Transmisión de Anaplasma marginale por garrapatas

Directory of Open Access Journals (Sweden)

Kelly A. Brayton

2012-01-01

Full Text Available Anaplasma marginale, patógeno de distribución mundial, es transmitido por garrapatas Ixódidas. Comprender su complejo desarrollo dentro de la garrapata vector, permitirá la predicción de brotes y ofrecerá oportunidades para controlar su transmisión. En este trabajo se revisa su ciclo básico de desarrollo junto con los estudios recientes acerca de las diferencias de transmisión entre cepas, que delinean aspectos de la interacción patógeno - vector. Bacterias, virus o protozoarios transmitidos por artrópodos causan enfermedades severas, tanto en humanos como en animales. Las enfermedades infecciosas transmitidas por garrapatas, entre las que incluimos a la Anaplasmosis (A. marginale, babesiosis (Babesia bigemina, B. bovis, B. divergens y Theileriosis (Theileria annulata, T. parva, se encuentran entre las más importantes en el ámbito mundial, con pérdidas cercanas a los siete mil millones de dólares anualmente; y, a pesar de su impacto, permanecen escasamente bajo control, basado primordialmente en la aplicación de acaricidas, para interrumpir su transmisión. La aparición de garrapatas resistentes a múltiples sustancias acaricidas, representa una amenaza en este tipo de control y, como resultado, hay un resurgimiento de la investigación para el desarrollo de nuevas estrategias para su control. Nuevas opciones para prevenir la transmisión de patógenos de animales por garrapatas, será el resultado de entender las interacciones garrapata patógeno; proceso que culmina con el desarrollo de la infección y transmisión exitosa. En todos los casos de patógenos transmitidos por garrapatas, el desarrollo de la infección se realiza coordinamente a los momentos de adhesión y alimentación del vector sobre el animal. Esto sucede por la interdependencia en la señalización entre el patógeno y el vector al alimentarse y, por ello, será susceptible de intervención.

Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B-cell epitopes are predominantly located in the HVR.

Science.gov (United States)

Abbott, Jeffrey R; Palmer, Guy H; Howard, Chris J; Hope, Jayne C; Brown, Wendy C

2004-12-01

Organisms in the genus Anaplasma express an immunodominant major surface protein 2 (MSP2), composed of a central hypervariable region (HVR) flanked by highly conserved regions. Throughout Anaplasma marginale infection, recombination results in the sequential appearance of novel MSP2 variants and subsequent control of rickettsemia by the immune response, leading to persistent infection. To determine whether immune evasion and selection for variant organisms is associated with a predominant response against HVR epitopes, T-cell and linear B-cell epitopes were localized by measuring peripheral blood gamma interferon-secreting cells, proliferation, and antibody binding to 27 overlapping peptides spanning MSP2 in 16 cattle. Similar numbers of MSP2-specific CD4(+) T-cell epitopes eliciting responses of similar magnitude were found in conserved and hypervariable regions. T-cell epitope clusters recognized by the majority of animals were identified in the HVR (amino acids [aa] 171 to 229) and conserved regions (aa 101 to 170 and 272 to 361). In contrast, linear B-cell epitopes were concentrated in the HVR, residing within hydrophilic sequences. The pattern of recognition of epitope clusters by T cells and of HVR epitopes by B cells is consistent with the influence of protein structure on epitope recognition.

Uso de inóculo padronizado de Anaplasma marginale e da quimioprofilaxia no controle da anaplasmose bovina

Directory of Open Access Journals (Sweden)

Ribeiro M.F.B.

2003-01-01

Full Text Available O uso de inóculo homólogo padronizado de Anaplasma marginale foi comparado à prática de quimioprofilaxia com diidrato de oxitetraciclina na redução da riquetsemia e do volume globular (VG causada pela anaplasmose bovina. Os animais que receberam o inóculo (10(7 hemácias com Anaplasma marginaleapresentaram, ao serem desafiados em campo, riquetsemia média de 1,2% e redução média de VG de 23,0%, significativamente inferiores às do grupo-controle (P<0,05. No experimento de quimioprofilaxia os animais que receberam três doses de diidrato de oxitetraciclina (20mg/kg, com intervalos de 25 dias, apresentaram riquetsemia de 2,7% e redução de 36,3% no VG, significativamente inferiores às do grupo-controle (P<0,05. Ambas as medidas preventivas testadas foram eficientes na redução da intensidade da riquetsemia e na queda do VG.

Genetic characterization of Anaplasma marginale strains from Tunisia using single and multiple gene typing reveals novel variants with an extensive genetic diversity.

Science.gov (United States)

Ben Said, Mourad; Ben Asker, Alaa; Belkahia, Hanène; Ghribi, Raoua; Selmi, Rachid; Messadi, Lilia

2018-05-12

Anaplasma marginale, which is responsible for bovine anaplasmosis in tropical and subtropical regions, is a tick-borne obligatory intraerythrocytic bacterium of cattle and wild ruminants. In Tunisia, information about the genetic diversity and the phylogeny of A. marginale strains are limited to the msp4 gene analysis. The purpose of this study is to investigate A. marginale isolates infecting 16 cattle located in different bioclimatic areas of northern Tunisia with single gene analysis and multilocus sequence typing methods on the basis of seven partial genes (dnaA, ftsZ, groEL, lipA, secY, recA and sucB). The single gene analysis confirmed the presence of different and novel heterogenic A. marginale strains infecting cattle from the north of Tunisia. The concatenated sequence analysis showed a phylogeographical resolution at the global level and that most of the Tunisian sequence types (STs) formed a separate cluster from a South African isolate and from all New World isolates and strains. By combining the characteristics of each single locus with those of the multi-loci scheme, these results provide a more detailed understanding on the diversity and the evolution of Tunisian A. marginale strains. Copyright © 2018 Elsevier GmbH. All rights reserved.

Identification of a vertically transmitted strain from Anaplasma marginale (UFMG3): Molecular and phylogenetic characterization, and evaluation of virulence.

Science.gov (United States)

Silvestre, Bruna T; Silveira, Júlia A G; Meneses, Rodrigo M; Facury-Filho, Elias J; Carvalho, Antônio U; Ribeiro, Múcio F B

2016-02-01

Bovine anaplasmosis is a disease caused by the intraerythrocytic rickettsia species Anaplasma marginale and results in great economic losses in tropical and subtropical regions. Vertical transmission is an important phenomenon that contributes to the persistence of different strains of the agent within the same herd. The identification of new strains and genetic characterization studies are essential to understanding their epidemiology and virulence and for vaccine development. The aim of this study was to perform molecular and phylogenetic characterizations of a new vertically transmitted strain from A. marginale and to evaluate its virulence by experimental inoculation of rickettsia-free calves. Thirty newborn Holstein calves were subjected to molecular tests for the detection of A. marginale, Babesia bovis and Babesia bigemina. Calves positive for A. marginale (n=3) were splenectomized and monitored for the clinical manifestations of anaplasmosis. Blood samples from one of the calves that presented rickettsemia of 42.8% and spontaneous recovery of clinical parameters were used for molecular and phylogenetic characterization (msp1a gene), and inoculum production was used for the evaluation of virulence. This strain was identified as UFMG3. Three tandem repeat forms (13 and MGI19) were identified from the analysis of the msp1a gene, in which the form MGI19 appeared twice. Analysis of these repeats revealed the presence of the sequences QASTSS and SSASGQQQESS and of aspartic acid (D) at position 20 of both repeats. Phylogenetic analysis showed a close relationship among the UFMG3, MGI19 and UFMG2 strains. For virulence evaluation, six Holstein calves were inoculated intravenously with 2×10(7)A. marginale UFMG3-infected erythrocytes. The calves showed maximum rickettsemia of 5.1%, a moderate decrease in packed cell volume and spontaneous recovery of clinical parameters without the need for treatment. The results of experimental inoculation suggest that the strain A

Eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos naturalmente infectados por Anaplasma marginale

Directory of Open Access Journals (Sweden)

L.R. Alberton

2015-08-01

Full Text Available O agente de maior importância, em relação à anaplasmose bovina, é o Anaplasma marginale. Os principais sinais clínicos dessa enfermidade são anemia hemolítica, icterícia, dispneia, taquicardia, febre, fadiga, lacrimejamento, sialorreia, micção frequente, anorexia, perda de peso, aborto e morte. A terapia antimicrobiana é o principal protocolo terapêutico. O objetivo do presente trabalho foi avaliar a eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos leiteiros naturalmente infectados por Anaplasma marginale. Para isso, foram avaliados 48 zebuínos mestiços que apresentavam os sinais clínicos sugestivos da doença. Os animais foram submetidos à coleta de sangue para a realização de hemograma e à extração de DNA para a confirmação da presença de A. marginale, por meio da reação em cadeia pela polimerase (PCR. Os animais foram divididos em três grupos experimentais, para realização dos protocolos terapêuticos, utilizando-se dipropionato de imidocarb, oxitetraciclina e enrofloxacina. Trinta e seis animais (75% apresentaram reação positiva ao PCR. Os animais positivos não apresentaram diferenças significativas quanto ao hemograma e ao leucograma quando comparados com os negativos, no entanto os níveis de proteínas séricas foram inferiores nos animais positivos (P<0,05. Os três protocolos terapêuticos foram capazes de reduzir a infecção ao longo do tratamento (P<0,01, porém, após cinco dias de tratamento, a enrofloxacina apresentou maior efetividade em relação aos demais (P<0,01. Após o final do tratamento, nenhum protocolo foi capaz de eliminar totalmente a infecção pelo A. marginale em bovinos naturalmente infectados e manejados a campo.

Validation of an improved anaplasma antibody cELISA kit for detection of anaplasma ovis antibody in domestic sheep at the U.S. Sheep Experiment Station in Dubois, ID

Science.gov (United States)

An accurate and simple-to-perform new version of a competitive ELISA (cELISA) kit that became commercially available in 2015 for testing of cattle for antibody to Anaplasma marginale was validated for detection of Anaplasma ovis antibody in domestic sheep. True positives and negatives were identifie...

Subdominant Outer Membrane Antigens in Anaplasma marginale: Conservation, Antigenicity, and Protective Capacity Using Recombinant Protein.

Directory of Open Access Journals (Sweden)

Deirdre R Ducken

Full Text Available Anaplasma marginale is a tick-borne rickettsial pathogen of cattle with a worldwide distribution. Currently a safe and efficacious vaccine is unavailable. Outer membrane protein (OMP extracts or a defined surface protein complex reproducibly induce protective immunity. However, there are several knowledge gaps limiting progress in vaccine development. First, are these OMPs conserved among the diversity of A. marginale strains circulating in endemic regions? Second, are the most highly conserved outer membrane proteins in the immunogens recognized by immunized and protected animals? Lastly, can this subset of OMPs recognized by antibody from protected vaccinates and conserved among strains recapitulate the protection of outer membrane vaccines? To address the first goal, genes encoding OMPs AM202, AM368, AM854, AM936, AM1041, and AM1096, major subdominant components of the outer membrane, were cloned and sequenced from geographically diverse strains and isolates. AM202, AM936, AM854, and AM1096 share 99.9 to 100% amino acid identity. AM1041 has 97.1 to 100% and AM368 has 98.3 to 99.9% amino acid identity. While all four of the most highly conserved OMPs were recognized by IgG from animals immunized with outer membranes, linked surface protein complexes, or unlinked surface protein complexes and shown to be protected from challenge, the highest titers and consistent recognition among vaccinates were to AM854 and AM936. Consequently, animals were immunized with recombinant AM854 and AM936 and challenged. Recombinant vaccinates and purified outer membrane vaccinates had similar IgG and IgG2 responses to both proteins. However, the recombinant vaccinates developed higher bacteremia after challenge as compared to adjuvant-only controls and outer membrane vaccinates. These results provide the first evidence that vaccination with specific antigens may exacerbate disease. Progressing from the protective capacity of outer membrane formulations to

Immune response and biochemistry of calves immunized with rMSP1a ( Anaplasma marginale using carbon nanotubes as carrier molecules

Directory of Open Access Journals (Sweden)

Bruna Torres Silvestre

2018-05-01

Full Text Available Abstract Vaccination against Anaplasma marginale has been considered an important control strategy for bovine anaplasmosis. Recently, mice immunized with rMSP1 a linked to carbon nanotubes (MWNT showed significant immune responses, generating a new possibility for use of an inactivated vaccine. The objective of this study was to investigate the cellular and humoral responses in calves immunized with MWNT+rMSP1a , associated with inactivated vaccine of A. marginale produced in vitro, and evaluate the toxic effects of the MWNT on renal and hepatic function. rMSP1a was covalently linked to MWNT. Inactivated vaccine (AmUFMG2 was produced by cultivating A. marginale in IDE8 cells. Twenty-four Holstein calves were divided (four groups and immunized subcutaneously with PBS and non-carboxylated MWNT (control, G1, AmUFMG2 (G2, MWNT+rMSP1a (G3, and AmUFMG2 with MWNT+rMSP1a (G4. Blood samples were collected for total leukocyte counts, biochemical profiling and evaluation of the cellular and humoral response. Immunization with MWNT+rMSP1a induced increase in the total number of leukocytes, NK cells, in the lymphocyte populations and higher levels of antibodies compared to calves immunized only with AmUFMG2. Furthermore, MWNT did not induce changes in the biochemical profile. These data indicate that MWNT+rMSP1a were able to induce the immune responses more efficiently than AmUFMG2 alone, without generating toxicity.

Insights into mechanisms of bacterial antigenic variation derived from the complete genome sequence of Anaplasma marginale.

Science.gov (United States)

Palmer, Guy H; Futse, James E; Knowles, Donald P; Brayton, Kelly A

2006-10-01

Persistence of Anaplasma spp. in the animal reservoir host is required for efficient tick-borne transmission of these pathogens to animals and humans. Using A. marginale infection of its natural reservoir host as a model, persistent infection has been shown to reflect sequential cycles in which antigenic variants emerge, replicate, and are controlled by the immune system. Variation in the immunodominant outer-membrane protein MSP2 is generated by a process of gene conversion, in which unique hypervariable region sequences (HVRs) located in pseudogenes are recombined into a single operon-linked msp2 expression site. Although organisms expressing whole HVRs derived from pseudogenes emerge early in infection, long-term persistent infection is dependent on the generation of complex mosaics in which segments from different HVRs recombine into the expression site. The resulting combinatorial diversity generates the number of variants both predicted and shown to emerge during persistence.

Frequency of antibodies to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burdgorferi in cattle from the northeastern region of the state of Pará, Brazil Freqüência de anticorpos para Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax e Borrelia burgdorferi em bovinos do nordeste do Estado do Pará, Brasil

Directory of Open Access Journals (Sweden)

Daniel S. Guedes Junior

2008-06-01

Full Text Available Babesiosis, anaplasmosis, and trypanosomosis are relevant diseases, potentially causing morbidity in cattle, leading to economic losses. Borreliosis is import as a potential zoonosis. The objective of this study was to determine, by indirect enzyme-linked immunosorbent assay (ELISA, the frequency of seropositive cattle to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burgdorferi in cattle from the Northeastern region of Pará, Brazil. Sera samples from 246 female adult cattle from municipalities of Castanhal and São Miguel do Guamá were used. Crude antigens ELISAs were used to detect antibodies to all agents, except to A. marginale, to which an indirect ELISA with recombinant major surface 1a protein (MSP1a antigen was used. Overall frequencies of seropositive animals were: B. bigemina - 99.2%; B. bovis - 98.8%; A. marginale - 68.3%; T. vivax - 93.1% and B. burgdorferi - 54.9%. The frequencies of seropositive cattle to B. bovis and B. bigemina suggest a high rate of transmission of these organisms by tick in the studied region, which can be classified as enzootically stable to these hemoprotozoans. The low frequency of seropositive cattle to A. marginale may be attributed to a lower sensitivity of the recombinant antigen ELISA utilized or a distinct rate of inoculation of this rickettsia by ticks, as compared with Babesia sp. transmission. The high frequency of seropositive cattle to T. vivax indicates that this hemoprotozoan is prevalent in herds from the Northeastern region of Pará. The rate of animal that showed homologues antibodies to B. burgdorferi indicates the presence of the tickborne spirochaetal agent in the cattle population in the studied region.A babesiose, a anaplasmose e a tripanossomose são enfermidades relevantes, potencialmente causadoras de morbidade em bovinos, levando a perdas econômicas. A borreliose assume importância como zoonose potencial. O objetivo desse estudo foi determinar

Effect of gamma irradiation on anaplasma marginale in bovines

International Nuclear Information System (INIS)

Romero, H.Q.; Fernandez, M.V.G. de; Meza, B.R.; Rodriguez, E.

1981-01-01

Because the costs of treatment of anaplasmosis are very high, it was considered of great usefulness to obtain the modification of the pathogenecity and the antigenecity of A. marginale by means of gamma radiation ( 60 Co) to obtain a vaccine. This would be reflected favorably in saving lives as well as to obviate losses of meat and dairy production and the elimination of the risks derived from the introduction of selected cattle into the tropics. The main purpose of this study was to determine the optimal modification of the pathogenecity of A. marginale in splenectomized calves and adult cows, among 4 different radiation doses. (author)

Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System.

Science.gov (United States)

Zhang, Bing; Cavallaro, Antonio S; Mody, Karishma T; Zhang, Jun; Deringer, James R; Brown, Wendy C; Mahony, Timothy J; Yu, Chengzhong; Mitter, Neena

2016-11-05

Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale . Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris . When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm), 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

Immune response of calves inoculated with proteins ofAnaplasma marginale bound to an immunostimulant complex

Directory of Open Access Journals (Sweden)

Marcela Ribeiro Gasparini

Full Text Available Despite our current knowledge of the immunology, pathology, and genetics of Anaplasma marginale, prevention in cattle is currently based on old standbys, including live attenuated vaccines, antibiotic treatment, and maintaining enzootic stability in cattle herds. In the present study, we evaluated the use of an immunostimulant complex (ISCOMATRIX adjuvant, associated with a pool of recombinant major surface proteins (rMSP1a, rMSP1b, rMSP4 and rMSP5 to improve the humoral immune response triggered in calves mainly by IgG2. Ten calves were divided in three groups: 4 calves were inoculated with the ISCOMATRIX/rMSPs (G1; 2 calves were inoculated with ISCOMATRIX adjuvant (G2; and 4 calves received saline (G3. Three inoculations were administered at 21-day intervals. In G1, the calves showed significant increases in total IgG, IgG1 and IgG2 levels 21 days after the second inoculation, compared to the control group (p < 0.05, and G1 calves remained above the cut-off value 28 days after the third inoculation (p < 0.05. The post-immunized sera from calves in G1 reacted specifically for each of the rMSPs used. In conclusion, the ISCOMATRIX/rMSPs induced antigen-specific seroconversion in calves. Therefore, additional testing to explore the protection induced by rMSPs, both alone and in conjunction with proteins previously identified as subdominant epitopes, is warranted.

Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System

Directory of Open Access Journals (Sweden)

Bing Zhang

2016-11-01

Full Text Available Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale. Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris. When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm, 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

Prevalencia y detección por PCR anidada de Anaplasma marginale en bovinos y garrapatas en la zona central del Litoral ecuatoriano

Directory of Open Access Journals (Sweden)

Ariel Escobar Troya

2015-09-01

Full Text Available La bacteria que provoca la anaplasmosis en bovinos se conoce como Anaplasma marginale, es potencialmente transmitida de forma biológica por garrapatas, moscas y fómites o mediante sangre infectada como consecuencia del uso incorrecto de herramientas quirúrgicas. Hasta la fecha, Ecuador carece de estudios actualizados sobre procedimientos eficientes para el diagnóstico específico y, erradicación de A. marginale a través del control de estos insectos, por lo que resulta de gran importancia desarrollar e implementar trabajos relacionados con el uso de esta herramienta molecular, para la detección de la bacteria en vectores de transmisión que provocan la enfermedad en bovinos. En este trabajo, se extrajo ADN eficazmente con el método de Salting Out. Un total de 255 muestras fueron analizadas por PCR anidada, distribuidas del siguiente modo|108| Riphicephalus (Boophilus microplus, |85| bovinos, de estos el 13.46% y 85.48% dieron positivas para la rickettsia, las muestras de Amblyomma spp. |62| todas fueron negativas. El índice de concordancia Kappa |total de bovinos infestados frente a Riphicephalus (Boophilus microplus|, no fue significativo (0.28. Subsiguientemente, se determinó por χ2 (p=0.66 que la presencia o ausencia de la enfermedad es independiente del lugar de donde proviene el bovino.

Epitope-based vaccines with the Anaplasma marginale MSP1a functional motif induce a balanced humoral and cellular immune response in mice.

Directory of Open Access Journals (Sweden)

Paula S Santos

Full Text Available Bovine anaplasmosis is a hemoparasitic disease that causes considerable economic loss to the dairy and beef industries. Cattle immunized with the Anaplasma marginale MSP1 outer membrane protein complex presents a protective humoral immune response; however, its efficacy is variable. Immunodominant epitopes seem to be a key-limiting factor for the adaptive immunity. We have successfully demonstrated that critical motifs of the MSP1a functional epitope are essential for antibody recognition of infected animal sera, but its protective immunity is yet to be tested. We have evaluated two synthetic vaccine formulations against A. marginale, using epitope-based approach in mice. Mice infection with bovine anaplasmosis was demonstrated by qPCR analysis of erythrocytes after 15-day exposure. A proof-of-concept was obtained in this murine model, in which peptides conjugated to bovine serum albumin were used for immunization in three 15-day intervals by intraperitoneal injections before challenging with live bacteria. Blood samples were analyzed for the presence of specific IgG2a and IgG1 antibodies, as well as for the rickettsemia analysis. A panel containing the cytokines' transcriptional profile for innate and adaptive immune responses was carried out through qPCR. Immunized BALB/c mice challenged with A. marginale presented stable body weight, reduced number of infected erythrocytes, and no mortality; and among control groups mortality rates ranged from 15% to 29%. Additionally, vaccines have significantly induced higher IgG2a than IgG1 response, followed by increased expression of pro-inflammatory cytokines. This is a successful demonstration of epitope-based vaccines, and protection against anaplasmosis may be associated with elicitation of effector functions of humoral and cellular immune responses in murine model.

Spatio-temporal variations and genetic diversity of Anaplasma spp. in cattle from the North of Tunisia.

Science.gov (United States)

Belkahia, Hanène; Ben Said, Mourad; El Mabrouk, Narjesse; Saidani, Mariem; Cherni, Chayma; Ben Hassen, Mariem; Bouattour, Ali; Messadi, Lilia

2017-09-01

In cattle, anaplasmosis is a tick-borne rickettsial disease caused by Anaplasma marginale, A. centrale, A. phagocytophilum, and A. bovis. To date, no information concerning the seasonal dynamics of single and/or mixed infections by different Anaplasma species in bovines are available in Tunisia. In this work, a total of 1035 blood bovine samples were collected in spring (n=367), summer (n=248), autumn (n=244) and winter (n=176) from five different governorates belonging to three bioclimatic zones from the North of Tunisia. Molecular survey of A. marginale, A. centrale and A. bovis in cattle showed that average prevalence rates were 4.7% (minimum 4.1% in autumn and maximum 5.6% in summer), 7% (minimum 3.9% in winter and maximum 10.7% in autumn) and 4.9% (minimum 2.7% in spring and maximum 7.3% in summer), respectively. A. phagocytophilum was not detected in all investigated cattle. Seasonal variations of Anaplasma spp. infection and co-infection rates in overall and/or according to each bioclimatic area were recorded. Molecular characterization of A. marginale msp4 gene indicated a high sequence homology of revealed strains with A. marginale sequences from African countries. Alignment of 16S rRNA A. centrale sequences showed that Tunisian strains were identical to the vaccine strain from several sub-Saharan African and European countries. The comparison of the 16S rRNA sequences of A. bovis variants showed a perfect homology between Tunisian variants isolated from cattle, goats and sheep. These present data are essential to estimate the risk of bovine anaplasmosis in order to develop integrated control policies against multi-species pathogen communities, infecting humans and different animal species, in the country. Copyright © 2017 Elsevier B.V. All rights reserved.

Molecular Epidemiological Survey and Genetic Characterization of Anaplasma Species in Mongolian Livestock.

Science.gov (United States)

Ochirkhuu, Nyamsuren; Konnai, Satoru; Odbileg, Raadan; Murata, Shiro; Ohashi, Kazuhiko

2017-08-01

Anaplasma species are obligate intracellular rickettsial pathogens that cause great economic loss to the animal industry. Few studies on Anaplasma infections in Mongolian livestock have been conducted. This study examined the prevalence of Anaplasma marginale, Anaplasma ovis, Anaplasma phagocytophilum, and Anaplasma bovis by polymerase chain reaction assay in 928 blood samples collected from native cattle and dairy cattle (Bos taurus), yaks (Bos grunniens), sheep (Ovis aries), and goats (Capra aegagrus hircus) in four provinces of Ulaanbaatar city in Mongolia. We genetically characterized positive samples through sequencing analysis based on the heat-shock protein groEL, major surface protein 4 (msp4), and 16S rRNA genes. Only A. ovis was detected in Mongolian livestock (cattle, yaks, sheep, and goats), with 413 animals (44.5%) positive for groEL and 308 animals (33.2%) positive for msp4 genes. In the phylogenetic tree, we separated A. ovis sequences into two distinct clusters based on the groEL gene. One cluster comprised sequences derived mainly from sheep and goats, which was similar to that in A. ovis isolates from other countries. The other divergent cluster comprised sequences derived from cattle and yaks and appeared to be newly branched from that in previously published single isolates in Mongolian cattle. In addition, the msp4 gene of A. ovis using same and different samples with groEL gene of the pathogen demonstrated that all sequences derived from all animal species, except for three sequences derived from cattle and yak, were clustered together, and were identical or similar to those in isolates from other countries. We used 16S rRNA gene sequences to investigate the genetically divergent A. ovis and identified high homology of 99.3-100%. However, the sequences derived from cattle did not match those derived from sheep and goats. The results of this study on the prevalence and molecular characterization of A. ovis in Mongolian livestock can facilitate

Induced immune response of Escherichia coli BL21 expressing recombinant MSP1a and MSP1b proteins of Anaplasma marginale

Directory of Open Access Journals (Sweden)

Katia Tamekuni

2009-11-01

Full Text Available This work aims to evaluate the potential of immunization with E. coli BL21 expressing the recombinant rMSP1a and rMSP1b proteins of Anaplasma marginale. E. coli BL21 was transformed with recombinant plasmids pET102/msp1α and pET101/msp1β, and rMSP1a and rMSP1b were expressed after induction by IPTG. BALB/c mice were vaccinated with formolized BL21/rMSP1a and BL21/rMSP1b, and the production in mice sera of whole IgG was determined by ELISA. The mice immunized with BL21/rMSP1a showed a better humoral response for whole IgG when compared to the mice immunized with BL21/rMSP1b; these mice exhibited a small response after the second vaccination. Sera of mice immunized with BL21/rMSP1a reacted via western blot with BL21 and rMSP1a, with molecular masses varying from 70 to 105 kDa. Sera of mice immunized with BL21/rMSP1b reacted with BL21 and rMSP1b with a molecular mass of 100 kDa. These results demonstrate that BL21 containing rMSP1a and rMSP1b in the outer membrane were able to produce an immune response in mice, reinforcing its use in vaccine models against bovine anaplasmosis.Esse trabalho avaliou o potencial de imunização de Escherichia coli BL21 expressando as proteínas recombinantes rMSP1a e rMSP1b de Anaplasma marginale. A E. coli BL21 foi transformada com os plasmídios recombinantes pET102/msp1α e pET101/msp1β e as proteínas rMSP1a e rMSP1b foram expressas após indução com IPTG. Camundongos BALB/c foram vacinados com BL21/rMSP1a e BL21/rMSP1b formolisadas, e a produção de IgG total foi determinada pelo teste de ELISA nos soros dos camundongos imunizados. Os camundongos imunizados com a BL21/rMSP1a mostraram uma melhor resposta humoral para IgG total, comparada à resposta apresentada pelos camundongos imunizados com BL21/rMSP1b; estes camundongos exibiram uma menor resposta após a segunda vacinação. Soros de camundongos imunizados BL21/rMSP1a reagiram pelo western blot com BL21 e rMSP1a, com massa molecular variando de 70 a

Molecular biological identification of Babesia, Theileria, and Anaplasma species in cattle in Egypt using PCR assays, gene sequence analysis and a novel DNA microarray.

Science.gov (United States)

El-Ashker, Maged; Hotzel, Helmut; Gwida, Mayada; El-Beskawy, Mohamed; Silaghi, Cornelia; Tomaso, Herbert

2015-01-30

In this preliminary study, a novel DNA microarray system was tested for the diagnosis of bovine piroplasmosis and anaplasmosis in comparison with microscopy and PCR assay results. In the Dakahlia Governorate, Egypt, 164 cattle were investigated for the presence of piroplasms and Anaplasma species. All investigated cattle were clinically examined. Blood samples were screened for the presence of blood parasites using microscopy and PCR assays. Seventy-one animals were acutely ill, whereas 93 were apparently healthy. In acutely ill cattle, Babesia/Theileria species (n=11) and Anaplasma marginale (n=10) were detected. Mixed infections with Babesia/Theileria spp. and A. marginale were present in two further cases. A. marginale infections were also detected in apparently healthy subjects (n=23). The results of PCR assays were confirmed by DNA sequencing. All samples that were positive by PCR for Babesia/Theileria spp. gave also positive results in the microarray analysis. The microarray chips identified Babesia bovis (n=12) and Babesia bigemina (n=2). Cattle with babesiosis were likely to have hemoglobinuria and nervous signs when compared to those with anaplasmosis that frequently had bloody feces. We conclude that clinical examination in combination with microscopy are still very useful in diagnosing acute cases of babesiosis and anaplasmosis, but a combination of molecular biological diagnostic assays will detect even asymptomatic carriers. In perspective, parallel detection of Babesia/Theileria spp. and A. marginale infections using a single microarray system will be a valuable improvement. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

Caracterização da imunogenicidade das proteínas recombinantes Virb9, Virb10 e fator termo instável de Elongação de Peptídeos de Anaplasma marginale em camundongos

Directory of Open Access Journals (Sweden)

Ana Beatriz Canevari Castelão

2012-10-01

Full Text Available Considerando as limitações dos atuais métodos de controle contra a anaplasmose bovina, o desenvolvimento de uma vacina efetiva se faz necessário. A partir do advento da análise genômica e proteômica, novas proteínas de membrana de Anaplasma marginale foram identificadas como possíveis candidatas a componentes de uma vacina, tais como, VirB9,VirB10 e Fator Termo Instavél de Elongação de Peptídeos (EF-Tu. Embora estas proteínas ainda não estejam bem caracterizadas na membrana de A. marginale, a produção destas na forma recombinante (rVirB 9, rVirB10 e rEF-Tutem sido realizada, mas as mesmas ainda não foram exploradas em formulações vacinais. Neste trabalho, avaliou-se ouso de rVirB9, rVirB10 e rEF-Tu emulsionadas em adjuvante Montanide em camundongos. Nas condições testadas, verificou-se a indução de forte resposta imune humoral com a produção de IgG1 e IgG2a, sendo que as proporções dos níveis de produção destas subclasses indicam predomínio de IgG1. Entretanto, esplenócitos de animais, que foram injetados com rVirB9 ou rVirB10, produziram interferon-gama acima do limite de detecção do ensaio após estimulação in vitro, sinalizando assim resposta celular específica. Assim, novas avaliações serão realizadas com a finalidade de modular o perfil de resposta imune obtido em bovinos e avaliar a proteção contra A. marginale.

NCBI nr-aa BLAST: CBRC-ACAR-01-1026 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-1026 ref|YP_153799.1| hypothetical protein AM518 [Anaplasma marginale ...str. St. Maries] gb|AAV86544.1| hypothetical protein AM518 [Anaplasma marginale str. St. Maries] YP_153799.1 3.7 24% ...

NCBI nr-aa BLAST: CBRC-LAFR-01-0905 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-0905 ref|YP_153919.1| hypothetical protein AM688 [Anaplasma marginale ...str. St. Maries] gb|AAV86664.1| hypothetical protein AM688 [Anaplasma marginale str. St. Maries] YP_153919.1 5e-08 62% ...

Anaplasma marginale attenuated by irradiation, its potential use as vaccine

International Nuclear Information System (INIS)

Gil, A.; Pupiales, N.; Castro, J.; Higuera, B.; Orrego, J.

1986-01-01

Five groups of 5 calves each were inoculated: group 1 (control) with 5 x 10 8 non-irradiated parasites (day 0) and group 2 with the same dose of irradiated (900 Gy) parasites on day 0. Both groups showed clinical signs of the infection, although group 2 was less severely affected. On day 41 group 3 was inoculated with blood (1 x 10 9 parasites) from an animal in group 2. These parasites were irradiated again (900 Gy) prior to inoculation. On day 59 group 4 was inoculated with blood (1 x 10 9 parasites) from the same animal in group 2. This inoculum was irradiated a second time (900 Gy) and the cells were washed and culture ''IN VITRO'' for 4 days prior to inoculation. Parasitaemia increased abruptly in group 3 (peak = 25%) concomitant with a sudden drop in hematocrit. Two animals died, the others required treatment. Group 4 had a transient and low parasitaemia (peak = 2%) and normal hematocrit values. On day 201 all animals including a new control (group 5) of 5 animals, were inoculated with 2 x 10 9 heterologous parasites. All 5 control animals reached 20% parasitaemia and averaged a -40% hematocrit decrease when treated. In contrast, the remaining animals had from -20% to normal hematocrit values and from 5.6% to non-detectable parasitaemias. All inoculated calves showed high antibody titers which increased once the parasitaemia was overcome, and after challenge. It appears that two (900 Gy) irradiations effectively attenuated A. marginale, conferring an active and long lasting protection. However, inoculum cells had to be washed and cultured to prevent hemolitic shock

Epidemiology of Babesia, Anaplasma and Trypanosoma species using a new expanded reverse line blot hybridization assay.

Science.gov (United States)

Paoletta, Martina Soledad; López Arias, Ludmila; de la Fournière, Sofía; Guillemi, Eliana Carolina; Luciani, Carlos; Sarmiento, Néstor Fabián; Mosqueda, Juan; Farber, Marisa Diana; Wilkowsky, Silvina Elizabeth

2018-02-01

Vector-borne hemoparasitic infections are a major problem that affects livestock industries worldwide, particularly in tropical and subtropical regions. In this work, a reverse line blot (RLB) hybridization assay was developed for the simultaneous detection and identification of Anaplasma, Babesia and bovine trypanosomes, encompassing in this way the most relevant hemoparasites that affect cattle. A total of 186 bovine blood samples collected from two different ecoepidemiological regions of northeast Argentina, with and without tick control, were analyzed with this new RLB. High diversity of parasites, such as Babesia bovis, B. bigemina, Anaplasma marginale and three different Trypanosoma species, was found. High rates of coinfections were also detected, and significant differences were observed not only in the prevalence of parasites but also in the level of coinfections between the two analyzed areas. Regarding the Trypanosoma genus, we provide molecular evidence of the presence of T. vivax and T. theileri for the first time in Argentina. Besides, since the RLB is a prospective tool, it allowed the identification of a yet unknown bovine trypanosome which could not be assigned to any of the bovine species known so far. In the present study we provide new insights on the prevalence of several pathogens that directly impact on livestock production in Argentina. The RLB assay developed here allows to identify simultaneously numerous pathogenic species which can also be easily expanded to detect other blood borne pathogens. These characteristics make the RLB hybridization assay an essential tool for epidemiological survey of all vector-borne pathogens. Copyright © 2017 Elsevier GmbH. All rights reserved.

Detection and phylogenetic characterisation of novel Anaplasma and Ehrlichia species in Amblyomma triguttatum subsp. from four allopatric populations in Australia.

Science.gov (United States)

Gofton, Alexander W; Waudby, Helen P; Petit, Sophie; Greay, Telleasha L; Ryan, Una M; Irwin, Peter J

2017-08-01

Anaplasma and Ehrlichia spp. are tick-borne pathogens that can cause severe disease in domestic animals, and several species are responsible for emerging zoonoses in the northern hemisphere. Until recently, the only members of these genera reported in Australia (A. marginale, A. centrale, and A. platys) were introduced from other continents, through the importation of domestic animals and their associated ticks. However, unique Anaplasma and Ehrlichia 16S rRNA gene sequences were recently detected for the first time in native Australian ticks, particularly in Amblyomma triguttatum subsp. ticks from southwest Western Australia (WA). We used molecular techniques to survey Am. triguttatum subsp. ticks from four allopatric populations in southern and western Australia for Anaplasma and Ehrlichia species, and described here the phylogeny of these novel organisms. An A. bovis variant (genotype Y11) was detected in ticks from two study sites; Yanchep National Park (12/280, 4.3%) and Barrow Island (1/69, 1.4%). Phylogenetic analysis of 16S rRNA and groEL gene sequences concluded that A. bovis genotype Y11 is a unique genetic variant, distinct from other A. bovis isolates worldwide. Additionally, a novel Ehrlichia species was detected in Am. triguttatum subsp. from three of the four study sites; Yanchep National Park (18/280, 6.4%), Bungendore Park (8/46, 17.4%), and Innes National Park (9/214, 4.2%), but not from Barrow Island. Phylogenetic analysis of 16S, groEL, gltA, and map1 gene sequences revealed that this Ehrlichia sp. is most closely related to, but clearly distinct from, E. ruminantium and Ehrlichia sp. Panola Mountain. We propose to designate this new species 'Candidatus Ehrlichia occidentalis'. Anaplasma bovis genotype Y11 and 'Candidatus E. occidentalis' are the first Anaplasma and Ehrlichia species to be recorded in native Australian ticks. Copyright © 2017 Elsevier GmbH. All rights reserved.

Effect of milk production system on the enzootic stability to Anaplasma marginale and Babesia bovis in calves in the Campo das Vertentes region of Minas Gerais state, BrazilEfeito do sistema de produção de leite sobre a estabilidade enzoótica para Anaplasma marginale e Babesia bovis em bezerras na região do Campo das Vertentes de Minas Gerais, Brasil

Directory of Open Access Journals (Sweden)

Christiane Maria Barcellos Magalhães Rocha

2012-04-01

Full Text Available We conducted a cross-sectional observational study, in order to determine the frequency of anti-A. marginale and anti-B. bovis antibodies in calves from four to 12 months of age from ten farms that producing B type milk and an equal number that produce raw milk refrigerated, located in the Campo das Vertentes region of Minas Gerais state, in the period September 2008 to August 2009. Blood smears were performed, serologic testing by indirect immunofluorescence technique (IFAT, given the packed cell volume, rickettsemia, and the clinical scores of animals infected by A. marginale. In the farms that produce B type milk, the overall average frequency of seropositive calves was 94.47% (166/176 and 89.20% (157/176 for A. marginale and B. bovis, respectively. Already on the farms that produce raw milk refrigerated, the overall average frequency of A. marginale was 92.59% (149/161 and for B. bovis from 86.30% (139/161, and there was no significant difference (p > 0.05 in the frequency of calves infected for both hemoparasitic between the two systems of milk production. Statistically significant (p 0.05 among calves from properties that produce B type milk and raw milk refrigerated. The results of this study indicate that, in the Campos das Vertentes region of Minas Gerais, the production system does not interfere with the enzootic stability for A. marginale and B. bovis in calves from dairy farms B milk or raw milk refrigerated, with low probability of anaplasmosis and/or babesiosis in adults animals.Foi realizado um estudo observacional do tipo transversal, com o objetivo de determinar a frequência de anticorpos anti-A. marginale e B. bovis em 337 bezerras com idade entre quatro a 12 meses, oriundas de dez propriedades produtoras de leite B e igual número de fazendas de leite cru refrigerado (leite C, na região do Campo das Vertentes de Minas Gerais, no período de setembro de 2008 a agosto de 2009. Foram realizados esfregaços sangu

Anaplasma spp. in dogs and owners in north-western Morocco.

Science.gov (United States)

Elhamiani Khatat, Sarah; Daminet, Sylvie; Kachani, Malika; Leutenegger, Christian M; Duchateau, Luc; El Amri, Hamid; Hing, Mony; Azrib, Rahma; Sahibi, Hamid

2017-04-24

Anaplasma phagocytophilum is an emerging tick-borne zoonotic pathogen of increased interest worldwide which has been detected in northern Africa. Anaplasma platys is also present in this region and could possibly have a zoonotic potential. However, only one recent article reports on the human esposure to A. phagocytophilum in Morocco and no data are available on canine exposure to both bacteria. Therefore, we conducted a cross-sectional epidemiological study aiming to assess both canine and human exposure to Anaplasma spp. in Morocco. A total of 425 dogs (95 urban, 160 rural and 175 working dogs) and 11 dog owners were sampled from four cities of Morocco. Canine blood samples were screened for Anaplasma spp. antibodies by an enzyme-linked immunosorbent assay (ELISA) and for A. phagocytophilum and A. platys DNA by a real-time polymerase chain reaction (RT-PCR) targeting the msp2 gene. Human sera were tested for specific A. phagocytophilum immunoglobulin G (IgG) using a commercial immunofluorescence assay (IFA) kit. Anaplasma spp. antibodies and A. platys DNA were detected in 21.9 and 7.5% of the dogs, respectively. Anaplasma phagocytophilum DNA was not amplified. Anaplasma platys DNA was significantly more frequently amplified for working dogs. No statistically significant differences in the prevalence of Anaplasma spp. antibodies or A. platys DNA detection were observed between sexes, age classes or in relation to exposure to ticks. A total of 348 Rhipicephalus sanguineus (sensu lato) ticks were removed from 35 urban and working dogs. The majority of dog owners (7/10) were seroreactive to A. phagoyctophilum IgG (one sample was excluded because of hemolysis). This study demonstrates the occurrence of Anaplasma spp. exposure and A. platys infection in dogs, and A. phagocytophilum exposure in humans in Morocco.

Alpha proteobacteria of genus Anaplasma (Rickettsiales: Anaplasmataceae): Epidemiology and characteristics of Anaplasma species related to veterinary and public health importance.

Science.gov (United States)

Atif, Farhan Ahmad

2016-05-01

The Anaplasma species are important globally distributed tick-transmitted bacteria of veterinary and public health importance. These pathogens, cause anaplasmosis in domestic and wild animal species including humans. Rhipicephalus, Ixodes, Dermacentor and Amblyomma genera of ticks are the important vectors of Anaplasma. Acute anaplasmosis is usually diagnosed upon blood smear examination followed by antibodies and nucleic acid detection. All age groups are susceptible but prevalence increases with age. Serological cross-reactivity is one of the important issues among Anaplasma species. They co-exist and concurrent infections occur in animals and ticks in same geographic area. These are closely related bacteria and share various common attributes which should be considered while developing vaccines and diagnostic assays. Movement of susceptible animals from non-endemic to endemic regions is the major risk factor of bovine/ovine anaplasmosis and tick-borne fever. Tetracyclines are currently available drugs for clearance of infection and treatment in humans and animals. Worldwide vaccine is not yet available. Identification, elimination of reservoirs, vector control (chemical and biological), endemic stability, habitat modification, rearing of tick resistant breeds, chemotherapy and tick vaccination are major control measures of animal anaplasmosis. Identification of reservoirs and minimizing the high-risk tick exposure activities are important control strategies for human granulocytic anaplasmosis.

ORF Alignment: NC_004842 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available [Anaplasma ... marginale str. St. Maries] ... Length = 114 ... Query: 16 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWL...DKASGARTEKTEWHSIVVFSEG 75 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWL...DKASGARTEKTEWHSIVVFSEG Sbjct: 1 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWLDKASGARTEKTEWHSIVVFSEG 60 ...

Molecular detection of tick-borne bacteria and protozoa in cervids and wild boars from Portugal.

Science.gov (United States)

Pereira, André; Parreira, Ricardo; Nunes, Mónica; Casadinho, Afonso; Vieira, Maria Luísa; Campino, Lenea; Maia, Carla

2016-05-10

Wildlife can act as reservoir of different tick-borne pathogens, such as bacteria, parasites and viruses. The aim of the present study was to assess the presence of tick-borne bacteria and protozoa with veterinary and zoonotic importance in cervids and wild boars from the Centre and South of Portugal. One hundred and forty one blood samples from free-ranging ungulates including 73 red deer (Cervus elaphus), 65 wild boars (Sus scrofa) and three fallow deer (Dama dama) were tested for the presence of Anaplasma marginale/A. ovis, A. phagocytophilum, Anaplasma/Ehrlichia spp., Babesia/Theileria spp., Borrelia burgdorferi (sensu lato) (s.l.), and Rickettsia spp. DNA by PCR. Anaplasma spp. DNA was detected in 33 (43.4 %) cervids (31 red deer and two fallow deer) and in two (3.1 %) wild boars while Theileria spp. were found in 34 (44.7 %) cervids (32 red deer and two fallow deer) and in three (4.6 %) wild boar blood samples. Sequence analysis of msp4 sequences identified A. marginale, A. ovis, while the analysis of rDNA sequence data disclosed the presence of A. platys and A. phagocytophilum and T. capreoli and Theileria sp. OT3. Anaplasma spp./Theileria spp. mixed infections were found in 17 cervids (22.4 %) and in two wild boars (3.1 %). All samples were negative for Babesia sp., B. burgdorferi (s.l.), Ehrlichia sp. or Rickettsia sp. This is the first detection of Anaplasma marginale, A. ovis, A. phagocytophilum, A. platys, Theileria capreoli and Theileria sp. OT3 in cervids and wild boars from Portugal. Further studies concerning the potential pathogenicity of the different species of  Anaplasma and Theileria infecting wild ungulates, the identification of their vector range, and their putative infectivity to domestic livestock and humans should be undertaken.

Anaplasma ovis genetic diversity detected by major surface protein 1a and its prevalence in small ruminants.

Science.gov (United States)

Aktas, Munir; Özübek, Sezayi

2018-04-01

Anaplasma ovis is a widely distributed tick-borne rickettsial pathogen of sheep, goats, and wild ruminants. The aims of this study were to assess the prevalence, associations of Anaplasma ovis in sheep and goats, as well as its genetic diversity based on analysis of the msp1α gene. A total of 416 DNA samples from sheep (n = 236) and goats (n = 180) from four provinces in southeastern Turkey were analyzed by PCR. The overall A. ovis prevalence was 18% (CI 14.4-22.1). The infection rates of A. ovis varied from 15.9% to 21.8% in sampled provinces, and they were not significantly different. There was no difference between Anaplasma ovis infection in sheep (20.3%, CI 15.4-26.0) and goats (15.0%, CI 10.1-21.1) or in infection rate of animals 1 year (16.4%, CI 12.4-21.2). A significant association between A. ovis infection and the presence of Rhipicephalus bursa and Rhipicephalus turanicus was observed (P diversity of A. ovis were found in small ruminants in Turkey. Copyright © 2018 Elsevier B.V. All rights reserved.

High Prevalence of Anaplasma spp. in Small Ruminants in Morocco.

Science.gov (United States)

Ait Lbacha, H; Alali, S; Zouagui, Z; El Mamoun, L; Rhalem, A; Petit, E; Haddad, N; Gandoin, C; Boulouis, H-J; Maillard, R

2017-02-01

The prevalence of infection by Anaplasma spp. (including Anaplasma phagocytophilum) was determined using blood smear microscopy and PCR through screening of small ruminant blood samples collected from seven regions of Morocco. Co-infections of Anaplasma spp., Babesia spp, Theileria spp. and Mycoplasma spp. were investigated and risk factors for Anaplasma spp. infection assessed. A total of 422 small ruminant blood samples were randomly collected from 70 flocks. Individual animal (breed, age, tick burden and previous treatment) and flock data (GPS coordinate of farm, size of flock and livestock production system) were collected. Upon examination of blood smears, 375 blood samples (88.9%) were found to contain Anaplasma-like erythrocytic inclusion bodies. Upon screening with a large spectrum PCR targeting the Anaplasma 16S rRNA region, 303 (71%) samples were found to be positive. All 303 samples screened with the A. phagocytophilum-specific PCR, which targets the msp2 region, were found to be negative. Differences in prevalence were found to be statistically significant with regard to region, altitude, flock size, livestock production system, grazing system, presence of clinical cases and application of tick and tick-borne diseases prophylactic measures. Kappa analysis revealed a poor concordance between microscopy and PCR (k = 0.14). Agreement with PCR is improved by considering microscopy and packed cell volume (PCV) in parallel. The prevalence of double infections was found to be 1.7, 2.5 and 24% for Anaplasma-Babesia, Anaplasma-Mycoplasma and Anaplasma-Theileria, respectively. Co-infection with three or more haemoparasites was found in 1.6% of animals examined. In conclusion, we demonstrate the high burden of anaplasmosis in small ruminants in Morocco and the high prevalence of co-infections of tick-borne diseases. There is an urgent need to improve the control of this neglected group of diseases. © 2015 Blackwell Verlag GmbH.

Anaplasma, Ehrlichia and Rickettsia species infections in cats

NARCIS (Netherlands)

Pennisi, Maria Grazia; Hofmann-Lehmann, Regina; Radford, Alan D; Tasker, Séverine; Belák, Sándor; Addie, Diane D; Boucraut-Baralon, Corine; Egberink, Herman; Frymus, Tadeusz; Gruffydd-Jones, Tim; Hartmann, Katrin; Horzinek, Marian C; Hosie, Margaret J; Lloret, Albert; Lutz, Hans; Marsilio, Fulvio; Thiry, Etienne; Truyen, Uwe; Möstl, Karin

2017-01-01

OVERVIEW: Anaplasma species, Ehrlichia species and Rickettsia species are vector-borne pathogens infecting a wide variety of mammals, but causing disease in very few of them. Infection in cats: Anaplasma phagocytophilum is the most important feline pathogen among these rickettsial organisms, and

Prevalence of Anaplasma phagocytophilum in North Carolina Eastern Black Bears ( Ursus americanus ).

Science.gov (United States)

Westmoreland, Lori S H; Stoskopf, Michael K; Maggi, Ricardo G

2016-10-01

We detected Anaplasma phagocytophilum by DNA amplification in whole blood from free-ranging, hunter-killed American black bears ( Ursus americanus ) from the east coast of North Carolina, US. Molecular prevalence for Anaplasma phagocytophilum was 3% from 68 black bears. No DNA of other Anaplasma or Ehrlichia spp. was identified.

Molecular and phylogenetic analysis of Anaplasma spp. in sheep and goats from six provinces of China.

Science.gov (United States)

Zhang, Yan; Lv, Yali; Zhang, Feifei; Zhang, Wenjing; Wang, Jinhong; Cui, Yanyan; Wang, Rongjun; Jian, Fuchun; Zhang, Longxian; Ning, Changshen

2016-12-30

Members of the genus Anaplasma are important emerging tick-borne pathogens in both humans and animals in tropical and subtropical areas. Here, we investigated the presence of Anaplasma spp. in 621 sheep and 710 goats from six provinces of China. Polymerase chain reaction (PCR) and DNA sequencing were conducted to determine the prevalence of Anaplasma (A.) phagocytophilum, A. ovis and A. bovis targeting the 16S ribosomal RNA or the major surface protein 4 gene. PCR revealed Anaplasma in 39.0% (240/621) of sheep and 45.5% (323/710) of goats. The most frequently detected species was A. ovis (88/621, 14.2% for sheep; 129/710, 18.2% for goats), followed by A. bovis (60/621, 9.7% for sheep; 74/710, 10.4% for goats) and A. phagocytophilum (33/621, 5.3% for sheep; 15/710, 2.1% for goats). Additionally, eight sheep and 20 goats were found to be infected with three pathogens simultaneously. DNA sequencing confirmed the presence of these three Anaplasma species in the investigated areas, and phylogenetic analysis indicated that there was geographic segregation to a certain extent, as well as a relationship between the host and cluster of A. ovis. The results of the present study provide valuable data that helps understand the epidemiology of anaplasmosis in ruminants from China.

Detection of Rickettsia and Anaplasma from hard ticks in Thailand.

Science.gov (United States)

Malaisri, Premnika; Hirunkanokpun, Supanee; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

2015-12-01

We collected a total of 169 adult hard ticks and 120 nymphs from under the leaves of plants located along tourist nature trails in ten localities. The results present data examining the vector competence of ticks of different genera and the presence of Rickettsia and Anaplasma species. The ticks belonged to three genera, Amblyomma, Dermacentor, and Haemaphysalis, comprising 11 species. Rickettsia bacteria were detected at three collection sites, while Anaplasma bacteria were detected at only one site. Phylogenetic analysis revealed new rickettsia genotypes from Thailand that were closely related to Rickettsia tamurae, Rickettsia monacensis, and Rickettsia montana. This study was also the first to show that Anaplasma bacteria are found in Haemaphysalis shimoga ticks and are closely related evolutionarily to Anaplasma bovis. These results provide additional information for the geographical distribution of tick species and tick-borne bacteria in Thailand and can therefore be applied for ecotourism management. © 2015 The Society for Vector Ecology.

Natural Anaplasma phagocytophilum infection in ticks from a forest area of Selenge province, Mongolia

Directory of Open Access Journals (Sweden)

G Javkhlan

2014-03-01

Full Text Available Anaplasma phagocytophilum is a zoonotic agent of public health importance, infecting both humans and animals. An investigation of the presence of Anaplasma phagocytophilum as well as Anaplasma platys was conducted in a forest area of Selenge province, Mongolia, where ticks are widely distributed and tick-borne diseases are highly endemic. Ticks were collected and tested using polymerase chain reaction based on groEL methodology. Anaplasma phagocytophilum was detected in 14 (6% of Ixodes persulcatus ticks and four (1% Dermacentor nuttalli ticks; infection of Anaplasma platys was detected in 1% of Ixodes persulcatus ticks and 10% of Dermacentor nuttalli ticks. The phylogenetic tree showed that the Anaplasma phagocytophilum clustered with the Russian group, most likely due to similar geographical locations. This finding is significant for both veterinary and public health officials given that these agents can cause both animal and human illness.

Immunisation of smallholder dairy cattle against anaplasmosis and babesiosis in Malawi

DEFF Research Database (Denmark)

Tjørnehøj, Kirsten; Lawrence, J. A.; Kafuwa, P. T.

1997-01-01

A field study was conducted in the Southern Region of Malawi to evaluate the possible benefits of immunisation of improved dairy cattle against Anaplasma marginale, Babesia bigemina and Babesia bovis. Friesian crossbred heifers were immunised when they were being reared on Government farms. They ...

Estimated seroprevalence of Anaplasma spp. and spotted fever group Rickettsia exposure among herders and livestock in Mongolia.

Science.gov (United States)

von Fricken, Michael E; Lkhagvatseren, Sukhbaatar; Boldbaatar, Bazartseren; Nymadawa, Pagbajab; Weppelmann, Thomas A; Baigalmaa, Bekh-Ochir; Anderson, Benjamin D; Reller, Megan E; Lantos, Paul M; Gray, Gregory C

2018-01-01

To better understand the epidemiology of tick-borne disease in Mongolia, a comprehensive seroprevalence study was conducted investigating exposure to Anaplasma spp. and spotted fever group (SFG) Rickettsia spp. in nomadic herders and their livestock across three provinces from 2014 to 2015. Blood was collected from 397 herders and 2370 livestock, including sheep, goats, cattle, horses and camels. Antibodies against Anaplasma spp. and SFG Rickettsia were determined by indirect immunofluorescence using commercially available slides coated with Anaplasma phagocytophilum and Rickettsia rickettsii antigens. Logistic regression was used to determine if the odds of previous exposure differed by gender, location, and species, with or without adjustment for age. To examine the association between seroprevalence and environmental variables we used ArcGIS to circumscribe the five major clusters where human and animal data were collected. Anaplasma spp. exposure was detected in 37.3% (136/365) of humans and 47.3% (1120/2370) of livestock; SFG Rickettsia exposure was detected in 19.5% (73/374) humans and 20.4% (478/2342) livestock. Compared to the southern province (aimag) of Dornogovi, located in the Gobi Desert, humans were significantly more likely to be exposed to Anaplasma spp. and SFG Rickettsia in the northern provinces of Tov (OR=7.3, 95% CI: 3.5, 15.1; OR=3.3, 95% CI: 1.7, 7.5), and Selenge (OR=6.9, 95% CI: 3.4, 14.0; OR=2.2, 95% CI: 1.1, 4.8). The high seroprevalence of Anaplasma spp. and SFG Rickettsia in humans and livestock suggests that exposure to tick-borne pathogens may be common in herders and livestock in Mongolia, particularly in the more northern regions of the country. Until more is known about these pathogens in Mongolia, physicians and veterinarians in the countryside should consider testing for Anaplasma and SFG Rickettsia infections and treating clinically compatible cases, while public health authorities should expand surveillance efforts for these

EL MISTICISMO de los espíritus marginales

Directory of Open Access Journals (Sweden)

JOSÉ JORGE DE CARVALHO

2001-01-01

Full Text Available EL ARTÍCULO OFRECE UNA VISIÓN PANORÁMICA DE LAS MANIFESTACIONES RELIGIOSAS brasileñas marginales con relación al cristianismo dominante, entre las cuales se destacan el espiritismo kardecista y las varias formas de religiones de origen africano, todas de tradición oral. Un punto común a esas expresiones religiosas es la experiencia del trance y la posesión, que busco teorizar con la idea de la apófasis radical. En la segunda mitad del ensayo presento una antología de textos sagrados afrobrasileños, los cuales comento en una perspectiva de simbología comparada. Ellos señalan la presencia de un misticismo análogo al de los místicos de las llamadas "grandes religiones" o "religiones del libro". Propongo, entonces, incluir esas tradiciones marginales como parte constitutiva de la experiencia religiosa de la humanidad como un todo.

Molecular approaches to detect and study the organisms causing ...

African Journals Online (AJOL)

This review will summarise the molecular approaches used to detect and analyse the genomes of Babesia bovis, B. bigemina and Anaplasma marginale which cause bovine babesiosis and anaplasmosis. These tick borne diseases are widely distributed in Africa, Asia, Australia, and Central and South America and for ...

Diversidad genética de la región variable de los genes msp1a y msp4 en cepas de Anaplasma marginale de México

Directory of Open Access Journals (Sweden)

Rafael Jiménez Ocampo

2012-01-01

Full Text Available La anaplasmosis es de difícil control debido a la diversidad genética de la rickettsia. La proteína Msp1a, compuesta de repetidos variables de entre 23 y 31 aminoácidos en su región variable y la proteína Msp4, son dos de las proteínas de superficie más estudiadas en A. marginale y han sido ampliamente usadas como marcadores genéticos en la caracterización de cepas de A. marginale de diferentes orígenes geográficos. En este trabajo se analizaron, la región variable de la proteína Msp1a y la proteína Msp4 de 10 cepas mexicanas. En el caso de Msp1a, se observó un patrón de segregación que contiene los repetidos (alpha, beta, beta, gama en diferentes modalidades a lo largo de aislamientos del Golfo de México, principalmente en zonas de estabilidad enzoótica, mientras que la máxima variabilidad se presentó en Tamaulipas, en aislamientos de un brote de la enfermedad, es decir en zonas de inestabilidad. La diversidad observada no es tan extensa como se esperaba y, misma que se puede explicar por la presión que el sistema inmune del hospedero ejerce contra la rickettsia y los mecanismos de esta última para evadirla. En el caso de la proteína Msp4, la secuencia fue altamente conservada tanto en nucleótidos como en aminoácidos para los aislados en estudio, aunque, se observan diferencias con lo previamente reportado en México para este marcador.

The Life and Death of Anaplasma

Centers for Disease Control (CDC) Podcasts

Dr. Setu Vora, medical director of critical care and physician director of performance improvement at Backus Hospital in Norwich, Connecticut, reads his poem The Life and Death of Anaplasma and discusses the poem’s origins.

Construcción de Distribuciones Multivariadas con Marginales Dependientes Usando Cópulas en R

OpenAIRE

Jaramillo-Elorza, M. C; Lozano, J. A

2014-01-01

Las cópulas se han convertido en una herramienta popular para la construcción de modelos multivariados en campos donde la dependencia multivariada es de gran interés. El propósito de este trabajo es presentar las cópulas tanto en su concepto teórico, como en su implementación en el software estadístico R y profundizar en la construcción de distribuciones multivariadas con marginales dependientes, usando la clase mvdc del paquete copula, la cual permite utilizar varias y diferentes marginales ...

Retrospective study of hemoparasites in cattle in southern Italy by reverse line blot hybridization.

Science.gov (United States)

Ceci, Luigi; Iarussi, Fabrizio; Greco, Beatrice; Lacinio, Rosanna; Fornelli, Stefania; Carelli, Grazia

2014-06-01

Tick-borne diseases are widespread in tropical and temperate regions and are responsible for important economic losses in those areas. In order to assess the presence and prevalence of various pathogens in southern Italy, we retrospectively analyzed cattle blood samples collected for a previous study in 2000 using reverse line blot (RLB) hybridization. The study had been carried out in three regions of southern Italy on 1,500 randomly selected and apparently healthy adult cattle. RLB showed that 43.7% of the cattle were positive for nine different species of hemoparasites with either a single infection or a mixed infection. Theileria buffeli was the most common species found, being present in 27.3% of the animals, followed by Anaplasma marginale in 18.1%, Anaplasma centrale in 13.8%, Babesia bigemina and Anaplasma bovis in 4.2%, Anaplasma phagocytophilum in 1.7%, Babesia bovis in 1.6%, Babesia major in 0.2% and Babesia divergens in 0.1%. Complete blood counts showed different degrees of anemia in 363 animals (24.2%) and of these, 169 were RLB-positive for at least one pathogen. Among the ticks that were collected from the cattle, the following species were identified: Rhipicephalus bursa, Ixodes ricinus, Hyalomma marginatum, Boophilus annulatus, Dermacentor marginatus and Haemaphysalis (sulcata, parva, inermis and punctata). The results obtained confirmed the spread of endemic tick-borne pathogens in the regions studied.

Molecular and serological prevalence of Toxoplasma gondii and Anaplasma spp. infection in goats from Chongqing Municipality, China

Directory of Open Access Journals (Sweden)

Zhou Zuoyong

2018-01-01

Full Text Available Toxoplasmosis and anaplasmosis are severe zoonotic diseases, the former caused by Toxoplasma gondii and the latter by Anaplasma spp. In the present study, 332 goat blood samples were randomly collected from Chongqing Municipality, China to screen for T. gondii and Anaplasma spp. We used a polymerase chain reaction (PCR to detect DNA, and enzyme-linked immunosorbent assay (ELISA to test for T. gondii antibodies. The prevalence of T. gondii and Anaplasma spp. was 38% and 35% respectively by PCR, and 42% for T. gondii antibodies by ELISA. The co-infection rate by T. gondii and Anaplasma was 13%, where the two predominant pathogens co-infecting were Anaplasma phagocytophilum + A. bovis (10%, followed by T. gondii + A. phagocytophilum (9.64%. While co-infection by three pathogens varied ranging from 1.81% to 5.72%, less than 1% of goats were found to be positive for four pathogens. This is the first investigation of T. gondii and Anaplasma spp. infection in goats from Chongqing.

Molecular detection of Rickettsia, Anaplasma, Coxiella and Francisella bacteria in ticks collected from Artiodactyla in Thailand.

Science.gov (United States)

Sumrandee, Chalao; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

2016-07-01

A total of 79 ticks collected from Sambar deer (Cervus unicolor), Barking deer (Muntiacus muntjak) and Wild boar (Sus scrofa) were examined by PCR for the presence of Rickettsia, Anaplasma, Coxiella, and Francisella bacteria. Of the 79 ticks, 13% tested positive for Rickettsia, 15% tested positive for Anaplasma, 4% tested positive for Coxiella, and 3% tested positive for Francisella. Interestingly, triple infection with Anaplasma, Rickettsia and Francisella was determined in a Dermacentor auratus tick. Moreover, another triple infection with Rickettsia, Anaplasma, and Coxiella was found in a Haemaphysalis lagrangei tick. Double infection of Rickettsia with Coxiella was also detected in another H. lagrangei tick. From the phylogenetic analyses, we found a Rickettsia sp. with a close evolutionary relationship to Rickettsia bellii in the H. lagrangei tick. We also found the first evidence of a Rickettsia sp. that is closely related to Rickettsia tamurae in Rhipicephalus (Boophilus) microplus ticks from Thailand. H. lagrangei and Haemaphysalis obesa ticks collected from Sambar deer tested positive for Anaplasma species form the same clade with Anaplasma bovis. In contrast, other H. lagrangei ticks collected from Sambar deer and D. auratus ticks collected from Wild boar were also reported for the first time to be infected with an Anaplasma species that is closely related to Anaplasma platys. The phylogenetic analysis of the 16S rRNA gene of Coxiella bacteria revealed that Coxiella symbionts from H. lagrangei formed a distinctly different lineage from Coxiella burnetii (a human pathogen). Additionally, Francisella bacteria identified in D. auratus ticks were found to be distantly related to a group of pathogenic Francisella species. The identification of these bacteria in several feeding ticks suggests the risk of various emerging tick-borne diseases and endosymbionts in humans, wildlife, and domestic animals in Thailand. Copyright © 2016 Elsevier GmbH. All rights

Infecção natural por hemoparasitos em bezerros submetidos à quimio-profilaxia aos 30 dias de idade Natural infection by hemoparasites in calves submitted to chemo -prophylaxis wonder 30 days of age

Directory of Open Access Journals (Sweden)

Rosângela A. Da Silva

2007-09-01

Full Text Available O complexo Tristeza Parasitária acarreta grandes prejuízos à pecuária bovina nacional. Os principais agentes etiológicos são Babesia bigemina, B. bovis e Anaplasma marginale, sendo o carrapato Boophilus microplus o principal vetor. Este trabalho relata a ocorrência de infecção natural por hemoparasitos da tristeza parasitária bovina em 36 bezerros com alta infestação natural por carrapatos e submetidos à quimioprofilaxia aos 30 dias de idade. Babesia bigemina (33,3%, B. bovis (11,1% e A. marginale (13,9% foram detectados em esfregaços sangüíneos de 16 animais (44,4% de diferentes idades. Seis bezerros apresentaram sintomas (16,7% e um morreu (2,8%. O número de casos clínicos foi decorrente de uma associação de fatores, destacando-se a alta infestação precoce por carrapatos e a baixa imunidade passiva em período em que os bezerros ainda não haviam desenvolvido imunidade ativa suficiente.The tick-borne disease (TBD brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%, B. bovis (11.1% and A. marginale (13.9%. Six animals had clinical symptoms (16.7% and one dead (2.8%. The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

The Life and Death of Anaplasma

Centers for Disease Control (CDC) Podcasts

2012-03-30

Dr. Setu Vora, medical director of critical care and physician director of performance improvement at Backus Hospital in Norwich, Connecticut, reads his poem The Life and Death of Anaplasma and discusses the poem’s origins.  Created: 3/30/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 4/2/2012.

Targeting ticks for control of selected hemoparasitic diseases of cattle.

Science.gov (United States)

Kocan, K M

1995-03-01

Development in and transmission of hemoparasites by tick vectors are phenomena closely synchronized with the tick feeding cycle. In all known life cycles, initial infection of tick tissues occurs in midgut epithelial cells and transmission is effected as ticks feed after parasites have developed and multiplied in salivary glands. Many factors reviewed affect development and transmission of hemoparasites by ticks including age of ticks, artificial temperature, climate and/or season, tick stage or sex, hemoparasite variation, concurrent infection of ticks with other pathogens, host cell susceptibility, transovarial transmission, effect of hemoparasites on tick biology, and the effect of infecting parasitemia level in cattle on infection rates in ticks. Four hemoparasites of cattle, Anaplasma marginale, Cowdria ruminantium, Theileria parva, and Babesia spp., are all dependent on ticks for biological transmission. Babesia is transmitted transovarially whereas the other three are transmitted transstadially. Mechanical transfer of infective blood via fomites and mouthparts of biting arthropods is also a major means of transmission for Anaplasma marginale but not of the others. Potential control methods for hemoparasites that target parasites as they are developing in their respective tick hosts include tick control, vaccines (against ticks and parasites), and drugs (against ticks and parasites). Successful application of control strategies will be dependent upon thorough understanding of parasite developmental cycles, biology of the tick vectors and the immune response of cattle to ticks and to hemoparasites. The most effective control measures will be those that are targeted against both ticks and the hemoparasites they vector.

Functional and Immunological Relevance of Anaplasma marginale Major Surface Protein 1a Sequence and Structural Analysis

Czech Academy of Sciences Publication Activity Database

Cabezas Cruz, Alejandro; Passos, L.M.F.; Lis, K.; Kenneil, R.; Valdés, James J.; Ferrolho, J.; Tonk, Miray; Pohl, A.E.; Grubhoffer, Libor; Zweygarth, E.; Shkap, V.; Ribeiro, M.F.B.; Estrada-Pena, A.; Kocan, K.M.; de la Fuente, J.

2013-01-01

Roč. 8, č. 6 (2013), e65243 E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 238511 - POSTICK Institutional support: RVO:60077344 Keywords : CD4(+) T-lymphocytes * B-cell epitopes * salivary glands Subject RIV: EC - Immunology Impact factor: 3.534, year: 2013

Arnaldo Saraiva y las literaturas marginales y marginalizadas

Directory of Open Access Journals (Sweden)

Carlos Nogueira

2014-04-01

Full Text Available This article focuses on Arnaldo Saraiva’s studies and teaching in the area of the socalled marginal or marginalized literatures of Portugal and Brazil, and on the unusually significant impact they have had on successive generations of teachers, cultural agents and literary scholars. RESUMEN: El presente trabajo versa sobre los estudios y la actividad docente de Arnaldo Saraiva en el área de las llamadas literaturas marginales o marginalizadas de Portugal y de Brasil, así como el impacto extrañamente significativo que aquellos han tenido en sucesivas generaciones de profesores, agentes culturales o estudiosos de la literatura.

Bovine babesiosis and anaplasmosis complex: diagnosis and evaluation of the risk factors from Bahia, Brazil

Directory of Open Access Journals (Sweden)

Lucimar Souza Amorim

Full Text Available Direct diagnoses were made by using - blood smears and nested PCR (nPCR tests on 309 blood samples from crossbred dairy cattle in the municipality of Ibicaraí, Bahia. From diagnostic blood smear slides, the observed parasitic frequencies were 31.1% for Anaplasma marginale and 20.4% for Babesia sp. From nPCR diagnoses, they were 63% for A. marginale, 34% for Babesia bigemina and 20.4% for Babesia bovis. There were significant differences (P <0.01 between the two diagnostic methods (nPCR and blood smear slides. The compliance obtained from the kappa test was 0.41 and 0.48 for A. marginale and Babesia sp., respectively. The tick samples from the six farms analyzed using nPCR were only positive for A. marginale. Evaluation of the risk factors relating to the presence of ticks and the age of the animals showed that there was a significant association (P <0.01 with the frequency of animals infected with both pathogens. Therefore, under the conditions studied, nPCR proved to be a good tool for diagnosing the agents of the bovine babesiosis and anaplasmosis complex because of its sensitivity and specificity in comparison with blood smears. The municipality of Ibicaraí is an area with endemic prevalence of bovine babesiosis and anaplasmosis confirmed by nPCR and A. marginale is the main agent of the disease.

A molecular epidemiological survey of Babesia, Hepatozoon, Ehrlichia and Anaplasma infections of dogs in Japan

Science.gov (United States)

KUBO, Shotaro; TATENO, Morihiro; ICHIKAWA, Yasuaki; ENDO, Yasuyuki

2015-01-01

Tick-borne diseases are often encountered in canine clinical practice. In the present study, a molecular epidemiological survey of dogs in Japan was conducted to understand the prevalence and geographical distribution of Babesia spp., Hepatozoon spp., Ehrlichia spp. and Anaplasma spp. Pathogen-derived DNA in blood samples obtained from 722 dogs with a history of exposure to ticks and/or fleas was examined by PCR. The prevalence of Babesia gibsoni, Babesia odocoilei-like species, Hepatozoon canis and Ehrlichia spp./Anaplasma spp. was 2.4% (16/722), 0.1% (1/722), 2.5% (18/722) and 1.5% (11/722), respectively. While B. gibsoni and Ehrlichia spp./Anaplasma spp. were detected in the western part of Japan, H. canis was detected in Tohoku area in addition to western and central parts of Japan. PMID:25947226

Investigating the Adult Ixodid Tick Populations and Their Associated Anaplasma, Ehrlichia, and Rickettsia Bacteria at a Rocky Mountain Spotted Fever Hotspot in Western Tennessee.

Science.gov (United States)

Trout Fryxell, Rebecca T; Hendricks, Brain M; Pompo, Kimberly; Mays, Sarah E; Paulsen, Dave J; Operario, Darwin J; Houston, Allan E

2017-08-01

Ehrlichiosis and rickettsiosis are two common bacterial tick-borne diseases in the southeastern United States. Ehrlichiosis is caused by ehrlichiae transmitted by Amblyomma americanum and rickettsiosis is caused by rickettsiae transmitted by Amblyomma maculatum and Dermacentor variabilis. These ticks are common and have overlapping distributions in the region. The objective of this study was to identify Anaplasma, Ehrlichia, and Rickettsia species associated with questing ticks in a Rocky Mountain spotted fever (RMSF) hotspot, and identify habitats, time periods, and collection methods for collecting questing-infected ticks. Using vegetation drags and CO 2 -baited traps, ticks were collected six times (May-September 2012) from 100 sites (upland deciduous, bottomland deciduous, grassland, and coniferous habitats) in western Tennessee. Adult collections were screened for Anaplasma and Ehrlichia (simultaneous polymerase chain reaction [PCR]) and Rickettsia using genus-specific PCRs, and resulting positive amplicons were sequenced. Anaplasma and Ehrlichia were only identified within A. americanum (Ehrlichia ewingii, Ehrlichia chaffeensis, Panola Mountain Ehrlichia, and Anaplasma odocoilei sp. nov.); more Ehrlichia-infected A. americanum were collected at the end of June regardless of habitat and collection method. Rickettsia was identified in three tick species; "Candidatus Rickettsia amblyommii" from A. americanum, R. parkeri and R. andeanae from A. maculatum, and R. montanensis ( = montana) from D. variabilis. Overall, significantly more Rickettsia-infected ticks were identified as A. americanum and A. maculatum compared to D. variabilis; more infected-ticks were collected from sites May-July and with dragging. In this study, we report in the Tennessee RMSF hotspot the following: (1) Anaplasma and Ehrlichia are only found in A. americanum, (2) each tick species has its own Rickettsia species, (3) a majority of questing-infected ticks are collected May-July, (4) A

Development of duplex PCR for simultaneous detection of Theileria spp. and Anaplasma spp. in sheep and goats.

Science.gov (United States)

Cui, Yanyan; Zhang, Yan; Jian, Fuchun; Zhang, Longxian; Wang, Rongjun; Cao, Shuxuan; Wang, Xiaoxing; Yan, Yaqun; Ning, Changshen

2017-05-01

Theileria spp. and Anaplasma spp., which are important tick-borne pathogens (TBPs), impact the health of humans and animals in tropical and subtropical areas. Theileria and Anaplasma co-infections are common in sheep and goats. Following alignment of the relevant DNA sequences, two primer sets were designed to specifically target the Theileria spp. 18S rRNA and Anaplasma spp. 16S rRNA gene sequences. Genomic DNA from the two genera was serially diluted tenfold for testing the sensitivities of detection of the primer sets. The specificities of the primer sets were confirmed when DNA from Anaplasma and Theileria (positive controls), other related hematoparasites (negative controls) and ddH 2 O were used as templates. Fifty field samples were also used to evaluate the utility of single PCR and duplex PCR assays, and the detection results were compared with those of the PCR methods previously published. An optimized duplex PCR assay was established from the two primer sets based on the relevant genes from the two TBPs, and this assay generated products of 298-bp (Theileria spp.) and 139-bp (Anaplasma spp.). The detection limit of the assay was 29.4 × 10 -3  ng per μl, and there was no cross-reaction with the DNA from other hematoparasites. The results showed that the newly developed duplex PCR assay had an efficiency of detection (P > 0.05) similar to other published PCR methods. In this study, a duplex PCR assay was developed that can simultaneously identify Theileria spp. and Anaplasma spp. in sheep and goats. This duplex PCR is a potentially valuable assay for epidemiological studies of TBPs in that it can detect cases of mixed infections of the pathogens. Copyright © 2017 Elsevier Inc. All rights reserved.

Molecular Characterization and Phylogenetic Analysis of Anaplasma spp. and Ehrlichia spp. Isolated from Various Ticks in Southeastern and Northwestern Regions of Iran.

Science.gov (United States)

Jafar Bekloo, Ahmad; Ramzgouyan, Maryam Roya; Shirian, Sadegh; Faghihi, Faezeh; Bakhshi, Hassan; Naseri, Fatemeh; Sedaghat, Mehdi; Telmadarraiy, Zakkyeh

2018-05-01

Anaplasma/Ehrlichia species are tick-transmitted pathogens that cause infections in humans and numerous domestic and wild animal species. There is no information available on the molecular characteristics and phylogenetic position of Anaplasma/Ehrlichia spp. isolated from tick species from different geographic locations in Iran. The aim of this study was to determine the prevalence, molecular characteristics, and phylogenetic relationship of both Anaplasma spp. and Ehrlichia spp. in tick species isolated from different domestic animals from two different geographical locations of Iran. A total of 930 ticks were collected from 93 cattle, 250 sheep, and 587 goats inhabiting the study areas. The collected ticks were then investigated for the presence of Anaplasma/Ehrlichia spp. using nested PCR based on the 16S rRNA gene, followed by sequencing. Sequence analysis was done based on the data published in the GenBank on Anaplasma/Ehrlichia spp. isolates using bioinformatic tools such as the standard nucleotide BLAST. Genome of Anaplasma or Ehrlichia spp. was detected in 14 ticks collected in Heris, including 5 Dermacentor marginatus, 1 Haemaphysalis erinacei, 3 Hyalomma anatolicum, and 4 Rhipicephalus sanguineus, also in 29 ticks collected in Chabahar, including 14 R. sanguineus, 8 D. marginatus, 3 Hyalomma Anatolicum, and 4 Hyalomma dromedarii. Partial analysis of the 16S rRNA gene sequence of positive samples collected from goats and sheep showed that they were infected with Anaplasma/Ehrlichia spp. that were 94-98% identical to ovine Anaplasma and 91-96% identical to Neoehrlichia and Ehrlichia spp. The various ticks identified in this study suggest the possible emergence of tick-borne diseases in animals and humans in these regions. R. sanguineus and D. marginatus seem to be predominant vectors responsible for anaplasmosis in these regions. Partial sequence analysis of the 16S rRNA gene showed that A. ovis is genetically polymorphic in these regions. Furthermore, an

Detection of Ehrlichia spp., Anaplasma spp., Rickettsia spp., and Other Eubacteria in Ticks from the Thai-Myanmar Border and Vietnam

OpenAIRE

Parola, Philippe; Cornet, Jean-Paul; Sanogo, Yibayiri Osée; Miller, R. Scott; Thien, Huynh Van; Gonzalez, Jean-Paul; Raoult, Didier; Telford III, Sam R.; Wongsrichanalai, Chansuda

2003-01-01

A total of 650 ticks, including 13 species from five genera, were collected from animals, from people, or by flagging of the vegetation at sites on the Thai-Myanmar border and in Vietnam. They were tested by PCR to detect DNA of bacteria of the order Rickettsiales. Three Anaplasma spp. were detected in ticks collected in Thailand, including (i) Anaplasma sp. strain AnDa465, which was considered a genotype of Anaplasma platys (formerly Ehrlichia platys) and which was obtained from Dermacentor ...

[Natural infection by hemoparasites in calves submitted to chemoprophylaxis at 30 days of age].

Science.gov (United States)

da Silva, Rosângela A; Corrêa, Fabíola do N; Botteon, Rita de Cássia C M; Botteon, Paulo de Tarso L

2007-01-01

The tick-borne disease (TBD) brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%), B. bovis (11.1%) and A. marginale (13.9%). Six animals had clinical symptoms (16.7%) and one dead (2.8%). The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

Diagnosis of hemoparasitosis trough the spread-smear technique using a drop of blood clot

OpenAIRE

Neusa Saltiél Stobbe; Eunice Leonora Chaplin; Maria das Graças de Souza Paiva; Nilton Rogério Santos Silva; Flávio A. Pacheco Araújo; Elinor Fortes

1992-01-01

The spread-smear technique using a drop of blood clot and stained by diluted and undimitcd Giemsa stain was evaluated for the search of blood cell types and recognition of Babesia bovis, Babesia bigemina and Anaplasma marginale hemoparasites. The blood clot samples were taken from a 6 month-old calf experimentally inoculated with the blood from a Cattle Tick Fever carrier. The Technique was sumitable for the observation of different blood cells and for the recognition of the hemoparasites.

HEMOPARASITOSIS EN GANADERÍA DOBLE PROPÓSITO VENEZOLANA, DIAGNÓSTICO Y CONTROL: UNA REVISIÓN

Directory of Open Access Journals (Sweden)

Rita Tamasaukas

2010-01-01

Full Text Available Este trabajo de revisión de tesis doctoral incluye resultados de investigaciones realizadas en el periodo 1971 a 2009 sobre cuatro hemoparasitosis causados por protozoarios y rickettsiales en Venezuela y otros países, con énfasis en la infección mixta en rebaños bovinos, y su diagnóstico y control. En Venezuela, las afecciones causadas por agentes hemotrópicos parasitarios están distribuidas en todos los estados del país con vocación ganadera, en especial, en rebaños bovinos y bufalinos. Entre aquellos encontramos a especies del género Anaplasma (Anaplasma marginale, Babesia (Babesia bigemina y B. bovis, y Trypanosoma (Trypanosoma vivax, con una frecuencia endémica y con variaciones estacionales.

First case of Anaplasma platys infection in a dog from Croatia

Directory of Open Access Journals (Sweden)

Dyachenko Viktor

2012-03-01

Full Text Available Abstract Background It is known that Anaplasma (A. platys, the causative agent of infectious canine cyclic thrombocytopenia, is endemic in countries of the Mediterranean basin. However, few reports are available from the Balkans. This case report describes a dog, which was imported from Croatia to Germany in May 2010. One month later the dog was presented to a local veterinarian in Germany due to intermittent/recurrent diarrhoea. Diagnostic tests were performed to identify infections caused by Anaplasma spp., Ehrlichia spp., Hepatozoon canis, Babesia spp., Leishmania spp., Borrelia burgdorferi and/or Dirofilaria immitis. Findings Haematological examination of a blood smear revealed basophilic inclusions in thrombocytes, which were confirmed as A. platys with a species-specific real-time PCR. Additionally, an infection with Babesia (B. vogeli was also detected (PCR and serology. No specific antibodies against Anaplasma antigen were detectable. Although the dog showed no specific clinical signs, thrombocytopenia, anaemia and elevated C-reactive protein (CRP were observed. Sequencing of a 1,348-bp partial ribosomal RNA gene revealed highest homology to A. platys sequences from Thailand, Japan and France. Conclusions A. platys was detected for first time in a dog imported from Croatia. As the dog was also co-infected by B. vogeli, unique serological and haematological findings were recorded. Thrombocytopenia, anaemia and elevated values of C-reactive protein were the laboratory test abnormalities observed in this case. A. platys infections should be considered in dogs coming from Croatia and adjacent regions.

Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

Science.gov (United States)

Beckley, Carl S; Shaban, Salisu; Palmer, Guy H; Hudak, Andrew T; Noh, Susan M; Futse, James E

2016-01-01

Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc) were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B. bigemina prevalence

Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

Directory of Open Access Journals (Sweden)

Carl S Beckley

Full Text Available Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B

Seroprevalence and risk factors associated with Ehrlichia canis, Anaplasma spp., Borrelia burgdorferi sensu lato, and D. immitis in hunting dogs from southern Italy.

Science.gov (United States)

Piantedosi, Diego; Neola, Benedetto; D'Alessio, Nicola; Di Prisco, Francesca; Santoro, Mario; Pacifico, Laura; Sgroi, Giovanni; Auletta, Luigi; Buch, Jesse; Chandrashekar, Ramaswamy; Breitschwerdt, Edward B; Veneziano, Vincenzo

2017-10-01

Canine vector-borne diseases (CVBDs) are caused by a range of pathogens transmitted to dogs by arthropods. The present study investigates Ehrlichia canis, Anaplasma spp., Borrelia burgdorferi sensu lato, and Dirofilaria immitis seroprevalences in hunting dogs from southern Italy. Dogs (no. 1335) were tested using a commercial in-clinic enzyme-linked immunosorbent assay kit. Odds ratios (ORs) were calculated by logistic regression analysis to identify risk factors. Overall, 138/1335 dogs (10.3%) were seroreactive to at least one CVBD pathogen. E. canis, Anaplasma spp., B. burgdorferi s.l., and D. immitis seroprevalences were 7.6, 4.4, 0.3, and 0.2%, respectively. E. canis and Anaplasma spp. co-exposures were found in 30 dogs (2.2%), compared with Anaplasma spp. and B. burgdorferi s.l. co-exposures in 2 dogs (0.1%). Adult age was a risk factor for E. canis (OR 2.35) seroreactivity whereas hunting fur-bearing animals for E. canis (OR 4.75) and Anaplasma spp. (OR 1.87), respectively. The historical presence of tick infestation was identified as a risk factor for positivity to E. canis (OR 2.08) and Anaplasma spp. (OR 2.15). Finally, larger dog pack size was significantly associated with E. canis (OR 1.85) and Anaplasma spp. (OR 2.42) exposures. The results of the present survey indicated that hunting dog populations are at relative risk of CVBDs in southern Italy. Further studies are needed to evaluate the role of hunting dogs in the epidemiology of vector-borne organisms due to sharing common environments with wild, sympatric animal populations.

Occurrence of Hepatozoon canis (Adeleorina: Hepatozoidae) and Anaplasma spp. (Rickettsiales: Anaplasmataceae) in black-backed jackals (Canis mesomelas) in South Africa.

Science.gov (United States)

Penzhorn, Barend L; Netherlands, Edward C; Cook, Courtney A; Smit, Nico J; Vorster, Ilse; Harrison-White, Robert F; Oosthuizen, Marinda C

2018-03-20

Domestic dogs are not native to sub-Saharan Africa, which may account for their susceptibility to Babesia rossi, of which endemic black-backed jackals (Canis mesomelas) are natural reservoirs. There is virtually no information on the occurrence of potentially pathogenic haemogregarines (e.g. Hepatozoon canis) or even rickettsial bacteria (e.g. Ehrlichia spp. and Anaplasma spp.) in indigenous canids in sub-Saharan Africa. Such organisms could pose a risk to domestic dogs, as well as to populations of endangered indigenous canid species. Genomic DNA extracted from blood samples taken from 126 free-ranging and 16 captive black-backed jackals was subjected to reverse line blot (RLB) hybridization assay; 82 (57.8%) specimens reacted only with the Ehrlichia/Anaplasma genera-specific probe. Full-length bacterial 16S rRNA gene of five of these specimens was cloned and the recombinants sequenced. The ten 16S rDNA sequences obtained were most closely related, with approximately 99% identity, to Anaplasma sp. South African Dog, various uncultured Anaplasma spp., as well as various Anaplasma phagocytophilum genotypes. Ninety-one specimens were screened for haemogregarines through PCR amplification using the 18S rRNA gene; 20 (21.9%) specimens reacted positively, of which 14 (15.4%) were confirmed positive for Hepatozoon genotypes from within H. canis. Two (2.2%) specimens were found positive for two different Hepatozoon genotypes. Sequence analyses confirmed the presence of 16S rDNA sequences closely related to A. phagocytophilum and Anaplasma sp. South African Dog as well as two H. canis genotypes in both free-ranging and captive black-backed jackals. Distinguishing between closely related lineages may provide insight into differences in pathogenicity and virulence of various Anaplasma and H. canis genotypes. By building up a more comprehensive understanding of the range and diversity of the bacteria and eukaryotic organisms (piroplasms and haemogregarines) in the blood of

Incidencia de los Hábitos Alimenticios en los Niveles de Rendimiento Académico Escolar en las Instituciones Educativas Secundarias Urbano Marginales de Juliaca

OpenAIRE

Aguilar Roque, Gaylee Yemira

2015-01-01

El presente trabajo de investigación denominado “INCIDENCIA DE LOS HÁBITOS ALIMENTICIOS EN LOS NIVELES DE RENDIMIENTO ACADÉMICO ESCOLAR EN LAS INSTITUCIONES EDUCATIVAS SECUNDARIAS URBANO - MARGINALES DE JULIACA”, cuyo objetivo general es establecer la importancia del consumo de cereales andinos y productos procesados en los niveles de rendimiento académico de los estudiantes de las I.E.S. de las zonas urbano – marginales de la ciudad de Juliaca. Este estudio nos permite establec...

Remodeling of tick cytoskeleton in response to infection with Anaplasma phagocytophilum

Czech Academy of Sciences Publication Activity Database

Cabezas Cruz, Alejandro; Alberdi, P.; Valdés, James J.; Villar, M.; de la Fuente, J.

2017-01-01

Roč. 22, Jun 1 (2017), s. 1830-1844 ISSN 1093-4715 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : cytoskeleton * proteomics * transcriptomics * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology

NNDSS - Table II. Ehrlichiosis and Anaplasmosis, Anaplasma phagocytophilum infection to Ehrlichia chaffeensis infection

Data.gov (United States)

U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis and Anaplasmosis, Anaplasma phagocytophilum infection to Ehrlichia chaffeensis infection - 2018. In this Table, provisional cases of...

Diagnosis of hemoparasitosis trough the spread-smear technique using a drop of blood clot

Directory of Open Access Journals (Sweden)

Neusa Saltiél Stobbe

1992-12-01

Full Text Available The spread-smear technique using a drop of blood clot and stained by diluted and undimitcd Giemsa stain was evaluated for the search of blood cell types and recognition of Babesia bovis, Babesia bigemina and Anaplasma marginale hemoparasites. The blood clot samples were taken from a 6 month-old calf experimentally inoculated with the blood from a Cattle Tick Fever carrier. The Technique was sumitable for the observation of different blood cells and for the recognition of the hemoparasites.

Usos marginales de los marcadores del discurso. Su efecto en la comprensión lectora en español como lengua extranjera

Directory of Open Access Journals (Sweden)

María Fernanda Pelayo

2003-04-01

Full Text Available En este trabajo abordamos lo que hemos denominado usos marginales de los marcadores del discurso y cómo afectan a la comprensión lectora en español como lengua extranjera. Tras un análisis y definición de estos usos no ortodoxos de los marcadores del discurso, realizamos una clasificación preliminar de los mismos. Finalmente, diseñamos y llevamos a cabo un estudio empírico acerca de la manera en que los usos marginales de los marcadores del discurso podrían afectar a la comprensión lectora de textos en español como lengua extranjera. Losresultados obtenidos en este estudio experimental muestran que existe una tendencia bastante generalizada que nos hace aventurarnos a concluir que efectivamente los lectores de español como lengua extranjera muestran tenerproblemas para comprender textos en los que se han empleado usos marginales de los marcadores del discurso. Por otra parte, el uso ortodoxo de los marcadores del discurso parece favorecer la comprensión adecuada del texto.

Frequency of Anaplasma marginale (Theiler 1910 and Babesia sp in mestizo bovine Zebu, in the Municipality of Ixiamas county Abel Iturralde Department of The La Paz, Bolivia

Directory of Open Access Journals (Sweden)

Mercado Alvaro

2011-08-01

Full Text Available The present work one carries out in the Municipality of Ixiamas County Abel Iturralde of the department of Peace-Bolivia, between May and August of 2010. The objective was to determine the presence of Anaplama sp and Babesia sp, through sanguine smear, they took 160 samples of blood, 40 bovine of the four areas they have been evaluated. The results indicate the presence of Anaplasma sp 6,90%, 6,20% in females and 9,70% in males, this represents 2,50% for the area TO, 5,00% area B, 17,50% area C and 2,50% area D. According to the category 12,50% in calves, 0,00% in torillos, 4,80% in bulls, 6,20% in cows and 14,30% in heifers. The presence of Babesia sp 3,13%, with relationship to the sex 3,10% in females and 3,22% in males, being observed 2,50% in the area TO, 5,00% in the area B, 5,00% in the area C and 0,00% in the area D, according to the category 0,00% in calves, torillos 4,80% bulls, 2,73% vacates and 7,14% in heifers.

Bovine anaplasmosis with emphasis on immune responses and protection

International Nuclear Information System (INIS)

Ristic, M.

1980-01-01

Anaplasmosis is an infectious and transmissible disease manifested by progressive anaemia and the appearance of other characteristic disease symptoms. It is a world-wide tick-borne disease of cattle and some wild ruminants caused by the rickettsia Anaplasma marginale. By drawing on information obtained from studies of plasmodial cell cultures, a method has recently been developed for short-term in vitro cultivation of A. marginale. An attenuated Anaplasma organism capable of growth in both ovine and bovine erythrocytes was used to demonstrate that the in vitro system provided the necessary requirements for active transfer of the organism from cell to cell. Organismal antigens are found in the erythrocytes of infected animals, whereas soluble antigens are derived from their erythrocytes and serum. Serums from convalescing animals interact with these antigens in agglutination, complement fixation, fluorescent antibody and precipitation tests. Passive transfer of sera from immune to susceptible cattle, however, does not seem to confer protection against the infection and development of the disease. Studies that employed various tests for measuring cell-mediated immune (CMI) responses (leukocyte migration inhibition, blast transformation and cytotoxicity), in association with information collected simultaneously on antibody activity, have shown that both humoral and cellular immune responses are needed for the development of protective immunity in anaplasmosis. It was further shown that an active replication of Anaplasma is essential for induction of these two types of immune responses. Consequently, live virulent and attenuated immunogens fulfil requirements for induction of protective immunity. With the virulent agent, however, development of protective immunity is preceded by induction of auto-immune responses apparently associated with pathogenesis of anaemia in anaplasmosis. Inactivated immunogens derived from blood of infected cattle and used in combination with

Detection of Ehrlichia spp., Anaplasma spp., Rickettsia spp., and other eubacteria in ticks from the Thai-Myanmar border and Vietnam.

Science.gov (United States)

Parola, Philippe; Cornet, Jean-Paul; Sanogo, Yibayiri Osée; Miller, R Scott; Thien, Huynh Van; Gonzalez, Jean-Paul; Raoult, Didier; Telford III, Sam R; Wongsrichanalai, Chansuda

2003-04-01

A total of 650 ticks, including 13 species from five genera, were collected from animals, from people, or by flagging of the vegetation at sites on the Thai-Myanmar border and in Vietnam. They were tested by PCR to detect DNA of bacteria of the order RICKETTSIALES: Three Anaplasma spp. were detected in ticks collected in Thailand, including (i) Anaplasma sp. strain AnDa465, which was considered a genotype of Anaplasma platys (formerly Ehrlichia platys) and which was obtained from Dermacentor auratus ticks collected from dogs; (ii) Anaplasma sp. strain AnAj360, which was obtained from Amblyomma javanense ticks collected on a pangolin; and (iii) Anaplasma sp. strain AnHl446, which was closely related to Anaplasma bovis and which was detected in Haemaphysalis lagrangei ticks collected from a bear. Three Ehrlichia spp. were identified, including (i) Ehrlichia sp. strain EBm52, which was obtained from Boophilus microplus ticks collected from cattle from Thailand; (ii) Ehrlichia sp. strain EHh324, which was closely related to Ehrlichia chaffeensis and which was detected in Haemaphysalis hystricis ticks collected from wild pigs in Vietnam; and (iii) Ehrlichia sp. strain EHh317, which was closely related to Ehrlichia sp. strain EBm52 and which was also detected in H. hystricis ticks collected from wild pigs in Vietnam. Two Rickettsia spp. were detected in Thailand, including (i) Rickettsia sp. strain RDla420, which was detected in Dermacentor auratus ticks collected from a bear, and (ii) Rickettsia sp. strain RDla440, which was identified from two pools of Dermacentor larvae collected from a wild pig nest. Finally, two bacteria named Eubacterium sp. strain Hw124 and Eubacterium sp. strain Hw191 were identified in Haemaphysalis wellingtoni ticks collected from chicken in Thailand; these strains could belong to a new group of bacteria.

El impuesto al valor agregado en los contratos de campos marginales

OpenAIRE

Niquinga Salazar, Oscar Javier

2007-01-01

Esta investigación dirigida por los métodos de investigación sistemático, exegético, y teleológico, pretende analizar los contratos petroleros de Campos Marginales utilizados por la legislación ecuatoriana y específicamente, el papel de Impuesto al Valor Agregado en la producción de la Curva Base; ésta, se convierte en una figura contractual innovadora que ha producido una interesante discusión a nivel nacional; sin embargo, la propuesta de este trabajo va encaminado a encontra...

High infection of Anaplasma and Ehrlichia spp. among tick species collected from different geographical locations of Iran

Directory of Open Access Journals (Sweden)

Leila Tajedin

2016-10-01

Full Text Available Objective: To ascertain the prevalence of the Anaplasma/Ehrlichia infections in tick population within four provinces of Iran. Methods: A total of 384 tick specimens were collected from domestic animals inhabiting in four provinces (East Azerbaijan, Gilan, South Khorasan and Yazd. Specimens were identified based on morphological analysis. The detection of Anaplasma spp./Ehrlichia spp. within tick samples was carried out by nested PCR amplification of the 16S ribosomal RNA gene accompanied by DNA sequencing and analysis for verification. Results: A total of 10 tick species were identified as follows: Ornithodoros lahorensis (O. lahorensis (44.8%, Hyalomma dromedarii (15.6%, Dermacentor marginatus (13.5%, Hyalomma anatolicum (11.2%, Hyalomma asiaticum (5.7%, Hyalomma marginatum (4.9%, Rhipicephalus sanguineus (2.3%, Hyalomma detritum (1.0%, Dermacentor niveus (0.5% and Argas persicus (0.3%. The percentage distribution of Anaplasma/Ehrlichia was 55.5% (213 across 384 studied ticks. Conclusions: To the best of our knowledge, this is the first report of Anaplasma ovis infection in O. lahorensis in Iran. We also conjecture the prevalence of Ehrlichia spp. in Yazd Province based on sequencing results; also, it is suggested that O. lahorensis is a potential vector in the studied area. This survey highlights the importance of Argasidae family to verify and correlate their threat in causing anaplasmosis and other diseases in animals.

Neonatal Anaplasma platys infection in puppies: Further evidence for possible vertical transmission

Czech Academy of Sciences Publication Activity Database

Matei, I.A.; Stuen, S.; Modrý, David; Degan, A.; D'Amico, G.; Mihalca, A. D.

2017-01-01

Roč. 219, 1 January (2017), s. 40-41 ISSN 1090-0233 Institutional support: RVO:60077344 Keywords : Anaplasma platys * canine * vertical transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.802, year: 2016

Análisis de la dinámica relacional generada por las websites de Internet en el desarrollo de los turismos marginales

Directory of Open Access Journals (Sweden)

José Mª Prat

2012-01-01

Full Text Available El conocimiento de los actores turísticos del territorio, y de sus relaciones, es un elemento básico para la gestión activa de cualquier destino turístico. Como que, gracias a las nuevas tecnologías de la información y a la popularizacióndel uso de Internet, se han creado una gran cantidad de relaciones sociales gracias a las websites, interrelacionadas, que han permitido una rápida y amplia difusión promocional de aquellos destinos que ofrecen unas alternativas turísticas más marginales, como respuesta a los nuevos planteamientos post-fordistas del turismo, generándose una dinámica relacional que se ha beneficiado del rápido desarrollo de las TIC's. En este trabajo se han analizado dichas relaciones entre websites, en el caso del desarrollo de dos turismos marginales, el naturista y el swinger, en Cap d'Agde, en el sur de Francia, comprobándose la existencia de una relación directa entre la dinámica relacional del territorio y elgrado de desarrollo de los turismos marginales.

Ticks circulate Anaplasma, Ehrlichia, Babesia and Theileria parasites in North of Iran.

Science.gov (United States)

Bekloo, Ahmad Jafar; Bakhshi, Hasan; Soufizadeh, Ayoub; Sedaghat, Mohammad Mehdi; Bekloo, Romina Jafar; Ramzgouyan, Maryam Roya; Chegeni, Asadollah Hosseini; Faghihi, Faezeh; Telmadarraiy, Zakkyeh

2017-12-15

Ticks serve as important vectors of some pathogens of medical importance all over the world and identification of their rate of infection plays an important role for further control of diseases. In the current study, we investigated on ticks collected from north of Iran where raising and caring livestock are the main task of the people in order to find evidences of infection of Babesia, Theileria, Anaplasma and Ehrlichia microbial agents. Totally, 609 hard tick species from two genera Hyalomma and Rhipicephalus including; Hy. scupense, Hy. dromedarii, Hy. rufipes, Hy. marginatum, Hy. asiaticum, Hy. anatolicum, R. bursa, R. sanguineus and R. turanicus were identified. Molecular analysis revealed the presence of Anaplasma, Ehrlichia, Babesia and Theileria microorganism agents in all collected tick species except Hy. asiaticum and R. turanicus. To the best of our knowledge, this is the first report on identification of B. occultans in Hyalomma anatolicum and B. ovis in Hyalomma sp in Iran. Copyright © 2017 Elsevier B.V. All rights reserved.

First confirmed report of outbreak of theileriosis/anaplasmosis in a cattle farm in Henan, China.

Science.gov (United States)

Cui, Yanyan; Wang, Xiaoxing; Zhang, Yan; Yan, Yaqun; Dong, Haiju; Jian, Fuchun; Shi, Ke; Zhang, Longxian; Wang, Rongjun; Ning, Changshen

2018-01-01

Tick-borne diseases (TBDs) impose a significant constraint to livestock production world widely. In this paper, we presented a case of TBD in a cattle farm in Henan, China. 35 blood samples (7 samples sent by veterinarian, 28 samples gathered by our colleagues) were collected from ill, surviving and asymptomatic cattle and microscopic observation and PCR assays were conducted to characterize the pathogens. Genus Ixodes feeding on these cattle were collected and identified. Theileria annulata-like and Anaplasma marginale-like pathogens were observed in the blood smears stained with Giemsa staining under microscope. Furthermore, 5 out of 7 cattle blood samples were found to be positive for T. annulata by PCR. In the 28 blood specimens, three were positive for T. annulata, while A. marginale DNA was detected in nine blood DNA samples. Besides, 56 ticks feeding on cattle were collected from this farm and were all identified as Rhipisephalus microplus, meanwhile, 10 of them were found to be positive for A. marginale. In addition, phylogenetic analysis of the msp4 gene sequences of A. marginale obtained in this study showed that the isolate from cattle (KX840009) fell in the same clade with that of R. microplus (KX904527), sharing 100% similarity. To the best of our knowledge, this is the first confirmed report of outbreak of theileriosis/anaplasmosis in cattle farms in Henan, China. Copyright © 2017. Published by Elsevier B.V.

Molecular detection of tick-borne pathogens in cattle from Southwestern Ethiopia.

Directory of Open Access Journals (Sweden)

Zerihun Hailemariam

Full Text Available Tick-borne diseases (TBDs cause significant losses among livestock and impact the livelihoods of resource-poor farming communities worldwide. In Ethiopia, detailed studies on the epidemiology of tick-borne pathogens (TBPs in cattle using sensitive molecular detection methods are scarce. The objective of this study was to determine the prevalence and species composition of bovine TBPs of veterinary significance in local cattle populations. A comprehensive cross-sectional epidemiological study was conducted in cattle populations of Illubabor zone in Southwestern Ethiopia from June to August 2013. For this purpose, blood samples were collected from 392 cattle. A combination of polymerase chain reaction (PCR and a Reverse Line Blot (RLB hybridization assay was employed for the detection of TBPs in these samples. The PCR/RLB results of the 392 blood samples indicated a high overall prevalence of 96.9% for TBPs, including Theileria mutans (66.1%, Theileria orientalis (51.8%, Anaplasma sp. Omatjenne (25.5%, Anaplasma marginale (14.5%, Babesia bigemina (14.0% and Theileria velifera (13.0% and minor occurrences of Ehrlichia ruminantium (0.5% and Ehrlichia minasensis (0.26%. Moreover, three novel Anaplasma genotypes were detected in bovine blood samples. A phylogenetic analysis revealed that they most likely represent three, but at least two, new species. The prevalence of the three novel Anaplasma species, preliminary designated as Anaplasma sp. Hadesa, Anaplasma sp. Saso and Anaplasma sp. Dedessa, was 12.5%, 14.3% and 5.6%, respectively. Overall, a total of 227 cattle (57.9% were found to be co-infected with two or more TBPs simultaneously and 86 different species combinations were observed. The findings show a very high burden of infection of cattle with TBPs in Ethiopia. The high frequency of co-infections suggests that clinical manifestations might be complex. Further research is required to determine the pathogenicity, host cell types and vector of

Genetic Diversity of Tick-Borne Rickettsial Pathogens; Insights Gained from Distant Strains

Directory of Open Access Journals (Sweden)

Sebastián Aguilar Pierlé

2014-01-01

Full Text Available The ability to capture genetic variation with unprecedented resolution improves our understanding of bacterial populations and their ability to cause disease. The goal of the pathogenomics era is to define genetic diversity that results in disease. Despite the economic losses caused by vector-borne bacteria in the Order Rickettsiales, little is known about the genetic variants responsible for observed phenotypes. The tick-transmitted rickettsial pathogen Anaplasma marginale infects cattle in tropical and subtropical regions worldwide, including Australia. Genomic analysis of North American A. marginale strains reveals a closed core genome defined by high levels of Single Nucleotide Polymorphisms (SNPs. Here we report the first genome sequences and comparative analysis for Australian strains that differ in virulence and transmissibility. A list of genetic differences that segregate with phenotype was evaluated for the ability to distinguish the attenuated strain from virulent field strains. Phylogenetic analyses of the Australian strains revealed a marked evolutionary distance from all previously sequenced strains. SNP analysis showed a strikingly reduced genetic diversity between these strains, with the smallest number of SNPs detected between any two A. marginale strains. The low diversity between these phenotypically distinct bacteria presents a unique opportunity to identify the genetic determinants of virulence and transmission.

First report of Anaplasma ovis in pupal and adult Melophagus ovinus (sheep ked) collected in South Xinjiang, China.

Science.gov (United States)

Zhao, Li; He, Bo; Li, Kai-Rui; Li, Fei; Zhang, Lu-Yao; Li, Xian-Qiang; Liu, Yong-Hong

2018-04-19

Melophagus ovinus (sheep ked) is a blood-feeding ectoparasite that belongs to the family Hippoboscidae (Diptera: Hippoboscoidea) and mainly parasitizes sheep. The life-cycle of M. ovinus consists of three stages: larva, pupa and adult. It has a worldwide distribution and has been found in four provinces of China, especially South Xinjiang. In addition to causing direct damage to animal hosts, M. ovinus serves as a vector for disease transmission. In this study, our aim was to investigate the presence of Anaplasma spp. in pupal and adult M. ovinus. A total of 93 specimens (including eight pupal specimens) of M. ovinus collected in South Xinjiang were selected for isolation of genomic DNA, followed by PCR amplification and sequencing of the msp4 gene of Anaplasma spp. The sequences were analyzed in MEGA 7.0 software and via online BLAST. PCR and sequencing results showed that all the specimens collected in 2013 were free of Anaplasma spp., whereas three and 25 specimens (including five pupal specimens) collected in 2016 and 2017, respectively, tested positive for Anaplasma spp. The analysis of 24 msp4 gene sequences (from four pupal specimens) confirmed the presence of A. ovis in M. ovinus specimens collected in South Xinjiang, China. The detected A. ovis isolates belong to Genotypes II and III. To the best of our knowledge, this is the first report of the detection of A. ovis DNA in pupal M. ovinus, confirming the vertical transmission of A. ovis in M. ovinus and the potential of M. ovinus to serve as a vector for A. ovis.

La sexualidad en los jóvenes de sectores marginales. Un informe de avance

OpenAIRE

Aigneren Aburto, José Miguel

2004-01-01

La sexualidad en los jovenes de sectores marginales. El problema es la sexualidad de los adolescentes en un mundo de pobreza e inequidad. Este estudio tiene como objetivo general describir los crudos productos sexuales de la miseria y los mitos que envenenan a la juventud marginal. Es un intento de retratar a aquellos adolescentes que conocen el sexo en la escuela del submundo que esconden los cordones de extrema pobreza del Medellín de hoy. Los resultados citados corresponden a realidades co...

Molecular detection of Anaplasma platys, Anaplasma phagocytophilum and Wolbachia sp. but not Ehrlichia canis in Croatian dogs.

Science.gov (United States)

Huber, Doroteja; Reil, Irena; Duvnjak, Sanja; Jurković, Daria; Lukačević, Damir; Pilat, Miroslav; Beck, Ana; Mihaljević, Željko; Vojta, Lea; Polkinghorne, Adam; Beck, Relja

2017-11-01

The bacteria Anaplasma platys, Anaplasma phagocytophilum and Ehrlichia canis are tick-borne agents that cause canine vector-borne disease. The prevalence of these pathogens in South Eastern Europe is unknown with the exception of an isolated case of A. platys detected in a dog imported into Germany from Croatia. To gain a better insight into their presence and prevalence, PCR-based screening for these bacterial pathogens was performed on domesticated dogs from different regions of Croatia. Blood samples from 1080 apparently healthy dogs from coastal and continental parts of Croatia as well as tissue samples collected from 63 deceased dogs with a history of anaemia and thrombocytopenia were collected for molecular screening by an Anaplasmataceae-specific 16S rRNA conventional PCR. Positive samples were confirmed using a second Anaplasmataceae-specific PCR assay with the PCR product sequenced for the purpose of bacterial species identification. All sequenced isolates were georeferenced and a kernel intensity estimator was used to identify clusters of greater case intensity. 42/1080 (3.8%; CI 2.7-5.0) of the healthy dogs were PCR positive for bacteria in the Anaplasmataceae. Sequencing of the 16S rRNA gene amplified from these positive samples revealed the presence of A. platys in 2.5% (CI 1.6-3.4%, 27 dogs), A. phagocytophilum in 0.3% (CI 0-0.6%, 3 dogs) and a Wolbachia endosymbiont in 1.1% (CI 0.4-1.6%, 12 dogs) of dogs screened in this study. Necropsied dogs were free from infection. Notably, no evidence of E. canis infection was found in any animal. This survey represents a rare molecular study of Anaplasmataceae in dogs in South Eastern Europe, confirming the presence of A. platys and A. phagocytophilum but not E. canis. The absence of E. canis was surprising given it has been described in all other Mediterranean countries surveyed and raises questions over the regional vector capacity of the Rhipicephalus sanguineus tick.

Ixodes scapularis saliva mitigates inflammatory cytokine secretion during Anaplasma phagocytophilum stimulation of immune cells

Czech Academy of Sciences Publication Activity Database

Chen, G.; Severo, M. S.; Sohail, M.; Sakhon, O. S.; Wikel, S. K.; Kotsyfakis, Michalis; Pedra, J. H. F.

2012-01-01

Roč. 5, č. 1 (2012), s. 229 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Tick * Ixodes scapularis * Saliva * Anaplasma phagocytophilum * Rickettsial agent Subject RIV: EC - Immunology Impact factor: 3.246, year: 2012 http://www.parasitesandvectors.com/content/5/1/229

Anaplasma phagocytophilum Infection Subverts Carbohydrate Metabolic Pathways in the Tick Vector, Ixodes scapularis

Czech Academy of Sciences Publication Activity Database

Cabezas Cruz, Alejandro; Alberdi, P.; Valdés, James J.; Villar, M.; de la Fuente, J.

2017-01-01

Roč. 7, 7 February (2017), č. článku 23. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : proteomics * transcriptomics * glucose metabolism * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016

Comparative genomics and transcriptomics of trait-gene association

Directory of Open Access Journals (Sweden)

Pierlé Sebastián

2012-11-01

Full Text Available Abstract Background The Order Rickettsiales includes important tick-borne pathogens, from Rickettsia rickettsii, which causes Rocky Mountain spotted fever, to Anaplasma marginale, the most prevalent vector-borne pathogen of cattle. Although most pathogens in this Order are transmitted by arthropod vectors, little is known about the microbial determinants of transmission. A. marginale provides unique tools for studying the determinants of transmission, with multiple strain sequences available that display distinct and reproducible transmission phenotypes. The closed core A. marginale genome suggests that any phenotypic differences are due to single nucleotide polymorphisms (SNPs. We combined DNA/RNA comparative genomic approaches using strains with different tick transmission phenotypes and identified genes that segregate with transmissibility. Results Comparison of seven strains with different transmission phenotypes generated a list of SNPs affecting 18 genes and nine promoters. Transcriptional analysis found two candidate genes downstream from promoter SNPs that were differentially transcribed. To corroborate the comparative genomics approach we used three RNA-seq platforms to analyze the transcriptomes from two A. marginale strains with different transmission phenotypes. RNA-seq analysis confirmed the comparative genomics data and found 10 additional genes whose transcription between strains with distinct transmission efficiencies was significantly different. Six regions of the genome that contained no annotation were found to be transcriptionally active, and two of these newly identified transcripts were differentially transcribed. Conclusions This approach identified 30 genes and two novel transcripts potentially involved in tick transmission. We describe the transcriptome of an obligate intracellular bacterium in depth, while employing massive parallel sequencing to dissect an important trait in bacterial pathogenesis.

Violencia basada en género en zonas urbanas y urbano-marginales de Lima y Callao, 2007 - 2010

Directory of Open Access Journals (Sweden)

Pedro Mascaro-Sánchez

2012-04-01

Full Text Available Objetivos: Determinar y comparar las características de la violencia en pobladores de zonas urbanas y urbano-marginales. Diseño: Estudio epidemiológico descriptivo. Institución: Escuela de Obstetricia, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Participantes: Mujeres de Lima y Callao. Intervenciones: Entre los años 2007 y 2010, se aplicó una entrevista estructurada a 3 971 mujeres de zonas urbanas y urbano-marginales de Lima y Callao. Se incluyó mujeres residentes de la zona, excluyéndose aquellas con problemas psicológicos evidentes y problemas del habla. Los datos fueron analizados con estadísticas descriptivas y con el estadístico chi cuadrado, significativo a un nivel p<0,05. Principales medidas de resultados: Violencia física. Resultados: De las entrevistadas, 39% tenía entre 20 y 24 años de edad. El 47% identificó violencia física, siendo similar en zonas urbanas y urbano-marginales. Los empujones y bofetadas fueron la forma más frecuente de violencia en ambas áreas. Con respecto al estudio de la violencia psicológica, fueron más frecuentes la utilización de gritos y celos por posesividad, también en ambas áreas. El gasto de la pareja sin la consulta fue ligeramente mayor para el área urbano marginal (49% que para el área urbana (42%. El intento de tener relaciones sexuales contra su voluntad fue el tipo de violencia más frecuente (37%, más en el área urbana (41% que en el área urbano marginal (34%. Conclusiones: Se evidenció episodios de violencia física, psicológica, económica y sexual similares para el área urbana y el área urbano-marginal, siendo la violencia sexual más frecuente en el área urbana.

Prevalence Survey of Selected Bovine Pathogens in Water Buffaloes in the North Region of Brazil

Directory of Open Access Journals (Sweden)

Jenevaldo Barbosa da Silva

2014-01-01

Full Text Available Although the largest buffalo herd in the occident is in the north region of Brazil, few studies have been conducted to assess the prevalence of selected parasitic diseases in buffalo herd. The present study was therefore conducted to investigate the epidemiological of Toxoplasma gondii, Neospora caninum, Anaplasma marginale, Babesia bigemina, and Babesia bovis in water buffaloes in the north region of Brazil. A total of 4796 buffalo blood samples were randomly collected from five provinces and simultaneously analyzed by the IFAT and ELISA. The serological prevalence of T. gondii and N. caninum was 41.3% and 55.5% in ELISA and 35.7% and 48.8% in IFAT, respectively. The overall prevalence of A. marginale, B. bovis, and B. bigemina was 63%, 25%, and 21% by ELISA and 50.0%, 22.5%, and 18.8% by IFAT, respectively. This study shows valuable information regarding the serological survey of selected bovine pathogens in water buffaloes in the north region of Brazil which will likely be very beneficial for the management and control programs of this disease.

Use of multiplex polymerase chain reaction-based assay to conduct epidemiological studies on bovine hemoparasites in Mexico.

Science.gov (United States)

Figueroa, J V; Alvarez, J A; Ramos, J A; Vega, C A; Buening, G M

1993-01-01

A study was conducted to test the applicability of a Polymerase Chain Reaction (PCR)-based approach for the simultaneous detection of the bovine hemoparasites Babesia bigemina, B. bovis and Anaplasma marginale. Bovine blood samples from cattle ranches of a previously determined enzootic zone in the Yucatan Peninsula of Mexico, were collected from peripheral blood and processed for PCR analysis. Blood samples were subjected to DNA amplification by placing an aliquot in a reaction tube containing oligonucleotide primers specific for DNA of each hemoparasite species. The PCR products were detected by Dot-Blot nucleic acid hybridization utilizing nonradioactive, species-specific, digoxigenin PCR-labeled DNA probes. Four hundred twenty one field samples analyzed by the multiplex PCR-DNA probe assay showed 66.7%, 60.1% and 59.6% prevalence rates for B. bigemina, B. bovis and A. marginale, respectively. The multiplex PCR analysis showed that animals with single, double or triple infection could be detected with the parasite specific DNA probes. The procedure is proposed as a valuable tool for the epidemiological analysis in regions where the hemoparasite species are concurrently infecting cattle.

The Prostaglandin E2-EP3 Receptor Axis Regulates Anaplasma phagocytophilum-Mediated NLRC4 Inflammasome Activation

Czech Academy of Sciences Publication Activity Database

Wang, X.; Shaw, D.K.; Hammond, H.L.; Sutterwala, F.S.; Rayamajhi, M.; Shirey, K.A.; Perkins, D.J.; Bonventre, J.V.; Velayutham, T.S.; Evans, S.M.; Rodino, K.G.; VieBrock, L.; Scanlon, K.M.; Carbonetti, N.H.; Carlyon, J.A.; Miao, E.A.; McBride, J.W.; Kotsyfakis, Michalis; Pedra, J. H. F.

2016-01-01

Roč. 12, č. 8 (2016), č. článku e1005803. E-ISSN 1553-7374 Institutional support: RVO:60077344 Keywords : Rickettsial agents * Anaplasma phagocytophilum * prostaglandin E2-EP3 Receptor Axis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.003, year: 2015

Ixodes scapularis Tick Cells Control Anaplasma phagocytophilum Infection by Increasing the Synthesis of Phosphoenolpyruvate from Tyrosine

Czech Academy of Sciences Publication Activity Database

Cabezas Cruz, Alejandro; Espinosa, P. J.; Obregon, D. A.; Alberdi, P.; de la Fuente, J.

2017-01-01

Roč. 7, AUG 17 (2017), č. článku 375. ISSN 2235-2988 Institutional support: RVO:60077344 Keywords : proteomics * transcriptomics * phosphoenolpyruvate * glycerol-3-phosphate * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.300, year: 2016

Molecular detection of Anaplasma platys infection in free-roaming dogs and ticks from Kenya and Ivory Coast

Czech Academy of Sciences Publication Activity Database

Matei, I.A.; D'Amico, G.; Yao, P.K.; Ionică, A.M.; Kanyari, P. W. N.; Daskalaki, A.A.; Dumitrache, M.O.; Sándor, A.D.; Gherman, C.M.; Qablan, M.; Modrý, David; Mihalca, A. D.

2016-01-01

Roč. 9, MAR 16 (2016), č. článku 157. ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Africa * Anaplasma platys * carnivores * Kenya * Ivory Coast Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.080, year: 2016

Anaplasmose bovina: parâmetros clínicos e de patologia clínica em bezerros infectados experimentalmente.: parâmetros clínicos e de patologia clínica em bezerros infectados experimentalmente.

OpenAIRE

Leonardo Costa Tavares Coelho

2007-01-01

Avaliou-se o comportamento dos parâmetros de patologia clínica em cinco bezerros HPB, com idade entre 90 e 120 dias, inoculados com Anaplasma marginale. O período médio de incubação foi de 13 dias, a duração do período patente, quando foram realizadas as análises, foi de 14 dias e o período convalescente durou 10 dias. Foram avaliadas as alterações no equilíbrio ácido-básico, perfil eletrolítico, parâmetros bioquímicos e hematológicos. Os animais apresentaram anemia, inicialmente normocítica ...

Infections and risk factors for livestock with species of Anaplasma, Babesia and Brucella under semi-nomadic rearing in Karamoja Region, Uganda.

Science.gov (United States)

Lolli, Chiara; Marenzoni, Maria Luisa; Strona, Paolo; Lappo, Pier Giorgio; Etiang, Patrick; Diverio, Silvana

2016-03-01

A survey was conducted to estimate the prevalence of Anaplasma, Babesia and Brucella spp. infections in cattle, goats and sheep in the Karamoja Region of Uganda and to identify possible risk factors existing in this semi-nomadic and pastoral area. Low cost laboratory tests were used to diagnose infections (Rose Bengal test for Brucella spp. antibodies and direct microscopic examination for Anaplasma and Babesia spp.). Multivariable logistic regression models were applied to identify possible risk factors linked to gender, animal species, age (only for cattle) and districts. A total of 3935 cattle, 729 goats and 306 sheep of five districts of the Karamoja Region were tested. Seroprevalence for Brucella was 9.2 % (CI, 95 %: 8.4-10), for Anaplasma 19.5 % (CI 95 %: 18.4-20.6) and for Babesia 16 % (CI 95 %: 15-17.1). Significant differences in infections prevalence were observed against risk factors associated with districts and species. Cattle were the species with higher risk of the infections. Female gender was identified as at risk only for Brucella spp. infection. Cattle more than one year old had greater likelihood to be Brucella seropositive. Co-infections of Anaplasma and Babesia spp. were statistically associated, especially in goats and sheep. Further studies to identify risk factors related to host species and geographical districts are needed. The influence on the semi-nomadic agro-pastoral system in Karamoja of animal raids and animal mixing should be further investigated. Findings were important to sensitize Karamojong undertaking measures on infection control, especially on cattle, which are their main source of food.

Detection and identification of Anaplasma phagocytophilum, Borrelia burgdorferi, and Rickettsia helvetica in Danish Ixodes ricinus ticks

DEFF Research Database (Denmark)

Skarphédinsson, Sigurdur; Lyholm, Birgitte Fjendbo; Ljungberg, Marianne

2007-01-01

% of adult ticks. The difference in prevalence between Anaplasma and Borrelia in adult ticks supports the idea that their maintenance cycles in nature may be different. Ticks were also infected with Rickettsia helvetica. Our study indicates that A. phagocytophilum prevalence in ticks in Denmark is as high...

Detection of Anaplasma sp. phylogenetically related to A. phagocytophilum in a free-living bird in Brazil

Directory of Open Access Journals (Sweden)

Anna Claudia Baumel Mongruel

2017-08-01

Full Text Available Abstract Wild animals play an important role in carrying vectors that may potentially transmit pathogens. Several reports highlighted the participation of wild animals on the Anaplasma phagocytophilum cycle, including as hosts of the agent. The aim of this study was to report the molecular detection of an agent phylogenetically related to A. phagocytophilum isolated from a wild bird in the Midwest of the state of Paraná, Brazil. Fifteen blood samples were collected from eleven different bird species in the Guarapuava region. One sample collected from a Penelope obscura bird was positive in nested PCR targeting the 16S rRNA gene of Anaplasma spp. The phylogenetic tree based on the Maximum Likelihood analysis showed that the sequence obtained was placed in the same clade with A. phagocytophilum isolated from domestic cats in Brazil. The present study reports the first molecular detection of a phylogenetically related A. phagocytophilum bacterium in a bird from Paraná State.

Prevalence of Anaplasma phagocytophilum infection and effect on lamb growth

Directory of Open Access Journals (Sweden)

Steinshamn Håvard

2011-05-01

Full Text Available Abstract Background A major challenge in sheep farming during the grazing season along the coast of south-western Norway is tick-borne fever (TBF caused by the bacteria Anaplasma phagocytophilum that is transmitted by the tick Ixodes ricinus. Methods A study was carried out in 2007 and 2008 to examine the prevalence of A. phagocytophilum infection and effect on weaning weight in lambs. The study included 1208 lambs from farms in Sunndal Ram Circle in Møre and Romsdal County in Mid-Norway, where ticks are frequently observed. All lambs were blood sampled and serum was analyzed by an indirect fluorescent antibody assay (IFA to determine an antibody status (positive or negative to A. phagocytophilum infection. Weight and weight gain and possible effect of infection were analyzed using ANOVA and the MIXED procedure in SAS. Results The overall prevalence of infection with A. phagocytophilum was 55%. A lower weaning weight of 3% (1.34 kg, p A. phagocytophilum infection compared to seronegative lambs at an average age of 137 days. Conclusions The results show that A. phagocytophilum infection has an effect on lamb weight gain. The study also support previous findings that A. phagocytophilum infection is widespread in areas where ticks are prevalent, even in flocks treated prophylactic with acaricides.

One particular Anaplasma phagocytophilum ecotype infects cattle in the Camargue, France.

Science.gov (United States)

Dugat, Thibaud; Leblond, Agnès; Keck, Nicolas; Lagrée, Anne-Claire; Desjardins, Isabelle; Joulié, Aurélien; Pradier, Sophie; Durand, Benoit; Boulouis, Henri-Jean; Haddad, Nadia

2017-08-02

Anaplasma phagocytophilum is a zoonotic tick-borne pathogen responsible for granulocytic anaplasmosis, a mild to a severe febrile disease that affects man and several animal species, including cows and horses. In Europe, I. ricinus is the only proven vector for this pathogen, but studies suggest that other tick genera and species could be involved in its transmission. Our objective was to assess the presence and genetic diversity of A. phagocytophilum in domestic animals and different tick species from the Camargue region, located in the south of France. A total of 140 ticks and blood samples from 998 cattle and 337 horses were collected in Camargue and tested for the presence of A. phagocytophilum DNA by msp2 quantitative real-time PCR. Molecular typing with four markers was performed on positive samples. Anaplasma phagocytophilum DNA was detected in 6/993 (0.6%) cows, 1/20 (5%) Haemaphysalis punctata, 1/57 (1.75%) Rhipicephalus pusillus, and was absent in horses (0%). All cattle A. phagocytophilum presented a profile identical to an A. phagocytophilum variant previously detected in Dermacentor marginatus, Hyalomma marginatum, and Rhipicephalus spp. in Camargue. Our results demonstrate that one particular A. phagocytophilum variant infects cattle in Camargue, where I. ricinus is supposed to be rare or even absent. Dermacentor marginatus, Rhipicephalus spp. and Hyalomma spp., and possibly other tick species could be involved in the transmission of this variant in this region.

Spatial distribution of Anaplasma phagocytophilum and Hepatozoon canis in red foxes (Vulpes vulpes) in Hungary.

Science.gov (United States)

Tolnai, Z; Sréter-Lancz, Z; Sréter, T

2015-07-01

In recent years, Ehrlichia canis and Hepatozoon canis transmitted by Rhipicephalus sanguineus were reported from Hungary. The aim of the present study was to reveal the spatial distribution pattern of pathogens transmitted by R. sanguineus in a sentinel species, red fox (Vulpes vulpes) in Hungary and to analyse the relationship of these patterns with landscape and climate by geographical information systems. Fox carcasses, representing 0.5% of the total fox population were randomly selected out of all the foxes of Hungary. The spleen samples of the animals were tested by real-time PCR for Anaplasma platys, Babesia vogeli, E. canis and H. canis infection. Positive results were confirmed by conventional PCR followed by sequencing. The prevalence of H. canis infection was 22.2% (95% CI=18.4-26.4%), and this parasite was detected in all areas including the mountain regions of Hungary. These findings indicate that other tick species or other transmission routes (oral and transplacental) might be in the background of the countrywide distribution of H. canis. Anaplasma platys was not found; nevertheless, the prevalence of Anaplasma phagocytophilum infection transmitted by Ixodes ricinus was 12.5% (95% CI=9.7-16.1%) in foxes. B. vogeli and E. canis infection was not detected. There was no correlation between environmental parameter values in the home range of foxes and A. phagocytophilum or H. canis infection, which is in line with that observed in the case of tick species infesting foxes in Hungary. The results of this study indicate that R. sanguineus, if present, might be rare in Hungary. Our baseline study can be used for future evaluation of the effect of climate change on the spreading and emergence of R. sanguineus transmitted pathogens in Hungary. Copyright © 2015 Elsevier GmbH. All rights reserved.

Molecular detection of Anaplasma bovis, Ehrlichia canis and Hepatozoon felis in cats from Luanda, Angola.

Science.gov (United States)

Oliveira, Ana Cristina; Luz, Maria Francisca; Granada, Sara; Vilhena, Hugo; Nachum-Biala, Yaarit; Lopes, Ana Patrícia; Cardoso, Luís; Baneth, Gad

2018-03-20

Molecular identification of tick-borne pathogen infection in cats from Africa is scarce. The presence of bacterial (Anaplasma and Ehrlichia) and protozoal (Babesia and Hepatozoon) agents was investigated in blood samples from 102 domestic cats from Luanda, Angola, by polymerase chain reaction and DNA sequencing. Three cats (2.9%) were found infected with Ehrlichia canis, three (2.9%) with Hepatozoon felis and one (1.0%) with Anaplasma bovis. The prevalence of infections with one single agent was 4.9%, and that of infection with two agents (i.e. E. canis and H. felis) was 1.0%. In total, six cats (5.9%) were found infected with at least one of the detected tick-borne agents. This is the first report of A. bovis, E. canis and H. felis in cats from Angola. To the best of our knowledge, A. bovis is also being reported for the first time in domestic cats outside of Japan. Cats are at a low to moderate risk of being infected with tick-borne agents in Luanda.

Molecular detection of Anaplasma phagocytophilum DNA in the lesser horseshoe bat (Rhinolophus hipposideros) guano.

Science.gov (United States)

Afonso, E; Goydadin, A-C

2018-05-30

Although bats are increasingly recognised as potential reservoir hosts of human zoonotic pathogens, bacteria in bats are still poorly studied. To investigate the DNA faecal prevalence of the bacterium Anaplasma phagocytophilum, we sampled 23 lesser horseshoe bat (Rhinolophus hipposideros) maternity colonies located in buildings (churches, barns) in rural villages of eastern France. A total of 552 faecal samples were collected from 278 individuals. Anaplasma phagocytophilum DNA was detected in the faeces of 63 individuals (22.7%). Such high prevalence might suggest persistent infection in bats and/or a frequent consumption of insect preys carrying bacteria. Faecal DNA prevalence varied highly among colonies but was not related to the colony size. Faecal DNA prevalence was the highest in the Jura Department, where the density of ticks is known to be the highest across the study area. Because the sampled bats live in close proximity to humans, we discuss how concerning the presence of A. phagocytophilum DNA in bat guano is for humans frequenting places of worship that shelter bats. We also advocate future research to understand what a high faecal DNA prevalence in bat guano really implicates in terms of bacteria transmission.

Detection of Anaplasma phagocytophilum DNA in Ixodes ticks (Acari: Ixodidae) from Madeira Island and Setubal District, mainland Portugal.

Science.gov (United States)

Santos, Ana Sofia; Santos-Silva, Maria Margarida; Almeida, Victor Carlos; Bacellar, Fátima; Dumler, John Stephen

2004-09-01

A total of 278 Ixodes ticks, collected from Madeira Island and Setubal District, mainland Portugal, were examined by polymerase chain reaction (PCR) for the presence of Anaplasma phagocytophilum. Six (4%) of 142 Ixodes ricinus nymphs collected in Madeira Island and 1 nymph and 1 male (2%) of 93 I. ventalloi collected in Setubal District tested positive for A. phagocytophilum msp2 genes or rrs. Infection was not detected among 43 I. ricinus on mainland Portugal. All PCR products were confirmed by nucleotide sequencing to be identical or to be most closely related to A. phagocytophilum. To our knowledge, this is the first evidence of A. phagocytophilum in ticks from Setubal District, mainland Portugal, and the first documentation of Anaplasma infection in I. ventalloi. Moreover, these findings confirm the persistence of A. phagocytophilum in Madeira Island's I. ricinus.

Prevalence of Anaplasma phagocytophilum infection in feral cats in Massachusetts.

Science.gov (United States)

Galemore, Erin R; Labato, Mary A; O'Neil, Elizabeth

2018-01-01

The primary objective of this study was to determine the prevalence of Anaplasma phagocytophilum infection and exposure in adult feral cats in Massachusetts, an endemic area for A phagocytophilum and its tick vector Ixodes scapularis . The secondary objective was to determine if there were correlations between A phagocytophilum infection and the presence of anemia and thrombocytopenia. Blood samples were collected between June and December 2015 from 175 apparently healthy adult feral cats that were presented to trap and release spay/neuter centers in Massachusetts. Complete blood count, blood smear evaluation, SNAP 4Dx Plus test (IDEXX) and A phagocytophilum PCR were performed on all samples to document acute infection (PCR-positive and/or inclusions observed on blood smear) and exposure to A phagocytophilum (SNAP 4Dx Plus-positive for A phagocytophilum antibodies). The prevalence of exposure to A phagocytophilum in feral cats in Massachusetts was 9.7%, whereas the prevalence of acute infection was 6.9%. All blood smears were negative for Anaplasma species inclusions; therefore, acute infection was defined as testing positive on PCR analysis. No statistically significant correlations were identified for cats that were positive for A phagocytophilum on PCR analysis or SNAP 4Dx Plus test and the presence of anemia or thrombocytopenia. The prevalence of A phagocytophilum exposure in feral cats approaches 10% and is higher than the previously reported national average prevalence of 4.3% in the USA. A phagocytophilum infection may be an emerging infectious disease in cats. Further research is needed to determine the prevalence of clinical illness associated with A phagocytophilum infection in cats living in endemic areas.

Detection of Anaplasma phagocytophilum DNA in Ixodes Ticks (Acari: Ixodidae) from Madeira Island and Setúbal District, Mainland Portugal

Science.gov (United States)

Santos-Silva, Maria Margarida; Almeida, Victor Carlos; Bacellar, Fátima; Dumler, John Stephen

2004-01-01

A total of 278 Ixodes ticks, collected from Madeira Island and Setúbal District, mainland Portugal, were examined by polymerase chain reaction (PCR) for the presence of Anaplasma phagocytophilum. Six (4%) of 142 Ixodes ricinus nymphs collected in Madeira Island and 1 nymph and 1 male (2%) of 93 I. ventalloi collected in Setúbal District tested positive for A. phagocytophilum msp2 genes or rrs. Infection was not detected among 43 I. ricinus on mainland Portugal. All PCR products were confirmed by nucleotide sequencing to be identical or to be most closely related to A. phagocytophilum. To our knowledge, this is the first evidence of A. phagocytophilum in ticks from Setúbal District, mainland Portugal, and the first documentation of Anaplasma infection in I. ventalloi. Moreover, these findings confirm the persistence of A. phagocytophilum in Madeira Island's I. ricinus. PMID:15498168

Coinfection of sheep with Anaplasma, Theileria and Babesia species in the Kurdistan Region, Iraq.

Science.gov (United States)

Renneker, S; Abdo, J; Bakheit, M A; Kullmann, B; Beyer, D; Ahmed, J; Seitzer, U

2013-11-01

Infections of small ruminants with Anaplasma, Theileria and Babesia species are widely distributed in the old world and are of great economic impact. In Iraq, data on disease occurrence in sheep caused by above-mentioned infectious agents are scarce. This study provides information on various haemoparasitic agents infecting sheep in the Kurdistan Region, Iraq, using molecular diagnostic tools. Altogether, 195 samples originating from three governorates in the Kurdistan Region, namely Duhok, Erbil and Sulaimaniya, were analysed. The following pathogens were identified: Anaplasma ovis (62.6%), Theileria ovis (14.35%), T. lestoquardi (7.7%), T. uilenbergi (5.6%) and Babesia ovis (1.5%). T. uilenbergi is detected for the first time in Iraq. Coinfection of sheep with different pathogens could be observed in this study, and it was found that 45 of 195 (23%) of the samples contained more than one pathogen. Even triple-positive samples were identified in 3% of the investigated animals. In conclusion, we confirm the coinfection of sheep with various haemoparasitic pathogen species in the Kurdistan Region of Iraq. Further investigations are needed to reveal the epidemiology of the diseases, the respective tick vectors, and, in the case of coinfection, pathogens' interaction and possible cross-protection. © 2013 Blackwell Verlag GmbH.

Anaplasma phagocytophilum MSP4 and HSP70 Proteins Are Involved in Interactions with Host Cells during Pathogen Infection

Czech Academy of Sciences Publication Activity Database

Contreras, M.; Alberdi, P.; Mateos-Hernández, L.; Fernández de Mera, I.G.; García-Pérez, A. L.; Vancová, Marie; Villar, M.; Ayllón, N.; Cabezas Cruz, Alejandro; Valdés, James J.; Stuen, S.; Gortazar, C.; de la Fuente, J.

2017-01-01

Roč. 7, JUL 5 (2017), č. článku 307. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : anaplasmosis * immunology * hl60 * tick * vaccine * sheep * Anaplasma phagocytophilum Subject RIV: EC - Immunology OBOR OECD: Immunology Impact factor: 4.300, year: 2016

Detection of Theileria annulata in blood samples of carrier cattle by PCR.

Science.gov (United States)

d'Oliveira, C; van der Weide, M; Habela, M A; Jacquiet, P; Jongejan, F

1995-01-01

We report the detection of Theileria annulata, the causative agent of tropical theileriosis, by PCR in blood samples obtained from carrier cattle. The assay employs primers specific for the gene encoding the 30-kDa major merozoite surface antigen of T. annulata. A 721-bp fragment was amplified from blood samples taken monthly from calves experimentally infected with one of four different stocks of T. annulata originating in either Mauritania, Portugal, Spain, or Turkey. At the end of the experiment, five animals carried the infection for 12 months and two animals remained infected for 15 months. DNAs from six other Theileria species, T. parva, T. mutans, T. sergenti, T. buffeli, T. velifera, and T. taurotragi, were not amplified. Moreover, DNAs from four other hemoparasites (Anaplasma centrale, Anaplasma marginale, Babesia bovis, and Babesia bigemina) were also not amplified. As a control, primers derived from the small subunit rRNA gene of Theileria spp. amplified a 1.1-kb DNA fragment from all Theileria species examined but not from the other four hemoparasites. As few as two to three parasites per microliter of infected blood in a 50-microliters sample volume were detected by Southern or microplate hybridization with a T. annulata-specific cDNA probe. In addition, 92 field samples obtained from cattle in Spain were tested; 22% were positive in blood smears, 40% were positive by immunofluorescent antibody test, and 75% were positive for T. annulata by PCR. The method provides a useful diagnostic tool for detecting T. annulata carrier cattle. PMID:8567902

Effectiveness of enrofloxacin for the treatment of experimentally-induced bovine anaplasmosis Eficácia da enrofloxacina no tratamento da anaplasmose bovina experimental

Directory of Open Access Journals (Sweden)

Elias Jorge Facury-Filho

2012-03-01

Full Text Available Four groups of six Holstein calves were inoculated with 3.6 × 10(7 erythrocytes parasitized with Anaplasma marginale. The criteria for treatment of calves were increasing A. marginale rickettsemia and 30% reduction of baseline packed cell volume (PCV of each animal. Group 1 (G1 received 7.5 mg.kg-1 of enrofloxacin in a single dose; Group 2 (G2 7.5 mg.kg-1 of enrofloxacin twice every three days; Group 3 (G3 20 mg.kg-1 of long-acting oxytetracycline in a single dose; and Group 4 (G4 a single dose of PBS. Physical examinations, blood smears and PCV were performed daily. On day treatment, G1, G2 and G3 animals had a mean rickettsemia of 17, 23 and 12%, respectively. At 2 days after treatment (DAT G1 and G2 animals showed a significant reduction of rickettsemia (p Quatro grupos de seis bezerros da raça Holandesa foram inoculados com 3,6 × 10(7 eritrócitos parasitados com Anaplasma marginale. Os critérios para o tratamento dos bezerros foram aumento da rickettsemia do A. marginale e redução de 30% do valor basal de volume globular (VG de cada animal. O Grupo 1 (G1 recebeu 7,5 mg.kg-1 de enrofloxacina em dose única; o Grupo 2 (G2, 7,5 mg.kg-1 de enrofloxacina duas vezes a cada três dias; o Grupo 3 (G3, 20 mg.kg-1 de oxitetraciclina de longa ação em dose única; e o Grupo 4 (G4 uma única dose de PBS. Exames físicos, esfregaço sanguíneo e VG foram realizadas diariamente. No dia do tratamento, os animais G1, G2 e G3 apresentaram rickettsemia média de 17, 23 e 12%, respectivamente. Nos primeiros 2 dias após o tratamento (DAT os animais do G1 e G2 mostraram uma redução significativa de rickettsemia (p < 0,05 em relação ao G3. Animais do G3 tiveram altas taxas de rickettsemia nos 2 DAT e uma diminuição lenta até à estabilização em 9 de DAT. O VG médio no G1 e G2 aumentou e estabilizou após 7 e 8 DAT, respectivamente. A estabilização do VG do G3 foi aos 13 DAT. A enrofloxacina e a oxitetraciclina foram efetivas no tratamento da

Molecular Detection of Anaplasma bovis in Cattle from Central Part of Iran

Directory of Open Access Journals (Sweden)

Vahid Noaman

2010-09-01

Full Text Available Anaplasma bovis is a leukocytotropic agent of bovine anaplasmosis and there is no available information about molecular study on this agent in cattle of Iran. In this study a total 150 cattle blood samples were collected from central part of Iran. The presence of A. bovis examined using light microscopic detection and species-specific nested polymerase chain reaction (nested-PCR based on 16S rRNA gene. Of the 150 cattle, 4 (2.66 % was positive for A. bovis by nested-PCR. These data is the first A. bovis DNA presence in cattle from central part of Iran.

Uveitis due to anaplasmosis in a newborn Holstein calf Uveíte por anaplasmose em bezerro da raça Holandesa

Directory of Open Access Journals (Sweden)

J.L. Laus

2006-12-01

Full Text Available Relata-se o caso de um bovino com, aproximadamente, seis horas de vida, apresentando histórico de febre, apatia, inapetência e desconforto ocular. No exame oftálmico rotineiro, encontraram-se valores do teste da lágrima de Schirmer aumentados, diminuição da pressão intra-ocular, hemorragia conjuntival, uveíte anterior, edema corneal e injeção ciliar em ambos os olhos. Coletou-se amostra de sangue para realização de esfregaço sangüíneo, hemograma e bioquímica sérica. No esfregaço visibilizaram-se corpúsculos de Anaplasma marginale em hemácias parasitadas. Quanto à bioquímica sérica, não foram observadas alterações. Os mesmos exames foram realizados na mãe do animal tendo como resultado a positividade para A. marginale. Para o controle da uveíte foi utilizada uma única aplicação de 0,5ml de betametasona a 5%, por via subconjuntival, em cada um dos olhos. Para o tratamento da anaplasmose, seguiu-se o protocolo a base de 10mg/kg de oxitetraciclina, por via intramuscular profunda, a cada 12 horas. Diante os achados oftálmicos e a presença de corpúsculos de A. marginale em hemácias parasitadas, contatou-se, ser um caso de uveíte crônica secundaria a doença sistêmica, factível com Anaplasmose.

Canine infection with Borrelia burgdorferi, Dirofilaria immitis, Anaplasma spp. and Ehrlichia spp. in Canada, 2013-2014.

Science.gov (United States)

Herrin, Brian H; Peregrine, Andrew S; Goring, Jonas; Beall, Melissa J; Little, Susan E

2017-05-19

Canine test results generated by veterinarians throughout Canada from 2013-2014 were evaluated to assess the geographical distribution of canine infection with Borrelia burgdorferi, Dirofilaria immitis, Ehrlichia spp., and Anaplasma spp. The percent positive test results of 115,636 SNAP® 4Dx® Plus tests from dogs tested were collated by province and municipality to determine the distribution of these vector-borne infections in Canada. A total of 2,844/115,636 (2.5%) dogs tested positive for antibody to B. burgdorferi. In contrast, positive test results for D. immitis antigen and antibodies to Ehrlichia spp. and Anaplasma spp. were low, with less than 0.5% of dogs testing positive for any one of these three agents nationwide. Provincial seroprevalence for antibodies to B. burgdorferi ranged from 0.5% (Saskatchewan)-15.7% (Nova Scotia); the areas of highest percent positive test results were in proximity to regions in the USA considered endemic for Lyme borreliosis, including Nova Scotia (15.7%) and Eastern Ontario (5.1%). These high endemic foci, which had significantly higher percent positive test results than the rest of the nation (P Canada. Using dogs as sentinels for these pathogens can aid in recognition of the public and veterinary health threat that each pose.

The prevalence of Anaplasma phagocytophilum in questing Ixodes ricinus ticks in SW Poland.

Science.gov (United States)

Kiewra, Dorota; Zaleśny, Grzegorz; Czułowska, Aleksandra

2014-01-01

Ticks constitute important vectors of human and animal pathogens. Besides the Lyme borreliosis and tick-borne encephalitis, other pathogens such as Babesia spp., Rickettsia spp., and Anaplasma phagocytophilum, are of increasing public health interest. In Poland, as in other European countries, Ixodes ricinus, the most prevalent tick species responsible for the majority of tick bites in humans, is the main vector of A. phagocytophilum. The aim of the study was to estimate the infection level of I. ricinus with A. phagocytophilum in selected districts, not previously surveyed for the presence of this agent. Sampling of questing ticks was performed in 12 forested sites, located in four districts (Legnica, Milicz, Lubań, and Oława) in SW Poland. Altogether, 792 ticks (151 females, 101 males, and 540 nymphs) representing I. ricinus were checked for the presence of A. phagocytophilum. The average infection level was 4.3%, with higher rate reported for adult ticks. The highest percentage of infected adults was observed in Milicz (17.4%) and the lowest in Oława (6.8%). The abundance of questing I. ricinus in all examined sites as well as the infection with A. phagocytophilum indicate for the first time the risk for HGA transmission in SW Poland.

Evaluation of an indirect ELISA for the diagnosis of Babesia bovis in Uruguay

International Nuclear Information System (INIS)

Cardozo, H.; Solari, M.A.; Etchebarne, J.

1992-01-01

In initially establishing the FAO/IAEA indirect ELISA for the detection of antibodies to Babesia bovis, the optical density (OD) values of sera from known positive or negative local cattle were compared to the OD values obtained from the negative and positive reference sera provided with the ELISA kit. The percentage of false positive and negative sera were 2.53% and 2.97% respectively. The cut-off values for the negative reference serum in the kit were compared with those of a local negative population. These values were found to be similar. The specificity of the test was evaluated by testing 30 sera from animals experimentally infected with Anaplasma marginale and 30 sera from animals infected with Babesia bigemina. These were no cross-reaction either between A. marginale and B. bovis or between B. bigemina and B. bovis. A serological survey using this ELISA kit was carried out on animals from an enzootic area and an area free from the vecot Boophilus microplus. 53 out of 282 animals (18.8%) in the enzootic area were positive whilst all the animals (113) from the free area were negative. This study would indicate that the FAO/IAEA ELISA kit has a sensitivity of around 98% and specificity of 97%. (author). 8 refs, 2 figs, 2 tabs

REDES COMUNITARIAS: UN DESAFÍO PARA ESCUELAS URBANO-MARGINALES

Directory of Open Access Journals (Sweden)

Mirta Giacobbe Tovani

2009-01-01

Full Text Available Las ideas básicas de este trabajo son conocer y comprender el entramado de la red de relaciones entre los distintos actores de las instituciones: escuela y organismos de la comunidad y su incidencia en la calidad educativa / calidad de vida. Analizamos la visión de los distintos actores educativos acerca de la inserción de la escuela en la comunidad. Tomamos como punto de partida el análisis de las relaciones entre calidad educativa y calidad de vida, en poblaciones urbano-marginales. Realizamos en primer lugar una investigación exploratoria, para conocer las características generales de escuelas que reciben población marginal. En una segunda etapa seleccionamos cuatro escuelas, que tomamos como casos e indagamos sus problemáticas. En ellas observamos gran dificultad para la construcción de redes comunitarias desde la institución escolar. Si bien responden a los problemas puntuales, mediante cambios o innovaciones planificados dinámica y flexiblemente, no existen soluciones duraderas debido a la falta de una convocatoria que comprometa a todas las instituciones de la comunidad constituyendo una efectiva relación en red. Estos resultados alcanzados en la investigación son producto de la triangulación de los datos estadísticos, documentales e históricos así como de los procedentes de la observación participante y de la información de las entrevistas en profundidad.

DETECTION OF ANTIBODIES TO ANAPLASMA, BARTONELLA AND COXIELLA IN RURAL INHABITANTS OF THE CARIBBEAN AREA OF COLOMBIA

Directory of Open Access Journals (Sweden)

Salim Máttar

2006-12-01

Full Text Available Objetivo. Establecer la seroprevalencia de Bartonella spp, Anaplasma phagocytophilum (antesErlichia y Coexiella burnetii. Materiales y métodos. Se analizaron sueros representativos de unsector de la población en el año 2003, recolectados de personas que trabajan en actividades delcampo en los departamentos de Córdoba y Sucre que sirvieron como población base de las muestrasque se obtuvieron. Los trabajadores rurales elegidos a participar tenían entra 16 – 65 años deedad. Los sueros fueron examinados por IFA para detección de anticuerpos contra IgG para Bartonellaspp, Erlichia Anaplasma phagocytophilum y Coexiella burnetii. Resultados. La seroprevalencia deanticuerpos de todos los microorganismos estudiados fue de 56.8%. De 81 muestras de sueroanalizadas el 26.6% fueron seropositivas contra C. burnetii, el 37.7% tuvieron anticuerpos contraBartonella y el 20% de los individuos evaluados fueron seropositivos para Anaplasmaphagocytophilum. Conclusiones. Nuestros datos indican que la prevalencia de anticuerpos contraBartonella, A. phagocytophilum y C. burnetii son altos en nuestra región. Los resultados indicanque estas enfermedades zoonoticas son muy comunes en las personas que residen en el área delcaribe colombiano. Este estudio demuestra por primera vez la presencia de estos microorganismosen Colombia.

Citrate synthase gene sequence: a new tool for phylogenetic analysis and identification of Ehrlichia.

Science.gov (United States)

Inokuma, H; Brouqui, P; Drancourt, M; Raoult, D

2001-09-01

The sequence of the citrate synthase gene (gltA) of 13 ehrlichial species (Ehrlichia chaffeensis, Ehrlichia canis, Ehrlichia muris, an Ehrlichia species recently detected from Ixodes ovatus, Cowdria ruminantium, Ehrlichia phagocytophila, Ehrlichia equi, the human granulocytic ehrlichiosis [HGE] agent, Anaplasma marginale, Anaplasma centrale, Ehrlichia sennetsu, Ehrlichia risticii, and Neorickettsia helminthoeca) have been determined by degenerate PCR and the Genome Walker method. The ehrlichial gltA genes are 1,197 bp (E. sennetsu and E. risticii) to 1,254 bp (A. marginale and A. centrale) long, and GC contents of the gene vary from 30.5% (Ehrlichia sp. detected from I. ovatus) to 51.0% (A. centrale). The percent identities of the gltA nucleotide sequences among ehrlichial species were 49.7% (E. risticii versus A. centrale) to 99.8% (HGE agent versus E. equi). The percent identities of deduced amino acid sequences were 44.4% (E. sennetsu versus E. muris) to 99.5% (HGE agent versus E. equi), whereas the homology range of 16S rRNA genes was 83.5% (E. risticii versus the Ehrlichia sp. detected from I. ovatus) to 99.9% (HGE agent, E. equi, and E. phagocytophila). The architecture of the phylogenetic trees constructed by gltA nucleotide sequences or amino acid sequences was similar to that derived from the 16S rRNA gene sequences but showed more-significant bootstrap values. Based upon the alignment analysis of the ehrlichial gltA sequences, two sets of primers were designed to amplify tick-borne Ehrlichia and Neorickettsia genogroup Ehrlichia (N. helminthoeca, E. sennetsu, and E. risticii), respectively. Tick-borne Ehrlichia species were specifically identified by restriction fragment length polymorphism (RFLP) patterns of AcsI and XhoI with the exception of E. muris and the very closely related ehrlichia derived from I. ovatus for which sequence analysis of the PCR product is needed. Similarly, Neorickettsia genogroup Ehrlichia species were specifically identified by

Molecular characterization and specific detection of Anaplasma species (AP-sd) in sika deer and its first detection in wild brown bears and rodents in Hokkaido, Japan.

Science.gov (United States)

Moustafa, Mohamed Abdallah Mohamed; Lee, Kyunglee; Taylor, Kyle; Nakao, Ryo; Sashika, Mariko; Shimozuru, Michito; Tsubota, Toshio

2015-12-01

A previously undescribed Anaplasma species (herein referred to as AP-sd) has been detected in sika deer, cattle and ticks in Japan. Despite being highly similar to some strains of A. phagocytophilum, AP-sd has never been detected in humans. Its ambiguous epidemiology and the lack of tools for its specific detection make it difficult to understand and interpret the prevalence of this Anaplasma species. We developed a method for specific detection, and examined AP-sd prevalence in Hokkaido wildlife. Our study included 250 sika deer (Cervus nippon yesoensis), 13 brown bears (Ursus arctos yesoensis) and 252 rodents including 138 (Apodemus speciosus), 45 (Apodemus argenteus), 42 (Myodes rufocanus) and 27 (Myodes rutilus) were collected from Hokkaido island, northern Japan, collected during 2010 to 2015. A 770 bp and 382 bp segment of the 16S rRNA and gltA genes, respectively, were amplified by nested PCR. Results were confirmed by cloning and sequencing of the positive PCR products. A reverse line blot hybridization (RLB) based on the 16S rRNA gene was then developed for the specific detection of AP-sd. The prevalence of AP-sd by nested PCR in sika deer was 51% (128/250). We detected this Anaplasma sp. for the first time in wild brown bears and rodents with a prevalence of 15% (2/13) and 2.4% (6/252), respectively. The sequencing results of the 16S rRNA and gltA gene amplicons were divergent from the selected A. phagocytophilum sequences in GenBank. Using a newly designed AP-sd specific probe for RLB has enabled us to specifically detect this Anaplasma species. Besides sika deer and cattle, wild brown bears and rodents were identified as potential reservoir hosts for AP-sd. This study provided a high throughput molecular method that specifically detects AP-sd, and which can be used to investigate its ecology and its potential as a threat to humans in Japan. Copyright © 2015 Elsevier B.V. All rights reserved.

Anaplasma phagocytophilum in Danish sheep: confirmation by DNA sequencing

Directory of Open Access Journals (Sweden)

Thamsborg Stig M

2009-12-01

Full Text Available Abstract Background The presence of Anaplasma phagocytophilum, an Ixodes ricinus transmitted bacterium, was investigated in two flocks of Danish grazing lambs. Direct PCR detection was performed on DNA extracted from blood and serum with subsequent confirmation by DNA sequencing. Methods 31 samples obtained from clinically normal lambs in 2000 from Fussingø, Jutland and 12 samples from ten lambs and two ewes from a clinical outbreak at Feddet, Zealand in 2006 were included in the study. Some of the animals from Feddet had shown clinical signs of polyarthritis and general unthriftiness prior to sampling. DNA extraction was optimized from blood and serum and detection achieved by a 16S rRNA targeted PCR with verification of the product by DNA sequencing. Results Five DNA extracts were found positive by PCR, including two samples from 2000 and three from 2006. For both series of samples the product was verified as A. phagocytophilum by DNA sequencing. Conclusions A. phagocytophilum was detected by molecular methods for the first time in Danish grazing lambs during the two seasons investigated (2000 and 2006.

Test of the sheep ked Melophagus ovinus (L) as a vector of Anaplasma ovis Lestoquard.

Science.gov (United States)

Zaugg, J L; Coan, M E

1986-05-01

The sheep ked Melophagus ovinus was evaluated as a possible vector of Anaplasma ovis. In 4 tests, 45 to 293 keds were transferred from sheep with acute anaplasmosis, low level parasitemia, or carrier state of anaplasmosis to individual splenectomized ewes. Keds were confined in stockinette cages attached to the dorsal midline of the recipient hosts for 10 days. Throughout the 90-day observation periods after the keds were transferred, no clinical, serologic, or hematologic evidence of anaplasmosis was detected in any of the ked-recipient ewes. Results indicate that sheep keds probably are not mechanical or biological vectors of the ovine anaplasmosis organism.

Ehrlichia canis and Anaplasma platys in ticks of dogs in Cuiaba, Mato GrossoEhrlichia canis e Anaplasma platys em carrapatos de cães de Cuiabá, Mato Grosso

Directory of Open Access Journals (Sweden)

Valéria Dutra

2012-06-01

Full Text Available Diseases transmitted by arthropods such as Rhipicephalus sanguineus, are caused by a spectrum of pathogens. Among these are the canine monocytic ehrlichiosis and cyclical thrombocytopenia with a cosmopolitan distribution. Aiming to verify the presence of DNA of Anaplasma platys and Ehrlichia canis in ticks R. sanguineus collected in the period 2008 to 2009 of 380 infected dogs. Ticks, after maceration, were subjected to DNA extraction and then nested PCR was performed for amplification of A. platys and E. canis. Of these, 81 (29.7% amplified DNA from ehrlichiais agents, where 38 (17.9% amplified in E. canis and 32 (15.7% for A. platys. The observation of two pathogens, combined with worldwide distribution of the tick R. sanguineus, demonstrates the high risk of infection with these pathogens in dogs in the city of Cuiaba. Doenças transmitidas por artrópodes, como o Rhipicephalus sanguineus, são causadas por um espectro de patógenos. Dentre estas, estão a erliquiose monocítica canina e trombocitopenia cíclica com distribuição cosmopolita. Com o objetivo de verificar a presença de DNA de Anaplasma platys e Ehrlichia canis em carrapatos R. sanguineus coletados no período de 2008 a 2009 de 380 cães infestados. Os carrapatos, após a maceração, foram submetidos a extração de DNA e, em seguida, foi realizada a Nested PCR para a amplificação da espécie A. platys e E. canis. Destes, 81 (29.7% amplificaram o DNA dos agentes ehrlichiais, onde 38 (17.9% amplificaram para E. canis e 32 (15.7% para A. platys. A observação dos dois patógenos, combinado com distribuição mundial do carrapato R. sanguineus, demonstra o elevado risco de infecção por esses patógenos de cães na cidade de Cuiabá.

Influence des paramètres d'un laser ER: YAG sur l'adaptation marginale d'une restauration à faible contraction

OpenAIRE

Peeters, Frédéric

2013-01-01

Quarante molaires ont été réparties en cinq groupes. C'est avec un laser de type Er:YAG que des cavités occlusales ont été faites sur les dents des quatre premiers groupes et cela avec certains paramètres définis et spécifiques à chacun. Les dents du dernier groupe quant à elles, ont subi un traitement conventionnel de fraisage. L’obturation des cavités a été faite avec le même matériau, une résine composite à faible taux de contraction. L'adaptation marginale de chaque dent a ensuite été com...

Anaplasma phagocytophilum in ticks in Slovenia

Directory of Open Access Journals (Sweden)

Knap Nataša

2010-11-01

Full Text Available Abstract Ticks act as vectors of many pathogens of domestic animals and humans. Anaplasma phagocytophilum in Europe is transmitted by the ixodid tick vector Ixodes ricinus. A. phagocytophilum causes a disease with diverse clinical signs in various hosts. A great genetic diversity of the groESL operon of A. phagocytophilum has been found in ticks elsewhere. In Slovenia, the variety of the groESL operon was conducted only on deer samples. In this study, the prevalence of infected ticks was estimated and the diversity of A. phagocytophilum was evaluated. On 8 locations in Slovenia, 1924 and 5049 (6973 I. ricinus ticks were collected from vegetation in the years 2005 and 2006, respectively. All three feeding stages of the tick's life cycle were examined. The prevalence of ticks infected with A. phagocytophilum in the year 2005 and in the year 2006 was 0.31% and 0.63%, respectively, and it did not differ considerably between locations. The similarity among the sequences of groESL ranged from 95.6% to 99.8%. They clustered in two genetic lineages along with A. phagocytophilum from Slovenian deer. One sequence formed a separate cluster. According to our study, the prevalence of A. phagocytophilum in ticks is comparable to the findings in other studies in Europe, and it does not vary considerably between locations and tick stages. According to groESL operon analysis, two genetic lineages have been confirmed and one proposed. Further studies on other genes would be useful to obtain more information on genetic diversity of A. phagocytophilum in ticks in Slovenia.

Deficiencia de Vitamina A y Estado Nutricional Antropométrico en niños MarginalesUrbanos y Rurales en el Estado Zulia, Venezuela

OpenAIRE

Amaya-Castellanos, Daisy; Viloria-Castejón, Haydée; Ortega, Pablo; Gómez, Gisela; Urrieta, Jesús R; Lobo, Pablo; Estévez, Jesús

2002-01-01

El presente estudio transversal fue realizado para estimar la prevalencia de deficiencia de vitamina A (DVA) y desnutrición proteico-energética en una población infantil (24 a 85 meses) de tres barrios marginales urbanos de Maracaibo Estado Zulia, Venezuela (n=173) y de una zona rural (n=34), vecina a Maracaibo, por medio del análisis del retinol sérico y mediciones antropométricas, aplicando puntuación Z a los indicadores Talla//Edad (ZT//E); Peso//Edad (ZP//E) y Peso//Talla (ZP//T), compara...

Anaplasma phagocytophilum increases the levels of histone modifying enzymes to inhibit cell apoptosis and facilitate pathogen infection in the tick vector Ixodes scapularis

Czech Academy of Sciences Publication Activity Database

Cabezas-Cruz, A.; Alberdi, P.; Ayllón, N.; Valdés, James J.; Pierce, R.; Villar, M.; de la Fuente, J.

2016-01-01

Roč. 11, č. 4 (2016), s. 303-319 ISSN 1559-2294 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : Anaplasma * epigenetic s * histone modifying enzyme * histone * pathogen * tick Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.394, year: 2016

Babesia canis vogeli, Ehrlichia canis, and Anaplasma platys infection in a dog.

Science.gov (United States)

Al Izzi, Salah; Martin, Donald S; Chan, Roxanne Y Y; Leutenegger, Christian M

2013-12-01

A 12-month-old male neutered mixed breed dog was presented with a history of diarrhea, lethargy, emaciation, polydypsia, and sniffling. Physical examination findings included pale mucous membranes, increased heart and respiratory rates, and normal rectal temperature (38°C). Hematologic abnormalities included anemia and thrombocytopenia. Biochemical abnormalities included hypoalbuminemia, hyperbilirubinemia, and elevated ALP and ALT activities. A SNAP 4Dx test result was positive for Ehrlichia canis. Babesia canis vogeli organisms were found in the peripheral blood films, while morulae of E canis were not seen. Real-time polymerase chain reaction testing confirmed the presence of both B c vogeli and E canis organisms, and also was positive for Anaplasma platys infection. The dog recovered following treatment with doxycycline and imidocarb dipropionate, with normal hematology and biochemical profiles. © 2013 American Society for Veterinary Clinical Pathology.

Human Exposure to Anaplasma phagocytophilum in Two Cities of Northwestern Morocco

Science.gov (United States)

Elhamiani Khatat, Sarah; Sahibi, Hamid; Hing, Mony; Alaoui Moustain, Ismail; El Amri, Hamid; Benajiba, Mohammed; Kachani, Malika; Duchateau, Luc; Daminet, Sylvie

2016-01-01

Anaplasma phagocytophilum is an emerging tick-borne zoonosis with extensive increased interest. Epidemiological data are available in several regions of the USA, Europe and Asia in contrast to other parts of the world such as North Africa. Blood samples of 261 healthy individuals divided in two groups i.e., dog handlers and blood donors were analysed. Indirect immunofluorescent assay using a commercial kit was performed to detect specific A. phagocytophilum IgG. Two dilutions were used to assess the prevalence of seroreactive samples. Demographic variables were assessed as potential risk factors using exact logistic regression. Seropositivity rates reached 37% and 27% in dog handlers and 36% and 22% in blood donors. No statistically significant differences were found in the prevalence rates between the two groups. Analysis of risk factors such as gender, age groups, outdoor activities, self-reported previous exposure to ticks, or contact with domestic animals (dogs, cats, ruminants and horses) did not shown any significant difference. A. phagocytophilum exposure was common in both high-risk population and blood donors in Morocco. PMID:27532208

Remodeling of tick cytoskeleton in response to infection with Anaplasma phagocytophilum.

Science.gov (United States)

Cabezas-Cruz, Alejandro; Alberdi, Pilar; Valdes, James J; Villar, Margarita; de la Fuente, Jose

2017-06-01

The obligate intracellular pathogen Anaplasma phagocytophilum infects vertebrate and tick hosts. In this study, a genome-wide search for cytoskeleton components was performed in the tick vector, Ixodes scapularis . The available transcriptomics and proteomics data was then used to characterize the mRNA and protein levels of I. scapularis cytoskeleton components in response to A. phagocytophilum infection. The results showed that cytoskeleton components described in other model organisms were present in the I. scapularis genome. One type of intermediate filaments (lamin), a family of septins that was recently implicated in the cellular response to intracellular pathogens, and several members of motor proteins (kinesins and dyneins) that could be implicated in the cytoplasmic movements of A. phagocytophilum were found. The results showed that levels of tubulin, actin, septin, actin-related proteins and motor proteins were affected by A. phagocytophilum , probably to facilitate infection in I. scapularis . Functional studies demonstrated a role for selected cytoskeleton components in pathogen infection. These results provided a more comprehensive view of the cytoskeletal components involved in the response to A. phagocytophilum infection in ticks.

OCORRÊNCIA DE Anaplasma bovis (Donatien & Lestoquard, 1936, Dumler et al. 2001 NA REGIÃO DE BOM JESUS DO ITABAPOANA, RJ

Directory of Open Access Journals (Sweden)

Orlando Augusto Melo Junior

2010-12-01

Full Text Available In the present study, 400 capillary blood smears collected from the ear and the tail of 200 bovines were microscopically examinedfor the presence of hemoparasites. The diagnosis was based on the direct research, semonstrating the etiologic agent inclusions. Eleven bovines (5.5% were considered infected by Anaplasma bovis, confirming the presence of this hemoparasite in the city of Bom Jesus do Itabapoana, the first city of the northwesten region of the state of Rio de Janeiro to register such occurrence.

Intrauterine Transmission of Anaplasma phagocytophilum in Persistently Infected Lambs

Directory of Open Access Journals (Sweden)

Snorre Stuen

2018-02-01

Full Text Available Anaplasma phagocytophilum, which causes the disease tick-borne fever (TBF, is the most important tick-borne pathogen in European animals. TBF may contribute to severe welfare challenges and economic losses in the Norwegian sheep industry. The bacterium causes a persistent infection in sheep and several other animal species. The objective of this study was to investigate whether intrauterine transmission occurs in persistently infected sheep. The study included thirteen 5–6-month-old unmated ewes, of which twelve were experimentally infected with A. phagocytophilum (GenBank acc. no. M73220. Four to six weeks later, all ewes were mated, and nine became pregnant. Blood samples were collected from these ewes and their offspring. If the lamb died, tissue samples were collected. The samples were analyzed with real-time PCR (qPCR targeting the msp2 gene. PCR-positive samples were further analyzed by semi-nested PCR and 16S rDNA sequencing. A total of 20 lambs were born, of which six died within two days. Six newborn lambs (30% were PCR-positive (qPCR, of which one was verified by 16S rDNA sequencing. The present study indicates that intrauterine transmission of A. phagocytophilum in persistently infected sheep may occur. The importance of these findings for the epidemiology of A. phagocytophilum needs to be further investigated.

Estimates of repeatability and correlations of hemoparasites infection levels for cattle reared in endemic areas for Rhipicephalus microplus.

Science.gov (United States)

Giglioti, Rodrigo; de Oliveira, Henrique Nunes; Bilhassi, Talita Barban; Portilho, Amanda Izeli; Okino, Cintia Hiromi; Marcondes, Cintia Righetti; de Sena Oliveira, Marcia Cristina

2018-01-30

Rhipicephalus microplus is a vector of cattle tick fever, a disease caused by the protozoans Babesia bovisand B. bigemina, and also anaplasmosis, produced by the Rickettsiales Anaplasma marginale. These tick-borne pathogens cause considerable losses to Brazilian livestock breeders and represent an obstacle to the expanded use of taurine breeds due to their higher sensitivity to ticks and hemoparasites compared to zebu breeds. Differences in the susceptibility to hemoparasites were also verified within breeds, suggesting that may be possible to select a most resistant phenotype. Therefore, repeatability of R. microplus counts and copy number of hemoparasites DNA were estimated, along with correlations between themselves, aiming to verify if those measures can be used as parameters to classify animals according to their parasite resistance degrees. Forty-two Canchim females kept on pastures naturally infested by ticks were evaluated for the level of infestation by R. microplus and infection by B. bovis, B. bigemina, and A. marginale. Twenty-four evaluations were performed once a month, for adult female ticks counts and blood samplings. The experimental period was divided into four phases, according to the animals age range: Phase 1: 8 to 13 months (collections 1 to 6); phase 2: 14 to 19 months (collections 7 to 12); phase 3: 20 to 25 months (collections 13 to 18), and phase 4: 26 to 31 months (collections 19 to 24). Blood samples were submitted to absolute quantification of hemoparasites DNA sequences using qPCR. The hemoparasite and tick counts data were transformed for normalization and were analyzed using mixed models. Among three species of hemoparasites studied, A. marginale presented the highest level of infection. During phase 3, B. bigemina presented higher infection levels (p hemoparasites and ticks. Moreover, the animal age may be an important factor related to resistance against these pathogens. The data obtained shed more light on the resistance to

Mixed Ehrlichia canis, Hepatozoon canis, and presumptive Anaplasma phagocytophilum infection in a dog.

Science.gov (United States)

Mylonakis, Mathio E; Koutinas, Alex F; Baneth, Gad; Polizopoulou, Zoe; Fytianou, Anna

2004-01-01

A 5-month-old, female, mongrel dog was admitted to the Clinic of Companion Animal Medicine, Aristotle University of Thessaloniki, Greece, with depression, anorexia, fever, peripheral lymphadenopathy, splenomegaly, oculonasal discharge, nonregenerative anemia, and mild thrombocytopenia. Cytology of Giemsa-stained buffy coat, bone marrow, and lymph node aspiration smears revealed numerous morulae in mononuclear leukocytes and in neutrophils, and Hepatozoon canis gamonts in neutrophils. The dog was seropositive to Ehrlichia canis (immunofluorescence assay [IFA]) and Hepatozoon canis (ELISA) but not to Anaplasma phagocytophilum (IFA). A nested polymerase chain reaction performed on bone marrow aspirates was positive for E canis. This method was not applied for the detection of A phagocytophilum. Treatment with doxycycline and imidocarb dipropionate resulted in both clinical and parasitologic cure. This is the first reported case of a mixed infection with E canis, H canis, and presumptive A phagocytophilum. The findings emphasize the value of cytology in offering a quick and inexpensive diagnosis in mixed tick-borne infections of dogs.

Anaplasma phagocytophilum, Bartonella spp., haemoplasma species and Hepatozoon spp. in ticks infesting cats: a large-scale survey.

Science.gov (United States)

Duplan, Florent; Davies, Saran; Filler, Serina; Abdullah, Swaid; Keyte, Sophie; Newbury, Hannah; Helps, Chris R; Wall, Richard; Tasker, Séverine

2018-03-20

Ticks derived from cats have rarely been evaluated for the presence of pathogens. The aim of this study was to determine the prevalence of Anaplasma phagocytophilum, Bartonella spp., haemoplasma species and Hepatozoon spp. in ticks collected from cats in the UK. Five hundred and forty DNA samples extracted from 540 ticks collected from cats presenting to veterinarians in UK practices were used. Samples underwent a conventional generic PCR assay for detection of Hepatozoon spp. and real-time quantitative PCR assays for detection of Anaplasma phagocytophilum and three feline haemoplasma species and a generic qPCR for detection of Bartonella spp. Feline 28S rDNA served as an endogenous internal PCR control and was assessed within the haemoplasma qPCR assays. Samples positive on the conventional and quantitative generic PCRs were submitted for DNA sequencing for species identification. Feline 28S rDNA was amplified from 475 of the 540 (88.0%) ticks. No evidence of PCR inhibition was found using an internal amplification control. Of 540 ticks, 19 (3.5%) contained DNA from one of the tick-borne pathogens evaluated. Pathogens detected were: A. phagocytophilum (n = 5; 0.9%), Bartonella spp. (n = 7; 1.3%) [including Bartonella henselae (n = 3; 0.6%) and Bartonella clarridgeiae (n = 1; 0.2%)], haemoplasma species (n = 5; 0.9%), "Candidatus Mycoplasma haemominutum" (n = 3; 0.6%), Mycoplasma haemofelis (n = 1; 0.2%), "Candidatus Mycoplasma turicensis" (n = 1; 0.2%), Hepatozoon spp. (n = 2; 0.4%), Hepatozoon felis (n = 1; 0.2%) and Hepatozoon silvestris (n = 1; 0.2%). These data provide important information on the prevalence of tick-borne pathogens in ticks infesting cats, with the identification of haemoplasma species, A. phagocytophilum, H. felis and Bartonella spp. (including B. henselae and B. clarridgeiae). This study also documents the first report of H. silvestris in ticks collected from domestic cats.

Detection of Borrelia lusitaniae, Rickettsia sp. IRS3, Rickettsia monacensis, and Anaplasma phagocytophilum in Ixodes ricinus collected in Madeira Island, Portugal.

Science.gov (United States)

de Carvalho, Isabel Lopes; Milhano, Natacha; Santos, Ana Sofia; Almeida, Victor; Barros, Silvia C; De Sousa, Rita; Núncio, Maria Sofia

2008-08-01

A total of 300 Ixodes ricinus ticks were tested by polymerase chain reaction (PCR) for the presence of Borrelia spp., Rickettsia spp., and Anaplasma phagocytophilum. Sequence analysis demonstrated 8 (2.7%) ticks infected with B. lusitaniae, 60 (20%) with Rickettsia spp., and 1 (0.3%) with A. phagocytophilum. Seven (2.3%) ticks were coinfected with B. lusitaniae and Rickettsia spp., 2 (0.6%) with R. monacensis, and 5 (1.7%) with Rickettsia sp. IRS3. The results of this study suggest simultaneous transmission of multiple tick-borne agents on Madeira Island, Portugal.

Prevalencia de caries de infancia temprana en niños menores de 6 años de edad, residentes en poblados urbano marginales de Lima Norte

OpenAIRE

Villena Sarmiento, Rita; Pachas Barrionuevo, Flor; Sánchez Huamán, Yhedina; Carrasco Loyola, Milagros

2014-01-01

La prevalencia de caries de infancia temprana es un problema de salud pública prevenible y que afecta a un gran número de niños. El propósito de este trabajo fue determinar la prevalencia yseveridad de la caries dental en niños de 6-71 meses de edad de comunidades urbano marginales de Lima. Se evaluaron a 332 niños con los criterios de caries dental de la OMS, con equipo noinvasivo, bajo luz natural, y con técnica de rodilla-rodilla para los más pequeños. Fueron calibrados 3 odontólogos en el...

The Prostaglandin E2-EP3 Receptor Axis Regulates Anaplasma phagocytophilum-Mediated NLRC4 Inflammasome Activation.

Directory of Open Access Journals (Sweden)

Xiaowei Wang

2016-08-01

Full Text Available Rickettsial agents are sensed by pattern recognition receptors but lack pathogen-associated molecular patterns commonly observed in facultative intracellular bacteria. Due to these molecular features, the order Rickettsiales can be used to uncover broader principles of bacterial immunity. Here, we used the bacterium Anaplasma phagocytophilum, the agent of human granulocytic anaplasmosis, to reveal a novel microbial surveillance system. Mechanistically, we discovered that upon A. phagocytophilum infection, cytosolic phospholipase A2 cleaves arachidonic acid from phospholipids, which is converted to the eicosanoid prostaglandin E2 (PGE2 via cyclooxygenase 2 (COX2 and the membrane associated prostaglandin E synthase-1 (mPGES-1. PGE2-EP3 receptor signaling leads to activation of the NLRC4 inflammasome and secretion of interleukin (IL-1β and IL-18. Importantly, the receptor-interacting serine/threonine-protein kinase 2 (RIPK2 was identified as a major regulator of the immune response against A. phagocytophilum. Accordingly, mice lacking COX2 were more susceptible to A. phagocytophilum, had a defect in IL-18 secretion and exhibited splenomegaly and damage to the splenic architecture. Remarkably, Salmonella-induced NLRC4 inflammasome activation was not affected by either chemical inhibition or genetic ablation of genes associated with PGE2 biosynthesis and signaling. This divergence in immune circuitry was due to reduced levels of the PGE2-EP3 receptor during Salmonella infection when compared to A. phagocytophilum. Collectively, we reveal the existence of a functionally distinct NLRC4 inflammasome illustrated by the rickettsial agent A. phagocytophilum.

Anaplasma phagocytophilum MSP4 and HSP70 Proteins Are Involved in Interactions with Host Cells during Pathogen Infection

Directory of Open Access Journals (Sweden)

Marinela Contreras

2017-07-01

Full Text Available Anaplasma phagocytophilum transmembrane and surface proteins play a role during infection and multiplication in host neutrophils and tick vector cells. Recently, A. phagocytophilum Major surface protein 4 (MSP4 and Heat shock protein 70 (HSP70 were shown to be localized on the bacterial membrane, with a possible role during pathogen infection in ticks. In this study, we hypothesized that A. phagocytophilum MSP4 and HSP70 have similar functions in tick-pathogen and host-pathogen interactions. To address this hypothesis, herein we characterized the role of these bacterial proteins in interaction and infection of vertebrate host cells. The results showed that A. phagocytophilum MSP4 and HSP70 are involved in host-pathogen interactions, with a role for HSP70 during pathogen infection. The analysis of the potential protective capacity of MSP4 and MSP4-HSP70 antigens in immunized sheep showed that MSP4-HSP70 was only partially protective against pathogen infection. This limited protection may be associated with several factors, including the recognition of non-protective epitopes by IgG in immunized lambs. Nevertheless, these antigens may be combined with other candidate protective antigens for the development of vaccines for the control of human and animal granulocytic anaplasmosis. Focusing on the characterization of host protective immune mechanisms and protein-protein interactions at the host-pathogen interface may lead to the discovery and design of new effective protective antigens.

Longitudinal field study on bovine Babesia spp. and Anaplasma phagocytophilum infections during a grazing season in Belgium.

Science.gov (United States)

Lempereur, Laetitia; Lebrun, Maude; Cuvelier, Pascale; Sépult, Géraldine; Caron, Yannick; Saegerman, Claude; Shiels, Brian; Losson, Bertrand

2012-04-01

Anaplasmosis and babesiosis are major tick-borne diseases with a high economic impact but are also a public health concern. Blood samples collected in the spring, summer, and autumn of 2010 from 65 cows in seven different farms in Belgium were monitored with an indirect immunofluorescence antibody test to assess seroprevalence against these pathogens. Seroprevalences to Babesia spp. were measured as 10.7%, 20%, and 12.3% in spring, summer, and autumn, respectively, whereas seroprevalences to Anaplasma phagocytophilum were 30.8%, 77%, and 56.9%, respectively. A total of 805 Ixodes ricinus ticks were collected at the same time from both cattle (feeding ticks) and grazed pastures (questing ticks). The infection level of ticks, assessed by PCR assay, for Babesia spp. DNA was 14.6% and 7.9% in feeding and questing ticks, respectively, whereas 21.7% and 3% of feeding and questing ticks were found be positive for A. phagocytophilum cDNA. Fifty-five PCR-positive samples were identified by sequencing as Babesia sp. EU1, of which five from feeding ticks were positive for both A. phagocytophilum and Babesia sp. EU1. The high density of wild cervids in the study area could explain these observations, as deer are considered to be the main hosts for adults of I. ricinus. However, the absence of Babesia divergens both in feeding and questing ticks is surprising, as the study area is known to be endemic for cattle babesiosis. Increasing cervid populations and comorbidity could play an import role in the epidemiology of these tick-borne diseases.

An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.

Science.gov (United States)

Oliva Chávez, Adela S; Fairman, James W; Felsheim, Roderick F; Nelson, Curtis M; Herron, Michael J; Higgins, LeeAnn; Burkhardt, Nicole Y; Oliver, Jonathan D; Markowski, Todd W; Kurtti, Timothy J; Edwards, Thomas E; Munderloh, Ulrike G

2015-01-01

Anaplasma phagocytophilum, the causative agent of Human Granulocytic Anaplasmosis (HGA), is an obligately intracellular α-proteobacterium that is transmitted by Ixodes spp ticks. However, the pathogen is not transovarially transmitted between tick generations and therefore needs to survive in both a mammalian host and the arthropod vector to complete its life cycle. To adapt to different environments, pathogens rely on differential gene expression as well as the modification of proteins and other molecules. Random transposon mutagenesis of A. phagocytophilum resulted in an insertion within the coding region of an o-methyltransferase (omt) family 3 gene. In wild-type bacteria, expression of omt was up-regulated during binding to tick cells (ISE6) at 2 hr post-inoculation, but nearly absent by 4 hr p.i. Gene disruption reduced bacterial binding to ISE6 cells, and the mutant bacteria that were able to enter the cells were arrested in their replication and development. Analyses of the proteomes of wild-type versus mutant bacteria during binding to ISE6 cells identified Major Surface Protein 4 (Msp4), but also hypothetical protein APH_0406, as the most differentially methylated. Importantly, two glutamic acid residues (the targets of the OMT) were methyl-modified in wild-type Msp4, whereas a single asparagine (not a target of the OMT) was methylated in APH_0406. In vitro methylation assays demonstrated that recombinant OMT specifically methylated Msp4. Towards a greater understanding of the overall structure and catalytic activity of the OMT, we solved the apo (PDB_ID:4OA8), the S-adenosine homocystein-bound (PDB_ID:4OA5), the SAH-Mn2+ bound (PDB_ID:4PCA), and SAM- Mn2+ bound (PDB_ID:4PCL) X-ray crystal structures of the enzyme. Here, we characterized a mutation in A. phagocytophilum that affected the ability of the bacteria to productively infect cells from its natural vector. Nevertheless, due to the lack of complementation, we cannot rule out secondary mutations.

An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.

Directory of Open Access Journals (Sweden)

Adela S Oliva Chávez

Full Text Available Anaplasma phagocytophilum, the causative agent of Human Granulocytic Anaplasmosis (HGA, is an obligately intracellular α-proteobacterium that is transmitted by Ixodes spp ticks. However, the pathogen is not transovarially transmitted between tick generations and therefore needs to survive in both a mammalian host and the arthropod vector to complete its life cycle. To adapt to different environments, pathogens rely on differential gene expression as well as the modification of proteins and other molecules. Random transposon mutagenesis of A. phagocytophilum resulted in an insertion within the coding region of an o-methyltransferase (omt family 3 gene. In wild-type bacteria, expression of omt was up-regulated during binding to tick cells (ISE6 at 2 hr post-inoculation, but nearly absent by 4 hr p.i. Gene disruption reduced bacterial binding to ISE6 cells, and the mutant bacteria that were able to enter the cells were arrested in their replication and development. Analyses of the proteomes of wild-type versus mutant bacteria during binding to ISE6 cells identified Major Surface Protein 4 (Msp4, but also hypothetical protein APH_0406, as the most differentially methylated. Importantly, two glutamic acid residues (the targets of the OMT were methyl-modified in wild-type Msp4, whereas a single asparagine (not a target of the OMT was methylated in APH_0406. In vitro methylation assays demonstrated that recombinant OMT specifically methylated Msp4. Towards a greater understanding of the overall structure and catalytic activity of the OMT, we solved the apo (PDB_ID:4OA8, the S-adenosine homocystein-bound (PDB_ID:4OA5, the SAH-Mn2+ bound (PDB_ID:4PCA, and SAM- Mn2+ bound (PDB_ID:4PCL X-ray crystal structures of the enzyme. Here, we characterized a mutation in A. phagocytophilum that affected the ability of the bacteria to productively infect cells from its natural vector. Nevertheless, due to the lack of complementation, we cannot rule out secondary

Diversity of ankA and msp4 genes of Anaplasma phagocytophilum in Slovenia.

Science.gov (United States)

Strašek Smrdel, Katja; von Loewenich, Friederike D; Petrovec, Miroslav; Avšič Županc, Tatjana

2015-03-01

Granulocytic anaplasmosis is a tick transmitted emerging disease in Europe and worldwide. The agent, Anaplasma phagocytophilum is transmitted by ticks of the genus Ixodes and causes infections in humans and domestic animals. The analysis of different target genes showed that in nature several genetic variants of A. phagocytophilum were present. The purpose of our study was to genetically characterize A. phagocytophilum strains from eight humans, 16 dogs, 12 wild boars, one bear and 18 tick pools from Slovenia. Therefore, the ankA and msp4 genes of A. phagocytophilum were chosen. The same genetic ankA and msp4 variant of A. phagocytophilum was detected in humans, wild boar and a part of the pooled ticks indicating that it circulates in a zoonotic cycle between wild boar and ticks. In dogs, three ankA variants of A. phagocytophilum were detected. One of them was identical to the one that was found in humans. In contrast, all dogs harboured the same msp4 variant as humans and wild boar. In ticks, numerous ankA and msp4 variants were present. Copyright © 2014 Elsevier GmbH. All rights reserved.

The infection of questing Dermacentor reticulatus ticks with Babesia canis and Anaplasma phagocytophilum in the Chernobyl exclusion zone.

Science.gov (United States)

Karbowiak, Grzegorz; Vichová, Bronislavá; Slivinska, Kateryna; Werszko, Joanna; Didyk, Julia; Peťko, Branislav; Stanko, Michal; Akimov, Igor

2014-08-29

Tick occurrence was studied in the Chernobyl exclusion zone (CEZ) during the August-October 2009-2012. Dermacentor reticulatus ticks were collected using the flagging method and then screened for infection with Anaplasma phagocytophilum and Babesia canis by a PCR method incorporating specific primers and sequence analysis. The prevalence of infection with B. canis canis and A. phagocytophilum was found to be 3.41% and 25.36%, respectively. The results present the first evidence of B. canis canis and A. phagocytophilum in questing D. reticulatus ticks from the Chernobyl exclusion zone. They also reveal the presence of tick-borne disease foci in areas with no human activity, and confirm that they can be maintained in areas after a nuclear disaster with radioactive contamination. Copyright © 2014 Elsevier B.V. All rights reserved.

First evidence of Anaplasma platys and Hepatozoon canis co-infection in a dog from Romania--a case report.

Science.gov (United States)

Andersson, Martin; Turcitu, Mihai A; Stefanache, Mircea; Tamba, Paula; Barbuceanu, Florica; Chitimia, Lidia

2013-06-01

Anaplasma platys was first identified and described in North America as a Rickettsia-like, platelet-specific organism in dogs with infectious canine cyclic thrombocytopenia. In Europe, A. platys has so far mainly been described for some Mediterranean countries. Here, we describe a case of A. platys infection in a dog from Romania, confirmed by PCR. Additionally, the dog had a co-infection with Hepatozoon canis. To the best of our knowledge, this is the first case of A. platys infection in Romania and the first case of a co-infection with A. platys and H. canis altogether. Both pathogens should be considered as possible disease agents in dogs suffering from disease associated with tick bite in south-eastern Europe. Copyright © 2013 Elsevier GmbH. All rights reserved.

A putative marker for human pathogenic strains of Anaplasma phagocytophilum correlates with geography and host, but not human tropism.

Science.gov (United States)

Foley, Janet; Stephenson, Nicole; Cubilla, Michelle Pires; Qurollo, Barbara; Breitschwerdt, Edward B

2016-03-01

Anaplasma phagocytophilum is an Ixodes species tick-transmitted bacterium that is capable of infecting a variety of host species, although there is a diversity of bacterial strains with differing host tropism. Recent analysis of A. phagocytophilum strains suggested that "drhm", a gene locus designated "distantly related to human marker" (drhm), which was predicted to be an integral membrane protein with possible transporter functions was not present in available canine and human isolates. By assessing 117 strains from 14 host species from across the US, we extended this analysis. Phylogenetic clades were associated with geography, but not host species. Additionally, a virulent clade that lacks drhm and infects dogs, horses, and humans in northeastern US was identified. Copyright © 2015 Elsevier GmbH. All rights reserved.

A specific DNA probe which identifies Babesia bovis in whole blood.

Science.gov (United States)

Petchpoo, W; Tan-ariya, P; Boonsaeng, V; Brockelman, C R; Wilairat, P; Panyim, S

1992-05-01

A genomic library of Babesia bovis DNA from the Mexican strain M was constructed in plasmid pUN121 and cloned in Escherichia coli. Several recombinants which hybridized strongly to radioactively labeled B. bovis genomic DNA in an in situ screening were selected and further analyzed for those which specifically hybridized to B. bovis DNA. It was found that pMU-B1 had the highest sensitivity, detecting 25 pg of purified B. bovis DNA, and 300 parasites in 10 microliters of whole infected blood, or 0.00025% parasitemia. pMU-B1 contained a 6.0 kb B. bovis DNA insert which did not cross-hybridize to Babesia bigemina, Trypanosoma evansi, Plasmodium falciparum, Anaplasma marginale, Boophilus microplus and cow DNA. In the Southern blot analysis of genomic DNA, pMU-B1 could differentiate between two B. bovis geographic isolates, Mexican strain M and Thai isolate TS4. Thus, the pMU-B1 probe will be useful in the diagnosis of Babesia infection in cattle and ticks, and in the differentiation of B. bovis strains.

Molecular and serological detection of Theileria equi, Babesia caballi and Anaplasma phagocytophilum in horses and ticks in Maranhão, Brazil

Directory of Open Access Journals (Sweden)

Rita de Maria Seabra Nogueira

Full Text Available ABSTRACT: Equine piroplasmosis is a tick-borne disease caused by the intraeytrhocytic protozoans Babesia caballi and Theileria equi. It has been reported as a main equine parasitic disease. In addition, Anaplasma phagocytophilum, the causative agent of granulocytic ehrlichiosis, causes a seasonal disease in horses. Both diseases, can be detrimental to animal health. In this sense, blood samples and ticks were collected from 97 horses raised in the microregion of Baixada Maranhense, Maranhão State, Brazil. Serum samples were subjected to Indirect Fluorescence Antibody Test (IFAT and blood samples and ticks to Polymerase Chain Reaction (PCR to evaluate the infection by Theileria equi, Babesia caballi and Anaplasma phagocytophilum. The overall seroprevalence was 38.14%, 18.55% and 11.34% for T. equi, B. caballi and A. phagocytophilum, respectively. The results of PCR from blood samples showed 13.40% and 3.09% positive samples to T. equi and B. caballi, respectively. A total of 170 tick specimens were collected and identified as Dermacentor nitens, Amblyomma cajennense sensu lato and Rhipicephalus (Boophilus microplus. It was detected 2.35% (4/170 and 0.59% (1/170 positive tick samples by PCR for T. equi and B. caballi, respectively. All samples were negative to A. phagocytophilum. No statically difference (p>0.05 was observed when gender, age, use of ectoparasiticide and tick presence were analyzed. A BLASTn analysis of the sequenced samples indicated 97 to 100% similarity with T. equi 18S rRNA gene sequences in GenBank and 98 to 100% with B. caballi. Genetic analysis classified the obtained sequences as T. equi and B. caballi cluster, respectively. It can be concluded that these pathogens occur and are circulating in the studied area.

Anaplasma phagocytophilum Manipulates Host Cell Apoptosis by Different Mechanisms to Establish Infection

Directory of Open Access Journals (Sweden)

Pilar Alberdi

2016-07-01

Full Text Available Anaplasma phagocytophilum is an emerging zoonotic pathogen that causes human and animal granulocytic anaplasmosis and tick-borne fever of ruminants. This obligate intracellular bacterium evolved to use common strategies to establish infection in both vertebrate hosts and tick vectors. Herein, we discuss the different strategies used by the pathogen to modulate cell apoptosis and establish infection in host cells. In vertebrate neutrophils and human promyelocytic cells HL-60, both pro-apoptotic and anti-apoptotic factors have been reported. Tissue-specific differences in tick response to infection and differential regulation of apoptosis pathways have been observed in adult female midguts and salivary glands in response to infection with A. phagocytophilum. In tick midguts, pathogen inhibits apoptosis through the Janus kinase/signal transducers and activators of transcription (JAK/STAT pathway, while in salivary glands, the intrinsic apoptosis pathways is inhibited but tick cells respond with the activation of the extrinsic apoptosis pathway. In Ixodes scapularis ISE6 cells, bacterial infection down-regulates mitochondrial porin and manipulates protein processing in the endoplasmic reticulum and cell glucose metabolism to inhibit apoptosis and facilitate infection, whereas in IRE/CTVM20 tick cells, inhibition of apoptosis appears to be regulated by lower caspase levels. These results suggest that A. phagocytophilum uses different mechanisms to inhibit apoptosis for infection of both vertebrate and invertebrate hosts.

Anaplasma phagocytophilum-Related Defects in CD8, NKT, and NK Lymphocyte Cytotoxicity

Directory of Open Access Journals (Sweden)

Diana G. Scorpio

2018-04-01

Full Text Available Human granulocytic anaplasmosis, caused by the tick-transmitted Anaplasma phagocytophilum, is not controlled by innate immunity, and induces a proinflammatory disease state with innate immune cell activation. In A. phagocytophilum murine infection models, hepatic injury occurs with production of IFNγ thought to be derived from NK, NKT cells, and CD8 T lymphocytes. Specific A. phagocytophilum ligands that drive inflammation and disease are not known, but suggest a clinical and pathophysiologic basis strikingly like macrophage activation syndrome (MAS and hemophagocytic syndrome (HPS. We studied in vivo responses of NK, NKT, and CD8 T lymphocytes from infected animals for correlates of lymphocyte-mediated cytotoxicity and examined in vitro interactions with A. phagocytophilum-loaded antigen-presenting cells (APCs. Murine splenocytes were examined and found deficient in cytotoxicity as determined by CD107a expression in vitro for specific CTL effector subsets as determined by flow cytometry. Moreover, A. phagocytophilum-loaded APCs did not lead to IFNγ production among CTLs in vitro. These findings support the concept of impaired cytotoxicity with A. phagocytophilum presentation by APCs that express MHC class I and that interact with innate and adaptive immune cells with or after infection. The findings strengthen the concept of an enhanced proinflammatory phenotype, such as MAS and HPS disease states as the basis of disease and severity with A. phagocytophilum infection, and perhaps by other obligate intracellular bacteria.

Brotes de babesiosis y anaplasmosis bovina diagnosticados en el INTA Salta, Argentina: período 2006-2016

Directory of Open Access Journals (Sweden)

ARAOZ V

2017-12-01

Full Text Available Se realizó un estudio retrospectivo de brotes de babesiosis y anaplasmosis (tristeza parasitaria bovina, TPB ocurridos entre 2006 y 2016 en el Noroeste argentino (NOA para evaluar algunos aspectos epidemiológicos y clínicos de estas enfermedades. De 4.398 muestras para diagnóstico, 238 (5,4% tuvieron sospechas de TPB, las cuales se confirmaron en 106 (44,3% casos por observación microscópica de los agentes causales. Cuarenta y siete (44,3% brotes se debieron a Anaplasma marginale, 40 (37,7% a Babesia bovis y 14 (13,2% a Babesia bigemina. En cinco (4,7% focos de babesiosis no se determinó la especie causal de Babesia. Los brotes se diagnosticaron en 62 establecimientos ganaderos de cuatro provincias (Salta, Jujuy, Santiago del Estero y Chaco. La mayoría ocurrieron en verano y otoño, con máxima incidencia en abril y nula en setiembre para ambas noxas. Las vacas adultas fueron la categoría de ganado más afectada. En 58% (61/106 de los brotes murió al menos un bovino, con un número promedio de cuatro muertes por brote. Se concluye que la TPB continúa incidiendo negativamente en la producción bovina del NOA. SUMMARY. Bovine babesiosis and anaplasmosis outbreaks diagnosed at INTA Salta, Argentina: 2006-2016. A retrospective study of babesiosis and anaplasmosis outbreaks (tick fever, TF was made, which occurred from 2006 to 2016 in Northwest Argentina (NWA, to evaluate clinical and epidemiological aspects of these diseases. From 4,398 specimens, 238 (5.4% were associated with suspicions of TF and 106 of these cases (44.3% were confirmed as TF outbreaks by microscopic observation of causal agents. Forty seven (44.3% were due to Anaplasma marginale, 40 (37.7% to Babesia bovis and 14 (13.2% to Babesia bigemina. In five (4.7% outbreaks of babesiosis, Babesia species were not determined. Outbreaks were diagnosed at 62 different cattle ranches in four provinces (Salta, Jujuy, Santiago del Estero and Chaco. The outbreaks occurred mostly during

Clinical and molecular features of one case of human infection with Anaplasma phagocytophilum from Podlaskie Province in eastern Poland

Directory of Open Access Journals (Sweden)

Renata Welc-Falęciak

2015-09-01

Full Text Available The article focuses on the clinical and laboratory diagnosis of human granulocytic anaplasmosis (HGA caused by Anaplasma phagocytophilum infection in one of 28 patients (3.6%; n=1/28 tested samples with early Lyme borreliosis. The clinical and laboratory results of a 42-year-old patient fulfilled criteria of confirm anaplasmosis and suggest an acute stage of illness. The described case provides strong presumptive evidence that infection in this patient was acquired with a pathogenic strain of A. phagocytophilum through a tick bite. A positive DNA with PCR for A. phagocytophilum infection was sequenced and analyzed phylogenetically. Physicians should consider the possibility of anaplasmosis in patients with early Lyme borreliosis, and A. phagocytophilum should be considered as a differential diagnosis in all patients from an endemic region of potential high risk factors for tick-borne diseases.

Epigenetic silencing of host cell defense genes enhances intracellular survival of the rickettsial pathogen Anaplasma phagocytophilum.

Directory of Open Access Journals (Sweden)

Jose C Garcia-Garcia

2009-06-01

Full Text Available Intracellular bacteria have evolved mechanisms that promote survival within hostile host environments, often resulting in functional dysregulation and disease. Using the Anaplasma phagocytophilum-infected granulocyte model, we establish a link between host chromatin modifications, defense gene transcription and intracellular bacterial infection. Infection of THP-1 cells with A. phagocytophilum led to silencing of host defense gene expression. Histone deacetylase 1 (HDAC1 expression, activity and binding to the defense gene promoters significantly increased during infection, which resulted in decreased histone H3 acetylation in infected cells. HDAC1 overexpression enhanced infection, whereas pharmacologic and siRNA HDAC1 inhibition significantly decreased bacterial load. HDAC2 does not seem to be involved, since HDAC2 silencing by siRNA had no effect on A. phagocytophilum intracellular propagation. These data indicate that HDAC up-regulation and epigenetic silencing of host cell defense genes is required for A. phagocytophilum infection. Bacterial epigenetic regulation of host cell gene transcription could be a general mechanism that enhances intracellular pathogen survival while altering cell function and promoting disease.

Monoinfections caused by Borrelia burgdorferi and Borrelia burgdorferi / Anaplasma phagocytophilum co-infections in forestry workers and farmers

Directory of Open Access Journals (Sweden)

Małgorzata Tokarska-Rodak

2015-10-01

Full Text Available Background: The presence of co-infections induced by tick-borne pathogens in humans is an important epidemiological phenomenon. This issue has attracted growing attention of doctors and people working under conditions of an increased risk of being exposed to tick bites. Material and Methods: The research group consisted of 93 individuals with current anti-immunoglobulin M/G (IgM/ IgG Borrelia burgdorferi or IgG anti-Anaplasma phagocytophilum. The respondents were identified during the screening survey in a group of farmers and foresters occupationally exposed to tick bites. The aim of the work was to analyse the frequency of antibodies to specific antigens of B. burgdorferi and the levels of cytokines in forestry workers and farmers with B. burgdorferi monoinfections and B. burgdorferi / A. phagocytophilum co-infections. Statistical analysis was performed using the Chi2, Mann-Whitney U and Kruskal-Wallis tests. Results: There is a stronger generation of IgG antibodies to B. burgdorferi antigens in patients with B. burgdorferi / A. phagocytophilum co-infections, such as variable major protein-like sequence expressed (VlsE (p < 0.05, p19 (p < 0.02, p17 (p < 0.05 and complement regulator-acquiring surface protein 3 (CRASP3 (p < 0.02 compared to persons with B. burgdorferi monoinfections. The discrepancies in the synthesis of cytokines interleukin 6 (IL-6, IL-10, and tumor necrosis factor α (TNF-α have not been found in persons with B. burgdorferi monoinfections and B. burgdorferi / A. phagocytophilum co-infection. Conclusions: The immune response directed against B. burgdorferi is stronger in patients co-infected with B. burgdorferi and A. phagocytophilum than in those with monoinfection. Med Pr 2015;66(5:645–651

Whole genome transcription profiling of Anaplasma phagocytophilum in human and tick host cells by tiling array analysis

Directory of Open Access Journals (Sweden)

Chavez Adela

2008-07-01

Full Text Available Abstract Background Anaplasma phagocytophilum (Ap is an obligate intracellular bacterium and the agent of human granulocytic anaplasmosis, an emerging tick-borne disease. Ap alternately infects ticks and mammals and a variety of cell types within each. Understanding the biology behind such versatile cellular parasitism may be derived through the use of tiling microarrays to establish high resolution, genome-wide transcription profiles of the organism as it infects cell lines representative of its life cycle (tick; ISE6 and pathogenesis (human; HL-60 and HMEC-1. Results Detailed, host cell specific transcriptional behavior was revealed. There was extensive differential Ap gene transcription between the tick (ISE6 and the human (HL-60 and HMEC-1 cell lines, with far fewer differentially transcribed genes between the human cell lines, and all disproportionately represented by membrane or surface proteins. There were Ap genes exclusively transcribed in each cell line, apparent human- and tick-specific operons and paralogs, and anti-sense transcripts that suggest novel expression regulation processes. Seven virB2 paralogs (of the bacterial type IV secretion system showed human or tick cell dependent transcription. Previously unrecognized genes and coding sequences were identified, as were the expressed p44/msp2 (major surface proteins paralogs (of 114 total, through elevated signal produced to the unique hypervariable region of each – 2/114 in HL-60, 3/114 in HMEC-1, and none in ISE6. Conclusion Using these methods, whole genome transcription profiles can likely be generated for Ap, as well as other obligate intracellular organisms, in any host cells and for all stages of the cell infection process. Visual representation of comprehensive transcription data alongside an annotated map of the genome renders complex transcription into discernable patterns.

Prevalence of Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi sensu lato, Anaplasma spp. and Leishmania infantum in apparently healthy and CVBD-suspect dogs in Portugal - a national serological study

Directory of Open Access Journals (Sweden)

Cardoso Luís

2012-03-01

Full Text Available Abstract Background Canine vector-borne diseases (CVBDs are caused by a wide range of pathogens transmitted to dogs by arthropods including ticks and insects. Many CVBD-agents are of zoonotic concern, with dogs potentially serving as reservoirs and sentinels for human infections. The present study aimed at assessing the seroprevalence of infection with or exposure to Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi sensu lato, Anaplasma spp. and Leishmania infantum in dogs in Portugal. Methods Based on 120 veterinary medical centres from all the regions of mainland and insular Portugal, 557 apparently healthy and 628 CVBD-suspect dogs were sampled. Serum, plasma or whole blood was tested for qualitative detection of D. immitis antigen and antibodies to E. canis, B. burgdorferi s. l., Anaplasma spp. and L. infantum with two commercial in-clinic enzyme-linked immunosorbent assay kits. Odds ratios (OR were calculated by logistic regression analysis to identify independent risk factors of exposure to the vector-borne agents. Results Total positivity levels to D. immitis, E. canis, B. burgdorferi, Anaplasma spp., L. infantum, one or more agents and mixed agents were 3.6%, 4.1%, 0.2%, 4.5%, 4.3%, 14.0% and 2.0% in the healthy group, and 8.9%, 16.4%, 0.5%, 9.2%, 25.2%, 46.3% and 11.6% in the clinically suspect group, respectively. Non-use of ectoparasiticides was a risk factor for positivity to one or more agents both in the apparently healthy (OR = 2.1 and CVBD-suspect (OR = 1.5 dogs. Seropositivity to L. infantum (OR = 7.6, E. canis (OR = 4.1 and D. immitis (OR = 2.4 were identified as risk factors for the presence of clinical signs compatible with CVBDs. Positivity to mixed agents was not found to be a risk factor for disease. Conclusions Dogs in Portugal are at risk of becoming infected with vector-borne pathogens, some of which are of zoonotic concern. CVBDs should be considered by practitioners and prophylactic measures must be put in

First molecular evidence of Anaplasma ovis and Rickettsia spp. in keds (Diptera: Hippoboscidae) of sheep and wild ruminants.

Science.gov (United States)

Hornok, Sándor; de la Fuente, José; Biró, Nóra; Fernández de Mera, Isabel G; Meli, Marina L; Elek, Vilmos; Gönczi, Eniko; Meili, Theres; Tánczos, Balázs; Farkas, Róbert; Lutz, Hans; Hofmann-Lehmann, Regina

2011-10-01

To evaluate the presence of rickettsial agents in hippoboscid flies with molecular methods, 81 sheep keds (Melophagus ovinus) were collected from 23 sheep, 144 deer keds (Lipoptena cervi) were caught in the environment, and a further 463 and 59 individuals of the latter species were obtained from fresh carcasses of 29 red deer and 17 roe deer, respectively. DNA was extracted individually or in pools. Anaplasma ovis was demonstrated in all examined sheep keds, and from one pool of free-living deer keds. Rickettsia helvetica or other, unidentified rickettsiae were also present in one pool of sheep keds, and in four pools of deer keds from both red deer and roe deer. This is the first account of polymerase chain reaction positivity of hippoboscid flies for A. ovis and rickettsiae. These results raise the possibility that-apart from cattle and roe deer as already reported-sheep and red deer might also play a reservoir role in the epidemiology of rickettsioses.

Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago.

Science.gov (United States)

Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto

2016-07-01

Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island. Copyright © 2016

Molecular detection of Dirofilaria immitis, Hepatozoon canis, Babesia spp., Anaplasma platys and Ehrlichia canis in dogs on Costa Rica.

Science.gov (United States)

Wei, Lanjing; Kelly, Patrick; Ackerson, Kate; El-Mahallawy, Heba S; Kaltenboeck, Bernhard; Wang, Chengming

2014-03-01

Although vector-borne diseases are important causes of morbidity and mortality in dogs in tropical areas, there is little information on these conditions in Costa Rica. In PCRs of blood from dogs in Costa Rica, we did not detect DNAs of Rickettsia (R.) felis and Coxiella (C.) burnetii but we did find evidence of infection with Dirofilaria (D.) immitis (9/40, 22.5%), Hepatozoon (H.) canis (15/40, 37.5%), Babesia spp. (10/40, 25%; 2 with B. gibsoni and 8 with B. vogeli), Anaplasma (A.) platys (3/40, 7.5%) and Ehrlichia (E.) canis (20/40, 50%). Nine dogs (22.5%) were free of any vector-borne pathogens while 14 (35%) were infected with a single pathogen, 11 (27.5%) with two, 4 (10%) with three, 1 (2.5%) with four, and 1 (2.5%) with five pathogens. Dogs in Costa Rica are commonly infected with vector-borne agents.

Molecular epidemiology of the emerging zoonosis agent Anaplasma phagocytophilum (Foggie, 1949) in dogs and ixodid ticks in Brazil.

Science.gov (United States)

Santos, Huarrisson A; Thomé, Sandra M G; Baldani, Cristiane D; Silva, Claudia B; Peixoto, Maristela P; Pires, Marcus S; Vitari, Gabriela L V; Costa, Renata L; Santos, Tiago M; Angelo, Isabele C; Santos, Leandro A; Faccini, João L H; Massard, Carlos L

2013-12-11

Anaplasma phagocytophilum is an emerging pathogen of humans, dogs and other animals, and it is transmitted by ixodid ticks. The objective of the current study was a) detect A. phagocytophilum in dogs and ixodid ticks using real-time Polymerase Chain Reaction (qPCR); and b) Determine important variables associated to host, environment and potential tick vectors that are related to the presence of A. phagocytophilum in dogs domiciled in Rio de Janeiro, Brazil. We tested blood samples from 398 dogs and samples from 235 ticks, including 194 Rhipicephalus sanguineus sensu lato, 15 Amblyomma cajennense, 8 Amblyomma ovale and 18 pools of Amblyomma sp. nymphs. A semi-structured questionnaire was applied by interviewing each dog owner. Deoxyribonucleic acid obtained from ticks and dog buffy coat samples were amplified by qPCR (msp2 gene). The sequencing of 16S rRNA and groESL heat shock operon genes and a phylogenetic analysis was performed. The multiple logistic regression model was created as a function of testing positive dogs for A. phagocytophilum. Among the 398 blood samples from dogs, 6.03% were positive for A. phagocytophilum. Anaplasma phagocytophilum was detected in one A. cajennense female tick and in five R. sanguineus sensu lato ticks (four males and one female). The partial sequences of the 16S rRNA, and groESL genes obtained were highly similar to strains of A. phagocytophilum isolated from wild birds from Brazil and human pathogenic strains. The tick species collected in positive dogs were R. sanguineus sensu lato and A. cajennense, with A.cajennense being predominant. Tick infestation history (OR = 2.86, CI = 1.98-14.87), dog size (OR = 2.41, IC: 1.51-12.67), the access to forest areas (OR = 3:51, CI: 1.52-16.32), hygiene conditions of the environment in which the dogs lived (OR = 4.35, CI: 1.86-18.63) and Amblyomma sp. infestation (OR = 6.12; CI: 2.11-28.15) were associated with A. phagocytophilum infection in dogs. This is the

Candidatus Neoehrlichia mikurensis and Anaplasma phagocytophilum: prevalences and investigations on a new transmission path in small mammals and ixodid ticks.

Science.gov (United States)

Obiegala, Anna; Pfeffer, Martin; Pfister, Kurt; Tiedemann, Tim; Thiel, Claudia; Balling, Anneliese; Karnath, Carolin; Woll, Dietlinde; Silaghi, Cornelia

2014-12-04

Small mammals are crucial for the life history of ixodid ticks, but their role and importance in the transmission cycle of tick-borne pathogens is mostly unknown. Candidatus Neoehrlichia mikurensis (CNM) and Anaplasma phagocytophilum are both tick-borne pathogens, and rodents are discussed to serve as main reservoir hosts for CNM but not for the latter especially in Germany. Analysing the prevalence of both pathogens in small mammals and their ticks in endemic regions may help to elucidate possible transmission paths in small mammal populations and between small mammals and ticks. In 2012 and 2013, small mammals were trapped at three different sites in Germany. DNA was extracted from different small mammal tissues, from rodent neonates, foetuses and from questing and attached ticks. DNA samples were tested for CNM and A. phagocytophilum by real-time PCR. Samples positive for A. phagocytophilum were further characterized at the 16S rRNA gene locus. CNM was detected in 28.6% of small mammals and in 2.2% of questing and 3.8% of attached ticks. Altogether 33 positive ticks were attached to 17 different hosts, while positive ticks per host ranged between one and seven. The prevalences for this pathogen differed significantly within small mammal populations comparing sites (χ(2): 13.3987; p: 0.0004) and between sexes. Male rodents had an approximately two times higher chance of infection than females (OR: 1.9652; 95% CI: 1.32-2.92). The prevalence for CNM was 31.8% (95% CI: 22-44) in rodent foetuses and neonates (23 of 67) from positive dams, and 60% (95% CI: 35.7-80.25) of positive gravid or recently parturient rodents (9 out of 15) had at least one positive foetus or neonate. Anaplasma phagocytophilum was detected at a low percentage in rodents (0-5.6%) and host-attached ticks (0.5-2.9%) with no significant differences between rodent species. However, attached nymphs were significantly more often infected than attached larvae (χ(2): 25.091; p: <0.0001). This study

Molecular epidemiology of Anaplasma platys, Ehrlichia canis and Babesia vogeli in stray dogs in Paraná, Brazil

Directory of Open Access Journals (Sweden)

Claudia M. Ribeiro

Full Text Available ABSTRACT: Hemoparasitic infections are tick-borne diseases, which affect animals and humans. Considering the importance of canine hemoparasitic infections in veterinary clinics, this study aimed to determine the occurrence of Anaplasma platys, Ehrlichia canis and Babesia vogeli in blood samples from 182 dogs not domiciled in the city of Pato Branco, southwestern region of Paraná State, Brazil, using polymerase chain reaction (PCR. The prevalence of A. platys and B. vogeli was 32.9% and 10.9% respectively, and A. platys infection prevailed (p<0.001. The number of dogs positive for A. platys was larger in Winter (p<0.05. All blood samples were negative for E. canis. In the dogs, infestation by Amblyomma cajennense predominated over that by Rhipicephalus sanguineus (p<0.001; but there was no significant association between PCR and the variables presence of ticks, sex and age. Dogs infected by A. platys and B. vogeli showed thrombocytopenia, lymphopenia and leukocytosis; but there was no correlation between such hematological changes and infection by hemoparasites. This appears to be the first molecular study that demonstrates the existence of A. platys and B. vogeli in dogs from the southwestern region of Paraná.

Intraoperative bleeding in dogs from Grenada seroreactive to Anaplasma platys and Ehrlichia canis.

Science.gov (United States)

Lanza-Perea, M; Zieger, U; Qurollo, B A; Hegarty, B C; Pultorak, E L; Kumthekar, S; Bruhl-Day, R; Breitschwerdt, E B

2014-01-01

Frequent exposure of Grenadian dogs to Rhipicephalus sanguineus results in Anaplasma platys, and Ehrlichia canis seroreactivity. During elective surgeries, substantial intraoperative hemorrhage occurs in some seroreactive dogs. To assess hemostatic parameters and bleeding tendencies as well as prevalence of PCR positivity in apparently healthy A. platys and E. canis seroreactive and seronegative free-roaming dogs from Grenada. Forty-seven elective surgery dogs allocated to 4 groups: Seronegative control (n = 12), A. platys (n = 10), E. canis (n = 14) and A. platys, and E. canis (n = 11) seroreactive. Preoperatively, hemostasis was assessed by platelet count, prothrombin time, activated partial thromboplastin time, and buccal mucosal bleeding time. Intra- and postoperative bleeding scores were subjectively assigned. Blood, spleen, bone marrow, and lymph node aspirates were tested by PCR. Bleeding scores in dogs coseroreactive for A. platys and E. canis were higher (P = .015) than those of seronegative dogs. A. platys DNA was amplified from 7/21 (33%) A. platys seroreactive dogs and from 1 E. canis seroreactive dog; E. canis DNA was amplified from 21/25 (84%) E. canis seroreactive dogs. E. canis DNA was amplified most often from blood, whereas A. platys DNA was amplified most often from bone marrow. Apparently healthy, free-roaming dogs coseropositive for A. platys and E. canis may have increased intraoperative bleeding tendencies despite normal hemostatic parameters. Future investigations should explore the potential for vascular injury as a cause for bleeding in these dogs. Improved tick control is needed for dogs in Grenada. Copyright © 2014 by the American College of Veterinary Internal Medicine.

Superinfection occurs in Anaplasma phagocytophilum infected sheep irrespective of infection phase and protection status

Directory of Open Access Journals (Sweden)

Bergström Karin

2009-10-01

Full Text Available Abstract Background Anaplasma phagocytophilum infection in domestic ruminants is widespread in the coastal areas of southern Norway. The bacteria may persist in mammalian hosts. Several genetic variants of A. phagocytophilum exist. In the present study, we investigate whether superinfection occurs in the acute and persistent phase of the infection. Methods Five-month-old lambs of the Norwegian Dala breed were experimentally infected with two 16S rRNA gene variants of A. phagocytophilum, i.e. A. phagocytophilum variant 1 (GenBank accession number M73220 and variant 2 (GenBank acc. no. AF336220. Eighteen lambs were used, two lambs in each group. Eight groups were experimentally inoculated with either variant 1 or 2 on day 0. Six of these groups were then challenged with the other variant on either days 7, 42 or 84, respectively. One group was left uninfected. The occurrence of A. phagocytophilum in blood samples was determined using semi-nested PCR analysis and gene sequencing. Specific antibodies were measured by an indirect immunofluorescence antibody assay (IFA. Results A. phagocytophilum variant 1 and 2 differed significantly with regards to clinical reaction and cross-immunity in infected lambs. Both variants were found in the blood after challenge. However, variant 1 was detected most frequently. Conclusion The present experiment indicates that superinfection of different genotypes occurs during the acute as well as the persistent phase of an A. phagocytophilum infection, even in lambs protected against the challenged infection.

Responsabilidad Social Matriz de indicadores sustentables que refleja el impacto de la forestación en tierras marginales del Partido de Bahía Blanca, Argentina

Directory of Open Access Journals (Sweden)

Regina del Carmen Durán Durán

2009-01-01

Full Text Available Actualmente, se han empezado a considerar otras obligaciones que tienen las empresas para con su comunidad; se trata de aspectos vinculados con las dimensiones sociales y ambientales. Desde este contexto, nuestro trabajo tiene como punto de partida el concepto de responsabilidad social desde la noción de sustentabilidad. El objetivo es evaluar la forestación como instrumento para mejorar la sostenibilidad de los sistemas productivos tradicionales en tierras marginales del Partido de Bahía Blanca, mitigando los impactos del desarrollo no responsable de la producción primaria. Para ello, se han identificado técnicas de manejo generadoras de externalidades positivas en otras actividades agropecuarias complementarias, donde existen limitantes edafológicas, apoyándose en las tres dimensiones del concepto de sustentabilidad: ecológica, económica, sociopolítica y cultural. De igual forma, se diseñó una matriz de evaluación y ponderación de impactos, que contempla indicadores cuantitativos y cualitativos, de cuya aplicación surge la forestación como una alternativa sustentable

The characterization and manipulation of the bacterial microbiome of the Rocky Mountain wood tick, Dermacentor andersoni.

Science.gov (United States)

Clayton, Katie A; Gall, Cory A; Mason, Katheen L; Scoles, Glen A; Brayton, Kelly A

2015-12-10

In North America, ticks are the most economically impactful vectors of human and animal pathogens. The Rocky Mountain wood tick, Dermacentor andersoni (Acari: Ixodidae), transmits Rickettsia rickettsii and Anaplasma marginale to humans and cattle, respectively. In recent years, studies have shown that symbiotic organisms are involved in a number of biochemical and physiological functions. Characterizing the bacterial microbiome of D. andersoni is a pivotal step towards understanding symbiont-host interactions. In this study, we have shown by high-throughput sequence analysis that the composition of endosymbionts in the midgut and salivary glands in adult ticks is dynamic over three generations. Four Proteobacteria genera, Rickettsia, Francisella, Arsenophonus, and Acinetobacter, were identified as predominant symbionts in these two tissues. Exposure to therapeutic doses of the broad-spectrum antibiotic, oxytetracycline, affected both proportions of predominant genera and significantly reduced reproductive fitness. Additionally, Acinetobacter, a free-living ubiquitous microbe, invaded the bacterial microbiome at different proportions based on antibiotic treatment status suggesting that microbiome composition may have a role in susceptibility to environmental contaminants. This study characterized the bacterial microbiome in D. andersoni and determined the generational variability within this tick. Furthermore, this study confirmed that microbiome manipulation is associated with tick fitness and may be a potential method for biocontrol.

Prevalence of Babesia canis, Borrelia burgdorferi sensu lato, and Anaplasma phagocytophilum in hard ticks collected from meadows of Lubelskie Voivodship (eastern Poland

Directory of Open Access Journals (Sweden)

Dzięgiel Beata

2014-03-01

Full Text Available The aim of the study was to assess the distribution of Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, and Babesia canis in adult females and males of Ixodes ricinus and Dermacentor reticulatus ticks, inhabiting meadows near large forest complexes throughout the Lubelskie Voivodship (eastern region of Poland. Ticks were collected using the flagging method. Among 720 ticks collected, 506 were identified as D. reticulatus, and 214 as I. ricinus. DNA of B. canis and B. burgdorferi s.l. was detected in 21.3% and 0.6% of D. reticulatus ticks, respectively. In I. ricinus ticks, DNA specific to B. burgdorferi s.l. and A. phagocytophilum was detected in 5.6% and 10.3%, respectively. Co-infections of B. burgdorferi s.l. and A. phagocytophilum were found in two I. ricinus ticks. These results indicate that the Lublin region is an area at risk of tick-borne diseases of humans and animals, which must be considered in clinical practice.

Infection of Anaplasma phagocytophilum and Ehrlichia spp. in Opossums and Dogs in Campeche, Mexico: The Role of Tick Infestation

Directory of Open Access Journals (Sweden)

Edgar Rojero-Vázquez

2017-12-01

Full Text Available In recent years, some tick-borne diseases such as anaplasmosis and ehrlichiosis became widespread worldwide, threatening the health of humans, domestic animals and wildlife. The aims of this study were to determine the presence of Anaplasma phagocytophilum, Ehrlichia canis, and Ehrlichia chaffeensis in 102 opossums (Didelphis spp. and 44 owned free-ranging dogs in southeastern Mexico using a specific polymerase chain reaction (PCR. A. phagocytophilum was detected in opossums and dogs with a prevalence of 3 and 27%, respectively. E. canis was only present in 7% of dogs, while we didn't detect E. chaffeensis in any host. We report the first evidence of infections of A. phagocytophilum in Didelphis virginiana and D. marsupialis in Mexico. The infection rates and patterns we found of A. phagocytophilum suggest that dogs are more directly involved in the ecology of this pathogen than opossums. Despite the small prevalence found, our results are of public health concern because of the zoonotic capabilities of A. phagocytophilum, the high tick infestation rates found and because both opossums and free-ranging dogs can achieve high population densities in the region.

Canine leishmaniosis caused by Leishmania major and Leishmania tropica: comparative findings and serology.

Science.gov (United States)

Baneth, Gad; Yasur-Landau, Daniel; Gilad, Matan; Nachum-Biala, Yaarit

2017-03-13

Infection and clinical disease associated with Leishmania major and Leishmania tropica, two common agents of human cutaneous leishmaniosis, have rarely been reported in dogs. This study describes dogs infected with these Leishmania spp. prevalent in the Middle East and North Africa, and compares the serological response of dogs infected with Leishmania infantum, L. major or L. tropica to whole promastigote antigen enzyme-linked immunosorbent assay (ELISA) of each species and to rK39 dipstick. Leishmania major infection in a 5-month-old male dog was associated with alopecic and ulcerative periocular and limb skin lesions which responded to allopurinol treatment. Infection was detected by skin and blood polymerase chain reaction (PCR) and confirmed by DNA sequencing but the dog was seronegative. Leishmania tropica infection was detected in a 3-month-old female dog co-infected with Babesia vogeli and Anaplasma platys and with no skin lesions. PCR and DNA sequencing of the blood and parasite culture were positive for L. tropica. Sera from 11 dogs infected with L. infantum, L. major or L. tropica were reactive with all three Leishmania spp. antigens except for sera from a dog with L. major infection. No significant differences were found between reactivity of dog sera to the antigen of the infecting species, or to the other Leishmania spp. antigens. Sera from dogs infected with L. infantum and L. tropica were positive with the rK39 antigen kit, while dogs with L. major infection were seronegative. Skin lesions in L. major infected dogs from this study and previous reports (n = 2) were ulcerative and located on the muzzle, feet and foot pads and not associated with generalized lymphadenomegaly and splenomegaly. In previous L. tropica infections, skin lesions were proliferative mucocutaneous in young dogs (n = 2), or associated with widespread dermatitis, lymphadenomegaly and splenomegaly in older dogs with similarity to L. infantum infection (n = 2). This

Understanding Anaplasmataceae pathogenesis using ‘Omics’ approaches

Directory of Open Access Journals (Sweden)

Ludovic ePruneau

2014-07-01

Full Text Available This paper examines how Omics approaches improve our understanding of Anaplasmataceae pathogenesis, through a global and integrative strategy to identify genes and proteins involved in biochemical pathways key for pathogen-host-vector interactions.The Anaplasmataceae family comprises obligate intracellular bacteria mainly transmitted by arthropods. These bacteria are responsible for major human and animal endemic and emerging infectious diseases with important economic and public health impacts. In order to improve disease control strategies, it is essential to better understand their pathogenesis. Our work focused on four Anaplasmataceae, which cause important animal, human and zoonotic diseases: Anaplasma marginale, A. phagocytophilum, Ehrlichia chaffeensis and E. ruminantium. Wolbachia spp. an endosymbiont of arthropods was also included in this review as a model of a non-pathogenic Anaplasmataceae.A gap analysis on Omics approaches on Anaplasmataceae was performed, which highlighted a lack of studies on the genes and proteins involved in the infection of hosts and vectors. Furthermore, most of the studies have been done on the pathogen itself, mainly on infectious free-living forms and rarely on intracellular forms. In order to perform a transcriptomic analysis of the intracellular stage of development, researchers developed methods to enrich bacterial transcripts from infected cells. These methods are described in this paper. Bacterial genes encoding outer membrane proteins, post-translational modifications, eukaryotic repeated motif proteins, proteins involved in osmotic and oxidative stress and hypothetical proteins have been identified to play a key role in Anaplasmataceae pathogenesis. Further investigations on the function of these outer membrane proteins and hypothetical proteins will be essential to confirm their role in the pathogenesis. Our work underlines the need for further studies in this domain and on host and vector responses

Tristeza parasitária bovina na região sul do Rio Grande do Sul: estudo retrospectivo de 1978-2005 Tick fever in southern Brazil: a retrospective study of 1978-2005

Directory of Open Access Journals (Sweden)

Milton Begeres de Almeida

2006-12-01

Full Text Available Foi realizado um estudo retrospectivo dos casos de tristeza parasitária bovina (TPB ocorridos no sul do Rio Grande do Sul, área de influência do Laboratório Regional de Diagnóstico (LRD da Faculdade de Veterinária da Universidade Federal de Pelotas entre 1978 e 2005. De um total de 4.884 materiais de bovinos provenientes de necropsias realizadas e órgãos ou sangue enviados ao laboratório 231 (4,7% tiveram o diagnóstico de TPB. Desses 231 surtos foram resgatados os dados de 221 diagnósticos dos quais 91 (41,1% foram causados por Babesia bovis, 11 (4,9% por Babesia bigemina, e 65 (29,41% por Anaplasma marginale. Em outros 33 (14,93% surtos de babesiose não foi informada a espécie de Babesia e em 21 (9,5% surtos foi detectada infecção mista por Babesia sp e A. marginale. Os índices gerais médios de morbidade, mortalidade e letalidade, resgatados em 149 dos 221 surtos da doença, foram de 11,17%, 6,81% e 70,04%, respectivamente. Verificou-se que, na região estudada, a maioria dos surtos ocorre durante os meses de verão e outono, e que os animais com um a três anos de idade são os mais afetados. Os sinais clínicos nos surtos caracterizaram-se por apatia, orelhas caídas, debilidade, febre, anorexia e emagrecimento. Os valores de hematócrito eram baixos. Hemoglobinúria foi frequentemente observada nos casos de babesiose. Sinais neurológicos estavam presentes nos casos de babesiose por B. bovis e se caracterizaram por transtornos da locomoção, tremores musculares, agressividade e quedas com movimentos de pedalagem. As lesões macroscópicas principais relatadas nos casos de babesiose foram esplenomegalia, hepatomegalia, fígado amarelo, hemoglobinúria, icterícia, hemorragias cardíacas e bile espessa. Congestão do córtex cerebral foi relatada nos casos de babesiose por B. bovis. Nesta região, com população de bovinos de aproximadamente 2.630.000 cabeças as perdas anuais por morte de bovinos pela enfermidade podem ser

Limited sharing of tick-borne hemoparasites between sympatric wild and domestic ungulates.

Science.gov (United States)

Ghai, Ria R; Mutinda, Mathew; Ezenwa, Vanessa O

2016-08-15

Tick-borne hemoparasites (TBHs) are a group of pathogens of concern in animal management because they are associated with a diversity of hosts, including both wild and domestic species. However, little is known about how frequently TBHs are shared across the wildlife-livestock interface in natural settings. Here, we compared the TBHs of wild Grant's gazelle (Nanger granti) and domestic sheep (Ovis aries) in a region of Kenya where these species extensively overlap. Blood samples collected from each species were screened for piroplasm and rickettsial TBHs by PCR-based amplification of 18S/16S ribosomal DNA, respectively. Overall, 99% of gazelle and 66% of sheep were positive for Babesia/Theileria, and 32% of gazelle and 47% sheep were positive for Anaplasma/Ehrlichia. Sequencing a subset of positive samples revealed infections of Theileria and Anaplasma. Sequences sorted into seven phylogenetically distinct genotypes-two Theileria, and five Anaplasma. With the exception of a putatively novel Anaplasma lineage from Grant's gazelle, these genotypes appeared to be divergent forms of previously described species, including T. ovis, A. ovis, A. bovis, and A. platys. Only one genotype, which clustered within the A. platys clade, contained sequences from both gazelle and sheep. This suggests that despite niche, habitat, and phylogenetic overlap, the majority of circulating tick-borne diseases may not be shared between these two focal species. Copyright © 2016 Elsevier B.V. All rights reserved.

Comparative strain analysis of Anaplasma phagocytophilum infection and clinical outcomes in a canine model of granulocytic anaplasmosis.

Science.gov (United States)

Scorpio, Diana G; Dumler, J Stephen; Barat, Nicole C; Cook, Judith A; Barat, Christopher E; Stillman, Brett A; DeBisceglie, Kristen C; Beall, Melissa J; Chandrashekar, Ramaswamy

2011-03-01

A pilot study was conducted to determine whether existing human or canine strains of Anaplasma phagocytophilum would reproduce clinical disease in experimentally inoculated dogs similar to dogs with naturally acquired granulocytic anaplasmosis. Six hounds were inoculated intravenously with one human and two canine strains of A. phagocytophilum that were propagated in vitro in HL-60 cells or in infected autologous neutrophils. Infected dogs were monitored for lethargy, anorexia, petechiae, lymphadenopathy, and fever. Dogs were assessed for complete blood count (CBC), serum chemistry, and serology (IFA and SNAP® 4Dx®); for A. phagocytophilum blood load by quantitative polymerase chain reaction; and for cytokine production. Prominent clinical signs were generalized lymphadenopathy and scleral injection; only one dog developed fever lasting 4 days. Notable laboratory alterations included sustained leukopenia and thrombocytopenia in all dogs. A. phagocytophilum morulae were noted in blood between days 10 and 11, although all dogs retained A. phagocytophilum DNA in blood through day 60. All dogs seroconverted by days 10-15 by IFA, and by days 17-30 by SNAP 4Dx; cytokine analyses revealed 10-fold increases in interleukin-2 and interleukin-18 in the neutrophil-propagated 98E4 strain-infected dog. All A. phagocytophilum strains produced infection, although canine 98E4 strain reproduced clinical signs, hematologic changes, and inflammatory cytokine elevations most consistent with granulocytic anaplasmosis when recognized clinically. Therefore, this strain should be considered for use in future studies of A. phagocytophilum canine infection models.

Serologic survey for selected arboviruses and other potential pathogens in wildlife from Mexico.

Science.gov (United States)

Aguirre, A A; McLean, R G; Cook, R S; Quan, T J

1992-07-01

During 1988 and 1989, a serologic survey of wildlife was conducted in northeastern Mexico to determine the presence, prevalence, and distribution of arboviruses and other selected disease agents. Eighty mammal specimens were tested. Antibodies to vesicular stomatitis-Indiana, Venezuelan equine encephalitis-Mena II, Rio Grande virus, and vesicular stomatitis-New Jersey were detected predominantly in small mammals. Deer and mouflon (Ovis musimon) had antibodies to bluetongue and epizootic hemorrhagic disease. Two species had serologic evidence of recent exposure to Francisella tularensis. A white-tailed deer (Odocoileus virginianus) had antibodies to Anaplasma marginale. All specimens tested for antibodies against Yersinia pestis and Brucella abortus were negative. Sera from 315 birds were tested for antibody against five equine encephalitis viruses and six avian pathogens. During 1988, antibodies to Venezuelan equine encephalitis-Mena II, Venezuelan equine encephalitis-TC83, St. Louis encephalitis, eastern equine encephalitis, and western equine encephalitis were detected in birds of several species. Antibodies to Pasteurella multocida and Newcastle disease virus were also detected. Birds from five species presented antibodies to Mycoplasma meleagridis. Specimens tested for M. gallisepticum, M. synoviae, and Chlamydia psittaci were negative. To the best of our knowledge, this survey represents the first serologic evidence of bluetongue, Cache Valley virus, epizootic hemorrhagic disease, Jamestown Canyon virus, vesicular stomatitis-Indiana, vesicular stomatitis-New Jersey, Rio Grande virus, and tularemia reported among wildlife in Mexico.

The development of an enzyme-linked immunosorbent assay for Trypanosoma vivax antibodies and its use in epidemiological surveys

Directory of Open Access Journals (Sweden)

Claudio R Madruga

2006-11-01

Full Text Available There are data indicating that the distribution of Trypanosoma vivax in the Brazilian territory is expanding with potential to reach other areas, where the vectors are present. The detection of anti-trypanosomal antibodies in serum provides important information of the trypanosomal status in cattle herds. For this reason, an enzyme-linked immunosorbent assay (Tv-ELISA-Ab with crude antigen from one Brazilian isolate of T. vivax was developed and evaluated. The sensitivity and specificity were respectively 97.6 and 96.9%. In the evaluation of cross-reactions, three calves inoculated with T. evansi trypimastigotes blood forms showed optical densities (OD under the cut-off during the whole experimental period, except one at 45 days post-inoculation. With relation to Babesia bovis, B. bigemina, and Anaplasma marginale, which are endemic hemoparasites in the studied area, the cross-reactions were shown to be 5.7, 5.3, and 1.1%, respectively. The first serological survey of Pantanal and state of Pará showed that T. vivax is widespread, although regions within both areas had significantly different prevalences. Therefore, this Tv-ELISA-Ab may be a more appropriate test for epidemiological studies in developing countries because the diagnostic laboratories in most countries may be able to perform an ELISA, which is not true for polymerase chain reaction.

Prevalence and Significance of Haemoparasitic Infections of Cattle in North- Central, Nigeria

Directory of Open Access Journals (Sweden)

J.Kamani.

Full Text Available The prevalence and significance of hemoparasites of cattle from north-central Nigeria was determined using diagnostic records from Parasitology Division, National Veterinary Research Institute (NVRI Vom, from May 2006 to April 2008. A total of 637 blood samples from cattle from four states (Plateau, Bauchi, Nasarawa and Kaduna of Nigeria in anticoagulant were submitted to the laboratory for parasitological diagnosis. Giemsa stained thin blood smears were examined for hemoparasites. Packed cell volume (PCV for each sample was determined and Hematocrit centrifuge technique (HCT was used to determine the presence of motile parasites. An overall prevalence of 25.7% was recorded for all samples examined. Babesia bigemina and B.bovis accounted for 16.0%, followed by Theileria mutans (3.1%, Trypanosoma spp (T.vivax and T. congolense (2.8%, Anaplasma marginale (1.9%, Microfilaria (1.4%. The hemoparasites identified alone or in combination with others had a significant (P<0.05 effect on the mean PCV of infected animals. Similarly, hemoparasites infection in young animals as well as during the dry season resulted in significant (P<0.05 reduction of PCV values. The result of this study shows these hemoparasites are endemic in cattle in the study area which may result in serious disease conditions when such animals are subjected to stressful condition. [Veterinary World 2010; 3(10.000: 445-448

Molecular detection and characterization of Anaplasma platys in dogs and ticks in Cuba.

Science.gov (United States)

Silva, Claudia Bezerra da; Santos, Huarrisson Azevedo; Navarrete, Maylín González; Ribeiro, Carla Carolina Dias Uzedo; Gonzalez, Belkis Corona; Zaldivar, Maykelin Fuentes; Pires, Marcus Sandes; Peckle, Maristela; Costa, Renata Lins da; Vitari, Gabriela Lopes Vivas; Massard, Carlos Luiz

2016-07-01

Canine cyclic thrombocytopenia, an infectious disease caused by Anaplasma platys is a worldwide dog health problem. This study aimed to detect and characterize A. platys deoxyribonucleic acid (DNA) in dogs and ticks from Cuba using molecular methods. The study was conducted in four cities of Cuba (Habana del Este, Boyeros, Cotorro and San José de las Lajas). Blood samples were collected from 100 dogs in these cities. The animals were inspected for the detection of tick infestation and specimens were collected. Genomic DNA was extracted from dog blood and ticks using a commercial kit. Genomic DNA samples from blood and ticks were tested by a nested polymerase chain reaction (nPCR) to amplify 678 base pairs (bp) from the 16S ribosomal DNA (rDNA) of A. platys. Positive samples in nPCR were also subjected to PCR to amplify a fragment of 580bp from the citrate synthase (gltA) gene and the products were sequenced. Only Rhipicephalus sanguineus sensu lato (s.l.) was found on dogs, and 10.20% (n=5/49) of these ticks plus sixteen percent (16.0%, n=16/100) of dogs were considered positive for A. platys by nPCR targeting the 16S rDNA gene. All analyzed gltA and 16S rDNA sequences showed a 99-100% identity with sequences of A. platys reported in around the world. Phylogenetic analysis showed two defined clusters for the 16S rDNA gene and three defined clusters for the gltA gene. Based on the gltA gene, the deduced amino acid sequence showed two mutations at positions 88 and 168 compared with the sequence DQ525687 (GenBank ID from Italian sample), used as a reference in the alignment. A preliminary study on the epidemiological aspects associated with infection by A. platys showed no statistical association with the variables studied (p>0.05). This is the first evidence of the presence of A. platys in dogs and ticks in Cuba. Further studies are needed to evaluate the epidemiological aspects of A. platys infection in Cuban dogs. Copyright © 2016 Elsevier GmbH. All rights

SEROLOGICAL EVIDENCE OF EXPOSURE TO Anaplasma phagocytophilum IN HORSES FROM THE RIO DE JANEIRO STATE MOUNTED POLICE BRED IN THE URBAN ZONE

Directory of Open Access Journals (Sweden)

Marcia Farias Rolim

2015-07-01

Full Text Available Anaplasma phagocytophilum is an emergent hemoparasite in regions where ticks are regularly found. In order to investigate the rate of anti-A. phagocytophilum antibody in horses of the Mounted Police of Rio de Janeiro state and therefore the presence of this agent, 41 horses from the Cavalry Squadron (CS and 50 from the Regiment of Mounted Police (RMP were selected. For the serologic diagnosis the Indirect Fluorescent Antibody test was performed. In the present work, among 91 equine sera samples anti-A. phagocytophilum antibodies, with titer ≥ 1:80, were detected in 11 animals (12%, being five (5% from males and six (7% females, with no statistical difference. The adult animals with ages varying between five and 14 years presented the highest rate of positive reaction, although antibodies were detected in animals of all ages. We did not observe statistic differences in relation to the presence of anti-A. phagocytophilum antibodies among the animals bred in the CS and RMP. The presence of anti-A.phagocytophilim antibodies in horses of the Mounted Police with no clinical signs is indicative that the parasite is present in the enzootic form among the horses of the urban area. The circulation of the parasite among the animals is not dependent of the presence of tick infestations.

Parasites of domestic and wild animals in South Africa. L. Ixodid ticks infesting horses and donkeys.

Science.gov (United States)

Horak, Ivan G; Heyne, Heloise; Halajian, Ali; Booysen, Shalaine; Smit, Willem J

2017-02-28

The aim of the study was to determine the species spectrum of ixodid ticks that infest horses and donkeys in South Africa and to identify those species that act as vectors of disease to domestic livestock. Ticks were collected opportunistically from 391 horses countrywide by their owners or grooms, or by veterinary students and staff at the Faculty of Veterinary Science, University of Pretoria. Ticks were also collected from 76 donkeys in Limpopo Province, 2 in Gauteng Province and 1 in North West province. All the ticks were identified by means of a stereoscopic microscope. Horses were infested with 17 tick species, 72.1% with Rhipicephalus evertsi evertsi, 19.4% with Amblyomma hebraeum and 15.6% with Rhipicephalus decoloratus. Rhipicephalus evertsi evertsi was recovered from horses in all nine provinces of South Africa and R. decoloratus in eight provinces. Donkeys were infested with eight tick species, and 81.6% were infested with R. evertsi evertsi, 23.7% with A. hebraeum and 10.5% with R. decoloratus. Several tick species collected from the horses and donkeys are the vectors of economically important diseases of livestock. Rhipicephalus evertsi evertsi is the vector of Theileria equi, the causative organism of equine piroplasmosis. It also transmits Anaplasma marginale, the causative organism of anaplasmosis in cattle. Amblyomma hebraeum is the vector of Ehrlichia ruminantium, the causative organism of heartwater in cattle, sheep and goats, whereas R. decoloratus transmits Babesia bigemina, the causative organism of babesiosis in cattle.

A proline racemase based PCR for identification of Trypanosoma vivax in cattle blood.

Directory of Open Access Journals (Sweden)

Regassa Fikru

Full Text Available A study was conducted to develop a Trypanosoma vivax (T. vivax specific PCR based on the T. vivax proline racemase (TvPRAC gene. Forward and reverse primers were designed that bind at 764-783 bp and 983-1002 bp of the gene. To assess its specificity, TvPRAC PCR was conducted on DNA extracted from different haemotropic pathogens: T. vivax from Nigeria, Ethiopia and Venezuela, T. congolense Savannah type, T. brucei brucei, T. evansi, T. equiperdum, T. theileri, Theileria parva, Anaplasma marginale, Babesia bovis and Babesia bigemina and from bovine, goat, mouse, camel and human blood. The analytical sensitivity of the TvPRAC PCR was compared with that of the ITS-1 PCR and the 18S PCR-RFLP on a dilution series of T. vivax DNA in water. The diagnostic performance of the three PCRs was compared on 411 Ethiopian bovine blood specimens collected in a former study. TvPRAC PCR proved to be fully specific for T. vivax, irrespective of its geographical origin. Its analytical sensitivity was lower than that of ITS-1 PCR. On these bovine specimens, TvPRAC PCR detected 8.3% T. vivax infections while ITS-1 PCR and 18S PCR-RFLP detected respectively 22.6 and 6.1% T. vivax infections. The study demonstrates that a proline racemase based PCR could be used, preferably in combination with ITS-1 PCR, as a species-specific diagnostic test for T. vivax infections worldwide.

Tristeza parasitária bovina no Sertão da Paraíba

Directory of Open Access Journals (Sweden)

V.M.M. Costa

2011-03-01

Full Text Available Descrevem-se 24 surtos de tristeza parasitária bovina no sertão paraibano, sendo 18 de anaplasmose por Anaplasma margimale, dois de babesiose por Babesia bigemina, dois por Babesia não identificada e dois por infecção mista de A. marginale e Babesia sp. Os surtos ocorreram entre agosto de 2007 a outubro de 2009, porém, com uma concentração dos surtos no final do período chuvoso e início do período seco de cada ano, sendo 22 em animais adultos e dois em bezerros de aproximadamente 11 meses. Dois surtos ocorreram em bovinos da raça Nelore, um em animais da raça Gir e os 21 restantes ocorreram em animais das raças Holandês, Pardo Suiço e mestiços das mesmas com zebuínos. Conclui-se que no sertão da Paraíba há áreas de instabilidade enzoótica, ocorrendo surtos de tristeza no final da época de chuvas, principalmente nas áreas de planaltos e serras da região da Borborema e em áreas úmidas como a Bacia do Rio do Peixe, Rio Piranhas e Rio Espinharas em que há a formação de microclimas favoráveis à sobrevivência do carrapato.

Molecular detection and identification of hemoparasites in pampas deer (Ozotoceros bezoarticus Linnaeus, 1758) from the Pantanal Brazil.

Science.gov (United States)

Silveira, Júlia A G; Rabelo, Elida M L; Lacerda, Ana C R; Borges, Paulo A L; Tomás, Walfrido M; Pellegrin, Aiesca O; Tomich, Renata G P; Ribeiro, Múcio F B

2013-06-01

Hemoparasites were surveyed in 60 free-living pampas deer Ozotoceros bezoarticus from the central area of the Pantanal, known as Nhecolândia, State of Mato Grosso do Sul, Brazil, through the analysis of nested PCR assays and nucleotide sequencing. Blood samples were tested for Babesia/Theileria, Anaplasma spp., and Trypanosoma spp. using nPCR assays and sequencing of the 18S rRNA, msp4, ITS, and cathepsin L genes. The identity of each sequence was confirmed by comparison with sequences from GenBank using BLAST software. Forty-six (77%) pampas deer were positive for at least one hemoparasite, according to PCR assays. Co-infection occurred in 13 (22%) animals. Based on the sequencing results, 29 (48%) tested positive for A. marginale. Babesia/Theileria were detected in 23 (38%) samples, and according to the sequencing results 52% (12/23) of the samples were similar to T. cervi, 13% (3/23) were similar to Babesia bovis, and 9% (2/23) were similar to B. bigemina. No samples were amplified with the primers for T. vivax, while 11 (18%) were amplified with the ITS primers for T. evansi. The results showed pampas deer to be co-infected with several hemoparasites, including species that may cause serious disease in cattle. Pampas deer is an endangered species in Brazil, and the consequences of these infections to their health are poorly understood. Copyright © 2013 Elsevier GmbH. All rights reserved.

Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents--analyzing the host-pathogen-vector interface in a metropolitan area.

Science.gov (United States)

Silaghi, Cornelia; Woll, Dietlinde; Hamel, Dietmar; Pfister, Kurt; Mahling, Monia; Pfeffer, Martin

2012-09-05

The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice), were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures.

Structure of the type IV secretion system in different strains of Anaplasma phagocytophilum

Directory of Open Access Journals (Sweden)

Al-Khedery Basima

2012-11-01

Full Text Available Abstract Background Anaplasma phagocytophilum is an intracellular organism in the Order Rickettsiales that infects diverse animal species and is causing an emerging disease in humans, dogs and horses. Different strains have very different cell tropisms and virulence. For example, in the U.S., strains have been described that infect ruminants but not dogs or rodents. An intriguing question is how the strains of A. phagocytophilum differ and what different genome loci are involved in cell tropisms and/or virulence. Type IV secretion systems (T4SS are responsible for translocation of substrates across the cell membrane by mechanisms that require contact with the recipient cell. They are especially important in organisms such as the Rickettsiales which require T4SS to aid colonization and survival within both mammalian and tick vector cells. We determined the structure of the T4SS in 7 strains from the U.S. and Europe and revised the sequence of the repetitive virB6 locus of the human HZ strain. Results Although in all strains the T4SS conforms to the previously described split loci for vir genes, there is great diversity within these loci among strains. This is particularly evident in the virB2 and virB6 which are postulated to encode the secretion channel and proteins exposed on the bacterial surface. VirB6-4 has an unusual highly repetitive structure and can have a molecular weight greater than 500,000. For many of the virs, phylogenetic trees position A. phagocytophilum strains infecting ruminants in the U.S. and Europe distant from strains infecting humans and dogs in the U.S. Conclusions Our study reveals evidence of gene duplication and considerable diversity of T4SS components in strains infecting different animals. The diversity in virB2 is in both the total number of copies, which varied from 8 to 15 in the herein characterized strains, and in the sequence of each copy. The diversity in virB6 is in the sequence of each of the 4 copies in

High throughput pyrosequencing technology for molecular differential detection of Babesia vogeli, Hepatozoon canis, Ehrlichia canis and Anaplasma platys in canine blood samples.

Science.gov (United States)

Kaewkong, Worasak; Intapan, Pewpan M; Sanpool, Oranuch; Janwan, Penchom; Thanchomnang, Tongjit; Kongklieng, Amornmas; Tantrawatpan, Chairat; Boonmars, Thidarut; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai

2014-06-01

Canine babesiosis, hepatozoonosis, ehrlichiosis, and anaplasmosis are tick-borne diseases caused by different hemopathogens. These diseases are causes of morbidity and mortality in dogs. The classic method for parasite detection and differentiation is based on microscopic observation of blood smears. The limitations of the microscopic method are that its performance requires a specially qualified person with professional competence, and it is ineffective in differentiating closely related species. This study applied PCR amplification with high throughput pyrosequencing for molecular differential detection of the following 4 hemoparasites common to tropical areas in dog blood samples: Babesia vogeli, Hepatozoon canis, Ehrlichia canis, and Anaplasma platys. PCR was initially used to amplify specific target regions of the ribosomal RNA genes of each parasite using 2 primer pairs that included 18S rRNA for protozoa (B. vogeli and H. canis) and 16S rRNA for rickettsia (E. canis and A. platys). Babesia vogeli and H. canis were discriminated using 9 nucleotide positions out of 30 base pairs, whereas E. canis and A. platys were differentiated using 15 nucleotide positions out of 34 base pairs that were determined from regions adjacent to 3' ends of the sequencing primers. This method provides a challenging alternative for a rapid diagnosis and surveillance of these tick-borne diseases in canines. Copyright © 2014 Elsevier GmbH. All rights reserved.

Anaplasma phagocytophilum inhibits human neutrophil apoptosis via upregulation of bfl-1, maintenance of mitochondrial membrane potential and prevention of caspase 3 activation.

Science.gov (United States)

Ge, Yan; Yoshiie, Kiyotaka; Kuribayashi, Futoshi; Lin, Mingqun; Rikihisa, Yasuko

2005-01-01

The inhibition of neutrophil apoptosis plays a central role in human granulocytic anaplasmosis. Intracellular signalling pathways through which the obligatory intracellular bacterium Anaplasma phagocytophilum inhibits the spontaneous apoptosis of human peripheral blood neutrophils were investigated. bfl-1 mRNA levels in uninfected neutrophils after 12 h in culture were reduced to approximately 5-25% of 0 h levels, but remained high in infected neutrophils. The eukaryotic RNA synthesis inhibitor, actinomycin D, prevented the maintenance of bfl-1 mRNA levels by A. phagocytophilum. Differences in mcl-1, bax, bcl-w, bad or bak mRNA levels in infected versus uninfected neutrophils were not remarkable. By using mitochondrial fluorescent dyes, Mitotracker Red and JC-1, it was found that most uninfected neutrophils lost mitochondrial membrane potential after 10-12 h incubation, whereas A. phagocytophilum-infected neutrophils maintained high membrane potential. Caspase 3 activity and the degree of apoptosis were lower in dose-dependent manner in A. phagocytophilum-infected neutrophils at 16 h post infection, as compared to uninfected neutrophils. Anti-active caspase 3 antibody labelling showed less positively stained population in infected neutrophils compared to those in uninfected neutrophils after 12 h incubation. These results suggest that A. phagocytophilum inhibits human neutrophil apoptosis via transcriptional upregulation of bfl-1 and inhibition of mitochondria-mediated activation of caspase 3.

Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents – Analyzing the host-pathogen-vector interface in a metropolitan area

Directory of Open Access Journals (Sweden)

Silaghi Cornelia

2012-09-01

Full Text Available Abstract Background The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Methods Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice, were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. Results 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Conclusion Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures.

Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents – Analyzing the host-pathogen-vector interface in a metropolitan area

Science.gov (United States)

2012-01-01

Background The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Methods Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice), were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. Results 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Conclusion Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures. PMID:22950642

Molecular Survey on Rickettsia spp., Anaplasma phagocytophilum, Borrelia burgdorferi Sensu Lato, and Babesia spp. in Ixodes ricinus Ticks Infesting Dogs in Central Italy.

Science.gov (United States)

Morganti, Giulia; Gavaudan, Stefano; Canonico, Cristina; Ravagnan, Silvia; Olivieri, Emanuela; Diaferia, Manuela; Marenzoni, Maria Luisa; Antognoni, Maria Teresa; Capelli, Gioia; Silaghi, Cornelia; Veronesi, Fabrizia

2017-11-01

Dogs are a common feeding hosts for Ixodes ricinus and may act as reservoir hosts for zoonotic tick-borne pathogens (TBPs) and as carriers of infected ticks into human settings. The aim of this work was to evaluate the presence of several selected TBPs of significant public health concern by molecular methods in I. ricinus recovered from dogs living in urban and suburban settings in central Italy. A total of 212 I. ricinus specimens were collected from the coat of domestic dogs. DNA was extracted from each specimen individually and tested for Rickettsia spp., Borrelia burgdorferi sensu lato, Babesia spp., and Anaplasma phagocytophilum, using real-time and conventional PCR protocols, followed by sequencing. Sixty-one ticks (28.8%) tested positive for TBPs; 57 samples were infected by one pathogen, while four showed coinfections. Rickettsia spp. was detected in 39 specimens (18.4%), of which 32 were identified as Rickettsia monacensis and seven as Rickettsia helvetica. Twenty-two samples (10.4%) tested positive for A. phagocytophilum; Borrelia lusitaniae and Borrelia afzelii were detected in two specimens and one specimen, respectively. One tick (0.5%) was found to be positive for Babesia venatorum (EU1). Our findings reveal the significant exposure of dogs to TBPs of public health concern and provide data on the role of dogs in the circulation of I. ricinus-borne pathogens in central Italy.

Prevalence of Ehrlichia canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, Bartonella vinsonii berkhoffii, and Rickettsia spp. in dogs from Grenada.

Science.gov (United States)

Yabsley, Michael J; McKibben, John; Macpherson, Calum N; Cattan, Peggy F; Cherry, Natalie A; Hegarty, Barbara C; Breitschwerdt, Edward B; O'Connor, Tom; Chandrashekar, Ramaswamy; Paterson, Tara; Perea, Marta Lanza; Ball, Geoffrey; Friesen, Stanley; Goedde, Jill; Henderson, Brooke; Sylvester, Wayne

2008-02-14

To identify the tick-borne pathogens in dogs from Grenada, we conducted a serologic survey for Ehrlichia canis in 2004 (104 dogs) and a comprehensive serologic and molecular survey for a variety of tick-borne pathogens in 2006 (73 dogs). In 2004 and 2006, 44 and 32 dogs (42.3% and 43.8%) were seropositive for E. canis, respectively. In 2006, several tick-borne pathogens were identified by serology and PCR. DNA of E. canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, and Bartonella sp. were identified in 18 (24.7%), 14 (19.2%), 5 (7%), 5 (7%), and 1 (1.4%) dogs, respectively. Six (8.2%) dogs were seropositive for Bartonella vinsonii subsp. berkhoffii. All dogs were seronegative and PCR-negative for Rickettsia spp. Coinfection with two or three pathogens was observed in eight dogs. Partial 16S rRNA E. canis and A. platys sequences were identical to sequences in GenBank. Partial 18S rRNA gene sequences from the Grenadian H. canis were identical to each other and had one possible mismatch (ambiguous base) from H. canis detected from Spain and Brazil. Grenadian B. c. vogeli sequences were identical to B. c. vogeli from Brazil and Japan. All of the detected pathogens are transmitted, or suspected to be transmitted, by Rhipicephalus sanguineus. Results of this study indicate that dogs from Grenada are infected with multiple tick-borne pathogens; therefore, tick-borne diseases should be included as differentials for dogs exhibiting thrombocytopenia, leukopenia, fever, or lethargy. One pathogen, E. canis, is also of potential public health significance.

A comparison of DNA extraction protocols from blood spotted on FTA cards for the detection of tick-borne pathogens by Reverse Line Blot hybridization.

Science.gov (United States)

Hailemariam, Zerihun; Ahmed, Jabbar Sabir; Clausen, Peter-Henning; Nijhof, Ard Menzo

2017-01-01

An essential step in the molecular detection of tick-borne pathogens (TBPs) in blood is the extraction of DNA. When cooled storage of blood under field conditions prior to DNA extraction in a dedicated laboratory is not possible, the storage of blood on filter paper forms a promising alternative. We evaluated six DNA extraction methods from blood spotted on FTA Classic ® cards (FTA cards), to determine the optimal protocol for the subsequent molecular detection of TBPs by PCR and the Reverse Line Blot hybridization assay (RLB). Ten-fold serial dilutions of bovine blood infected with Babesia bovis, Theileria mutans, Anaplasma marginale or Ehrlichia ruminantium were made by dilution with uninfected blood and spotted on FTA cards. Subsequently, DNA was extracted from FTA cards using six different DNA extraction protocols. DNA was also isolated from whole blood dilutions using a commercial kit. PCR/RLB results showed that washing of 3mm discs punched from FTA cards with FTA purification reagent followed by DNA extraction using Chelex ® resin was the most sensitive procedure. The detection limit could be improved when more discs were used as starting material for the DNA extraction, whereby the use of sixteen 3mm discs proved to be most practical. The presented best practice method for the extraction of DNA from blood spotted on FTA cards will facilitate epidemiological studies on TBPs. It may be particularly useful for field studies where a cold chain is absent. Copyright © 2016 Elsevier GmbH. All rights reserved.

Control de Rhipicephalus microplus (Acari: Ixodidae mediante el uso del hongo entomopatógeno Metarhizium anisopliae (Hypocreales: Clavicipitaceae. Revisión

Directory of Open Access Journals (Sweden)

Melina Maribel Ojeda-Chi

2011-01-01

Full Text Available Las infestaciones de la garrapata del ganado, Rhipicephalus microplus, producen el mayor problema global de ectoparásitos en ganado de regiones tropicales y subtropicales, provocan importantes pérdidas económicas en la producción de carne, leche y pieles, además incrementan los gastos derivados de los programas de control, y son capaces de transmitir Babesia bovis, B. bigemina y Anaplasma marginale. El control de R. microplus se basa principalmente en el uso de ixodicidas, sin embargo, su uso irracional ha propiciado la aparición de garrapatas resistentes a las principales familias de ixodicidas, siendo necesario desarrollar alternativas de control no químico. Una de estas alternativas es el uso de hongos entomopatógenos, entre los que se encuentra Metarhizium anisopliae (Hypocreales, Clavicipitaceae el cual ha demostrado ser eficiente, tanto en estudios in vitro como in vivo, para el control de las diferentes fases evolutivas de R. microplus, causa disminución en la tasa de oviposición, incrementa el período de incubación y de eclosión, además produce la muerte de larvas y garrapatas adultas con porcentajes de eficiencia de hasta el 100 %. Diferentes estudios demuestran que M. anisopliae representa una alternativa no química sustentable para el control de garrapatas. La presente revisión tiene como objetivo presentar información actualizada sobre el uso de diferentes cepas de M. anisopliae en el control de la garrapata R.microplus.

NCBI nr-aa BLAST: CBRC-GGOR-01-1354 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1354 ref|YP_003328481.1| hypothetical protein ACIS_00561 [Anaplasma centrale str. Israel...] gb|ACZ49167.1| hypothetical protein ACIS_00561 [Anaplasma centrale str. Israel] YP_003328481.1 0.002 28% ...

NCBI nr-aa BLAST: CBRC-GGOR-01-1354 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-GGOR-01-1354 ref|YP_003328565.1| hypothetical protein ACIS_00677 [Anaplasma centrale str. Israel...] gb|ACZ49251.1| hypothetical protein ACIS_00677 [Anaplasma centrale str. Israel] YP_003328565.1 0.002 28% ...

A comparative study of clinical manifestations, haematological and serological responses after experimental infection with Anaplasma phagocytophilum in two Norwegian sheep breeds

Directory of Open Access Journals (Sweden)

Sandstedt Karin

2011-02-01

Full Text Available Abstract Background It has been questioned if the old native Norwegian sheep breed, Old Norse Sheep (also called Norwegian Feral Sheep, normally distributed on coastal areas where ticks are abundant, is more protected against tick-borne infections than other Norwegian breeds due to a continuously high selection pressure on pasture. The aim of the present study was to test this hypothesis in an experimental infection study. Methods Five-months-old lambs of two Norwegian sheep breeds, Norwegian White (NW sheep and Old Norse (ON sheep, were experimentally infected with a 16S rRNA genetic variant of Anaplasma phagocytophilum (similar to GenBank accession number M73220. The experiment was repeated for two subsequent years, 2008 and 2009, with the use of 16 lambs of each breed annually. Ten lambs of each breed were inoculated intravenously each year with 0.4 ml A. phagocytophilum-infected blood containing approximately 0.5 × 106 infected neutrophils/ml. Six lambs of each breed were used as uninfected controls. Half of the primary inoculated lambs in each breed were re-challenged with the same infectious dose at nine (2008 and twelve (2009 weeks after the first challenge. The clinical, haematological and serological responses to A. phagocytophilum infection were compared in the two sheep breeds. Results The present study indicates a difference in fever response and infection rate between breeds of Norwegian sheep after experimental infection with A. phagocytophilum. Conclusion Although clinical response seems to be less in ON-lambs compared to NW-lambs, further studies including more animals are needed to evaluate if the ON-breed is more protected against tick-borne infections than other Norwegian breeds.

Comparative genomics of emerging human ehrlichiosis agents.

Directory of Open Access Journals (Sweden)

Julie C Dunning Hotopp

2006-02-01

Full Text Available Anaplasma (formerly Ehrlichia phagocytophilum, Ehrlichia chaffeensis, and Neorickettsia (formerly Ehrlichia sennetsu are intracellular vector-borne pathogens that cause human ehrlichiosis, an emerging infectious disease. We present the complete genome sequences of these organisms along with comparisons to other organisms in the Rickettsiales order. Ehrlichia spp. and Anaplasma spp. display a unique large expansion of immunodominant outer membrane proteins facilitating antigenic variation. All Rickettsiales have a diminished ability to synthesize amino acids compared to their closest free-living relatives. Unlike members of the Rickettsiaceae family, these pathogenic Anaplasmataceae are capable of making all major vitamins, cofactors, and nucleotides, which could confer a beneficial role in the invertebrate vector or the vertebrate host. Further analysis identified proteins potentially involved in vacuole confinement of the Anaplasmataceae, a life cycle involving a hematophagous vector, vertebrate pathogenesis, human pathogenesis, and lack of transovarial transmission. These discoveries provide significant insights into the biology of these obligate intracellular pathogens.

Genome-wide Anaplasma phagocytophilum AnkA-DNA interactions are enriched in intergenic regions and gene promoters and correlate with infection-induced differential gene expression.

Directory of Open Access Journals (Sweden)

J Stephen Dumler

2016-09-01

Full Text Available Anaplasma phagocytophilum, an obligate intracellular prokaryote, infects neutrophils and alters cardinal functions via reprogrammed transcription. Large contiguous regions of neutrophil chromosomes are differentially expressed during infection. Secreted A. phagocytophilum effector AnkA transits into the neutrophil or granulocyte nucleus to complex with DNA in heterochromatin across all chromosomes. AnkA binds to gene promoters to dampen cis-transcription and also has features of matrix attachment region (MAR-binding proteins that regulate three-dimensional chromatin architecture and coordinate transcriptional programs encoded in topologically-associated chromatin domains. We hypothesize that identification of additional AnkA binding sites will better delineate how A. phagocytophilum infection results in reprogramming of the neutrophil genome. Using AnkA-binding ChIP-seq, we showed that AnkA binds broadly throughout all chromosomes in a reproducible pattern, especially at: i intergenic regions predicted to be matrix attachment regions (MARs; ii within predicted lamina-associated domains; and iii at promoters ≤3,000 bp upstream of transcriptional start sites. These findings provide genome-wide support for AnkA as a regulator of cis-gene transcription. Moreover, the dominant mark of AnkA in distal intergenic regions known to be AT-enriched, coupled with frequent enrichment in the nuclear lamina, provides strong support for its role as a MAR-binding protein and genome re-organizer. AnkA must be considered a prime candidate to promote neutrophil reprogramming and subsequent functional changes that belie improved microbial fitness and pathogenicity.

Redes comunitarias: un desafío para escuelas urbano-marginales (COMMUNITY NETWORKS: A CHALLENGE FOR URBAN MARGINAL SCHOOLS

Directory of Open Access Journals (Sweden)

Moscoloni Bicchi Nora

2009-04-01

Full Text Available Resumen: Las ideas básicas de este trabajo son conocer y comprender el entramado de la red de relaciones entre los distintos actores de las instituciones: escuela y organismos de la comunidad y su incidencia en la calidad educativa / calidad de vida. Analizamos la visión de los distintos actores educativos acerca de la inserción de la escuela en la comunidad. Tomamos como punto de partida el análisis de las relaciones entre calidad educativa y calidad de vida, en poblaciones urbano-marginales. Realizamos en primer lugar una investigación exploratoria, para conocer las características generales de escuelas que reciben población marginal. En una segunda etapa seleccionamos cuatro escuelas, que tomamos como casos e indagamos sus problemáticas. En ellas observamos gran dificultad para la construcción de redes comunitarias desde la institución escolar. Si bien responden a los problemas puntuales, mediante cambios o innovaciones planificados dinámica y flexiblemente, no existen soluciones duraderas debido a la falta de una convocatoria que comprometa a todas las instituciones de la comunidad constituyendo una efectiva relación en red. Estos resultados alcanzados en la investigación son producto de la triangulación de los datos estadísticos, documentales e históricos así como de los procedentes de la observación participante y de la información de las entrevistas en profundidad.Abstract:The basic ideas of this work are to know and understand the fabric of the network of relationships between the different institutions involved in school and community agencies and their impact on the quality of education / quality of life. The vision of the different actors of education about the insertion of the school in the community is analyzed from the point of view of the school. The analysis started studying how the quality of education is related to the quality of life in marginalized urban populations. At first an exploratory research was

Molecular characterization of the recombinant protein RmLTI-BmCG-LTB: Protective immunity against Rhipicephalus (Boophilus microplus.

Directory of Open Access Journals (Sweden)

Bárbara Guimarães Csordas

Full Text Available The bovine tick Rhipicephalus (Boophilus microplus is found in several tropical and subtropical regions of the world. This parasite transmits pathogens that cause disease, such as babesiosis (Babesia bovis and B. bigemina and anaplasmosis (Anaplasma marginale. Tick infestations cause enormous livestock losses, and controlling tick infestations and the transmission of tick-borne diseases remains a challenge for the livestock industry. Because the currently available commercial vaccines offer only partial protection against R. (B. microplus, there is a need for more efficient vaccines. Several recombinant antigens have been evaluated using different immunization strategies, and they show great promise. This work describes the construction and immunological characterization of a multi-antigen chimera composed of two R. (B. microplus antigens (RmLTI and BmCG and one Escherichia coli antigen (B subunit, LTB. The immunogenic regions of each antigen were selected and combined to encode a single polypeptide. The gene was cloned and expressed in E. coli. For all of the experiments, two groups (treated and control of four Angus heifers (3-6 months old were used. The inoculation was performed via intramuscular injection with 200 μg of purified recombinant chimeric protein and adjuvated. The chimeric protein was recognized by specific antibodies against each subunit and by sera from cattle inoculated with the chimera. Immunization of RmLTI-BmCG-LTB cattle reduced the number of adult female ticks by 6.29% and vaccination of cattle with the chimeric antigen provided 55.6% efficacy against R. (B. microplus infestation. The results of this study indicate that the novel chimeric protein is a potential candidate for the future development of a more effective vaccine against R. (B. microplus.

Simultaneous Detection of Bovine Theileria and Babesia Species by Reverse Line Blot Hybridization

Science.gov (United States)

Gubbels, J. M.; de Vos, A. P.; van der Weide, M.; Viseras, J.; Schouls, L. M.; de Vries, E.; Jongejan, F.

1999-01-01

A reverse line blot (RLB) assay was developed for the identification of cattle carrying different species of Theileria and Babesia simultaneously. We included Theileria annulata, T. parva, T. mutans, T. taurotragi, and T. velifera in the assay, as well as parasites belonging to the T. sergenti-T. buffeli-T. orientalis group. The Babesia species included were Babesia bovis, B. bigemina, and B. divergens. The assay employs one set of primers for specific amplification of the rRNA gene V4 hypervariable regions of all Theileria and Babesia species. PCR products obtained from blood samples were hybridized to a membrane onto which nine species-specific oligonucleotides were covalently linked. Cross-reactions were not observed between any of the tested species. No DNA sequences from Bos taurus or other hemoparasites (Trypanosoma species, Cowdria ruminantium, Anaplasma marginale, and Ehrlichia species) were amplified. The sensitivity of the assay was determined at 0.000001% parasitemia, enabling detection of the carrier state of most parasites. Mixed DNAs from five different parasites were correctly identified. Moreover, blood samples from cattle experimentally infected with two different parasites reacted only with the corresponding species-specific oligonucleotides. Finally, RLB was used to screen blood samples collected from carrier cattle in two regions of Spain. T. annulata, T. orientalis, and B. bigemina were identified in these samples. In conclusion, the RLB is a versatile technique for simultaneous detection of all bovine tick-borne protozoan parasites. We recommend its use for integrated epidemiological monitoring of tick-borne disease, since RLB can also be used for screening ticks and can easily be expanded to include additional hemoparasite species. PMID:10325324

Molecular detection and identification of Rickettsiales pathogens in dog ticks from Costa Rica.

Science.gov (United States)

Campos-Calderón, Liliana; Ábrego-Sánchez, Leyda; Solórzano-Morales, Antony; Alberti, Alberto; Tore, Gessica; Zobba, Rosanna; Jiménez-Rocha, Ana E; Dolz, Gaby

2016-10-01

Although vector-borne diseases are globally widespread with considerable impact on animal production and on public health, few reports document their presence in Central America. This study focuses on the detection and molecular identification of species belonging to selected bacterial genera (Ehrlichia, Anaplasma and Rickettsia) in ticks sampled from dogs in Costa Rica by targeting several genes: 16S rRNA/dsb genes for Ehrlichia; 16S rRNA/groEL genes for Anaplasma, and ompA/gltA/groEL genes for Rickettsia. PCR and sequence analyses provides evidences of Ehrlichia canis, Anaplasma platys, and Anaplasma phagocytophilum infection in Rhipicephalus sanguineus s.l ticks, and allow establishing the presence of Rickettsia monacensis in Ixodes boliviensis. Furthermore, the presence of recently discovered Mediterranean A. platys-like strains is reported for the first time in Central America. Results provide new background on geographical distribution of selected tick-transmitted bacterial pathogens in Costa Rica and on their molecular epidemiology, and are pivotal to the development of effective and reliable diagnostic tools in Central America. Copyright © 2016 Elsevier GmbH. All rights reserved.

La agricultura y el bienestar nacional en el mundo

Directory of Open Access Journals (Sweden)

Claudio Bravo Ortega

2009-01-01

Full Text Available Las estimaciones de los efectos marginales del bienestar sugieren que el desarrollo agrícola ha tenido importantes efectos positivos en el bienestar nacional, en particular en los países en desarrollo. Los países de la América Latina y del Caribe también se han beneficiado del crecimiento agrícola, pero la producción no agrícola también ha tenido efectos marginales de bienestar, cuya magnitud es mayor que los proporcionados por las actividades agrícolas. Los países industrializados de altos ingresos obtuvieron ganancias marginales positivas de sus actividades no agrícolas, pero los efectos de la agricultura son negativos. Estos cálculos de los efectos marginales de bienestar en las diferentes regiones dependen de estimaciones econométricas de las elasticidades que relacionan las actividades económicas agrícolas y no agrícolas con cuatro elementos propuestos en una función teórica del bienestar nacional: el PIB nacional per capita, el ingreso promedio de los hogares más pobres dentro de los países, los resultados ambientales en lo que se refiere a la contaminación del aire y del agua y la deforestación, y la volatilidad macroeconómica. Los modelos econométricos fueron estimados empleando varias técnicas econométricas que tratan de la causalidad y la heterogeneidad internacional.

Anaplasma phagocytophilum and Babesia spp. in roe deer (Capreolus capreolus), fallow deer (Dama dama) and mouflon (Ovis musimon) in Germany.

Science.gov (United States)

Kauffmann, Melanie; Rehbein, Steffen; Hamel, Dietmar; Lutz, Walburga; Heddergott, Mike; Pfister, Kurt; Silaghi, Cornelia

2017-02-01

Infections with the tick-borne pathogens Anaplasma phagocytophilum and Babesia spp. can cause febrile disease in several mammalian species, including humans. Wild ruminants in Europe are suggested to serve as reservoir hosts for particular strains or species of these pathogens. The aims of this study were to investigate the occurrence of A. phagocytophilum and Babesia spp. in roe deer (Capreolus capreolus), fallow deer (Dama dama) and mouflon (Ovis musimon orientalis) in Germany, and the diversity and host association of genetic variants of A. phagocytophilum and Babesia species. From 2009 to 2010, 364 spleen samples from 153 roe deer, 43 fallow deer and 168 mouflon from 13 locations in Germany were tested for DNA of A. phagocytophilum and Babesia spp. by real-time PCR or conventional PCR, respectively. Variants of A. phagocytophilum were investigated with a nested PCR targeting the partial 16S rRNA gene, and species of piroplasms were identified by sequencing. DNA of A. phagocytophilum was detected in 303 (83.2%) samples: roe deer, 96.1% (147/153); fallow deer, 72.1% (31/43); and mouflon, 74.4% (125/168). Sequence analysis of 16S rRNA-PCR products revealed the presence of nine different genetic variants. DNA of Babesia spp. was found in 113 (31.0%) samples: roe deer, 62.8% (96/153); fallow deer, 16.3% (6/43); and mouflon, 6.5% (11/168). Babesia capreoli, Babesia sp. EU1 (referred to also as B. venatorum), B. odocoilei-like and a Theileria species were identified. Co-infections with A. phagocytophilum and Babesia spp. were detected in 30.0% of the animals which were tested positive for A. phagocytophilum and/or Babesia spp. Roe deer had a significantly higher percentage of co-infections (60.8%), followed by fallow deer (14.0%) and mouflon (6.5%). Thus, the results suggest that roe deer plays a key role in the endemic cycles of the pathogens investigated. Copyright © 2016 Elsevier Ltd. All rights reserved.

EL NIVEL EDUCATIVO Y SOCIOECONÓMICO DEL HOGAR Y HABILIDADES PRE-LECTORAS EN ESCUELAS URBANO Y URBANO-MARGINALES DE LA PROVINCIA DE MENDOZA-ARGENTINA

Directory of Open Access Journals (Sweden)

Yanina Canales Jara

2016-01-01

Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

Prevalence of select vector-borne disease agents in owned dogs of Ghana

Directory of Open Access Journals (Sweden)

Lorelei L. Clarke

2014-09-01

Full Text Available Ticks, sera and ethylenediaminetetraacetic acid (EDTA blood were collected from dogs evaluated at the Amakom Veterinary Clinic in Kumasi, Ghana. Sera were evaluated for Dirofilaria immitis antigen and antibodies against Borrelia burgdorferi, Anaplasma phagocytophilum and Ehrlichia canis. Conventional polymerase chain reaction assays designed to amplify the deoxyribonucleic acid (DNA ofEhrlichia spp. or Anaplasma spp. or Neorickettsia spp. or Wolbachia spp., Babesia spp., Rickettsia spp., Hepatozoon spp., Bartonella spp. and the haemoplasmas were performed on DNA extracted from EDTA blood and all positive amplicons were sequenced. This small survey shows that the following vector-borne pathogens are present in urban Ghanian dogs: Ehrlichia canis, Hepatozoon canis,Dirofilaria immitis and Anaplasma platys. Bartonella henselae was isolated from ticks but not from the dogs.

Survey on tick-borne pathogens in thoroughbred horses in the Hidaka district, Hokkaido, Japan.

Science.gov (United States)

Ybañez, Adrian Patalinghug; Sato, Fumio; Nambo, Yasuo; Fukui, Takashi; Masuzawa, Toshiyuki; Ohashi, Norio; Matsumoto, Kotaro; Kishimoto, Toshio; Inokuma, Hisashi

2013-01-31

A total of 87 Thoroughbred horses and 10 ixodid ticks from a ranch in Hidaka district, Hokkaido were tested for tick-borne diseases. Using the indirect fluorescent antibody (IFA) method, 3.4, 92.0 and 97.7% of the horses showed antibody titers of ≥ 80 against Anaplasma phagocytophilum, Rickettsia helvetica, and Borrelia garinii, respectively. This is the first report of infection with the 3 pathogens in horses in Japan. Using PCR, DNAs from the peripheral blood of all horses were found negative with any Anaplasma, Rickettsia and Borrelia spp., while those from Haemaphysalis megaspinosa ticks were found positive for Anaplasma sp. closely related to A. phagocytophilum in Japan, and A. bovis. B. japonica was also detected in an H. flava tick for the first time.

Serological survey of Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, and Ehrlichia canis infections in rural and urban dogs in Central Italy

Directory of Open Access Journals (Sweden)

Valentina Virginia Ebani

2014-11-01

Full Text Available [b]Introduction[i][/i][/b][i]. Borrelia burgdorferi [/i]sensu lato (s.l. and Anaplasma phagocytophilum are well known zoonotic pathogens, whereas[i] Ehrlichia canis[/i] is usually considered to be of veterinary concern, although on the basis of recent reports it also seems to be able to infect humans. [b]objective[/b]. The aim of the study was to determine the seroprevalence of [i]B. burgdorferi [/i]s.l., A. phagocytophilum and [i]E. canis[/i] in an Italian canine population, and to verify if there are differences between dogs living in urban areas and those from a rural environment. [b]materials and method.[/b] Blood sera of 1,965 dogs, 1,235 from cities and 730 from rural areas, were tested by indirect immunofluorescent assay (IFAT. [b]results[/b]. The overall seroprevalence was highest for E. canis (7.07%, followed by [i]A. phagocytophilum[/i] (4.68%, and [i]B. burgdorferi[/i] s.l. (1.47%. Rural dogs showed the highest seroprevalence to [i]B. burgdorferi[/i] s.l. and [i]A. phagocytophilum[/i]. No significant differences were observed between rural and urban [i]E. canis[/i]-positive dogs. A low percentage (1.32% of dogs with dual seropositivity was detected, and no triple positive reactions were observed. No significant differences were detected in the seroprevalence of the three agents in relationship to the age and gender of the dogs. Seroprevalence in the five years considered were not statistically different, except for the lowest rate for [i]E. canis[/i] observed in 2012. [b]conclusions[/b]. The results confirm the presence of [i]B. burgdorferi[/i] s.l., [i]A. phagocytophilum[/i] and [i]E. canis[/i] in Italian dogs in both urban and rural areas. Monitoring pet dogs, which share the same environment with their owners, is useful for identifying the presence of tick-borne disease agents of both veterinary and public health significance

El nivel educativo y socioeconómico del hogar y habilidades pre-lectoras en escuelas urbano y urbano-marginales de la provincia de Mendoza-Argentina

Directory of Open Access Journals (Sweden)

Yanina Canales, Jara

2016-05-01

Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

The risk of exposure to Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Babesia sp. and co-infections in Ixodes ricinus ticks on the territory of Niepołomice forest (southern Poland).

Science.gov (United States)

Asman, Marek; Nowak, Magdalena; Cuber, Piotr; Strzelczyk, Joanna; Szilman, Ewa; Szilman, Piotr; Trapp, Gizela; Siuda, Krzysztof; Solarz, Krzysztof; Wiczkowski, Andrzej

2013-01-01

Niepołomice Forest is located about 20 kilometers east of Cracow (Malopolska province, southern Poland). Its natural and touristic values, as well as wide range of hosts occurring within indicate this to be an area of high risk of exposure to Ixodes ricinus and tick-borne diseases it transfers. I. ricinus is a common species in Poland and Europe. Its seasonal activity begins in Poland in the early spring, and ends with late autumn. A total number of 129 specimens of I. ricinus was collected by flagging in Niepołomice Forest. DNA was isolated by ammonia method from 30 randomly-selected individuals. PCR was used to detect tick-borne pathogens with primers specific for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato and Babesia sp. Molecular studies confirmed the presence of all three pathogens in I. ricinus. A. phagocytophilum was found in 76.7%, Babesia sp., 60%, B. burgdorferi s. l., in 3.3% of studied ticks. A. phagocytophilum co-infection with Babesia sp., was found in 46.7% of the specimens. A co-infection of all three tested pathogens was recorded in one case (3.3%). In Poland the problem of tick-borne diseases is a growing issue, therefore people residing in southern Polish touristic areas should be informed about the prevention and protection against ticks.

Survey of selected pathogens and blood parameters of northern yellowstone elk: Wolf sanitation effect implications

Science.gov (United States)

Barber-Meyer, S. M.; White, P.J.; Mech, L.D.

2007-01-01

The restoration or conservation of predators could reduce seroprevalences of certain diseases in prey if predation selectively removes animals exhibiting clinical signs. We assessed disease seroprevalences and blood parameters of 115 adult female elk (Cervus elaphus) wintering on the northern range of Yellowstone National Park [YNP] during 2000-2005 and compared them to data collected prior to wolf (Canis lupus) restoration (WR) in 1995 and to two other herds in Montana to assess this prediction. Blood parameters were generally within two standard deviations of the means observed in other Montana herds (Gravelly-Snowcrest [GS] and Garnet Mountain [GM]), but Yellowstone elk had higher seroprevalences of parainfluenza-3 virus (95% CI YNP = 61.1-78.6, GS = 30.3-46.5) and bovine-virus-diarrhea virus type 1 (95% CI YNP = 15.9-31.9, GM = 0). In comparisons between pre-wolf restoration [pre-WR] (i.e., prior to 1995) seroprevalences with those post-wolf restoration [post-WR] in Yellowstone, we found lower seroprevalences for some disease-causing agents post-wolf restoration (e.g., bovine-virus-diarrhea virus type-1 [95% CI pre-WR = 73.1-86.3, post-WR = 15.9-31.9] and bovine-respiratory syncytial virus [95% CI pre-WR = 70.0-83.8, post-WR = 0]), but similar (e.g., Brucella abortus [95% CI pre-WR = 0-4.45, post-WR = 0-4.74] and epizootic hemorrhagic disease virus [95% CI pre-WR = 0, post-WR = 0]) or higher for others (e.g., Anaplasma marginale [95% CI pre-WR = 0, post-WR = 18.5-38.7] and Leptospira spp. [95% CI pre-WR = 0.5-6.5, post-WR = 9.5-23.5]). Though we did not detect an overall strong predation effect through reduced disease seroprevalence using retrospective comparisons with sparse data, our reference values will facilitate future assessments of this issue.

Bmcystatin, a cysteine proteinase inhibitor characterized from the tick Boophilus microplus

International Nuclear Information System (INIS)

Lima, Cassia A.; Sasaki, Sergio D.; Tanaka, Aparecida S.

2006-01-01

The bovine tick Rhipicephalus (Boophilus) microplus is a blood-sucking animal, which is responsible for Babesia spp and Anaplasma marginale transmission for cattle. From a B. microplus fat body cDNA library, 465 selected clones were sequenced randomly and resulted in 60 Contigs. An open reading frame (ORF) contains 98 amino acids named Bmcystatin, due to 70% amino acid identity to a classical type 1 cystatin from Ixodes scapularis tick (GenBank Accession No. DQ066227). The Bmcystatin amino acid sequence analysis showed two cysteine residues, theoretical pI of 5.92 and M r of 11kDa. Bmcystatin gene was cloned in pET 26b vector and the protein expressed using bacteria Escherichia coli BL21 SI. Recombinant Bmcystatin (rBmcystatin) purified by affinity chromatography on Ni-NTA-agarose column and ionic exchange chromatography on HiTrap Q column presented molecular mass of 11kDa, by SDS-PAGE and the N-terminal amino acid sequenced revealed unprocessed N-terminal containing part of pelB signal sequence. Purified rBmcystatin showed to be a C1 cysteine peptidase inhibitor with K i value of 0.1 and 0.6nM for human cathepsin L and VTDCE (vitellin degrading cysteine endopeptidase), respectively. The rBmcystatin expression analyzed by semi-quantitative RT-PCR confirmed the amplification of a specific DNA sequence (294bp) in the fat body and ovary cDNA preparation. On the other hand, a protein band was detected in the fat body, ovary, and the salivary gland extracts using anti-Bmcystatin antibody by Western blot. The present results suggest a possible role of Bmcystatin in the ovary, even though the gene was cloned from the fat body, which could be another site of this protein synthesis

Detection of Babesia bovis carrier cattle by using polymerase chain reaction amplification of parasite DNA.

Science.gov (United States)

Fahrimal, Y; Goff, W L; Jasmer, D P

1992-01-01

Carrier cattle infected with Babesia bovis are difficult to detect because of the low numbers of parasites that occur in peripheral blood. However, diagnosis of low-level infections with the parasite is important for evaluating the efficacies of vaccines and in transmission and epidemiological studies. We used the polymerase chain reaction (PCR) to amplify a portion of the apocytochrome b gene from the parasite and tested the ability of this method to detect carrier cattle. The target sequence is associated with a 7.4-kb DNA element in undigested B. bovis genomic DNA (as shown previously), and the amplified product was detected by Southern and dot blot hybridization. The assay was specific for B. bovis, since no amplification was detected with Babesia bigemina, Trypanosoma brucei, Anaplasma marginale, or leukocyte DNA. The target sequence was amplified in DNA from B. bovis Mexico, Texas, and Australia S and L strains, demonstrating the applicability of the method to strains from different geographic regions. The sensitivity of the method ranged from 1 to 10 infected erythrocytes extracted from 0.5 ml of blood. This sensitivity was about 1,000 times greater than that from the use of unamplified parasite DNA. By the PCR method, six B. bovis carrier cattle were detected 86% of the time (range, 66 to 100%) when they were tested 11 times, while with microscopic examination of thick blood smears, the same carrier cattle were detected only 36% of the time (range, 17 to 66%). The method provides a useful diagnostic tool for detecting B. bovis carrier cattle, and the sensitivity is significantly improved over that of current methods. The results also suggest that characteristics of the apocytchrome b gene may make this a valuable target DNA for PCR-based detection of other hemoparasites. Images PMID:1624551

Vaccinomics Approach to the Identification of Candidate Protective Antigens for the Control of Tick Vector Infestations and Anaplasma phagocytophilum Infection

Directory of Open Access Journals (Sweden)

Marinela Contreras

2017-08-01

Full Text Available Anaplasma phagocytophilum is an emerging tick-borne pathogen causing human granulocytic anaplasmosis (HGA, tick-borne fever (TBF in small ruminants, and other forms of anaplasmosis in different domestic and wild animals. The main vectors of this pathogen are Ixodes tick species, particularly I. scapularis in the United States and I. ricinus in Europe. One of the main limitations for the development of effective vaccines for the prevention and control of A. phagocytophilum infection and transmission is the identification of effective tick protective antigens. The objective of this study was to apply a vaccinomics approach to I. scapularis-A. phagocytophilum interactions for the identification and characterization of candidate tick protective antigens for the control of vector infestations and A. phagocytophilum infection. The vaccinomics pipeline included the use of quantitative transcriptomics and proteomics data from uninfected and A. phagocytophilum-infected I. scapularis ticks for the selection of candidate protective antigens based on the variation in tick mRNA and protein levels in response to infection, their putative biological function, and the effect of antibodies against these proteins on tick cell apoptosis and pathogen infection. The characterization of selected candidate tick protective antigens included the identification and characterization of I. ricinus homologs, functional characterization by different methodologies including RNA interference, immunofluorescence, gene expression profiling, and artificial tick feeding on rabbit antibodies against the recombinant antigens to select the candidates for vaccination trials. The vaccinomics pipeline developed in this study resulted in the identification of two candidate tick protective antigens that could be selected for future vaccination trials. The results showed that I. scapularis lipocalin (ISCW005600 and lectin pathway inhibitor (AAY66632 and I. ricinus homologs constitute

Tissue-specific signatures in the transcriptional response to Anaplasma phagocytophilum infection of Ixodes scapularis and Ixodes ricinus tick cell lines

Directory of Open Access Journals (Sweden)

Pilar eAlberdi

2016-02-01

Full Text Available Anaplasma phagocytophilum are transmitted by Ixodes spp. ticks and have become one of the most common and relevant tick-borne pathogens due to their impact on human and animal health. Recent results have increased our understanding of the molecular interactions between Ixodes scapularis and A. phagocytophilum through the demonstration of tissue-specific molecular pathways that ensure pathogen infection, development and transmission by ticks. However, little is known about the Ixodes ricinus genes and proteins involved in the response to A. phagocytophilum infection. The tick species I. scapularis and I. ricinus are evolutionarily closely related and therefore similar responses are expected in A. phagocytophilum-infected cells. However, differences may exist between I. scapularis ISE6 and I. ricinus IRE/CTVM20 tick cells associated with tissue-specific signatures of these cell lines. To address this hypothesis, the transcriptional response to A. phagocytophilum infection was characterized by RNA sequencing and compared between I. scapularis ISE6 and I. ricinus IRE/CTVM20 tick cell lines. The transcriptional response to infection of I. scapularis ISE6 cells resembled that of tick hemocytes while the response in I. ricinus IRE/CTVM20 cells was more closely related to that reported previously in infected tick midguts. The inhibition of cell apoptosis by A. phagocytophilum appears to be a key adaptation mechanism to facilitate infection of both vertebrate and tick cells and was used to investigate further the tissue-specific response of tick cell lines to pathogen infection. The results supported a role for the intrinsic pathway in the inhibition of cell apoptosis by A. phagocytophilum infection of I. scapularis ISE6 cells. In contrast, the results in I. ricinus IRE/CTVM20 cells were similar to those obtained in tick midguts and suggested a role for the JAK/STAT pathway in the inhibition of apoptosis in tick cells infected with A. phagocytophilum

Post-mortem hemoparasite detection in free-living Brazilian brown brocket deer (Mazama gouazoubira, Fischer 1814

Directory of Open Access Journals (Sweden)

Júlia Angélica Gonçalves da Silveira

Full Text Available Tick-borne infections can result in serious health problems for wild ruminants, and some of these infectious agents can be considered zoonosis. The aim of the present study was the post-mortem detection of hemoparasites in free-living Mazama gouazoubira from Minas Gerais state, Brazil. The deer samples consisted of free-living M. gouazoubira (n = 9 individuals that died after capture. Necropsy examinations of the carcasses were performed to search for macroscopic alterations. Organ samples were collected for subsequent imprint slides, and nested PCR assays were performed to detect hemoparasite species. Imprint slide assays from four deer showed erythrocytes infected with Piroplasmida small trophozoites, and A. marginale corpuscles were observed in erythrocytes from two animals. A. marginale and trophozoite co-infections occurred in two deer. A nested PCR analysis of the organs showed that six of the nine samples were positive for Theileria sp., five were positive for A. phagocytophilum and three were positive for A. marginale, with co-infection occurring in four deer. The results of the present study demonstrate that post-mortemdiagnostics using imprint slides and molecular assays are an effective method for detecting hemoparasites in organs.

Post-mortem hemoparasite detection in free-living Brazilian brown brocket deer (Mazama gouazoubira, Fischer 1814).

Science.gov (United States)

Silveira, Júlia Angélica Gonçalves da; Rabelo, Elida Mara Leite; Lima, Paula Cristina Senra; Chaves, Bárbara Neves; Ribeiro, Múcio Flávio Barbosa

2014-01-01

Tick-borne infections can result in serious health problems for wild ruminants, and some of these infectious agents can be considered zoonosis. The aim of the present study was the post-mortem detection of hemoparasites in free-living Mazama gouazoubira from Minas Gerais state, Brazil. The deer samples consisted of free-living M. gouazoubira (n = 9) individuals that died after capture. Necropsy examinations of the carcasses were performed to search for macroscopic alterations. Organ samples were collected for subsequent imprint slides, and nested PCR assays were performed to detect hemoparasite species. Imprint slide assays from four deer showed erythrocytes infected with Piroplasmida small trophozoites, and A. marginale corpuscles were observed in erythrocytes from two animals. A. marginale and trophozoite co-infections occurred in two deer. A nested PCR analysis of the organs showed that six of the nine samples were positive for Theileria sp., five were positive for A. phagocytophilum and three were positive for A. marginale, with co-infection occurring in four deer. The results of the present study demonstrate that post-mortem diagnostics using imprint slides and molecular assays are an effective method for detecting hemoparasites in organs.

High-throughput screening of tick-borne pathogens in Europe

DEFF Research Database (Denmark)

Michelet, Lorraine; Delannoy, Sabine; Devillers, Elodie

2014-01-01

was conducted on 7050 Ixodes ricinus nymphs collected from France, Denmark, and the Netherlands using a powerful new high-throughput approach. This advanced methodology permitted the simultaneous detection of 25 bacterial, and 12 parasitic species (including; Borrelia, Anaplasma, Ehrlichia, Rickettsia......, Bartonella, Candidatus Neoehrlichia, Coxiella, Francisella, Babesia, and Theileria genus) across 94 samples. We successfully determined the prevalence of expected (Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Rickettsia helvetica, Candidatus Neoehrlichia mikurensis, Babesia divergens, Babesia...

Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud

Directory of Open Access Journals (Sweden)

Élise Prébin

2009-03-01

Full Text Available Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud. Cet article a pour sujet ma relation à la société sud-coréenne, non seulement en tant qu’anthropologue mais aussi en tant que personne adoptée d’origine coréenne. Il relate la manière dont plusieurs sortes de relations ont dû être gérées pendant le terrain. Il a fallu d’un côté me rapprocher de mes informateurs pour pouvoir mener un terrain classique dans une société inconnue, comprendre une culture autre et traiter un sujet relevant des sciences sociales : le retour des adoptés étrangers dans leur pays d’origine. De l’autre, il a fallu établir une bonne distance avec ma famille biologique coréenne en m’en éloignant momentanément. Ma relation avec elle était en effet instable du fait qu’elle reposait sur une contradiction : mon statut d’étrangère en dépit de l’intimité que supposaient les liens du sang. Pourtant, cette relation continue entre ma famille biologique et moi-même a éclairé certaines ambiguïtés relatives au statut des adoptés dans la société sud-coréenne que le temps limité du terrain n’avait pas permis de saisir. Cet article ébauche donc une réflexion épistémologique sur la pertinence d’éléments biographiques dans le traitement anthropologique de certains sujets. Je montre en l’occurrence comment le don en mariage d’une fille biologique adoptée conjure de manière satisfaisante un don en adoption toujours problématique.Finding the right distance: stranger, marginal, ethnologist and relative in south Korea. The topic of this article is my relation to the South Korean society, not only as a social anthropologist but also as a Korean adoptee. I relate the way I had to manage contrasted relations while conducting fieldwork. On one hand, I endeavoured to get closer to my informants in order to conduct classic fieldwork in an unknown society, to understand a different culture

Prevalence of Endoglobular Hemotropic Parasites in Pure Gyr Cattle in Córdoba, Colombia

Directory of Open Access Journals (Sweden)

Rafael Blanco Martínez

2015-12-01

Full Text Available Bovine parasitic sadness produces significant losses in Colombia and it is associated with the presence of ticks. It is caused by microscopic endoglobular hemotropic parasites such as Anaplasma spp. and Babesia spp. In this study, 131 pure Gyr cows were studied from four cattle farms in Córdoba, Colombia. A blood sample of 5 ml was collected from the coccygeal vein for hematocrit determination and for blood smears stained with Wright’s stain, in order to assess intracellular parasitic forms morphologically compatible with Anaplasma spp. and Babesia spp. Chi-square test was used to determine whether the variables of body condition, mucous color, sex and production system (grazing, semi-confinement, and confinement were independent from the frequency of endoglobular hemotropic parasites. The study found that 24.43% of the sampled animals were positive for endoglobular hemotropic parasites; 20.61% (27/131 of them were positive for Anaplasma spp.; 3.05% (4/131 for Babesia spp., and 0.76% (1/131 for both Anaplasma spp. and Babesia spp. No significant differences (p > 0.05 were found for variables of mucous color, sex and production system (grazing, semi-confinement, and confinement. This allowed to register for the first time the prevalence of infection by endoglobular hemotropic parasites in Bos indicus cattle, of the Gyr breed specifically.

Allocation of the transmission service cost with base in marginal costs of the transmission network expansion; Asignacion del costo del servicio de transmision con base en costos marginales de expansion de la red de transmision

Energy Technology Data Exchange (ETDEWEB)

Ruiz Casillas, Manuel E.; Nieva Gomez, Rolando [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

2001-07-01

The transmission charges to the users must be completely defined in those systems where the restructuring has broken up the traditional functions of the companies; in order to introduce competition in the generation and commercialization segments of the electrical energy. The fundamentals of a method used are explained to assure the transmission service cases between their users. The method is based on the marginal expansion costs of the transmission network. Their more known applications have been in competitive markets of energy, in particular, where the energy price is the same one in all the localities. Nevertheless, it can be used under other forms of organization of the electrical industry. In order to illustrate results, the obtained ones from their application to the most important part of the transmission network of the Mexican system that operates interconnected, are presented. [Spanish] Los cargos de transmision a los usuarios deben estar completamente definidos en aquellos sistemas donde la reestructuracion ha desagregado las funciones tradicionales de las empresas; para introducir competencia en los segmentos de generacion y comercializacion de la energia electrica. Se explican los fundamentos de un metodo utilizado para asegurar los casos del servicio de transmision entre sus usuarios. El metodo se basa en los costos marginales de expansion de la red de transmision. Sus aplicaciones mas conocidas han sido en mercados competitivos de energia, en particular, donde el precio de la energia es el mismo en todas las localidades. Sin embargo, puede utilizarse bajo otras formas de organizacion de la industria electrica. Con el proposito de ilustrar resultados, se muestran los obtenidos de su aplicacion a la parte mas importante de la red de transmision del sistema mexicano que opera interconectada.

Investigação molecular de Ehrlichia spp. e Anaplasma platys em felinos domésticos: alterações clínicas, hematológicas e bioquímicas

Directory of Open Access Journals (Sweden)

Elisabete S Correa

2011-10-01

Full Text Available Ehrlichia sp. e Anaplasma platys são micro-organismos Gram negativos, parasitos intracelulares obrigatórios, residindo em vacúolos citoplasmáticos de leucócitos e plaquetas, encontrados no sangue periférico ou em tecidos. Poucos relatos têm sido feitos sobre erliquiose e anaplasmose em gatos no Brasil, os quais são baseados na presença de mórulas em leucócitos e plaquetas, ou pela detecção de anticorpos. O objetivo deste trabalho foi investigar a infecção natural por Ehrlichia sp. e A.platys em gatos no Município de Campos dos Goytacazes-RJ, através da hematoscopia e pela detecção do DNA desses agentes. Foram utilizadas amostras de sangue total e de soro de 91 gatos, independente de raça, sexo e idade. Realizaram-se hemograma, bioquímica sérica e PCR, utilizando oligonucleotídes para Ehrlichia sp. e A.platys. Os dados de hematoscopia mostraram que 9,89% dos gatos apresentaram mórulas em macroplaquetas. O DNA de A.platys foi detectado em 13,18% dos 91 animais e em 44,44% das amostras positivas à hematoscopia. O DNA de Ehrlichia sp. não foi detectado em nenhuma amostra. Nenhuma alteração foi observada nos sinais clínicos nem nos resultados laboratoriais nos animais estudados. Os dados sugerem que os felinos domésticos podem atuar como potenciais reservatórios para A. platys, como forma não sintomática das enfermidades relacionadas

The Microbiome of Ehrlichia-Infected and Uninfected Lone Star Ticks (Amblyomma americanum.

Directory of Open Access Journals (Sweden)

R T Trout Fryxell

Full Text Available The Lone Star tick, Amblyomma americanum, transmits several bacterial pathogens including species of Anaplasma and Ehrlichia. Amblyomma americanum also hosts a number of non-pathogenic bacterial endosymbionts. Recent studies of other arthropod and insect vectors have documented that commensal microflora can influence transmission of vector-borne pathogens; however, little is known about tick microbiomes and their possible influence on tick-borne diseases. Our objective was to compare bacterial communities associated with A. americanum, comparing Anaplasma/Ehrlichia -infected and uninfected ticks. Field-collected questing specimens (n = 50 were used in the analyses, of which 17 were identified as Anaplasma/Ehrlichia infected based on PCR amplification and sequencing of groEL genes. Bacterial communities from each specimen were characterized using Illumina sequencing of 16S rRNA gene amplicon libraries. There was a broad range in diversity between samples, with inverse Simpson's Diversity indices ranging from 1.28-89.5. There were no statistical differences in the overall microbial community structure between PCR diagnosed Anaplasma/Ehrlichia-positive and negative ticks, but there were differences based on collection method (P < 0.05, collection site (P < 0.05, and sex (P < 0.1 suggesting that environmental factors may structure A. americanum microbiomes. Interestingly, there was not always agreement between Illumina sequencing and PCR diagnostics: Ehrlichia was identified in 16S rRNA gene libraries from three PCR-negative specimens; conversely, Ehrlichia was not found in libraries of six PCR-positive ticks. Illumina sequencing also helped identify co-infections, for example, one specimen had both Ehrlichia and Anaplasma. Other taxa of interest in these specimens included Coxiella, Borrelia, and Rickettsia. Identification of bacterial community differences between specimens of a single tick species from a single geographical site indicates that

Efficacy of sarolaner in the prevention of Borrelia burgdorferi and Anaplasma phagocytophilum transmission from infected Ixodes scapularis to dogs.

Science.gov (United States)

Honsberger, Nicole A; Six, Robert H; Heinz, Thomas J; Weber, Angela; Mahabir, Sean P; Berg, Thomas C

2016-05-30

The efficacy of sarolaner (Simparica™, Zoetis) to prevent transmission primarily of Borrelia burgdorferi and secondarily of Anaplasma phagocytophilum from infected wild-caught Ixodes scapularis to dogs was evaluated in a placebo-controlled laboratory study. Twenty-four purpose-bred laboratory Beagles seronegative for B. burgdorferi and A. phagocytophilum antibodies were allocated randomly to one of three treatment groups: placebo administered orally on Days 0 and 7, or sarolaner at 2mg/kg administered orally on Day 0 (28 days prior to tick infestation) or on Day 7 (21 days prior to tick infestation). On Day 28, each dog was infested with approximately 25 female and 25 male wild caught adult I. scapularis that were determined to have prevalence of 57% for B. burgdorferi and 6.7% for A. phagocytophilum by PCR. In situ tick counts were conducted on Days 29 and 30. On Day 33, all ticks were counted and removed. Acaricidal efficacy was calculated based on the reduction of geometric mean live tick counts in the sarolaner-treated groups compared to the placebo-treated group for each tick count. Blood samples collected from each dog on Days 27, 49, 63, 77, 91 and 104 were tested for the presence of B. burgdorferi and A. phagocytophilum antibodies using the SNAP(®) 4Dx(®) Plus Test, and quantitatively assayed for B. burgdorferi antibodies using an ELISA test. Skin biopsies collected on Day 104 were tested for the presence of B. burgdorferi by bacterial culture and PCR. Geometric mean live tick counts for placebo-treated dogs were 14.8, 12.8, and 19.1 on Days 29, 30, and 33, respectively. The percent reductions in mean live tick counts at 1, 2, and 5 days after infestation were 86.3%, 100%, and 100% for the group treated with sarolaner 21 days prior to infestation, and 90.9%, 97.1%, and 100% for the group treated with sarolaner 28 days prior to infestation. Geometric mean live tick counts for both sarolaner-treated groups were significantly lower than those for the

La complejidad de la marginalidad y sus derivaciones en el marco de las economías regionales. El caso de la producción caprina en el extremo sur de Mendoza

Directory of Open Access Journals (Sweden)

María Eugenia Cepparo

2014-12-01

Full Text Available Este trabajo analiza la producción caprina en el departamento de Malargüe, sur de Mendoza, sus vinculaciones con el contexto local y en el marco de las transformaciones y perspectivas de los territorios rurales marginales de nuestras economías regionales. Nos referiremos a la situación actual y a la posibilidad de producción y faenamiento de carne caprina en el departamento. El estudio se enriquece, por una parte, con los aportes del marco conceptual de los procesos derivados de la marginalidad, y por la otra con las dinámicas y contextos de las economías regionales, y dentro de ellas, la de los sistemas productivos marginales que acompañan a las producciones extrapampeanas más tradicionales y destacadas.

Propiedades de crecimiento de las líneas celulares DH82 y RF/6A bajo condiciones normales de laboratorio

Directory of Open Access Journals (Sweden)

Samara Machuca Figueroa

2016-01-01

Full Text Available La línea celular RF/6A ha sido utilizada en estudios de corto plazo evaluando fármacos o infecciones experimentales con Anaplasma marginale; en contraste, DH82 es utilizada para la multiplicación de Ehrlichia canis. No obstante, se desconocen condiciones específicas de su crecimiento, por lo que se diseñaron varios experimentos para resolver interrogantes de su propagación. Ambas líneas, se adquirieron de la American Type Culture Collection, mantenidas en Medio Mínimo Esencial suplementado con suero fetal bovino, piruvato de Na y NaHCO3 e incubadas en atmósfera de 5% de CO2 en aire, a 37 °C. Los primeros ensayos, en placas de 24 pozos, esclarecieron los valores de dosis mínima inicial, que fueron 62,500 y 8,836 células/pozo para DH82 y RF/6A; así como los de densidad de siembra; cultivos con concentraciones de 5, 10, 20 y 40 células por mm2, cosechados con solución Tripsina-EDTA al alcanzar >95% de confluencia. Los índices estimados fueron: 3,319.32, 1,956.70, 870.73 y 422.14 para DH82 y 62.38, 63.51, 25.31 y 12.16 veces con RF/6A. La cinética del crecimiento, en cajas de Petri de 35 mm Ø, incluyó la siembra de 20 células/mm2, cambio del medio cada 63 h y cosecha cada 21 h para DH82; para RF/6A; la siembra fue 10 células/ mm2, cambio de medio cada 45 h y cosecha cada 15 h. El máximo crecimiento se observó hasta las 336 y 315 h con tiempos de duplicación de 42.9 y 36.9 h respectivamente para DH82 y RF/6A. Los datos permitieron proponer un modelo patrón de cultivo, para estudios futuros.

Emergence of oriental theileriosis in cattle and its transmission through Rhipicephalus (Boophilus microplus in Assam, India

Directory of Open Access Journals (Sweden)

Parikshit Kakati

2015-09-01

Full Text Available Aim: The aim of the present study was to investigate the presence of Theileria in blood samples of crossbred and indigenous adult cows raised under unorganized small scale farming system in a Babesia and Anaplasma endemic geographical area from Assam, India and to see its transmission through Rhipicephalus (Boophilus microplus ticks. Materials and Methods: For the present study, 57 clinical cases of cattle suspected to be of hemoparasitic infections were taken into consideration. The parasites were identified based on morphology in giemsa stained blood smear followed by polymerase chain reaction (PCR. Sera samples were tested for T. annulata antibodies in plate and Dot-ELISA. PCR was also conducted in eggs of Rhipicephalus (Boophilus microplus tick collected from a Theileria orientalis positive animal. Results: PCR amplified 1124, 776, and 160 bp DNA fragments of B. bigemina (64.91%,T. orientalis(21.05% and A. marginale (14.03%, respectively. This assay further conducted in 12 T. orientalis positive blood samples with primers of Buffeli, Chitose, and Ikeda variants of T. orientalis showed 3 samples positive to Ikeda type and none for Buffeli and Chitose. Babesia bovis and Theileria annulata specific primers also did not amplify any fragment during the PCR assay of the blood samples. Further, all sera samples tested negative to T. annulata antibodies in Plate and Dot-ELISA. PCR conducted in eggs of R (B.microplus tick collected from a T. orientalis positive animal revealed presence of the parasite DNA. Gradual improvement in physical condition leading to complete recovery in 10 out of 12 T. orientalis infected clinical cases treated with buparvaquone(at 2.5mg/kg.b.wt I/M was the feedback obtained from field veterinarians and the cattle owners. Conclusion: The present investigation represents the first report of occurrence of T. orientalis in cattle of Assam with involvement of pathogenic Ikeda strain in clinical outbreaks and its possible natural

Serosurveillance for livestock pathogens in free-ranging mule deer (Odocoileus hemionus.

Directory of Open Access Journals (Sweden)

Annette Roug

Full Text Available Routine disease surveillance has been conducted for decades in mule deer (Odocoileus hemionus in California for pathogens shared between wildlife and domestic ruminants that may have implications for the animal production industry and wildlife health. Deer sampled from 1990 to 2007 (n = 2,619 were tested for exposure to six pathogens: bluetongue virus (BTV, epizootic hemorrhagic disease virus (EHDV, bovine viral diarrhea virus (BVDV, Leptospira spp., Anaplasma spp. and Brucella spp. We evaluated the relationship between exposure to these pathogens and demographic risk factors to identify broad patterns in seroprevalence across a large temporal and spatial scale. The overall seroprevalence for the entire study period was 13.4% for BTV, 16.8% for EHDV, 17.1% for BVDV, 6.5% for Leptospira spp., 0.2% for Brucella spp., and 17% for Anaplasma spp. Antibodies against BTV and EHDV were most prevalent in the deer populations of southern California. Antibodies against Leptospira spp. and Anaplasma spp. were most prevalent in coastal and central northern California whereas antibodies against BVDV were most prevalent in central-eastern and northeastern California. The overall seroprevalence for Anaplasma spp. was slightly lower than detected in previous studies. North and central eastern California contains large tracts of federal land grazed by livestock; therefore, possible contact between deer and livestock could explain the high BVDV seroprevalence found in these areas. Findings from this study will help to establish baseline values for future comparisons of pathogen exposure in deer, inform on long-term trends in deer population health and provide relevant information on the distribution of diseases that are shared between wildlife and livestock.

TURISMO NATURISTA: UNA APUESTA POR EL TURISMO MARGINAL. EL CASO DEL BARRIO NATURISTA DE CAP D'AGDE EN FRANCIA

Directory of Open Access Journals (Sweden)

José María Prat Forga

2010-01-01

Full Text Available Dentro de las políticas de desarrollo local, el turismo tiene un peso cada vez mayor, cada vez más a fin de diversificar la oferta se potencian los turismos marginales, siendo uno de sus principales exponentes el turismo naturista. El barrio naturista de Cap d'Agde es uno de los principales centros mundiales de este tipo de turismo, impulsado por el propio gobierno francés. Sin embargo, en este mismo espacio emerge otro turismo, el swinger, paradigma del turismo erótico-sexual, provocando multiplicidad de relaciones no exentas de tensiones y conflictos en los diferentes espacios involucrados. En este artículo analizamos los puntos clave del turismo naturista y del turismo swinger, centrándonos en el barrio naturista de Cap d'Agde, símbolo de estos nuevos turismos marginales emergentes.

Wildlife reservoirs for vector-borne canine, feline and zoonotic infections in Austria

Directory of Open Access Journals (Sweden)

Georg G. Duscher

2015-04-01

The role of wild ungulates, especially ruminants, as reservoirs for zoonotic disease on the other hand seems to be negligible, although the deer filaroid Onchocerca jakutensis has been described to infect humans. Deer may also harbour certain Anaplasma phagocytophilum strains with so far unclear potential to infect humans. The major role of deer as reservoirs is for ticks, mainly adults, thus maintaining the life cycle of these vectors and their distribution. Wild boar seem to be an exception among the ungulates as, in their interaction with the fox, they can introduce food-borne zoonotic agents such as Trichinella britovi and Alaria alata into the human food chain.

Do Biology Majors Really Differ from Non–STEM Majors?

Science.gov (United States)

Cotner, Sehoya; Thompson, Seth; Wright, Robin

2017-01-01

Recent calls to action urge sweeping reform in science education, advocating for improved learning for all students—including those majoring in fields beyond the sciences. However, little work has been done to characterize the differences—if any exist—between students planning a career in science and those studying other disciplines. We describe an attempt to clarify, in broad terms, how non–STEM (science, technology, engineering, and mathematics) majors differ from life sciences majors, and how they are similar. Using survey responses and institutional data, we find that non–STEM majors are not unilaterally science averse; non–STEM majors are more likely than biology majors to hold misconceptions about the nature of science, yet they are not completely ignorant of how science works; non–STEM majors are less likely than biology majors to see science as personally relevant; and non–STEM majors populations are likely to be more diverse—with respect to incoming knowledge, perceptions, backgrounds, and skills—than a biology majors population. We encourage science educators to consider these characteristics when designing curricula for future scientists or simply for a well-informed citizenry. PMID:28798210

Lomé et ses environs (Togo) : inondations et évolution du littoral ...

African Journals Online (AJOL)

africaines, connaît un développement démographique important. Elle s'est agrandie considérablement et les nouveaux arrivants ont construit leurs habitations dans les zones marginales sans aménagements préalables : plusieurs quartiers se ...

Molecular Detection and Characterization of Zoonotic and Veterinary Pathogens in Ticks from Northeastern China

Science.gov (United States)

Wei, Feng; Song, Mingxin; Liu, Huanhuan; Wang, Bo; Wang, Shuchao; Wang, Zedong; Ma, Hongyu; Li, Zhongyu; Zeng, Zheng; Qian, Jun; Liu, Quan

2016-01-01

Tick-borne diseases are considered as emerging infectious diseases in humans and animals in China. In this study, Ixodes persulcatus (n = 1699), Haemaphysalis concinna (n = 412), Haemaphysalis longicornis (n = 390), Dermacentor nuttalli (n = 253), and Dermacentor silvarum (n = 204) ticks were collected by flagging from northeastern China, and detected for infection with Anaplasma, Ehrlichia, Babesia, and Hepatozoon spp. by using nested polymerase chain reaction assays and sequencing analysis. Anaplasma phagocytophilum was detected in all tick species, i.e., I. persulcatus (9.4%), H. longicornis (1.9%), H. concinna (6.5%), D. nuttalli (1.7%), and D. silvarum (2.3%); Anaplasma bovis was detected in H. longicornis (0.3%) and H. concinna (0.2%); Ehrlichia muris was detected in I. persulcatus (2.5%) and H. concinna (0.2%); Candidatus Neoehrlichia mikurensis was only detected in I. persulcatus (0.4%). The Ehrlichia variant (GenBank access number KU921424), closely related to Ehrlichia ewingii, was found in H. longicornis (0.8%) and H. concinna (0.2%). I. persulcatus was infected with Babesia venatorum (1.2%), Babesia microti (0.6%), and Babesia divergens (0.6%). Additionally, four Babesia sequence variants (GenBank access numbers 862303–862306) were detected in I. persulcatus, H. longicornis, and H. concinna, which belonged to the clusters formed by the parasites of dogs, sheep, and cattle (B. gibsoni, B. motasi, and B. crassa). Two Hepatozoon spp. (GenBank access numbers KX016028 and KX016029) associated with hepatozoonosis in Japanese martens were found in the collected ticks (0.1–3.1%). These findings showed the genetic variability of Anaplasma, Ehrlichia, Babesia, and Hepatozoon spp. circulating in ticks in northeastern China, highlighting the necessity for further research of these tick-associated pathogens and their role in human and animal diseases. PMID:27965644

FRECUENCIA DE HEMOPARÁSITOS EN BOVINOS DEL BAJO CAUCA Y ALTO SAN JORGE, 2000-2005

Directory of Open Access Journals (Sweden)

Mariana Herrera

2008-12-01

Full Text Available Objetivo. Determinar la frecuencia de hemoparásitos en los bovinos evaluados por microscopía directa. Materiales y métodos. Se aplicó un modelo epidemiológico cuyo diseño de investigación fue transeccional de tipo descriptivo retrospectivo transversal. Se analizó la totalidad de los datos de los últimos 5 años, proporcionados por el laboratorio Lavebac que presta su servicio a las regiones del Bajo Cauca Antioqueño y Córdoba. Se realizó un análisis de tendencias por el tipo de parásito, sistema de explotación, procedencia y época climática; seguido de un análisis comparativo de asociación utilizando la razón de disparidad (RD y el X2, mediante el programa EPI-INFO versión 3.3. Resultados. Se encontró una frecuencia hemoparasitaria del 22.5%, y de estos el 59.3% correspondió a Anaplasma sp, el 3.1% a Babesia sp y para Trypanosoma sp 30.9%. La región con mayor frecuencia hemoparasitaria fue Bajo Cauca (14%; los diagnósticos positivos fueron realizados con mayor frecuencia en época seca (14.9%, en la que se detectó mayor proporción de infección por Anaplasma sp. Conclusiones. Los resultados dan una aproximación a la frecuencia y distribución de Trypanosoma sp, Babesia sp y Anaplasma sp en dos zonas ganaderas de Colombia, en donde durante la época seca se encontró un mayor porcentaje de infección, y de los agentes hemoparasitarios Anaplasma sp es el más frecuente.

The freedom of knowledge : Asphalt ’s Academic and Children in the Academic Situation

Directory of Open Access Journals (Sweden)

Mônica Mesquita

2013-01-01

Full Text Available El propósito aquí es discutir sobre el proceso del encuentro que tuvo lugar en la cal le de asfalto de São Paulo - los hijos de asfalto y los académicos de asfalto. Las raíces del principal argumento se centran en la visión sociológica del mundo y en la postura de las etnomatemáticas, que se desarro llaron a través de un proyecto de investigación de doctorado. El acercamiento de posiciones marginales y no marginales y voces produce y es una práctica social activista. El objetivo de observar est e encuentro es alimentar el fin de verbalismo y el comienzo de un conocimien to situado que está acopl ada con nuestra vida cotidiana , con nuestro propio ser de búsqueda de equidad en los actos de investigación.

Do Biology Majors Really Differ from Non-STEM Majors?

Science.gov (United States)

Cotner, Sehoya; Thompson, Seth; Wright, Robin

2017-01-01

Recent calls to action urge sweeping reform in science education, advocating for improved learning for all students-including those majoring in fields beyond the sciences. However, little work has been done to characterize the differences-if any exist-between students planning a career in science and those studying other disciplines. We describe an attempt to clarify, in broad terms, how non-STEM (science, technology, engineering, and mathematics) majors differ from life sciences majors, and how they are similar. Using survey responses and institutional data, we find that non-STEM majors are not unilaterally science averse; non-STEM majors are more likely than biology majors to hold misconceptions about the nature of science, yet they are not completely ignorant of how science works; non-STEM majors are less likely than biology majors to see science as personally relevant; and non-STEM majors populations are likely to be more diverse-with respect to incoming knowledge, perceptions, backgrounds, and skills-than a biology majors population. We encourage science educators to consider these characteristics when designing curricula for future scientists or simply for a well-informed citizenry. © 2017 S. Cotner et al. CBE—Life Sciences Education © 2017 The American Society for Cell Biology. This article is distributed by The American Society for Cell Biology under license from the author(s). It is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

Determinación de las características anatómicas de las arterias coronarias de cerdo mediante técnica de inyección con látex

Directory of Open Access Journals (Sweden)

Guillermo Rivera

2015-06-01

Full Text Available Objetivo: Determinar las características anatómicas de las arterias coronarias del cerdo, mediante inyección con látex. Materiales y métodos: Se usaron 100 corazones de cerdo. Se insertaron sondas Nelaton a través de las arterias coronarias y se les inyectó solución de látex y tinta china. Se determinó el diámetro y el punto de origen para la coronaria derecha, coronaria izquierda, interventricular paraconal y circunfleja. Se cuantificaron el número de ramas diagonales, marginales ventriculares izquierdas y postero laterales. Se determinó frecuencia de ramus intermedius y tipo de dominancia. Se realizó análisis estadístico con un error estándar del 5%, con el Epidat 3,1. Resultados: El 100% de los orígenes anatómicos de las arterias coronarias fueron normales. La dominancia mas frecuente fue la derecha, 73%. El promedio de número de ramas marginales izquierdas, diagonales y posterolaterales fue de 3. La frecuencia de ramus intermedius fue de 12%. El calculo de chi cuadrado de Pearson mostró significancia entre el ramus intermedius y número de ramas marginales izquierdas (p=0,0009. Conclusiones: Las características anatómicas de las arterias coronarias del cerdo son similares a las del humano. El ramus intermedius se comporta como una primera rama marginal izquierda y no como una primera rama diagonal como lo afirman algunos autores.

Disease: H01140 [KEGG MEDICUS

Lifescience Database Archive (English)

Full Text Available obligate intracellular bacteria closely related to Ehrlichia and Anaplasma, causes an infectious mononucleosis...tis, anorexia, generalized lymphadenopathy, and peripheral blood mononucleosis. Infectious disease ... Neoricke

Visiones nórdicas de la guerra civil española

DEFF Research Database (Denmark)

Heiberg, Morten Rievers

2014-01-01

Existe una rica literatura escandinava sobre la Guerra Civil española escrita por voluntarios de las Brigadas Internacionales. Sin embargo, existen pocos estudios científicos y los que hay tratan casi en su totalidad de temas marginales y su calidad no es siempre sobresaliente. El problema parece...

Major depression

Science.gov (United States)

Depression - major; Depression - clinical; Clinical depression; Unipolar depression; Major depressive disorder ... providers do not know the exact causes of depression. It is believed that chemical changes in the ...

1964-IJBCS-Article-Alain Aigue

African Journals Online (AJOL)

hp

Theoretical of investigation. Empirical investigation of long rainfall records. Journal des Sciences Hydrologiques,. 49(4) : 591–610. Koutsoyiannis D. 2005. Incertitude, entropie, effet d'échelle et propriétés stochastiques hydrologiques. Propriétés distributionnelles marginales des processus hydrologiques et échelle d'état.

Urban Planning: A Tool for Achieving Spatial Justice in the Cities of the 21st Century

Directory of Open Access Journals (Sweden)

Steven Navarrete Cardona

2014-01-01

profano, el habitante de los barrios y localidades marginales, que, aunque pague el impuesto predial y de valorización, nunca verá las calles del lugar en que reside pavimentadas o más rutas de transporte público para llegar a su trabajo o a donde le plazca.

Distortion product otoacoustic emissions in college music majors and nonmusic majors

Directory of Open Access Journals (Sweden)

Rebecca L. Warner Henning

2016-01-01

Full Text Available The presence and absence of distortion product otoacoustic emissions (DPOAEs as well as DPOAE amplitudes were compared between college music majors and a control group of nonmusic majors. Participants included 28 music majors and 35 nonmusic majors enrolled at a university with ages ranging from 18-25 years. DPOAEs and hearing thresholds were measured bilaterally on all the participants. DPOAE amplitudes were analyzed at the following f2 frequencies: 1,187 Hz, 1,500 Hz, 1,906 Hz, 2,531 Hz, 3,031 Hz, 3812 Hz, 4,812 Hz, and 6,031 Hz. Significantly more music majors (7/28 than nonmusic majors (0/35 exhibited absent DPOAEs for at least one frequency in at least one ear. Both groups of students reported similar histories of recreational and occupational noise exposures that were unrelated to studying music, and none of the students reported high levels of noise exposure within the previous 48 h. There were no differences in audiometric thresholds between the groups at any frequency. At DPOAE f2 frequencies from 3,031 Hz to 6,031 Hz, nonsignificantly lower amplitudes of 2-4 dB were seen in the right ears of music majors versus nonmajors, and in the right ears of music majors playing brass instruments compared to music majors playing nonbrass instruments. Given the greater prevalence of absent DPOAEs in university music majors compared to nonmusic majors, it appears that early stages of cochlear damage may be occurring in this population. Additional research, preferably longitudinal and across multiple colleges/universities, would be beneficial to more definitively determine when the music students begin to show signs of cochlear damage, and to identify whether any particular subgroups of music majors are at a greater risk of cochlear damage.

An Emerging Tick-Borne Disease of Humans Is Caused by a Subset of Strains with Conserved Genome Structure

Science.gov (United States)

Barbet, Anthony F.; Al-Khedery, Basima; Stuen, Snorre; Granquist, Erik G.; Felsheim, Roderick F.; Munderloh, Ulrike G.

2013-01-01

The prevalence of tick-borne diseases is increasing worldwide. One such emerging disease is human anaplasmosis. The causative organism, Anaplasma phagocytophilum, is known to infect multiple animal species and cause human fatalities in the U.S., Europe and Asia. Although long known to infect ruminants, it is unclear why there are increasing numbers of human infections. We analyzed the genome sequences of strains infecting humans, animals and ticks from diverse geographic locations. Despite extensive variability amongst these strains, those infecting humans had conserved genome structure including the pfam01617 superfamily that encodes the major, neutralization-sensitive, surface antigen. These data provide potential targets to identify human-infective strains and have significance for understanding the selective pressures that lead to emergence of disease in new species. PMID:25437207

The Tick Protein Sialostatin L2 Binds to Annexin A2 and Inhibits NLRC4-Mediated Inflammasome Activation

Czech Academy of Sciences Publication Activity Database

Wang, X.; Shaw, D.K.; Sakhon, O. S.; Snyder, G.A.; Sundberg, E.J.; Santambrogio, L.; Sutterwala, F.S.; Dumlera, J.S.; Shirey, K.A.; Perkins, D.J.; Richard, K.; Chagas, A. C.; Calvo, E.; Kopecký, J.; Kotsyfakis, Michalis; Pedra, J. H. F.

2016-01-01

Roč. 84, č. 6 (2016), s. 1796-1805 ISSN 0019-9567 Institutional support: RVO:60077344 Keywords : Anaplasma phagocytophilum * bacterial ligands * NAIP/NLRC4 inflammasomes Subject RIV: EC - Immunology Impact factor: 3.593, year: 2016

Interdisciplinary Project Experiences: Collaboration between Majors and Non-Majors

Science.gov (United States)

Smarkusky, Debra L.; Toman, Sharon A.

2014-01-01

Students in computer science and information technology should be engaged in solving real-world problems received from government and industry as well as those that expose them to various areas of application. In this paper, we discuss interdisciplinary project experiences between majors and non-majors that offered a creative and innovative…

Prevalence of selected infectious disease agents in stray cats in Catalonia, Spain

Directory of Open Access Journals (Sweden)

Sara Ravicini

2016-02-01

Full Text Available Objectives The objective of the current study was to investigate the prevalence rates of the following infectious agents in 116 stray cats in the Barcelona area of Spain: Anaplasma phagocytophilum, Bartonella species, Borrelia burgdorferi, Chlamydia felis, Dirofilaria immitis, Ehrlichia species, feline calicivirus (FCV, feline herpesvirus-1 (FHV-1, feline leukaemia virus (FeLV, feline immunodeficiency virus (FIV, haemoplasmas, Mycoplasma species and Rickettsia species. Methods Serum antibodies were used to estimate the prevalence of exposure to A phagocytophilum, Bartonella species, B burgdorferi, Ehrlichia species and FIV; serum antigens were used to assess for infection by D immitis and FeLV; and molecular assays were used to amplify nucleic acids of Anaplasma species, Bartonella species, C felis, D immitis, Ehrlichia species, FCV, FHV-1, haemoplasmas, Mycoplasma species and Rickettsia species from blood and nasal or oral swabs. Results Of the 116 cats, 63 (54.3% had evidence of infection by Bartonella species, FeLV, FIV or a haemoplasma. Anaplasma species, Ehrlichia species or Rickettsia species DNA was not amplified from these cats. A total of 18/116 cats (15.5% were positive for FCV RNA (six cats, Mycoplasma species DNA (six cats, FHV-1 DNA (three cats or C felis DNA (three cats. Conclusions and relevance This study documents that shelter cats in Catalonia are exposed to many infectious agents with clinical and zoonotic significance, and that flea control is indicated for cats in the region.

LA COGESTION DES RESSOURCES NATURELLES - Abrégé ...

International Development Research Centre (IDRC) Digital Library (Canada)

6 oct. 2011 ... L'ENJEU Selon les estimations, de 600 à 900 millions de paysans pauvres habitent les régions marginales, écologiquement fragiles, des pays en développement. Leur survie dépend largement de l'accès aux ressources naturelles qui les entourent, mais la croissance démographique et l'extraction ...

Equine tick-borne infections in the Netherlands

NARCIS (Netherlands)

Butler, C.M.

2012-01-01

This thesis focuses on the emergence and establishment of equine tick-borne infections in the Netherlands, with particular attention to their diagnosis, clinical relevance and treatment. Four tick-borne agents (Borrelia burgdorferi, Theileria equi, Babesia caballi and Anaplasma phagocytophilum)

Flåtbårne infektioner i Danmark

DEFF Research Database (Denmark)

Jensen, Bo Bødker; Ocias, Lukas Frans; Andersen, Nanna Skaarup

2017-01-01

The castor bean tick, Ixodes ricinus, is common in woodlands in most of Denmark. Besides Borrelia burgdorferi, it can harbour a number of pathogenic microorganisms such as tick-borne encephalitis virus, Anaplasma phagocytophilum, Rickettsia helvetica, Francisella tularensis, Candidatus Neoehrlichia...

Major Sport Venues

Data.gov (United States)

Department of Homeland Security — The Major Public Venues dataset is composed of facilities that host events for the National Association for Stock Car Auto Racing, Indy Racing League, Major League...

Ehrlichia minasensis sp nov., isolated from the tick Rhipicephalus microplus

Czech Academy of Sciences Publication Activity Database

Cabezas-Cruz, A.; Zweygarth, E.; Vancová, Marie; Broniszewska, M.; Grubhoffer, Libor; Friche Passos, L.M.; Barbosa Ribeiro, M.F.; Alberdi, P.; de la Fuente, J.

2016-01-01

Roč. 66, č. 3 (2016), s. 1426-1430 ISSN 1466-5026 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : cell lines * Anaplasma * genotype * pathogen * Brazil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.134, year: 2016

Rickettsiae in questing Ixodes ricinus ticks in the Czech Republic

Czech Academy of Sciences Publication Activity Database

Venclíková, Kristýna; Rudolf, Ivo; Mendel, Jan; Betášová, Lenka; Hubálek, Zdeněk

2014-01-01

Roč. 5, č. 2 (2014), s. 135-138 ISSN 1877-959X Institutional support: RVO:68081766 Keywords : Ixodes ricinus * Anaplasma phagocytophilum * Rickettsia spp. * Rickettsia helvetica * Rickettsia monacensis * Candidatus Neoehrlichia mikurensis Subject RIV: EE - Microbiology, Virology Impact factor: 2.718, year: 2014

Estudio de la filtración marginal en la combinación de diferentes adhesivos en obturaciones de clase II y V

OpenAIRE

Navarro Majó, José Luis; Jané Noblom, L.; Basilio Monné, J.; Roig Cayón, Miguel; Sentís Vilalta, Juan

1993-01-01

Se estudian las filtraciones marginales en obturaciones «in vitro», de clase 11 y V, utilizando cuatro sistemas de adhesión dentinaria diferentes y un composite universal. Se concluye que ninguno de los cuatro productos consigue suprimir totalmente la filtración marginal, que es causada por el composite, a causa de su contracción de polimerización.

Co-infection with arthropod-borne pathogens in domestic cats.

Science.gov (United States)

André, Marcos Rogério; Filgueira, Kilder Dantas; Calchi, Ana Cláudia; Sousa, Keyla Carstens Marques de; Gonçalves, Luiz Ricardo; Medeiros, Vitor Brasil; Ximenes, Poliana Araújo; Lelis, Ivana Cristina Nunes Gadelha; Meireles, Maria Vanuza Nunes de; Machado, Rosangela Zacarias

2017-01-01

The role of several feline vector-borne pathogens (FVBP) as a cause of disease in cats has not been clearly determined. In fact, with the exception of Bartonella spp. and hemoplasmas, FVBP in cats has not been clearly determined in Brazil yet. The present study aimed at identifying, by using molecular methods, the presence of FVBP in three cats showing non-specific clinical signs and inclusions suggestive of hemoparasites in blood smears. Cytauxzoon felis, 'Candidatus Mycoplasma haemominutum', Ehrlichia sp. closely related to Ehrlichia canis, and Anaplasma sp. closely related to Anaplasma phagocytophilum were detected in blood samples from two out of three sampled cats. Both cats positive for multiple FVBP did not show hematological and biochemical abnormalities. The present work emphasizes the need for molecular confirmation of co-infection by multiple FVBP in cats presenting non-specific clinical signs and inclusions resembling hemoparasites in blood smears.

Co-infection with arthropod-borne pathogens in domestic cats

Directory of Open Access Journals (Sweden)

Marcos Rogério André

2017-11-01

Full Text Available Abstract The role of several feline vector-borne pathogens (FVBP as a cause of disease in cats has not been clearly determined. In fact, with the exception of Bartonella spp. and hemoplasmas, FVBP in cats has not been clearly determined in Brazil yet. The present study aimed at identifying, by using molecular methods, the presence of FVBP in three cats showing non-specific clinical signs and inclusions suggestive of hemoparasites in blood smears. Cytauxzoon felis, ‘Candidatus Mycoplasma haemominutum’, Ehrlichia sp. closely related to Ehrlichia canis, and Anaplasma sp. closely related to Anaplasma phagocytophilum were detected in blood samples from two out of three sampled cats. Both cats positive for multiple FVBP did not show hematological and biochemical abnormalities. The present work emphasizes the need for molecular confirmation of co-infection by multiple FVBP in cats presenting non-specific clinical signs and inclusions resembling hemoparasites in blood smears.

Major life events and development of major depression in Parkinson's disease patients

DEFF Research Database (Denmark)

Rod, Naja Hulvej; Bordelon, Y; Thompson, A

2012-01-01

BACKGROUND AND PURPOSE: Non-motor symptoms including depression are important features of Parkinson's disease (PD). We aim to address the relationship between major life events and depression amongst PD patients free of depressive symptoms at baseline. METHODS: New-onset PD patients from California...... were recruited in 2001-2007 and followed up for 3-4 years. The participants (n = 221) were examined by neurologists and responded to comprehensive interviews that included major life events, social support, and coping measures from validated scales. Major depression was assessed using the Structured...... Clinical Interview for the DSM-IV depression module (SCID). RESULTS: More than half of all patients had experienced major life events since diagnosed with PD, and 22 patients developed a major depression. The number of life events was associated with risk of depression in an exposure-dependent manner...

Novel Babesia and Hepatozoon agents infecting non-volant small mammals in the Brazilian Pantanal, with the first record of the tick Ornithodoros guaporensis in Brazil.

Science.gov (United States)

Wolf, Rafael William; Aragona, Mônica; Muñoz-Leal, Sebastián; Pinto, Leticia Borges; Melo, Andréia Lima Tomé; Braga, Isis Assis; Costa, Jackeliny dos Santos; Martins, Thiago Fernandes; Marcili, Arlei; Pacheco, Richard de Campos; Labruna, Marcelo B; Aguiar, Daniel Moura

2016-04-01

Taking into account the diversity of small terrestrial mammals of the Pantanal, the present study aimed to verify the occurrence of infection by Ehrlichia spp., Anaplasma spp., Rickettsia spp., Hepatozoon spp., Babesia spp. and parasitism by ticks in non-volant small mammals collected in the Brazilian Pantanal. Samples of blood, liver and spleen were collected from 64 captured animals, 22 marsupials and 42 rodents. Pathogen detection was performed by the use of genus-specific Polymerase Chain Reaction (PCR) assays. Ticks collected from the animals consisted of Amblyomma sculptum and Amblyomma triste nymphs, and Ornithodoros guaporensis larvae. None of the vertebrate samples (blood, liver, or spleen) yielded detectable DNA of Rickettsia spp. or Ehrlichia spp. The blood of the rodent Hylaeamys megacephalus yielded an Anaplasma sp. genotype (partial 16S rRNA gene) 99% similar to multiple Anaplasma spp. genotypes around the world. The blood of three rodents of the species Calomys callosus were positive for a novel Hepatozoon sp. agent, phylogenetically related (18S rDNA gene) to distinct Hepatozoon genotypes that have been detected in rodents from different parts of the world. One marsupial (Monodelphis domestica) and three rodents (Thrichomys pachyurus) were positive to novel piroplasmid genotypes, phylogenetically (18S rDNA gene) related to Theileria bicornis, Cytauxzoon manul, and Cytauxzoon felis. The present study provides the first molecular detection of Hepatozoon sp. and piroplasmids in small mammals in Brazil. Additionally, we expanded the distribution of O. guaporensis to Brazil, since this tick species was previously known to occur only in Bolivia. Copyright © 2016 Elsevier GmbH. All rights reserved.

Las calles y los barrios marginales de Daca

OpenAIRE

LeBeau, Nellie; Tuckfield, Hugh

2017-01-01

Cada año, alrededor de medio millón de personas busca alojamiento en Daca, a causa del nexo entre el cambio climático, la pobreza y la degradación del medio ambiente. Muchas de estas personas terminan viviendo en las calles.

Une étude marginale de littérature

Directory of Open Access Journals (Sweden)

Bibiane Fréché

2011-07-01

Full Text Available Rencontrer une note, selon un propos célèbre prêté au dramaturge Noel Coward, « is like going downstairs to answer the doorbel while making love ». (p. 11Andréas Pfersmann est maître de conférence à l’Université de la Polynésie française. Il étudie depuis près de vingt ans l’annotation. Tout aussi marginal que marginalisé dans les études françaises, le sujet n’est pas neuf pour autant. Les scientifiques allemands planchent depuis la fin du XIXe siècle sur le sujet et le monde anglo-saxon lui...

Effect of Climate and Land Use on the Spatio-Temporal Variability of Tick-Borne Bacteria in Europe

NARCIS (Netherlands)

Rosà, Roberto; Andreo, Veronica; Tagliapietra, Valentina; Baráková, Ivana; Arnoldi, Daniele; Hauffe, Heidi C.; Manica, Mattia; Rosso, Fausta; Blaňarová, Lucia; Bona, Martin; Derdáková, Marketa; Hamšíková, Zuzana; Kazimírová, Maria; Kraljik, Jasna; Kocianová, Elena; Mahríková, Lenka; Minichová, Lenka; Mošanský, Ladislav; Slovák, Mirko; Stanko, Michal; Špitalská, Eva; Ducheyne, Els; Neteler, Markus; Hubálek, Zdenek; Rudolf, Ivo; Venclikova, Kristyna; Silaghi, Cornelia; Overzier, Evelyn; Farkas, Robert; Földvári, Gábor; Hornok, Sándor; Takács, Nóra; Rizzoli, Annapaola

2018-01-01

The incidence of tick-borne diseases caused by Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum and Rickettsia spp. has been rising in Europe in recent decades. Early pre-assessment of acarological hazard still represents a complex challenge. The aim of this study was to model Ixodes

Integrated tick and tick-borne disease control trials in crossbred dairy cattle in Malawi

DEFF Research Database (Denmark)

Tjørnehøj, Kirsten; Whiteland, A. P.; Mfitilodze, M. W.

1996-01-01

Crossbred dairy heifers on a farm in an East Coast fever (ECF) endemic area in Malawi were immunised against Theileria parva, Anaplasma spp., Babesia bigemina, Babesia bovis and Cowdria ruminantium. They were treated at infrequent intervals with chlorfenvinphos to limit infestation with adult tic...

14 CFR Appendix B to Part 43 - Recording of Major Repairs and Major Alterations

Science.gov (United States)

2010-01-01

... inspected. (d) For extended-range fuel tanks installed within the passenger compartment or a baggage... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Recording of Major Repairs and Major... to Part 43—Recording of Major Repairs and Major Alterations (a) Except as provided in paragraphs (b...

CO{sub 2} emission costs and Gas/Coal competition for power production; Prezzi delle emissioni di CO{sub 2} e competivita' gas/carbone per la produzione termoelettrica

Energy Technology Data Exchange (ETDEWEB)

Santi, Federico [La Sapienza Univ., Roma (Italy). Dipartimento di Ingegneria Nucleare e Conversioni dell' Energia

2005-05-01

This paper demonstrates how a CO{sub 2} emission reduction programme can change the competition between the two power production technologies which will probably dominate the future of the Italian power industry: the coal fired USC steam power plant and the natural gas fired CCGT power plant. An economic value of the CO{sub 2} emission is calculated, in order to make the short-run-marginal-cost (or the long-run-marginal-cost). equal for both technologies, under a CO{sub 2} emission trading scheme and following a single-plant specific CO{sub 2} emission homogenizing approach. [Italian] Si dimostra come un programma teso alla riduzione delle emissioni di CO{sub 2} possa mutare la competivita' tra le due tecnologie per la produzione termoelettrica che saranno dominanti nel prossimo futuro in Italia: le centrali a carbone USC e le centrali CCGT a gas naturale. Si calcola il prezzo delle emissioni di CO{sub 2} per valutare il costo marginale di breve periodo (o il costo marginale di lungo periodo) per entrambe le tecnologie, avvalendosi di un programma di emission trading e utilizzando un approccio di omogeneizzazione delle emissioni di CO{sub 2} specifiche di ogni impianto.

LA MARGINALIDAD EN RELACIÓN A LA IDENTIDAD: LA LITERATURA DE PERIFERIA Y EL EMPODERAMIENTO CULTURAL DE SUS SUJETOS

Directory of Open Access Journals (Sweden)

Lais Botelho das Neves

2016-03-01

Full Text Available El estudio de la cultura brasileña se constituye en un área interdisciplinar y que involucra a un número significativo de obras y autores, de modo que los enfoques propuestos terminan seleccionando sólo algunos considerados más representativos, sin embargo, estos son selecciones arbitrarias y que por lo general desconsideran las contribuciones de las vertientes marginales del pensamiento y de la sociedad. De esta manera, en este artículo se intenta discutir sobre el lugar de la literatura marginal en el interior del pensamiento social brasileño, destacándose, en este sentido, su espacio social y su relevancia en relación a la dimensión capaz de colaborar con la construcción de la identidad de las poblaciones marginados. En este sentido, se verifica que si inicialmente fueron atribuidas connotaciones negativas a la marginalidad, a partir de la ocupación de un espacio de enunciación, eso fue re conceptuado, siendo asumida por individuos marginales, escritores o no, como una dimensión constructora de la identidad.

Viarios de cascos históricos: El Puente de las Estrellas en Ponferrada. Castilla y León. España

Directory of Open Access Journals (Sweden)

Jesús I. San José Alonso

2007-11-01

En este trabajo, se plantean las propuestas peatonales para el gozo urbano, el ocio y la cultura que por si mismas tienen un peso específico importante, no sólo para potenciar el uso de espacios, sino incluso para transformar su carácter, que llega en casos extremos a convertir lugares impersonales e incluso marginales, en verdaderos espacios lúdico-culturales a cielo abierto.

New criteria for selecting the origin of DNA replication in Wolbachia and closely related bacteria

DEFF Research Database (Denmark)

Ioannidis, Panagiotis; Dunning Hotopp, Julie C; Sapountzis, Panagiotis

2007-01-01

, the origin of DNA replication (ori) regions were identified in silico for Wolbachia strains and eleven other related bacteria belonging to Ehrlichia, Anaplasma, and Rickettsia genera. These features include DnaA-, CtrA- and IHF-binding sites as well as the flanking genes in C. crescentus. The Wolbachia ori...

Effect of climate and land use on the spatio-temporal variability of tick-borne bacteria in Europe

Czech Academy of Sciences Publication Activity Database

Rosà, R.; Andreo, V.; Tagliapietra, V.; Baráková, I.; Arnoldi, D.; Hauffe, H. C.; Manica, M.; Rosso, F.; Blaňarová, L.; Bona, M.; Derdáková, M.; Hamšíková, Z.; Kazimírová, M.; Kraljik, J.; Kocianová, E.; Mahríková, L.; Minichová, L.; Mošanský, L.; Slovák, M.; Stanko, M.; Špitalská, E.; Ducheyne, E.; Neteler, M.; Hubálek, Zdeněk; Rudolf, Ivo; Venclíková, Kristýna; Silaghi, C.; Overzier, E.; Farkas, R.; Földvári, G.; Hornok, S.; Takács, N.; Rizzoli, A.

2018-01-01

Roč. 15, č. 4 (2018), č. článku 732. ISSN 1660-4601 EU Projects: European Commission(XE) 261504 - EDENEXT Keywords : Acarological hazard * Anaplasma phagocytophilum * Borrelia burgdorferi sensu lato * Density of infected nymphs * Land use * Normalized difference vegetation index * Rickettsia spp Impact factor: 2.101, year: 2016

Tick-Pathogen Ensembles: Do Molecular Interactions Lead Ecological Innovation?

Czech Academy of Sciences Publication Activity Database

Cabezas Cruz, Alejandro; Estrada-Peňa, A.; Rego, Ryan O. M.; de la Fuente, J.

2017-01-01

Roč. 7, 13 March (2017), č. článku 74. ISSN 2235-2988 Institutional support: RVO:60077344 Keywords : tick-pathogen interactions * transcriptional reprogramming * epigenetics * ecological adaptation * Anaplasma phagocytophilum Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016

A Major in Science? Initial Beliefs and Final Outcomes for College Major and Dropout

OpenAIRE

Ralph Stinebrickner; Todd R. Stinebrickner

2014-01-01

Taking advantage of unique longitudinal data, we provide the first characterization of what college students believe at the time of entrance about their final major, relate these beliefs to actual major outcomes, and provide an understanding of why students hold the initial beliefs about majors that they do. The data collection and analysis are based directly on a conceptual model in which a student's final major is best viewed as the end result of a learning process. We find that students en...

Cross-sectional survey of health management and prevalence of vector-borne diseases, endoparasites and ectoparasites in Samoan dogs.

Science.gov (United States)

Carslake, R J; Hill, K E; Sjölander, K; Hii, S F; Prattley, D; Acke, E

2017-12-01

To determine the prevalence of selected canine vector-borne diseases (Leishmania infantum, Anaplasma spp., Ehrlichia canis, Borrelia burgdorferi and Dirofilaria immitis) and endo- and ectoparasites in Samoan dogs presenting for surgical sterilisation and to report on the general health management of the dogs. This study was a prospective serological cross-sectional survey. Management data were obtained for 242 dogs by interview with their owners. Blood samples were collected from 237 dogs and screened for the canine vector-borne diseases using point-of-care qualitative ELISA assays. Anaplasma spp. positive samples were screened by PCR and sequenced for species identification. Rectal faecal samples were collected from 204 dogs for faecal flotation and immunofluorescent antibody tests were performed for Giardia and Cryptosporidium spp. on a subset of 93 faecal samples. The skin and coat of 221 dogs were examined for presence of ectoparasites. The D. immitis antigen was detected in 46.8% (111/237) of dogs. Seroprevalence of Anaplasma spp. was 8.4% (20/237); A. platys was confirmed by PCR. Prevalence of hookworm was 92.6% (185/205) and Giardia was 29.0% (27/93). Ectoparasites were detected on 210/221 (95.0%) of dogs examined and 228/242 dogs (94.2%) had previously never received any preventative medication. There was a very high prevalence of D. immitis, hookworm and external parasites in Samoan dogs, and prophylactic medication is rarely administered. This is the first report confirming A. platys in Samoa and the South Pacific islands. The public health implications of poor management of the dogs should be considered and investigated further. © 2017 Australian Veterinary Association.

Major Roads

Data.gov (United States)

Minnesota Department of Natural Resources — This data set contains roadway centerlines for major roads (interstates and trunk highways) found on the USGS 1:24,000 mapping series. These roadways are current...

Prevalence and Risk Factors Associated with Hemoparasites in Cattle and Goats at the Edge of Kibale National Park, Western Uganda.

Science.gov (United States)

Weny, Geoffrey; Okwee-Acai, James; Okech, Samuel George; Tumwine, Gabriel; Ndyanabo, Susan; Abigaba, Salvatory; Goldberg, Tony L

2017-02-01

Livestock production is a major sector of the Ugandan economy. Ugandan ruminant livestock (principally cattle and goats) are susceptible to hemoparasites that can cause serious clinical disease and production losses. Kibale National Park, in western Uganda, is a protected forest ecosystem surrounded by small-scale farms where cattle and goats are raised. We conducted a cross-sectional study of cattle and goats in this area and diagnosed hemoparasite infections by microscopy. We collected data on animal characteristics and management practices to assess risk factors associated with infection. We studied 186 cattle and 317 goats from 20 villages, including 16 villages directly adjacent to Kibale and 4 villages ≥3 km from the park boundary. Hemoparasites detected in cattle and goats were of the genera Theileria, Anaplasma, and Trypanosoma with a prevalence of 15.1%, 1.6%, and 4.3% respectively in cattle, and 10%, 6.0%, and 0.0%, respectively in goats. Trypanosomes infected approximately 8% of cattle in villages bordering Kibale but were never detected in cattle in "control" villages ≥3 km from the park. Trypanosomes were approximately 7 times more likely to infect animals in households that did not provide veterinary care to their animals than in households that provided routine veterinary care. Within cattle, Theileria infections were approximately 7 times more likely to occur in cross-bred cattle than in indigenous pure breeds. Anaplasma infections were approximately 3.5 times more likely to occur in cattle than in goats (no goats were diagnosed with Trypanosoma infection). These data suggest that proximity to the park, provision of veterinary care, and breed are significant risk factors for hemoparasites in this population of ruminants, and that, in general, cattle are more susceptible than goats.

Student Perceptions of the First Course in Accounting: Majors versus Non-Majors

Science.gov (United States)

Tickell, Geoffrey; Lim, Tiong Kiong; Balachandran, Balasinghan

2012-01-01

This paper contributes to the continuing debate regarding the curriculum for the first undergraduate course in accounting by examining student perceptions from studying such a course. Participants are divided into two cohorts--Accounting & Finance Majors (AFM) and Other Business Majors (OBM). Results reported in this paper indicate that…

Major Depression Among Adults

Science.gov (United States)

... Depressive Episode Among Adolescents Data Sources Share Major Depression Definitions Major depression is one of the most ... Bethesda, MD 20892-9663 Follow Us Facebook Twitter YouTube Google Plus NIMH Newsletter NIMH RSS Feed NIMH ...

Psychology Degree Beliefs and Stereotypes: Differences in the Perceptions of Majors and Non-Majors

Science.gov (United States)

Brinthaupt, Thomas M.; Hurst, Jennifer R.; Johnson, Quinn R.

2016-01-01

Very little research examines the beliefs and stereotypes students have about the discipline and major of psychology. Previous research has found that psychology majors report hearing a variety of such beliefs and stereotypes more often from their fellow students than from their family members. In the current study, psychology majors/minors and…

Age at Menarche and Choice of College Major: Implications for STEM Majors

Science.gov (United States)

Brenner-Shuman, Anna; Waren, Warren

2013-01-01

Even though boys and girls in childhood perform similarly in math and spatial thinking, after puberty fewer young women pursue majors that emphasize abilities such as science, technology, engineering, and math (STEM) in college. If postpubertal feminization contributes to a lower likelihood of choosing STEM majors, then young women who enter…

Genomic and transcriptomic approaches towards the genetic ...

African Journals Online (AJOL)

est une légumineuse indigène sous utilisée enAfrique, mais qui est riche en amidon, avec une quantité raisonnable de proteine. Il reconnu comme étant resistant à la sécheresse, il est capable de pousser et de réaliser un cycle végétatif et reproducteur parfait dans les zones marginales de basse pluiviométrie (<700 mm) ...

Vergleich zwischen konventionellen und digitalen Abformungen präparierter Zähne : eine in-vivo Studie

OpenAIRE

Bosniac, Patricia Alessandra

2016-01-01

Das Ziel dieser in-vivo Studie war es, die marginale Diskrepanz von Zirkoniumoxid-Käppchen, die mithilfe zwei direkter und einer indirekten digitalen Abformmethode hergestellt wurden, miteinander zu vergleichen. Insgesamt wurden bei 23 Patienten 63 Zähne zur Aufnahme einer Kronenrestauration präpariert und nachfolgend intraoral digitalisiert sowie konventionell abgeformt. Hierfür wurden die zwei Intraoralscanner CEREC AC Omnicam und Cara TRIOS verwendet. Die konventionelle Abformung wurde ...

Blood protozoan parasites of rodents in Jos, Plateau State, Nigerai ...

African Journals Online (AJOL)

One hundred and thirty rodents, comprising nine different species caught from seven different locations in Jos, Nigeria, were examined for blood protozoan parasites, and 82(63.08%) were positive, with Plasmodium 63(48.46%), Trypanosoma 4(3.08%), Toxoplasma 6(4.62%), Babesia 7(5.38%) and Anaplasma 2(1.54%).

Neglected tick-borne pathogens in the Czech Republic, 2011–2014

Czech Academy of Sciences Publication Activity Database

Venclíková, Kristýna; Mendel, Jan; Betášová, Lenka; Blažejová, Hana; Jedličková, Petra; Straková, Petra; Hubálek, Zdeněk; Rudolf, Ivo

2016-01-01

Roč. 7, č. 1 (2016), s. 107-112 ISSN 1877-959X EU Projects: European Commission(XE) 261504 - EDENEXT Institutional support: RVO:68081766 Keywords : Ixodes ricinus * Rickettsia spp. * Candidatus N. mikurensis * Anaplasma phagocytophilum * Babesia spp. Subject RIV: FN - Epidemiology, Contagious Diseases ; Clinical Immunology Impact factor: 3.230, year: 2016

Major Links.

Science.gov (United States)

Henderson, Tona

1995-01-01

Provides electronic mail addresses for resources and discussion groups related to the following academic majors: art, biology, business, chemistry, computer science, economics, health sciences, history, literature, math, music, philosophy, political science, psychology, sociology, and theater. (AEF)

Prospects after Major Trauma

NARCIS (Netherlands)

Holtslag, H.R.

2007-01-01

Introduction. After patients survived major trauma, their prospects, in terms of the consequences for functioning, are uncertain, which may impact severely on patient, family and society. The studies in this thesis describes the long-term outcomes of severe injured patients after major trauma. In

Tick-Pathogen Interactions and Vector Competence: Identification of Molecular Drivers for Tick-Borne Diseases

Czech Academy of Sciences Publication Activity Database

de la Fuente, J.; Antunes, S.; Bonnet, S.; Cabezas Cruz, Alejandro; Domingos, A.G.; Estrada-Peňa, A.; Johnson, N.; Kocan, K.M.; Mansfield, K. L.; Nijhof, A.M.; Papa, A.; Rudenko, Natalia; Villar, M.; Alberdi, P.; Torina, A.; Ayllón, N.; Vancová, Marie; Golovchenko, Maryna; Grubhoffer, Libor; Caracappa, S.; Fooks, A. R.; Gortazar, C.; Rego, Ryan O. M.

2017-01-01

Roč. 7, APR 7 (2017), č. článku 114. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : tick * Anaplasma * flavivirus * Babesia * Borrelia * Microbiome * immunology * vaccine Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016

Seroprevalence of Selected Infectious Agents in a Free-Ranging, Low-Density Lion Population in the Central Kalahari Game Reserves in Botswana▿

OpenAIRE

Ramsauer, Sandra; Bay, Gert; Meli, Marina; Hofmann-Lehmann, Regina; Lutz, Hans

2007-01-01

Twenty-one free-ranging Central Kalahari lions (Panthera leo) exhibited a high prevalence rate of feline herpesvirus (100%) and feline immunodeficiency virus (71.4%). Canine distemper virus and feline calicivirus occurred with a low prevalence. All individuals tested negative for feline coronavirus, feline parvovirus, feline leukemia virus, Ehrlichia canis, and Anaplasma phagocytophilum.

Seroprevalence of selected infectious agents in a free-ranging, low-density lion population in the Central Kalahari Game Reserves in Botswana.

Science.gov (United States)

Ramsauer, Sandra; Bay, Gert; Meli, Marina; Hofmann-Lehmann, Regina; Lutz, Hans

2007-06-01

Twenty-one free-ranging Central Kalahari lions (Panthera leo) exhibited a high prevalence rate of feline herpesvirus (100%) and feline immunodeficiency virus (71.4%). Canine distemper virus and feline calicivirus occurred with a low prevalence. All individuals tested negative for feline coronavirus, feline parvovirus, feline leukemia virus, Ehrlichia canis, and Anaplasma phagocytophilum.

Weaving History through the Major

Science.gov (United States)

Mayfield, Betty

2014-01-01

The benefits of including the study of the history of mathematics in the education of mathematics majors have been discussed at length elsewhere. Many colleges and universities now offer a History of Mathematics course for mathematics majors, for mathematics education majors, or for general credit. At Hood College, we emphasize our commitment to…

Effet du compost à base de Calotropis procera (Aiton) W.T. Aiton sur ...

African Journals Online (AJOL)

Objectifs: Une étude à base de compost de Calotropis procera a été menée afin de mesurer l'effet sur la production de l'arachide sur de sols pauvres. Méthodologie et résultats: L'essai a été conduit sur le site de Doyaba au niveau des zones marginales du Tchad avec la variété fleur 11 d'arachide (Arachis hypogaea L.) ...

Margins in Swedish district heating systems; Marginaler i Fjaerrvaermesystem

Energy Technology Data Exchange (ETDEWEB)

Selinder, Patrik; Zinko, Heimo [ZW Energiteknik AB, Nykoeping (Sweden)

2003-03-01

It can be assumed on good reasons that the Swedish district heating nets are designed with relatively large margins concerning the transportable power. This is done historically to be able to transport the necessary power that can be called for on the coldest winter days but which occur rarely and also due to the former (until 2001) applied recommendations for the dimensioning of hot water flows. The aim of this project was to investigate the possibilities of reducing the connecting power to customers, both from a technical and from the customer point of view. The heating system of a building in Sweden is normally dimensioned according to a certain outdoor air temperature (DUT in Swedish). According to the Swedish Building Code, DUT20 is defined for a given location in such a way that if the heating system is designed for this temperature, the room temperature is allowed to decrease by 3 deg C in the average once in 20 years. That means that for economical reasons, a power deficiency is accounted for in the case of strong cold. The value of DUT is depending on the thermal inertia of the building. Buildings with high thermal inertia can have a higher DUT and vice versa. A reduced system size can in principle mean smaller size of pipes and consumer substations and more power available for additional customers to be connected. In principle, that means a more profitable district heating operation. Besides costs, another problem with oversized capacities are possible operational problems due to slow dynamic system responses, for instance at restarting occasions after a pump stop. A smaller valve size will result in a better system dynamic and may result in a more compliant system operation and increased delivery quality. By choosing just right DUT for every building and abandoning safety margins, it is shown in the report that the connecting power can be reduced in especially medium light to heavy buildings with larger time constants. However, this also means that the occasions with power deficiency will occur more often. The lower limit for the reduction of connection power is depending on the level of comfort the customers are prepared to accept. These questions have been discussed with selected customer representatives. The mentioned practice of oversizing of the heating power deliverable to the buildings presents a relatively large margin for reduction of consumable power without decreasing the level of heating comfort too much. In the report this method is recommended under the name 'stingy' (= adequate) dimensioning; it is still according to the recommendation of the Swedish building code based on DUT20 and following the regulations of the Swedish District Heating Association for the domestic hot water dimensioning. The result will be a decrease of about 30% of the connected power in most buildings, and somewhat more in the heaviest buildings. Further reduction of the connecting power will implicate a more strong impact on the heating comfort. We call this 'deficiency dimensioning' and we cannot really recommend it apart from some special customer groups who might accept this heating quality by receiving some kind of economic compensation.

The impact of major trauma network triage systems on patients with major burns.

Science.gov (United States)

Nizamoglu, Metin; O'Connor, Edmund Fitzgerald; Bache, Sarah; Theodorakopoulou, Evgenia; Sen, Sankhya; Sherren, Peter; Barnes, David; Dziewulski, Peter

2016-12-01

Trauma is a leading cause of death and disability worldwide. Patients presenting with severe trauma and burns benefit from specifically trained multidisciplinary teams. Regional trauma systems have shown improved outcomes for trauma patients. The aim of this study is to determine whether the development of major trauma systems have improved the management of patients with major burns. A retrospective study was performed over a four-year period reviewing all major burns in adults and children received at a regional burns centre in the UK before and after the implementation of the regional trauma systems and major trauma centres (MTC). Comparisons were drawn between three areas: (1) Patients presenting before the introduction of MTC and after the introduction of MTC. (2) Patients referred from MTC and non-MTC within the region, following the introduction of MTC. (3) Patients referred using the urban trauma protocol and the rural trauma protocol. Following the introduction of regional trauma systems and major trauma centres (MTC), isolated burn patients seen at our regional burns centre did not show any significant improvement in transfer times, admission resuscitation parameters, organ dysfunction or survival when referred from a MTC compared to a non-MTC emergency department. There was also no significant difference in survival when comparing referrals from all hospitals pre and post establishment of the major trauma network. No significant outcome benefit was demonstrated for burns patients referred via MTCs compared to non-MTCs. We suggest further research is needed to ascertain whether burns patients benefit from prolonged transfer times to a MTC compared to those seen at their local hospitals prior to transfer to a regional burns unit for further specialist care. Copyright © 2016 Elsevier Ltd and ISBI. All rights reserved.

Broad-range survey of vector-borne pathogens and tick host identification of Ixodes ricinus from Southern Czech Republic

Czech Academy of Sciences Publication Activity Database

Hönig, Václav; Carolan, H. E.; Vavrušková, Zuzana; Massire, C.; Mosel, M.l R.; Crowder, C. D.; Rounds, M. A.; Ecker, D. J.; Růžek, Daniel; Grubhoffer, Libor; Luft, B. J.; Eshoo, M. W.

2017-01-01

Roč. 93, č. 11 (2017), č. článku fix129. ISSN 0168-6496 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : burgdorferi sensu-lato * tick * Ixodes ricinus * pcr-esi/ms * Borrelia * host * Lyme borreliosis * Babesia * Anaplasma * Rickettsia Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.720, year: 2016

Tick-borne zoonotic pathogens in ticks feeding on the common nightingale including a novel strain of Rickettsia sp

Czech Academy of Sciences Publication Activity Database

Dubská, L.; Literák, I.; Kverek, P.; Roubalová, Eva; Kocianova, E.; Taragelova, V.

2012-01-01

Roč. 3, č. 4 (2012), s. 265-268 ISSN 1877-959X Institutional support: RVO:60077344 Keywords : tick * Ixodes ricinus * Borrelia garinii * Anaplasma phagocytophilum * Rickettsia helvetica * Babesia sp. EU1 * Common nightingale Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.353, year: 2012 http://www.sciencedirect.com/science/article/pii/S1877959X12000556

Stenting of major airway constriction

International Nuclear Information System (INIS)

Wu Xiaomei

2002-01-01

Objective: To investigate the correlated issues in the stenting treatment of major airway constriction. Methods: Nineteen cases of major airway stenting procedure were studied retrospectively. The clinical choice of stents of different advantages or deficiencies were discussed. The importance of intravenous anesthesia supporting, life-parameters monitoring during the procedures and the prevention of complications were analysed. Results: Under intravenous and local anesthesia, 19 Wallstents had been successively placed and relieved 19 cases of major airway constrictions due to malignant or benign diseases (15 of tumors, 3 of tuberculosis, 1 of tracheomalacia). Intravenous anesthesia and life-parameters monitoring had made the procedures more safe and precise. Conclusions: Major airway stenting is an reliable method for relieving tracheobronchial stenosis; and intravenous anesthesia supporting and life-parameters monitoring guarantee the satisfactions of procedures

Laboratorio de urbanismo emergente: Una mirada sobre los barrios informales de Latinoamérica

OpenAIRE

Saez Giraldez, Elia; Roch Peña, Fernando

2010-01-01

Se estudian los barrios informales o populares de Latinoamérica, como laboratorios donde comprender procesos urbanos y sociales distintos a los de la ciudad formal contemporánea, lo que puede contribuir a la definición de nuevas herramientas urbanísticas y de sostenibilidad (ambiental, social y urbana) Presentados habitualmente como barrios marginales, degradados y con niveles extremos de pobreza, los barrios populares no son consecuencia de procesos inmobiliarios o de las instituciones, sino...

Do You Have Major Depression?

Science.gov (United States)

... of this page please turn Javascript on. Feature: Depression Do You Have Major Depression? Past Issues / Fall 2009 Table of Contents Simple ... member may have major depression. —NIMH Types of Depression Just like other illnesses, such as heart disease, ...

Anaplasma phagocytophilum: deceptively simple or simply deceptive?

Czech Academy of Sciences Publication Activity Database

Severo, M. S.; Stephens, K. D.; Kotsyfakis, Michalis; Pedra, J. H. F.

2012-01-01

Roč. 7, č. 6 (2012), s. 719-731 ISSN 1746-0913 Institutional support: RVO:60077344 Keywords : obligate intracellular bacterium * rickettsial agents * ticks * vector-borne diseases Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.018, year: 2012

Establishing a legal service for major trauma patients at a major trauma centre in the UK.

Science.gov (United States)

Seligman, William H; Thompson, Julian; Thould, Hannah E; Tan, Charlotte; Dinsmore, Andrew; Lockey, David J

2017-09-01

Major trauma causes unanticipated critical illness and patients have often made few arrangements for what are sudden and life-changing circumstances. This can lead to financial, housing, insurance, legal and employment issues for patients and their families.A UK law firm worked with the major trauma services to develop a free and comprehensive legal service for major trauma patients and their families at a major trauma centre (MTC) in the UK. In 2013, a legal service was established at North Bristol NHS Trust. Referrals are made by trauma nurse practitioners and it operates within a strict ethical framework. A retrospective analysis of the activity of this legal service between September 2013 and October 2015 was undertaken. 66 major trauma patients were seen by the legal teams at the MTC. 535 hours of free legal advice were provided on non-compensation issues-an average of 8 hours per patient. This initiative confirms a demand for the early availability of legal advice for major trauma patients to address a range of non-compensation issues as well as for identification of potential compensation claims. The availability of advice at the MTC is convenient for relatives who may be spending the majority of their time with injured relatives in hospital. More data are needed to establish the rehabilitation and health effects of receiving non-compensation advice after major injury; however, the utilisation of this service suggests that it should be considered at the UK MTCs. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

Majorization arrow in quantum-algorithm design

International Nuclear Information System (INIS)

Latorre, J.I.; Martin-Delgado, M.A.

2002-01-01

We apply majorization theory to study the quantum algorithms known so far and find that there is a majorization principle underlying the way they operate. Grover's algorithm is a neat instance of this principle where majorization works step by step until the optimal target state is found. Extensions of this situation are also found in algorithms based in quantum adiabatic evolution and the family of quantum phase-estimation algorithms, including Shor's algorithm. We state that in quantum algorithms the time arrow is a majorization arrow

Las artes de leer e interpretar las hojas de coca

Directory of Open Access Journals (Sweden)

Eugenia Flores

2017-03-01

Full Text Available En este artículo quisiera hablar sobre un oficio secreto, subterráneo, clandestino, que es el arte de leer e interpretar las hojas de coca en espacios marginales del valle de Salta. Muestro en estas páginas las diferentes formas y modos en que la coca es utilizada por la población local, diversa y heterogénea, donde tradiciones indígenas ancestrales se manifiestan en prácticas concretas que rozan los límites entre la magia y la terapia. Presto especial interés, a partir del trabajo de campo realizado, a aquellas personas que manejan estas artes de leer las hojas de coca, las cuales en los casos analizados fueron adquiridas a partir de un ritual de paso, que fue el haber sido “tocado por el rayo”. Me interesa particularmente trabajar con estos hombres y mujeres, cuyo arte de hacer con coca es equiparable a las “maneras de hacer”. Estas maneras de hacer con la coca ritual no están visibilizadas y son subterráneas, marginales y silenciosas, en este artículo se pretende dar cuenta de estas prácticas con coca y sus dinámicas relaciones inter e intra comunales. Palabras-claves: Artes; maneras de hacer; coca; ritual.

Major hazards onshore and offshore

International Nuclear Information System (INIS)

1992-01-01

This symposium continues the tradition of bringing together papers on a topic of current interest and importance in terms of process safety - in this case, Major Hazards Onshore and Offshore. Lord Cullen in his report on the Piper Alpha disaster has, in effect, suggested that the experience gained in the control of major hazards onshore during the 1980s should be applied to improve safety offshore during the 1990s. This major three-day symposium reviews what has been learned so far with regard to major hazards and considers its present and future applications both onshore and offshore. The topics covered in the programme are wide ranging and deal with all aspects of legislation, the application of regulations, techniques for evaluating hazards and prescribing safety measures in design, construction and operation, the importance of the human factors, and recent technical developments in protective measures, relief venting and predicting the consequences of fires and explosions. (author)

Stray dogs of northern Jordan as reservoirs of ticks and tick-borne hemopathogens

Czech Academy of Sciences Publication Activity Database

Qablan, M.; Kubelová, M.; Široký, P.; Modrý, David; Amr, Z. S.

2012-01-01

Roč. 111, č. 1 (2012), s. 301-307 ISSN 0932-0113 R&D Projects: GA ČR GA206/09/0927 Grant - others:GA CR(CZ) GA524/09/0715 Keywords : ANAPLASMA-PHAGOCYTOPHILUM * GRANULOCYTIC EHRLICHIOSIS * MOLECULAR EVIDENCE * CANINE BABESIOSIS * HEPATOZOON-CANIS * ISRAEL * IXODIDAE * ACARI * COINFECTION * INFECTION Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.852, year: 2012

Biological characterization of venom peptides from the neotropical social waps Polistes major major (Dominican Republic)

Czech Academy of Sciences Publication Activity Database

Slaninová, Jiřina; Fučík, Vladimír; Borovičková, Lenka; Čeřovský, Václav

2007-01-01

Roč. 151, S1 (2007), s. 87-89 ISSN 1213-8118. [Pharmacological Days. Czech and Slovak Pharmacological Meeting /57./. Olomouc, 12.09.2007-14.09.2007] Institutional research plan: CEZ:AV0Z40550506 Keywords : venom peptides * Polistes major major Subject RIV: CE - Biochemistry

Major international sport profiles.

Science.gov (United States)

Patel, Dilip R; Stier, Bernhard; Luckstead, Eugene F

2002-08-01

Sports are part of the sociocultural fabric of all countries. Although different sports have their origins in different countries, many sports are now played worldwide. International sporting events bring athletes of many cultures together and provide the opportunity not only for athletic competition but also for sociocultural exchange and understanding among people. This article reviews five major sports with international appeal and participation: cricket, martial arts, field hockey, soccer, and tennis. For each sport, the major aspects of physiological and biomechanical demands, injuries, and prevention strategies are reviewed.

Major Decisions: Motivations for Selecting a Major, Satisfaction, and Belonging

Science.gov (United States)

Soria, Krista M.; Stebleton, Michael

2013-01-01

In this paper, we analyzed the relationship between students' motivations for choosing academic majors and their satisfaction and sense of belonging on campus. Based on a multi-institutional survey of students who attended large, public, research universities in 2009, the results suggest that external extrinsic motivations for selecting a major…

Unconventional Internships for English Majors.

Science.gov (United States)

Otto, Don H.

After five years of research, the English department at St. Cloud (Minnesota) State University created an internship program for English majors. The philosophy behind the program is that the typical experience of the English major in college is excellent preparation for what the college graduate will be doing in most careers in business,…

Major Biomass Conference

Science.gov (United States)

Top Scientists, Industry and Government Leaders to Gather for Major Biomass Conference America, South America and Europe will focus on building a sustainable, profitable biomass business at the Third Biomass Conference of the Americas in Montreal. Scheduled presentations will cover all biomass

An Alternative and Rapid Method for the Extraction of Nucleic Acids from Ixodid Ticks by Potassium Acetate Procedure

Directory of Open Access Journals (Sweden)

Islay Rodríguez

2014-08-01

Full Text Available Four variants of the potassium acetate procedure for DNA extraction from ixodid ticks at different stage of their life cycles were evaluated and compared with phenol-chloroform and ammonium hydroxide methods. The most rapid and most efficient variant was validated in the DNA extraction procedure from the engorged ticks collected from bovine, canine as well as from house ticks for the screening of Borrelia burgdorferi sensu lato, Anaplasma spp. and Babesia spp. The ammonium hydroxide procedure was used for non-engorged ticks. All the variants were efficient and allowed obtaining PCR-quality material according to the specific amplification of 16S rRNA gene fragment of the original tick. DNA extracted from the ticks under the study was tested by multiplex PCR for the screening of tick-borne pathogens. Anaplasma spp. and Babesia spp. amplification products were obtained from 29/48 extracts. Ammonium hydroxide protocol was not efficient for two extracts. Detection of amplification products from the PCR indicated that DNA had been successfully extracted. The potassium acetate procedure could be an alternative, rapid, and reliable method for DNA extraction from the ixodid ticks, mainly for poorly-resourced laboratories.

The Prototypical Majority Effect Under Social Influence.

Science.gov (United States)

Koriat, Asher; Adiv-Mashinsky, Shiri; Undorf, Monika; Schwarz, Norbert

2018-05-01

Majority views are reported with greater confidence and fluency than minority views, with the difference increasing with majority size. This Prototypical Majority Effect (PME) was attributed generally to conformity pressure, but Koriat et al. showed that it can arise from the processes underlying decision and confidence independent of social influence. Here we examined the PME under conditions that differ in social influence. In Experiment 1, a robust PME emerged in the absence of information about the majority views, but the provision sof that information increased the choice of the majority view and magnified the PME. In Experiment 2, a PME emerged in a minority-biased condition that misled participants to believe that the majority view was the minority view, but the PME was stronger in a majority-biased condition. The results were discussed in terms of a dual-process view: The PME observed under social influence may contain externally driven and internally driven components.

Personality, academic majors and performance

DEFF Research Database (Denmark)

Vedel, Anna; Thomsen, Dorthe Kirkegaard; Larsen, Lars

2015-01-01

Personality–performance research typically uses samples of psychology students without questioning their representativeness. The present article reports two studies challenging this practice. Study 1: group differences in the Big Five personality traits were explored between students (N = 1067......) in different academic majors (medicine, psychology, law, economics, political science, science, and arts/humanities), who were tested immediately after university enrolment. Study 2: six and a half years later the students’ academic records were obtained, and predictive validity of the Big Five personality...... traits and their subordinate facets was examined in the various academic majors in relation to Grade Point Average (GPA). Significant group differences in all Big Five personality traits were found between students in different academic majors. Also, variability in predictive validity of the Big Five...

Securing Major Events

International Nuclear Information System (INIS)

Loeoef, Susanna

2013-01-01

When asked why the IAEA should provide nuclear security support to countries that organize large public events, Nuclear Security Officer Sophia Miaw answers quickly and without hesitation. ''Imagine any major public event such as the Olympics, a football championship, or an Expo. If a dirty bomb were to be exploded at a site where tens of thousands of people congregate, the radioactive contamination would worsen the effects of the bomb, increase the number of casualties, impede a rapid emergency response, and cause long term disruption in the vicinity,'' she said. Avoiding such nightmarish scenarios is the driving purpose behind the assistance the IAEA offers States that host major sporting or other public events. The support can range from a single training course to a comprehensive programme that includes threat assessment, training, loaned equipment and exercises. The type and scope of assistance depends on the host country's needs. ''We incorporate nuclear security measures into their security plan. We don't create anything new,'' Miaw said

Major workplace related accidents in Singapore: A major trauma centre's experience.

Science.gov (United States)

Ng, Zhi Xu; Teo, Li Tserng; Go, Karen T S; Yeo, Yen Teng; Chiu, Ming Terk

2010-12-01

Major workplace related accidents pose a significant healthcare resource challenge in Singapore. Our study looks at the epidemiology of patients who were admitted for workplace related accidents, in a single institution, with an Injury Severity Score of >9. There were 196 cases of major workplace related accidents admitted between January 2006 and December 2007. The median age of patients admitted was 37 years with a large percentage being males (95.4%) and non-residents (57.1%). The most common ethnic group was Chinese (53.1%) followed by Indians (23.5%). The most common mechanism of injury was fall from height (66.3%) followed by injuries as a result of falling objects at work (21.9%). The percentage of patients who required surgical intervention was 69.9%. Patients admitted for major workplace related accidents had a median length of stay of 5 days in the hospital, a median length of 24 days of medical leave (ML), certifying them unfit for duty and the average cost of stay for each patient was S$11,000. We have a better understanding of the epidemiology and socio-economic impact of workplace related accidents through this study. Workplace related accidents result in significant number of man-days lost from work and monetary cost to employers, medical insurance and the hospital. With an improved understanding, we propose methods to prevent and reduce such accidents in future. A direct consequence of which will be the possible reduction of hospitalisation costs and better allocation of healthcare resources in the future.

Major Highway Lines, US, 2015, NAVTEQ

Data.gov (United States)

U.S. Environmental Protection Agency — NAVTEQ Major Highways for the United States. The Major Highways layer contains Road Network features based on the Functional Class attribute value on each link...

Major New Initiatives

Indian Academy of Sciences (India)

First page Back Continue Last page Overview Graphics. Major New Initiatives. Multi-party multi-rate video conferencing OOPS. Live Lecture OOPS. Rural ATM Machine Vortex. Finger print detection HP-IITM. Medical Diagnostic kit NeuroSynaptic. LCD projection system TeNeT. Web Terminal MeTeL Midas. Entertainment ...

Liquid in the major incision

International Nuclear Information System (INIS)

Herrera Jaramillo, Diego Alberto; Ortega Jaramillo, Hector

2003-01-01

We present the case of a patient with spill pleural extending in the left major incision. In the chest thorax PA, we could observe one of the complex radiographic appearances that take the reconfiguration of fluid in this localization, being this appearance dependent of the patient's position. Some points are also discussed on the anatomy of the major incisions and some of their radiographic characteristics

Domingo de Ramos, dalla violenza urbana alla solidarietà marginale

Directory of Open Access Journals (Sweden)

Riccardo Badini

2016-12-01

Full Text Available The article aims to analyze the poetry of Domingo de Ramos (Peru 1960 through themes like violence, urban decay and migration and presents the translation of an unpublished poem. A path is traced from the vanguards to the socio historical and political context of the  80s Peru, not to mention the innate inclination of the poet for marginal realities.

75 FR 31383 - Major Capital Investment Projects

Science.gov (United States)

2010-06-03

...-0009] RIN 2132-AB02 Major Capital Investment Projects AGENCIES: Federal Transit Administration (FTA... current approach to evaluating and rating major capital investment projects (``New Starts'' and ``Small...'' to address identified transportation needs in the corridor without a major capital investment in new...

Exorcismos del lenguaje. Letanías e incomunicación: voces de Chernóbil.

OpenAIRE

García Pérez, Manuel

2009-01-01

Frente a la actual retórica política de discursos informativamente previsibles donde la deslexicalización de los conceptos es cada vez más frecuente, existen publicaciones marginales que reflejan crudos testimonios de realidades objetivables no contempladas por los discursos mediáticos de las actuales socialdemocracias. La inefabilidad del dolor se transcribe entonces en una fragmentación recurrente de estructuras expresivas, más allá de la mitificación de convenciones lingüísticas tan repeti...

Jefaturas femeninas : una aproximación a la feminización de la pobreza y de la responsabilidad en familias desplazadas por la violencia

OpenAIRE

Yuri Romero-Picón; Yuri Chávez-Plazas

2013-01-01

Los autores exploran el tema de las jefaturas femeninas en un grupo de mujeres que fueron desplazadas por la violencia y llegaron a vivir a barrios marginales del municipio de Soacha, colombia, donde factores como el bajo nivel de escolaridad, los trabajos mal remunerados a los que tienen acceso, los problemas afectivos y el peso de responder solas con sus hogares agravan su situación de pobreza. En este contexto, la jefatura femenina es un rol que deben asumir para enfrentar la pobreza bajo...

Jefaturas femeninas: una aproximación a la feminización de la pobreza y de la responsabilidad en familias desplazadas por la violencia

OpenAIRE

Romero-Picón, Yuri

2013-01-01

Resumen Los autores exploran el tema de las jefaturas femeninas en un grupo de mujeres que fueron desplazadas por la violencia y llegaron a vivir a barrios marginales del municipio de Soacha, Colombia, donde factores como el bajo nivel de escolaridad, los trabajos mal remunerados a los que tienen acceso, los problemas afectivos y el peso de responder solas con sus hogares agravan su situación de pobreza. En este contexto, la jefatura femenina es un rol que deben asumir para enfrentar la pobre...

Análisis del impacto de la implementación de la red internet en el sistema educativo fiscal promario del cantón Pelileo para el periodo 2005-2010

OpenAIRE

Viteri Galarza, Fernando Paúl

2012-01-01

Sabiendo que la brecha tecnológica existente en los sectores menos favorecidos, como son las áreas rurales y urbano marginales del Ecuador, se incrementa cada vez más debido a una inexistente infraestructura de telecomunicaciones, el gobierno a través del Ministerio de Telecomunicaciones y la sociedad de la información MINTEL, ha ejecutado el proyecto de implementación de la red de internet en el sistema educativo público primario del cantón Pelileo, permitiendo a la comunidad ...

Los sistemas aluviales miocenos del borde noreste de la Cuenca de Madrid: sector Cifuentes - Las Inviernas (Guadalajara)

OpenAIRE

Alonso-Zarza, Ana María; Calvo Sorando, José Pedro; García del Cura, M. Ángeles; Hoyos,, M.

1990-01-01

El relleno mioceno en el borde noreste de la Cuenca de Madrid aparece constituido por varios complejos detríticos que se desarrollan a partir de los relieves mesozoicos de la Cordillera Ibérica, que constituye en este área el borde de la cuenca terciaria. Se definen esencialmente dos tipos de sistemas deposicionales dentro de las áreas marginales de la cuenca: abanicos aluviales y depósitos de ladera. Dentro de los primeros, que constituyen los elementos de mayor envergadura y los contribu...

La agricultura en la ciudad de Buenos Aires

OpenAIRE

Gallardo Araya, Nela Lena

2012-01-01

En diferentes lugares de la ciudad existe una amplia gama de experiencias vinculadas con la producción que incluye desde pequeñas macetas en los balcones hasta florecientes terrenos ubicados en espacios públicos y/o privados. Desde las ciencias agropecuarias, los fenómenos vinculados a la agricultura urbana son temas marginales; no obstante, se presentan valiosas discusiones que dan cuenta de la gran diversidad de prácticas y la importancia que tienen en el contexto actual. Uno de los aportes...

Virtual&Real: un’ipotesi per la realizzazione di un museo integrato.

Directory of Open Access Journals (Sweden)

Luigi Guerra

2008-07-01

Full Text Available Nonostante siano numerosi i musei italiani ad avere un sito Web di riferimento, l’analisi effettuata rileva un uso della rete e delle specificità della telematica assolutamente marginale. Il sito Web solo in rari casi si presenta come estensione del museo stesso, per lo più è una semplice vetrina che offre informazioni pratiche. L’ipotesi presentata nell’articolo ipotizza un uso della rete più complesso, in grado di anticipare estendere e consolidare le conoscenze apprese durante la visita al museo reale.

Bayesian Analysis of Multivariate Threshold Autoregressive Models with Missing Data

OpenAIRE

Calderón Villanueva, Sergio Alejandro

2014-01-01

Resumen. En algunos campos, nos vemos forzados a trabajar con datos faltantes en series de tiempo multivaridas, desafortunadamente el análisis en este contexto no puede ser hecho como en caso completo. El análisis de modelos multivaridos autoregresivos de umbrales(MTAR) con entradas exógenas y datos faltantes es llevado a cabo vía el enfoque Bayesiano. Los métodos MCMC son usados para obtener muestras de las distribuciones marginales aposteriori, incluyendo los valores de los umbrales y los d...

Major planning enquiries

Energy Technology Data Exchange (ETDEWEB)

Shore, P

1978-11-01

This is a speech delivered by the U.K. Secretary of State for the Environment in Manchester (UK) on September 13th 1978. It outlines the Minister's views on the role and significance of major planning inquiries - such as that proposed to be held on the Commercial Demonstration Fast Reactor. (CDFR) (author).

7 CFR 987.104 - Major marketing promotion.

Science.gov (United States)

2010-01-01

... 7 Agriculture 8 2010-01-01 2010-01-01 false Major marketing promotion. 987.104 Section 987.104... IN RIVERSIDE COUNTY, CALIFORNIA Administrative Rules Definitions § 987.104 Major marketing promotion. A major marketing promotion program is one requiring the expenditure of more than $500 of Committee...

The pectoralis major footprint: An anatomical study

Directory of Open Access Journals (Sweden)

Eduardo Antonio de Figueired

2013-12-01

Full Text Available Objective: To study the insertion of the pectoralis major tendon to the humerus, through knowledge of its dimensions in the coronal and sagittal planes. Methods: Twenty shoulders from 10 cadavers were dissected and the pectoralis major tendon insertion on the humerus was identified and isolated. The dimensions of its "footprint" (proximal to distal and medial to lateral borders and the distance from the top edge of the pectoralis major tendon to apex of the humeral head structures were measured. Results: The average proximal to distal border length was 80.8 mm (range: 70 -90 and the medial-to-lateral border length was 6.1 mm (5 -7. The average distance (and range from the apex of the pectoralis major tendon to the humeral head was 59.3 mm. Conclusions: We demonstrate that the insertion of the pectoralis major tendon is laminar, and the pectoralis major tendon has an average footprint height and width of 80.8 mm and 6.1 mm, respectively.

47 CFR 76.51 - Major television markets.

Science.gov (United States)

2010-10-01

... 47 Telecommunication 4 2010-10-01 2010-10-01 false Major television markets. 76.51 Section 76.51... CABLE TELEVISION SERVICE Carriage of Television Broadcast Signals § 76.51 Major television markets. For purposes of the cable television rules, the following is a list of the major television markets and their...

The "Discouraged-Business-Major" Hypothesis: Policy Implications

Science.gov (United States)

Marangos, John

2012-01-01

This paper uses a relatively large dataset of the stated academic major preferences of economics majors at a relatively large, not highly selective, public university in the USA to identify the "discouraged-business-majors" (DBMs). The DBM hypothesis addresses the phenomenon where students who are screened out of the business curriculum often…

Imaging of the major salivary glands

DEFF Research Database (Denmark)

Afzelius, Pia; Nielsen, Ming-Yuan; Ewertsen, Caroline

2016-01-01

The major salivary glands, submandibular, parotid and sublingual glands play an important role in preserving the oral cavity and dental health. Patients with problems of the major salivary glands may present with symptoms such as dry mouth, dysphagia and obstruction of duct, inflammation, severe...

Why It Pays to Major in Economics

Science.gov (United States)

Carroll, Thomas; Assane, Djeto; Busker, Jared

2014-01-01

In this article, the authors use a large, recent, and accessible data set to examine the effect of economics major on individual earnings. They find a significant positive earnings gain for economics majors relative to other majors, and this advantage increases with the level of education. Their findings are consistent with Black, Sanders, and…

El parlache: resultados de una investigación lexicográfica

Directory of Open Access Journals (Sweden)

Castañeda Luz Stella

2005-06-01

Full Text Available La idea de realizar una investigación sobre la caracterización lexicográfica del parlache, con el fin de elaborar un diccionario, se debe al interés de profundizar en el estudio de una variedad dialectal de origen diastrático, del español colombiano, denominada parlache, que utilizan amplios sectores de la sociedad, pero en especial los jóvenes de los barrios populares y marginales de Medellín y de su Área Metropolitana. En toda sociedad se presentan cambios lingüísticos que van mostrando las transformaciones de la realidad. Ahora bien, en los sectores populares y marginales de Medellín, el surgimiento de los cambios lingüísticos fue tan acelerado, que desbordó los límites normales de este fenómeno debido a la  agudización de la crisis social y al surgimiento de nuevas formas de "trabajo", caracterizadas por un marco de trasgresión de la ley y por un amplio dominio de la cultura de la droga, en donde el sector social más afectado ha sido el de los jóvenes. Por esto, a pesar de que el parlache es una variedad dialectal muy extendida, la mayor parte de sus hablantes y los que lo usan con mayor propiedad son los jóvenes entre 15 y 26 años.

El parlache: resultados de una investigación lexicográfica

Directory of Open Access Journals (Sweden)

Luz Stella Castañeda

2005-01-01

Full Text Available La idea de realizar una investigación sobre la caracterización lexicográfica del parlache, con el fin de elaborar un diccionario, se debe al interés de profundizar en el estudio de una variedad dialectal de origen diastrático, del español colombiano, denominada parlache, que utilizan amplios sectores de la sociedad, pero en especial los jóvenes de los barrios populares y marginales de Medellín y de su Área Metropolitana. En toda sociedad se presentan cambios lingüísticos que van mostrando las transformaciones de la realidad. Ahora bien, en los sectores populares y marginales de Medellín, el surgimiento de los cambios lingüísticos fue tan acelerado, que desbordó los límites normales de este fenómeno debido a la agudización de la crisis social y al surgimiento de nuevas formas de “trabajo”, caracterizadas por un marco de trasgresión de la ley y por un amplio dominio de la cultura de la droga, en donde el sector social más afectado ha sido el de los jóvenes. Por esto, a pesar de que el parlache es una variedad dialectal muy extendida, la mayor parte de sus hablantes y los que lo usan con mayor propiedad son los jóvenes entre 15 y 26 años

El parlache: resultados de una investigación lexicográfica

Directory of Open Access Journals (Sweden)

LUZ STELLA CASTAÑEDA

2005-06-01

Full Text Available La idea de realizar una investigación sobre la caracterización lexicográfica del parlache, con el fin de elaborar un diccionario, se debe al interés de profundizar en el estudio de una variedad dialectal de origen diastrático, del español colombiano, denominada parlache, que utilizan amplios sectores de la sociedad, pero en especial los jóvenes de los barrios populares y marginales de Medellín y de su Área Metropolitana. En toda sociedad se presentan cambios lingüísticos que van mostrando las transformaciones de la realidad. Ahora bien, en los sectores populares y marginales de Medellín, el surgimiento de los cambios lingüísticos fue tan acelerado, que desbordó los límites normales de este fenómeno debido a la agudización de la crisis social y al surgimiento de nuevas formas de “trabajo”, caracterizadas por un marco de trasgresión de la ley y por un amplio dominio de la cultura de la droga, en donde el sector social más afectado ha sido el de los jóvenes. Por esto, a pesar de que el parlache es una variedad dialectal muy extendida, la mayor parte de sus hablantes y los que lo usan con mayor propiedad son los jóvenes entre 15 y 26 años.

49 CFR 542.2 - Procedures for selecting low theft light duty truck lines with a majority of major parts...

Science.gov (United States)

2010-10-01

... 49 Transportation 6 2010-10-01 2010-10-01 false Procedures for selecting low theft light duty... TRUCK LINES TO BE COVERED BY THE THEFT PREVENTION STANDARD § 542.2 Procedures for selecting low theft... a low theft rate have major parts interchangeable with a majority of the covered major parts of a...

Performance profiles of major energy producers, 1991

International Nuclear Information System (INIS)

1992-01-01

Performance Profiles of Major Energy Producers 1991 is the fifteenth annual report of the Energy Information Administration's (EIA) Financial Reporting System (FRS). The report examines financial and operating developments, with particular reference to the 23 major energy companies (the FRS companies) required to report annually on Form EIA-28. It also traces key developments affecting the financial performance of major energy companies in 1991, as well as reviews important trends. Financial information is reported by major lines of business including oil and gas production, petroleum refining and marketing, and other energy operations. Domestic and international operations are examined separately in this report

Wildlife reservoirs for vector-borne canine, feline and zoonotic infections in Austria

Science.gov (United States)

Duscher, Georg G.; Leschnik, Michael; Fuehrer, Hans-Peter; Joachim, Anja

2014-01-01

Austria's mammalian wildlife comprises a large variety of species, acting and interacting in different ways as reservoir and intermediate and definitive hosts for different pathogens that can be transmitted to pets and/or humans. Foxes and other wild canids are responsible for maintaining zoonotic agents, e.g. Echinococcus multilocularis, as well as pet-relevant pathogens, e.g. Hepatozoon canis. Together with the canids, and less commonly felids, rodents play a major role as intermediate and paratenic hosts. They carry viruses such as tick-borne encephalitis virus (TBEV), bacteria including Borrelia spp., protozoa such as Toxoplasma gondii, and helminths such as Toxocara canis. The role of wild ungulates, especially ruminants, as reservoirs for zoonotic disease on the other hand seems to be negligible, although the deer filaroid Onchocerca jakutensis has been described to infect humans. Deer may also harbour certain Anaplasma phagocytophilum strains with so far unclear potential to infect humans. The major role of deer as reservoirs is for ticks, mainly adults, thus maintaining the life cycle of these vectors and their distribution. Wild boar seem to be an exception among the ungulates as, in their interaction with the fox, they can introduce food-borne zoonotic agents such as Trichinella britovi and Alaria alata into the human food chain. PMID:25830102

Satisfaction with College Major: A Grounded Theory Study

Science.gov (United States)

Milsom, Amy; Coughlin, Julie

2015-01-01

All college students must eventually choose and complete a major. Many switch majors, and some change it multiple times. Despite extensive literature addressing factors that influence students' initial choice of major, few scholars have examined students' experiences after enrollment in a selected major. In this study, we used a grounded theory…

Predictive Value of C-Reactive Protein for Major Complications after Major Abdominal Surgery: A Systematic Review and Pooled-Analysis.

Directory of Open Access Journals (Sweden)

Jennifer Straatman

Full Text Available Early diagnosis and treatment of complications after major abdominal surgery can decrease associated morbidity and mortality. Postoperative CRP levels have shown a strong correlation with complications. Aim of this systematic review and pooled-analysis was to assess postoperative values of CRP as a marker for major complications and construct a prediction model.A systematic review was performed for CRP levels as a predictor for complications after major abdominal surgery (MAS. Raw data was obtained from seven studies, including 1427 patients. A logit regression model assessed the probability of major complications as a function of CRP levels on the third postoperative day. Two practical cut-offs are proposed: an optimal cut-off for safe discharge in a fast track protocol and another for early identification of patients with increased risk for major complications.A prediction model was calculated for major complications as a function of CRP levels on the third postoperative day. Based on the model several cut-offs for CRP are proposed. For instance, a two cut-off system may be applied, consisting of a safe discharge criterion with CRP levels below 75 mg/L, with a negative predictive value of 97.2%. A second cut-off is set at 215 mg/L (probability 20% and serves as a predictor of complications, indicating additional CT-scan imaging.The present study provides insight in the interpretation of CRP levels after major abdominal surgery, proposing a prediction model for major complications as a function of CRP on postoperative day 3. Cut-offs for CRP may be implemented for safe early-discharge in a fast-track protocol and, secondly as a threshold for additional examinations, such as CT-scan imaging, even in absence of clinical signs, to confirm or exclude major complications. The prediction model allows for setting a cut-off at the discretion of individual surgeons or surgical departments.

Major disruption process in tokamak

International Nuclear Information System (INIS)

Kurita, Gen-ichi; Azumi, Masafumi; Tuda, Takashi; Takizuka, Tomonori; Tsunematsu, Toshihide; Tokuda, Shinji; Itoh, Kimitaka; Takeda, Tatsuoki

1981-11-01

The major disruption in a cylindrical tokamak is investigated by using the multi-helicity code, and the destabilization of the 3/2 mode by the mode coupling with the 2/1 mode is confirmed. The evolution of the magnetic field topology caused by the major disruption is studied in detail. The effect of the internal disruption on the 2/1 magnetic island width is also studied. The 2/1 magnetic island is not enhanced by the flattening of the q-profile due to the internal disruption. (author)

Work Values and College Major Choice

Science.gov (United States)

Balsamo, Michela; Lauriola, Marco; Saggino, Aristide

2013-01-01

Our study sought to clarify the nature of the known individual differences in work values associated with academic college major choice, specifically the question whether these precede or follow the choice of an academic major. To rule out environmental influences during academic study, group differences in five value orientations were evaluated…

Allegheny County Major Rivers

Data.gov (United States)

Allegheny County / City of Pittsburgh / Western PA Regional Data Center — This dataset contains locations of major rivers that flow through Allegheny County. These shapes have been taken from the Hydrology dataset. The Ohio River,...

Le tourisme à moto : les géographies renouvelées d'un phénomène marginal

OpenAIRE

Scol, Jean

2017-01-01

Le tourisme à moto répond souvent à des pratiques marginales et codes particuliers pour lesquels la route, le pilotage et la camaraderie jouent des rôles essentiels. Les concentrations sont un exemple représentatif des spécificités et du caractère marginal de ce tourisme. Le tourisme à moto fut, par ailleurs, longtemps ignoré voire rejeté par les territoires et les professionnels du tourisme qui gardaient de la moto et du motocycliste une image négative. Or, les motards ont changé. Ils sont, ...

Recycling No-man’s-land

OpenAIRE

Domènech Rodríguez, Marta; López López, David; Palumbo Fernández, Mariana

2012-01-01

La cultura del usar y tirar ha imperado en los últimos tiempos y el culto a lo nuevo ha también la arquitectura. Del mismo modo en que se descartan productos de consumo que todavía por los nuevos modelos, se planifican barrios completamente nuevos sobre suelos no urbanizados que provocan la expansión de las ciudades en forma de mancha de aceite, ignorando la de espacios ya urbanizados que se rechazan por ser tejidos industriales o socialmente marginales. Pero,¿No debería ser imperativo recic...

Reconstrucción paleoambiental y asociaciones de foraminiferos de la formación Tubará (plioceno temprano), sección Arroyo Piedras (norte de Colombia)

OpenAIRE

Molinares Blanco, Carlos Eduardo

2007-01-01

La Formación Tubará en el Arroyo Piedras (169 m) es dividida en tres segmentos, interpretados como producto de la sedimentación en ambientes marino marginales relacionados con la evolución del paleo-delta del río Magdalena durante el Plioceno Temprano: El segmento inferior, es interpretado como resultado de sedimentación siliciclástica en una llanura aluvial/deltaica; el segmento intermedio, como el resultado de sedimentación lagunar y/o en pantanos costeros y el superior, como la transición ...

Almidón modificado de yuca como sustituto económico del agente solidificante para medios de cultivo de tejidos vegetales

OpenAIRE

Romay, Gustavo; Matehus, Juan; Gerstl, Armando; Rueda, Rodrigo; Santana, María A

2006-01-01

Con una historia de más de cinco décadas, los beneficios del cultivo de tejidos vegetales (CTV) no han llegado a los agricultores de las regiones más necesitadas. El problema radica en la complejidad y costo de aplicación de la técnica. En Venezuela, la yuca (Manihot esculenta Crantz) es cultivada en suelos marginales por agricultores de escasos recursos. Las limitaciones del cultivo son la carencia de semilla sana y los bajos niveles de rendimiento. Esta situación puede superarse mediante el...

Turismo en el valle del Colca y sus impactos en el desarrollo

OpenAIRE

Córdova Aguilar, Hildegardo

2014-01-01

El turismo es una actividad que se viene proponiendo como la salida a los cuellos de botella que aparecen en la gestión de los procesos de desarrollo en territorios marginales, tal como es el caso de los Andes. La pobreza de las poblaciones que viven en zonas montañosas obliga a repensar las formas de desarrollo, para que las mismas les permitan una transferencia real de bienes materiales y los lleven a elevar su calidad de vida. Estos bienes, por lo general, no se producen localmente y ello ...

La subjetividad de la sociedad de trabajo

OpenAIRE

Hinkelammert, Franz

2005-01-01

El ensayo tiene como propósito lanzar una llamada de atención crítica ante una serie de fenómenos de índole política, económica y social que se gestan actualmente en el orden mundial. Describe, de manera amplia, cómo la globalización alimentada por un nuevo capitalismo evolucionado y la burocracia de las trasnacionales socavan lasensibilidad social del trabajo, el núcleo de identidad cultural de los pueblos y la democracia, transformándolas en fraudulentas y marginales, a la vez que contempla...

Vigencia y garantía de los derechos en las políticas petroleras en el año 2011

OpenAIRE

Almeida, Alexandra

2012-01-01

Evidencia las consecuencias de la aplicación de la política petrolera impulsada por la reforma de la Ley de Hidrocarburos que incluye la entrega de campos maduros a empresas privadas; la décima ronda de licitaciones para entregar campos marginales y la décimo primera ronda de licitaciones para concesionar los bloques del sur de la Amazonía, lo que conlleva violaciones de los derechos de las poblaciones que residen en los campos de explotación y amenazan a nuevas poblaciones. Estas poblaciones...

Cooperativas de pescadores artesanales y habitantes ribereños del Paraná: una experiencia de economía solidaria

OpenAIRE

Petean, Julieta; Capatto, Jorge

2011-01-01

Los pescadores artesanales y de subsistencia que integran las cooperativas de la costa del Paraná, objeto del presente trabajo, forman parte de un sector de muy bajos ingresos económicos que vive en zonas ribereñas marginales de los centros urbanos costeros o en comunidades dispersas y aisladas ubicadas en áreas casi siempre expuestas a riesgos de inundación. La formación de estas cooperativas forma parte del trabajo desarrollado en torno a la conservación de la diversidad biológica y cultura...

Resultados de un sistema para la vigilancia de caries de la infancia temprana

OpenAIRE

Eduardo BERNABÉ ORTIZ; Elsa Karina DELGADO-ANGULO; Pablo César SÁNCHEZ-BORJAS

2006-01-01

Objetivo: Describir los resultados de un sistema, implementado con los estudiantes de la Facultad de Estomatología Roberto Beltrán Neira, para la vigilancia de caries de la infancia temprana (CIT) en niños entre 6 y 36 meses de edad de comunidades urbano-marginales de Sol Naciente de Carabayllo. Materiales y métodos: Sesenta y dos de los 97 niños que aceptaron participar en la evaluación inicial durante el semestre 2004-I, fueron reexaminados a los 12 (semestre 2005-I) y 18 meses (semestre 20...

Relación del desarrollo cognitivo con el clima familiar y el estrés de la crianza

OpenAIRE

Vera Noriega,José Ángel; Morales Nebuay,Dulce Karina; Vera Noriega,Cristina

2005-01-01

Se llevo a cabo un estudio con 120 familias en pobreza extrema de las zonas marginales de Hermosillo, Sonora México. Madres de 32 años en promedio respondieron a una escala de funcionamiento familiar, estrés de la crianza y sus niños fueron medidos en desarrollo cognitivo. El objetivo fue evaluar las diferencias significativas entre los tres tipos de familias en su desarrollo cognitivo, el estrés de la crianza y el clima familiar. Se clasificaron las familias en base a la medida de clima fami...

Relationship of the cognitive development with the family clime and stress of the childrearing

OpenAIRE

Vera Noriega, José Ángel; Morales Nebuay, Dulce Karina; Vera Noriega, Cristina

2005-01-01

Se llevo a cabo un estudio con 120 familias en pobreza extrema de las zonas marginales de Hermosillo, Sonora México. Madres de 32 años en promedio respondieron a una escala de funcionamiento familiar, estrés de la crianza y sus niños fueron medidos en desarrollo cognitivo. El objetivo fue evaluar las diferencias significativas entre los tres tipos de familias en su desarrollo cognitivo, el estrés de la crianza y el clima familiar. Se clasificaron las familias en base a la medida de clima fami...

Malnutrición de micronutrientes. Estrategias de prevención y control.

OpenAIRE

Carlos Hernán Daza

2009-01-01

Las deficiencias de vitaminas y minerales afectan especialmente a madres y niños en áreas rurales y marginales de las grandes ciudades de los países en desarrollo, debido al consumo insuficiente de alimentos ricos en estos nutrientes, a infecciones recurrentes y síndromes de mala absorción. La fortificación de alimentos de consumo habitual y la suplementación de nutrientes deficitarios en la alimentación previenen la malnutrición de micronutrientes. En Colombia se fortifica la harina de trigo...

Performance profiles of major energy producers 1989

Energy Technology Data Exchange (ETDEWEB)

1991-01-23

Performance Profiles of Major Energy Producers 1989 is the thirteenth annual report of the Energy Information Administration's (EIA) Financial Reporting System (FRS). The report examines financial and operating developments, with particular reference to the 23 major energy companies (the FRS companies'') required to report annually on Form EIA-28. Financial information is reported by major lines of business including oil and gas production, petroleum refining and marketing, and other energy operations. Domestic and international operations are examined separately in this report. It also traces key developments affecting the financial performance of major energy companies in 1989, as well as review of important trends.

Major operations and activities

Energy Technology Data Exchange (ETDEWEB)

Black, D.G.

1995-06-01

This section of the 1994 Hanford Site Environmental Report summarizes the major operations and activities on the site. These operations and activities include site management, waste management, environmental restoration and corrective actions, and research and technology development.

Major operations and activities

International Nuclear Information System (INIS)

Black, D.G.

1995-01-01

This section of the 1994 Hanford Site Environmental Report summarizes the major operations and activities on the site. These operations and activities include site management, waste management, environmental restoration and corrective actions, and research and technology development

A major safety overhaul

CERN Multimedia

2003-01-01

A redefined policy, a revamped safety course, an environmental project... the TIS (Technical Inspection and Safety) Division has begun a major safety overhaul. Its new head, Wolfgang Weingarten, explains to the Bulletin why and how this is happening.

Sex segregation in undergraduate engineering majors

Science.gov (United States)

Litzler, Elizabeth

Gender inequality in engineering persists in spite of women reaching parity in college enrollments and degrees granted. To date, no analyses of educational sex segregation have comprehensively examined segregation within one discipline. To move beyond traditional methods of studying the long-standing stratification by field of study in higher education, I explore gender stratification within one field: engineering. This dissertation investigates why some engineering disciplines have a greater representation of women than other engineering disciplines. I assess the individual and institutional factors and conditions associated with women's representation in certain engineering departments and compare the mechanisms affecting women's and men's choice of majors. I use national data from the Engineering Workforce Commission, survey data from 21 schools in the Project to Assess Climate in Engineering study, and Carnegie Foundation classification information to study sex segregation in engineering majors from multiple perspectives: the individual, major, institution, and country. I utilize correlations, t-tests, cross-tabulations, log-linear modeling, multilevel logistic regression and weighted least squares regression to test the relative utility of alternative explanations for women's disproportionate representation across engineering majors. As a whole, the analyses illustrate the importance of context and environment for women's representation in engineering majors. Hypotheses regarding hostile climate and discrimination find wide support across different analyses, suggesting that women's under-representation in certain engineering majors is not a question of choice or ability. However, individual level factors such as having engineering coursework prior to college show an especially strong association with student choice of major. Overall, the analyses indicate that institutions matter, albeit less for women, and women's under-representation in engineering is not

Profiles of Motivated Self-Regulation in College Computer Science Courses: Differences in Major versus Required Non-Major Courses

Science.gov (United States)

Shell, Duane F.; Soh, Leen-Kiat

2013-12-01

The goal of the present study was to utilize a profiling approach to understand differences in motivation and strategic self-regulation among post-secondary STEM students in major versus required non-major computer science courses. Participants were 233 students from required introductory computer science courses (194 men; 35 women; 4 unknown) at a large Midwestern state university. Cluster analysis identified five profiles: (1) a strategic profile of a highly motivated by-any-means good strategy user; (2) a knowledge-building profile of an intrinsically motivated autonomous, mastery-oriented student; (3) a surface learning profile of a utility motivated minimally engaged student; (4) an apathetic profile of an amotivational disengaged student; and (5) a learned helpless profile of a motivated but unable to effectively self-regulate student. Among CS majors and students in courses in their major field, the strategic and knowledge-building profiles were the most prevalent. Among non-CS majors and students in required non-major courses, the learned helpless, surface learning, and apathetic profiles were the most prevalent. Students in the strategic and knowledge-building profiles had significantly higher retention of computational thinking knowledge than students in other profiles. Students in the apathetic and surface learning profiles saw little instrumentality of the course for their future academic and career objectives. Findings show that students in STEM fields taking required computer science courses exhibit the same constellation of motivated strategic self-regulation profiles found in other post-secondary and K-12 settings.

A sero-epidemiological survey of blood parasites in cattle in the north-eastern Free State, South Africa

Directory of Open Access Journals (Sweden)

M.S. Mtshali

2004-11-01

Full Text Available A survey to determine the incidence of parasites in cattle (n = 386 was conducted in the north eastern Free State between August 1999 and July 2000. Giemsa-stained blood smears were negative for blood parasites. A total of 94 % of the cattle were sero-positive for Babesia bigemina by indirect fluorescent antibody test while 87 % were sero-positive for Anaplasma by enzyme-linked immunosorbent assay. The observation of negative blood smears but high incidence of positive serological results for Anaplasma and Babesia for the same group of cattle indicates that this area is endemic for these diseases but with a stable disease situation. All the animals were sero-negative for B. bovis and this is probably because the tick vector (Boophilus microplus which transmits the disease is not present in the Free State Province. Two tick species belonging to the family Ixodidae were found on cattle, namely Boophilus decoloratus and Rhipicephalus evertsi evertsi. In the present study significant differences in seasonal burdens of B. decoloratus occurred, with the highest infestations recorded from February to June. The presence of R. evertsi evertsi throughout the year without any or with small fluctuations in winter months was observed, with a peak from February to May

Molecular and serological detection of tick-borne pathogens in dogs from an area endemic for Leishmania infantumin Mato Grosso do Sul, Brazil

Directory of Open Access Journals (Sweden)

Keyla Carstens Marques de Sousa

Full Text Available Tick-borne pathogens affect a wide range of vertebrate hosts. To identify tick-borne pathogens among dogs from Campo Grande, MS, Brazil testing seropositive for Leishmania infantum (syn. L. chagasi, a serological and molecular study was conducted to detectEhrlichia canis, Anaplasma platys and Babesia vogeli in 60 serum and spleen samples. A confirmatory diagnosis ofL. infantum based on serological and molecular assays was also performed, as was sequence alignment and phylogenetic analysis to assess the identity of the parasite species infecting these animals. IgG antibodies toEhrlichia spp., B. vogeli and L. infantum were found, respectively, in 39 (65%, 49 (81.6% and 60 (100% of the sampled dogs. Twenty-seven (45%, fifty-four (90%, fifty-three (88.3%, two (3.3% and one (1.6% dog were positive, respectively, forE. canis, Leishmania spp., Leishmania donovani complex, Babesia sp. and Anaplasma sp. in PCR assays. After sequencing, the amplicons showed 99% of identity with E. canis, B. vogeli, A. platys andLeishmania chagasi isolates. The findings of this study indicate that L. infantum-seropositive dogs from Campo Grande are exposed to multiple tick-borne pathogens, which should therefore be included in the differential diagnosis of dogs with clinical suspicion of leishmaniasis.

Franjas marginales de Brassica campestris L. (nabo) en cultivo de repollo. Efecto sobre pulgones y sus parasitoides: Título abreviado: Franjas marginales de Brassica campestris L. ....

OpenAIRE

Curis, M. C; Saravia Steudtner, F; Favaro, J. C; Sánchez, D; Bertolaccini, I

2014-01-01

La diversidad vegetal en los agroecosistemas afecta la dinámica poblacional de las plagas y de sus enemigos naturales, siendo una alternativa de control el uso de franjas trampa en algunos cultivos. El objetivo del trabajo fue determinar como una franja marginal de Brassicas campestris L. (Brassicales, Brassicaceae), afecta a la población de los pulgones de B. oleracea var. capitata y de sus parasitoides. El estudio se llevó a cabo en Santa Fe, a partir de febrero de 2012. Se estableció en un...

14 CFR 313.4 - Major regulatory actions.

Science.gov (United States)

2010-01-01

...) PROCEDURAL REGULATIONS IMPLEMENTATION OF THE ENERGY POLICY AND CONSERVATION ACT § 313.4 Major regulatory... of actions shall not be deemed as major regulatory actions requiring an energy statement: (1) Tariff...

Unity in Major Themes

DEFF Research Database (Denmark)

Booss-Bavnbek, Bernhelm; Davis, Philip J.

We describe and explain the desire, common among mathematicians, both for unity and independence in its major themes. In the dialogue that follows, we express our spontaneous and considered judgment and reservations; by contrasting the development of mathematics as a goal-driven process as opposed...

Nonspecific Bacterial Flora Isolated from the Body Surface and Inside Ixodes ricinus Ticks.

Science.gov (United States)

Okła, Hubert; Sosnowska, Malwina; Jasik, Krzysztof P; Słodki, Jan; Wojtyczka, Robert D

2012-09-28

Ixodes ricinus and other representatives of the order Ixodida are vectors of typical pathogens: Borrelia burgdorferi sensu lato, Anaplasma phagocytophilium, Babesia spp., a tick-borne encephalitis virus, and other microorganisms which are important from a medical and veterinary point of view. The presented study focuses on the verification of nonspecific bacterial flora of I. ricinus. We analyzed ticks collected in a forest region in Silesia, an industrial district in Poland. Methods of classical microbiology and biochemical assays (API 20 NE test, API Staph test and MICRONAUT System) were used for isolation and identification of microorganisms living on the body surface of I. ricinus and inside ticks. The results show the presence of various bacteria on the surface and inside ticks' bodies. During the study, we isolated Acinetobacter lwoffi, Pseudomonas fluorescens, Aeromonas hydrophila, Achromobacter denitrificans, Alcaligenes faecalis, Stenotrophomonas maltophilia, Pseudomonas oryzihabitans, Micrococcus spp., Kocuria varians, Staphylococcus lentus, Kocuria kristinae, Streptococcus pneumoniae, Rhizobium radiobacter, Staphylococcus xylosus. Majority of the isolated species are non-pathogenic environmental microorganisms, but some of the isolated bacterial strains could cause severe infections.

Performance profiles of major energy producers 1979

International Nuclear Information System (INIS)

1981-07-01

The purpose of this report is to examine year-to-year developments in the operations of 26 major US energy companies on a corporate level and also by major line of energy business and by major functions within each line of business. The period covered is 1977 to 1979. Comparisons of income and investment flow are featured and related to functionally allocated net investment in place. The presentation seeks to identify similarities and dissimilarities in results across lines-of-business activity or by firm size

Developing "Green" Business Plans: Using Entrepreneurship to Teach Science to Business Administration Majors and Business to Biology Majors

Science.gov (United States)

Letovsky, Robert; Banschbach, Valerie S.

2011-01-01

Biology majors team with business administration majors to develop proposals for "green" enterprise for a business plan competition. The course begins with a series of student presentations so that science students learn about the fundamentals of business, and business students learn about environmental biology. Then mixed biology-business student…

34 CFR 691.17 - Determination of eligible majors.

Science.gov (United States)

2010-07-01

... ACCESS TO RETAIN TALENT GRANT (NATIONAL SMART GRANT) PROGRAMS Application Procedures § 691.17... list of eligible majors identified by CIP code. (d) Designation of an additional eligible major. (1... include— (i) The CIP code and program title of the additional major; (ii) The reason or reasons the...

The major tokamak distruption in cylindrical plasma

International Nuclear Information System (INIS)

Choi, Jeong Sik; Choi, Eun Ha; Choi, Duk In

1986-01-01

The mechanism of the major disruption in tokamak plasma which involves the nonlinear interaction of tearing models is numerically studied in two and three dimensional formulations. In this study, it is found that in the two dimensional case with a flattened current density profile the magnetic islands of the m=2; n=1 mode do not saturate nonlinearly and but strongly interact with the limiter. Thus it is suggested that the helical perturbation of the m=2;n=1 mode plays the dominant role in the major disruption. We also show that the m=2;n=1 mode nonlinearly destablizes other tearing modes, especially the m=3;n=2 mode, from the nonlinear coupling of different helicities as also shown in other studies. The plasma extends across the plasma cross section, and the plasma core shifts inward along the major radius during the major disruption. The numerical result for the major disruption time measured using the nonlinear 3-D procedure for the initial value problem with PLT parameters is about 450 μsec which agrees reasonably well with the experimental value of 500 μsec. (Author)

Performance profiles of major energy producers 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-01-01

This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs.

Performance profiles of major energy producers 1996

International Nuclear Information System (INIS)

1998-01-01

This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs

Characterizing the epistemological development of physics majors

Directory of Open Access Journals (Sweden)

Elizabeth Gire

2009-02-01

Full Text Available Students in introductory physics courses are likely to have views about physics that differ from those of experts. However, students who continue to study physics eventually become experts themselves. Presumably these students either possess or develop more expertlike views. To investigate this process, the views of introductory physics students majoring in physics are compared with the views of introductory physics students majoring in engineering. In addition, the views of physics majors are assessed at various stages of degree progress. The Colorado learning attitudes about science survey is used to evaluate students’ views about physics, and students’ overall survey scores and responses to individual survey items are analyzed. Beginning physics majors are significantly more expertlike than nonmajors in introductory physics courses, and this high level of sophistication is consistent for most of undergraduate study.

Inequalities theory of majorization and its applications

CERN Document Server

Olkin, Ingram

1980-01-01

Although they play a fundamental role in nearly all branches of mathematics, inequalities are usually obtained by ad hoc methods rather than as consequences of some underlying ""theory of inequalities."" For certain kinds of inequalities, the notion of majorization leads to such a theory that is sometimes extremely useful and powerful for deriving inequalities. Moreover, the derivation of an inequality by methods of majorization is often very helpful both for providing a deeper understanding and for suggesting natural generalizations.Anyone wishing to employ majorization as a tool in applicati

A break-even analysis of major ear surgery.

Science.gov (United States)

Wasson, J D; Phillips, J S

2015-10-01

To determine variables which affect cost and profit for major ear surgery and perform a break-even analysis. Retrospective financial analysis. UK teaching hospital. Patients who underwent major ear surgery under general anaesthesia performed by the senior author in main theatre over a 2-year period between dates of 07 September 2010 and 07 September 2012. Income, cost and profit for each major ear patient spell. Variables that affect major ear surgery profitability. Seventy-six patients met inclusion criteria. Wide variation in earnings, with a median net loss of £-1345.50 was observed. Income was relatively uniform across all patient spells; however, theatre time of major ear surgery at a cost of £953.24 per hour varied between patients and was the main determinant of cost and profit for the patient spell. Bivariate linear regression of earnings on theatre time identified 94% of variation in earnings was due to variation in theatre time (r = -0.969; P break-even time for major ear surgery of 110.6 min. Theatre time was dependent on complexity of procedure and number of OPCS4 procedures performed, with a significant increase in theatre time when three or more procedures were performed during major ear surgery (P = 0.015). For major ear surgery to either break-even or return a profit, total theatre time should not exceed 110 min and 36 s. © 2015 John Wiley & Sons Ltd.

Exercise for patients with major depression

DEFF Research Database (Denmark)

Krogh, Jesper; Speyer, Helene; Gluud, Christian

2015-01-01

is to investigate the beneficial and harmful effects of exercise, in terms of severity of depression, lack of remission, suicide, and so on, compared with treatment as usual with or without co-interventions in randomized clinical trials involving adults with a clinical diagnosis of major depression. A meta......BACKGROUND: The lifetime prevalence of major depression is estimated to affect 17% of the population and is considered the second largest health-care problem globally in terms of the number of years lived with disability. The effects of most antidepressant treatments are poor; therefore, exercise...... has been assessed in a number of randomized clinical trials. A number of reviews have previously analyzed these trials; however, none of these reviews have addresses the effect of exercise for adults diagnosed with major depression. METHODS/DESIGN: The objective of this systematic review...

Absolutism versus Relativism: Philosophies of Education and Business Majors.

Science.gov (United States)

Deering, Thomas S.; And Others

1994-01-01

Results of the administration of Forsyth's Ethics Position Questionnaire to 20 student teachers, 20 experienced teachers, and 24 business majors were as follows: education majors and teachers were more idealistic and less relativistic than business majors; business majors showed significant disparity among themselves. Implications for the…

Prevention of Major Accident Hazards (MAHs) in major Hazard Installation (MHI) premises via land use planning (LUP): a review

Science.gov (United States)

Khudbiddin, M. Q.; Rashid, Z. A.; Yeong, A. F. M. S.; Alias, A. B.; Irfan, M. F.; Fuad, M.; Hayati, H.

2018-03-01

For a number of years, there is a concern about the causes of major hazards, their identification, risk assessment and the process of its management from the global perspective on the activities of the industries due to the protection of the environment, human and property. Though, industries cannot take pleasure in their business by harming the nature of the land, there are a number of measures that need to be put into consideration by the industries. Such measures are in terms of management and safety for the businesses, lives, properties, as well as the environment. The lack of consideration in the selected appropriate criteria can result in major accidental hazards (MAHs). This paper will review the land use planning (LUP) methods used in the past and present to prevent major accident hazards at major hazard installation (MHI).

Disturbances in equilibrium function after major earthquake.

Science.gov (United States)

Honma, Motoyasu; Endo, Nobutaka; Osada, Yoshihisa; Kim, Yoshiharu; Kuriyama, Kenichi

2012-01-01

Major earthquakes were followed by a large number of aftershocks and significant outbreaks of dizziness occurred over a large area. However it is unclear why major earthquake causes dizziness. We conducted an intergroup trial on equilibrium dysfunction and psychological states associated with equilibrium dysfunction in individuals exposed to repetitive aftershocks versus those who were rarely exposed. Greater equilibrium dysfunction was observed in the aftershock-exposed group under conditions without visual compensation. Equilibrium dysfunction in the aftershock-exposed group appears to have arisen from disturbance of the inner ear, as well as individual vulnerability to state anxiety enhanced by repetitive exposure to aftershocks. We indicate potential effects of autonomic stress on equilibrium function after major earthquake. Our findings may contribute to risk management of psychological and physical health after major earthquakes with aftershocks, and allow development of a new empirical approach to disaster care after such events.

Pediatric emergency department census during major sporting events.

Science.gov (United States)

Kim, Tommy Y; Barcega, Besh B; Denmark, T Kent

2012-11-01

Our study attempted to evaluate the effects of major sporting events on the census of a pediatric emergency department (ED) in the United States specifically related to the National Football League Super Bowl, National Basketball Association (NBA) Finals, and Major League Baseball World Series. We performed a retrospective data analysis of our pediatric ED census on the number of visits during major sporting events over a 5-year period. Data during the same period 1 week after the major sporting event were collected for comparison as the control. We evaluated the medians of 2-hour increments around the event start time. Subgroup analysis was performed for games involving the local sporting teams. Our results showed no significant difference in ED census during the sporting events, except in the post 6 to 8 hours of the NBA finals. Subgroup analysis of the Los Angeles Lakers showed the same significant findings in the post 6 to 8 hours of the NBA finals. No major difference in pediatric ED census is observed during the most major sporting events in the United States.

Paracetamol, Ibuprofen, and Recurrent Major Cardiovascular and Major Bleeding Events in 19 120 Patients With Recent Ischemic Stroke.

Science.gov (United States)

Gonzalez-Valcarcel, Jaime; Sissani, Leila; Labreuche, Julien; Bousser, Marie-Germaine; Chamorro, Angel; Fisher, Marc; Ford, Ian; Fox, Kim M; Hennerici, Michael G; Mattle, Heinrich P; Rothwell, Peter M; Steg, Philippe Gabriel; Vicaut, Eric; Amarenco, Pierre

2016-04-01

The presumed safety of paracetamol in high-cardiovascular risk patients has been questioned. We determined whether paracetamol or ibuprofen use is associated with major cardiovascular events (MACE) or major bleeding in 19 120 patients with recent ischemic stroke or transient ischemic attack of mainly atherothrombotic origin included in the Prevention of cerebrovascular and cardiovascular events of ischemic origin with terutroban in patients with a history of ischemic stroke or transient ischemic attack (PERFORM) trial. We performed 2 nested case-control analysis (2153 cases with MACE during trial follow-up and 4306 controls matched on Essen stroke risk score; 809 cases with major bleeding matched with 1616 controls) and a separate time-varying analysis. 12.3% were prescribed paracetamol and 2.5% ibuprofen. Median duration of treatment was 14 (interquartile range 5-145) days for paracetamol and 9 (5-30) days for ibuprofen. Paracetamol, but not ibuprofen, was associated with increased risk of MACE (odds ratio 1.21, 95% confidence interval [CI] 1.04-1.42) or a major bleeding (odds ratio 1.60, 95% CI 1.26-2.03), with no impact of daily dose and duration of paracetamol treatment. Time-varying analysis found an increased risk of MACE with both paracetamol (hazard ratio 1.22, 95% CI 1.05-1.43) and ibuprofen (hazard ratio 1.47, 95% CI 1.06-2.03) and of major bleeding with paracetamol (hazard ratio 1.95, 95% CI 1.45-2.62). There was a weak and inconsistent signal for association between paracetamol or ibuprofen and MACE or major bleeding, which may be related to either a genuine but modest effect of these drugs or to residual confounding. http://www.isrctn.com. Unique identifier: ISRCTN66157730. © 2016 American Heart Association, Inc.

US and MR Imaging of Pectoralis Major Injuries.

Science.gov (United States)

Lee, Yauk K; Skalski, Matt R; White, Eric A; Tomasian, Anderanik; Phan, Diane D; Patel, Dakshesh B; Matcuk, George R; Schein, Aaron J

2017-01-01

During the past 2 decades, the frequency of pectoralis major muscle injuries has increased in association with the increased popularity of bench press exercises. Injury of the pectoralis major can occur at the muscle origin, muscle belly, musculotendinous junction, intratendinous region, and/or humeral insertion-with or without bone avulsion. The extent of the tendon injury ranges from partial to complete tears. Treatment may be surgical or conservative, depending on the clinical scenario and anatomic characteristics of the injury. The radiologist has a critical role in the patient's treatment-first in detecting and then in characterizing the injury. In this article, the authors review the normal anatomy and anatomic variations of the pectoralis major muscle, classifications and typical patterns of pectoralis major injuries, and associated treatment considerations. The authors further provide an instructive guide for ultrasonographic (US) and magnetic resonance (MR) imaging evaluation of pectoralis major injuries, with emphasis on a systematic approach involving the use of anatomic landmarks. After reviewing this article, the reader should have an understanding of how to perform-and interpret the findings of-US and MR imaging of the pectoralis major. The reader should also understand how to classify pectoralis major injuries, with emphasis on the key findings used to differentiate injuries for which surgical management is required from those for which nonsurgical management is required. Familiarity with the normal but complex anatomy of the pectoralis major is crucial for performing imaging-based evaluation and understanding the injury findings. © RSNA, 2017 Online supplemental material is available for this article.

Bipolar disorder: Evidence for a major locus

Energy Technology Data Exchange (ETDEWEB)

Spence, M.A.; Flodman, P.L. [Univ. of California, Irvine, CA (United States); Sadovnick, A.D.; Ameli, H. [Univ. of British Columbia, Vancouver (Canada)] [and others

1995-10-09

Complex segregation analyses were conducted on families of bipolar I and bipolar II probands to delineate the mode of inheritance. The probands were ascertained from consecutive referrals to the Mood Disorder Service, University Hospital, University of British Columbia and diagnosed by DSM-III-R and Research Diagnostic Criteria. Data were available on over 1,500 first-degree relatives of the 186 Caucasian probands. The purpose of the analyses was to determine if, after correcting for age and birth cohort, there was evidence for a single major locus. Five models were fit to the data using the statistical package SAGE: (1) dominant, (2) recessive, (3) arbitrary mendelian inheritance, (4) environmental, and (5) no major effects. A single dominant, mendelian major locus was the best fitting of these models for the sample of bipolar I and II probands when only bipolar relatives were defined as affected (polygenic inheritance could not be tested). Adding recurrent major depression to the diagnosis {open_quotes}affected{close_quotes} for relatives reduced the evidence for a major locus effect. Our findings support the undertaking of linkage studies and are consistent with the analyses of the National Institutes of Mental Health (NIMH) Collaborative Study data by Rice et al. and Blangero and Elston. 39 refs., 4 tabs.

Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina

Directory of Open Access Journals (Sweden)

Alonso, R.

1989-04-01

Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en un momento dado de las aguas freáticas de los abanicos aluviales por aguas termales ricas en sílice, propiciaría junto con la evaporización la precipitación de la silíceo Los nódulos silíceos crecerían desplazando el sedimento terrígeno que constituye la roca caja o reemplazando nódulos previa de ulexita.

African-American students' perceptions of their majors, future professions, and the dietetics major and profession: a qualitative analysis.

Science.gov (United States)

Felton, Teena M; Nickols-Richardson, Sharon M; Serrano, Elena; Hosig, Kathy W

2008-07-01

African-American professionals are underrepresented in the profession of dietetics. This preliminary qualitative study identified African-American students' perceptions of their majors, future professions, and the dietetics major/profession to understand why they did or did not enter dietetics. It was hypothesized that dietetics students chose dietetics primarily for altruistic reasons, whereas students in other fields of study did not choose dietetics due to lack of awareness of dietetics. To learn students' views, African-American college students engaged in elicitation interviews or focus group discussions. Twenty-eight women and 12 men participated. Phenomenologic analysis identified common themes and meanings: African-American students selected their majors for a variety of reasons, including desire to help people, interest in the field, recommendation from an adult, and family influence. African-American students in fields of study other than dietetics believed that the dietetics major was not selected due to lack of awareness about dietetics. Both dietetics students and students in other fields of study perceived versatility, ability to work with/help people, and to have an influence as positive qualities about their future professions. Advanced degree and training requirements, lack of diversity, and low salary were identified as negative qualities about future professions. African-American students in fields of study other than dietetics had not been exposed to the dietetics major, careers, and profession. Recruitment efforts should begin early to increase the number of African-American students in dietetics.

Performance profiles of major energy producers 1993

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-01-01

Performance Profiles of Major Energy Producers 1993 is the seventeenth annual report of the Energy Information Administration`s (EIA) Financial Reporting System (FRS). The report examines financial and operating developments in energy markets, with particular reference to the 25 major US energy companies required to report annually on Form EIA-28. Financial information is reported by major liens of business, including oil and gas production, petroleum refining and marketing, other energy operations, and nonenergy businesses. Financial and operating results are presented in the context of energy market developments with a view toward identifying changing corporate strategies and measuring the performance of ongoing operations both in the US and abroad. This year`s report analyzes financial and operating developments for 1993 (Part 1: Developments in 1993) and also reviews key developments during the 20 years following the Arab Oil Embargo of 1973--1974 (Part 2: Major Energy Company Strategies Since the Arab Oil Embargo). 49 figs., 104 tabs.

Dynamics of Major Cereals Productivity in Nepal

Directory of Open Access Journals (Sweden)

Samaya Gairhe

2018-05-01

Full Text Available Cereal crops have played major roles in addressing food security issues in Nepal. In recent years there have been fluctuations in crop production and demands situations due to various reasons. Thus, the present study aims to analyze the dynamics of major cereals productivity in Nepal from 1995 to 2014. Focus group discussions were done in mid-hills and tarai of Nepal in 2015. Percentage change, compound growth rate, annual rate of change, coefficient of variation, instability index were calculated to analyze results. The result shows that the area, production and productivity of major cereals had an increasing trend over the study period. The major factors contributing on productivity increase in cereal crops were irrigation facilities, use of improved and hybrid seeds, chemical fertilizer and better technical knowhow among the farmers. For effective adoption of research outputs to improve the productivity emphasis should also be given on promotion of public private partnership (PPP in research and development.

Molecular Detection of Tick-Borne Pathogen Diversities in Ticks from Livestock and Reptiles along the Shores and Adjacent Islands of Lake Victoria and Lake Baringo, Kenya

Directory of Open Access Journals (Sweden)

David Omondi

2017-06-01

Full Text Available Although diverse tick-borne pathogens (TBPs are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April–May; October–December of 2012–2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma, and Hyalomma tick species, ticks were pooled (≤8 individuals by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium, 9.06% Ehrlichia canis, anaplasmosis (6.32% Anaplasma ovis, 14.36% Anaplasma platys, and 3.08% Anaplasma bovis,, and rickettsiosis (6.15% Rickettsia africae, 2.22% Rickettsia aeschlimannii, 4.27% Rickettsia rhipicephali, and 4.95% Rickettsia spp., as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi, and 1.37% Babesia caballi among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7% and Amblyomma nuttalli (100

Molecular Detection of Tick-Borne Pathogen Diversities in Ticks from Livestock and Reptiles along the Shores and Adjacent Islands of Lake Victoria and Lake Baringo, Kenya.

Science.gov (United States)

Omondi, David; Masiga, Daniel K; Fielding, Burtram C; Kariuki, Edward; Ajamma, Yvonne Ukamaka; Mwamuye, Micky M; Ouso, Daniel O; Villinger, Jandouwe

2017-01-01

Although diverse tick-borne pathogens (TBPs) are endemic to East Africa, with recognized impact on human and livestock health, their diversity and specific interactions with tick and vertebrate host species remain poorly understood in the region. In particular, the role of reptiles in TBP epidemiology remains unknown, despite having been implicated with TBPs of livestock among exported tortoises and lizards. Understanding TBP ecologies, and the potential role of common reptiles, is critical for the development of targeted transmission control strategies for these neglected tropical disease agents. During the wet months (April-May; October-December) of 2012-2013, we surveyed TBP diversity among 4,126 ticks parasitizing livestock and reptiles at homesteads along the shores and islands of Lake Baringo and Lake Victoria in Kenya, regions endemic to diverse neglected tick-borne diseases. After morphological identification of 13 distinct Rhipicephalus, Amblyomma , and Hyalomma tick species, ticks were pooled (≤8 individuals) by species, host, sampling site, and collection date into 585 tick pools. By supplementing previously established molecular assays for TBP detection with high-resolution melting analysis of PCR products before sequencing, we identified high frequencies of potential disease agents of ehrlichiosis (12.48% Ehrlichia ruminantium , 9.06% Ehrlichia canis ), anaplasmosis (6.32% Anaplasma ovis , 14.36% Anaplasma platys , and 3.08% Anaplasma bovis ,), and rickettsiosis (6.15% Rickettsia africae , 2.22% Rickettsia aeschlimannii , 4.27% Rickettsia rhipicephali , and 4.95% Rickettsia spp.), as well as Paracoccus sp. and apicomplexan hemoparasites (0.51% Theileria sp., 2.56% Hepatozoon fitzsimonsi , and 1.37% Babesia caballi ) among tick pools. Notably, we identified E. ruminantium in both Amblyomma and Rhipicephalus pools of ticks sampled from livestock in both study areas as well as in Amblyomma falsomarmoreum (66.7%) and Amblyomma nuttalli (100%) sampled

Performance profiles of major energy producers 1994

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-02-01

Performance Profiles of Major Energy Producers 1994 is the eighteenth annual report of the Energy Information Administration`s (EIA) Financial Reporting System (FRS). The report examines financial and operating developments in energy markets, with particular reference to the 24 major U.S. energy companies required to report annually on Form EIA-28. Financial information is reported by major lines of business, including oil and gas production, petroleum refining and marketing, other energy operations, and nonenergy businesses. Financial and operating results are presented in the context of energy market developments with a view toward identifying changing corporate strategies and measuring the performance of ongoing operations both in the United States and abroad.

Non-pet dogs as sentinels and potential synanthropic reservoirs of tick-borne and zoonotic bacteria

OpenAIRE

Hornok, Sandor; Denes, Bela; Meli, Marina L.; Tanczos, Balazs; Fekete, Lilla; Gyuranecz, Miklos; de la Fuente, Jose; Fernandez de Mera, Isabel G.; Farkas, Robert; Hofmann-Lehmann, Regina

2013-01-01

Blood samples were collected from 100 shepherd dogs, 12 hunting dogs and 14 stray dogs (apparently healthy) in southern Hungary to screen for the presence of emerging tick-borne pathogens. Based on real-time PCR results, 14 dogs (11%) had single or dual haemoplasma infection, and a same number of samples were positive for Anaplasma phagocytophilum. In one sample Coxiella burnetii was molecularly identified, and 20.3% of dogs seroconverted to the Q fever agent. Rickettsaemia (sensu stricto) wa...

Test for English Majors (TEM) in China

Science.gov (United States)

Jin, Yan; Fan, Jinsong

2011-01-01

The purpose of the Test for English Majors (TEM) is to measure the English proficiency of Chinese university undergraduates majoring in English Language and Literature and to examine whether these students meet the required levels of English language abilities as specified in the National College English Teaching Syllabus for English Majors…

Longitudinal assessment of neuropsychological function in major depression.

Science.gov (United States)

Douglas, Katie M; Porter, Richard J

2009-12-01

Neuropsychological impairment is a core component of major depression, yet its relationship to clinical state is unclear. The aims of the present review were to determine which neuropsychological domains and tasks were most sensitive to improvement in clinical state in major depression and to highlight the methodological issues in such research. Studies that included a baseline and at least one follow-up neuropsychological testing session in adults with major depression were identified using MEDLINE, Web of Science and ScienceDirect databases. Thirty studies were included in the review. Findings in younger adult populations suggested that improvement in mood was most strongly related to improved verbal memory and verbal fluency, while measures of executive functioning and attention tended to remain impaired across treatment. In late-life major depression, improved psychomotor speed was most closely related to treatment response, but there was much inconsistency between study findings, which may be due to methodological issues. In major depression, particular neuropsychological domains are more strongly related to clinical state than others. The findings from the present review suggest that the domains most sensitive to clinical state are verbal learning and memory, verbal fluency and psychomotor speed. In contrast, measures of attention and executive functioning perhaps represent more trait-like markers of major depression. With further methodologically sound research, the changes in neuropsychological function associated with treatment response may provide a means of evaluating different treatment strategies in major depression.

Diabetes mellitus in β-thalassemia major patients

Directory of Open Access Journals (Sweden)

Riadi Wirawan

2003-06-01

Full Text Available β-thalassemia major is a disease caused by β polypeptide chain synthesis disorder which is inherited as an autosomal recessive from both parents which is marked by little or no β globin chain synthesis. Medication for β thalassemia major patients is by repeated blood transfusions, which causes hemochromatosis. Hemochromatosis can occur in various organs including the pancreas. The aim of the study was to assess the alteration of plasma glucose concentration and the hemochromatosis prevalence. Fasting plasma glucose concentration and serum ferritin examination were measured in 115 β thalassemia major patients with ages between 10-23 years who were out-patients in the Thalassemia Centre, Department of Child Health, Medical School, University of Indonesia / Dr. Cipto Mangunkusumo General Hospital, Jakarta. The plasma glucose concentration examination was conducted by the GDH enzymatic method, with American Diabetes Association (ADA criteria in the evaluation, while the serum ferritin examination was conducted with the microparticle enzyme immuno assay (MEIA method. All patients had hemochromatosis, 14.8% of the patients had impaired fasting glucose level and 2.6% of the patients showed indications of diabetes mellitus. β thalassemia major patients who receive frequent transfusions will develop hemochromatosis that will in turn impair the pancreatic function. (Med J Indones 2003; 12: 87-93 Keywords : β thalassemia major, hemochromatosis, diabetes mellitus

Ciudades hechas a mano

OpenAIRE

Andreatta, Verena

2014-01-01

Favelas, tugurios, pueblos jóvenes, villas miseria, villas de emergencia, barriadas de ranchitos... son los nombres que reciben los asentamientos marginales en Brasil, Perú, Argentina, Colombia y Venezuela; diversos apelativos y la misma imagen tópica de la pobreza y de la construcción informal de los barrios populares en América Latina. Se trata de un fenómeno que surgió unánimemente en el paisaje urbano de este continente hace casi un siglo, y que tiene su expresión análoga en todas las gra...

Jefaturas femeninas : una aproximación a la feminización de la pobreza y de la responsabilidad en familias desplazadas por la violencia

Directory of Open Access Journals (Sweden)

Yuri Romero-Picón

2013-01-01

Full Text Available Los autores exploran el tema de las jefaturas femeninas en un grupo de mujeres que fueron desplazadas por la violencia y llegaron a vivir a barrios marginales del municipio de Soacha, colombia, donde factores como el bajo nivel de escolaridad, los trabajos mal remunerados a los que tienen acceso, los problemas afectivos y el peso de responder solas con sus hogares agravan su situación de pobreza. En este contexto, la jefatura femenina es un rol que deben asumir para enfrentar la pobreza bajo el principio de responsabilidad hacia sus hijos y seres queridos.

Mercadotecnia transfronteriza de servicios de salud en Tijuana

Directory of Open Access Journals (Sweden)

José Guadalupe Vargas Hernández

2005-07-01

Full Text Available Este artículo analiza las ventajas competitivas de la venta de servicios de salud en la región fronteriza de Tijuana - San Diego. En tanto muchos mexicanos y en general latinos pudientes viajan a Estados Unidos en procura de medicina especializada, muchos hispanos centroamericanos y norteamericanos provenientes de los sectores marginales buscan en México servicios de salud baratos. Este estudio ahonda en aspectos ideológicos, políticos y culturales de un campo específico de la economía transfronteriza en una zona de amplia integración económica.

Proyecto paisajístico de las márgenes del Río Paute en el área urbana de la ciudad de Paute, sector Zhumir-Chicty

OpenAIRE

Pesántez, Xavier

2008-01-01

Durante varios años ha existido una mala práctica en la utilización de las márgenes de los ríos de nuestras ciudades, han sido vertederos de escombros y de aguas putrefactas, se han construido avenidas marginales, canalizado quebradas, eliminado especies vegetativas, eliminando procesos ecológicos importantes. Esta tesis de diseño paisajístico pretende ser un primer paso en la estructuración del territorio y quizás un modelo para futuras aplicaciones de diseño de espacios más reducidos que s...

TEORIA MICROECONOMICA DE LAS ECONOMIAS CAMPESINAS

OpenAIRE

Rubiano, Jorge Enrique; Peña, Enrique

2012-01-01

Los autores abordan la irrelevancia de categorías teóricas macroeconómicas sobre los estudios de economía campesina, haciendo énfasis en la importancia macroeconómica y variables de tipo social y cultural inherentes a la misma.La intervención del Estado al interior del sector agro pecuario es implícitamente un cuestionamiento a la teoría de la redistribución de los factores productivos a través de las productividades marginales, pero no se orienta a buscar una redistribución del ingreso y la ...

Análisis Comparativo Entre el Dinero Electronico y el Sistema Bancario Tradicional: Medición en la Ciudad de Guayaquil

OpenAIRE

Espol; Peña Chávez, Shirley Katherine; Yulan Fienco, Vanesa Jacqueline

2017-01-01

Realizar un análisis comparativo entre el sistema bancario tradicional y el sistema de dinero electrónico, llamado actualmente “efectivo desde mi celular”, el mismo que constituye el nuevo medio de pago que implementó el gobierno de turno; a través del banco central del ecuador a partir de diciembre del 2014, con el propósito de mejorar la inclusión financiera en la población de los sectores marginales del país. el fin de esta investigación es de conocer si realmente se está desempeñando el o...

Ursa Major: ot losya do medvedya %t Ursa Major: from elk to bear

Science.gov (United States)

Lushnikova, A. V.

In the article material from various cultural and linguistic sources (Indo-European - Slavic, Indo-Iranian; Uralo-Altaic, Tungus, Ancient Egyptian, Babylonian) is used in order to trace up the chronology of the designation of Ursa Majopr, a constellation which has been playing an important role for people different regions since ancient times. It was used for observing of the visible yearly motion of the Sun, for working out seasonal changes; being a circumpolar and non-hiding behind the horizon it has been perceived as a symbol of immortality, its peculiar positional change during a year lay down in plot of the Uralo-Siberian myths about a cosmic hunt for the Elk, myths about deluge. Data from Uralo-Siberian mythology are analyzed. Designations of Ursa Major in the form of a horned hoofed animal such as elk, deer, cow (Uralo-Altaic, Tungus, Slavic, Indo-Iranian languages; Ancient Greece, Crete, Ancient Egypt) and connected with it (or derived from it) denominations and images of "enclosed space" - "vehicle for travelling and carrying goods" (a wagon, a boat) - "instrument for hunting-fishing, a ritual thing" - "household construction" are taken in consideration. The conclusion is made that the transition of the Ursa Major designation from elk to bear could follow the general tendency to shift from so-called matriarchy to patriarchy, to substitute female deities with male ones, which was reflected "in the rise" of the predatory animal cults (not earlier than II mil. B.C.). To prove this, lexical examples of resemblance and coincidences in designation of homed hoofed (elk, deer) and predatory (bear, wolf) animals should be analyzed. Such a goal-directed investigation of the chronology of Ursa Major designations has never been carried out.

Major depression in primary care: making the diagnosis

Science.gov (United States)

Ng, Chung Wai Mark; How, Choon How; Ng, Yin Ping

2016-01-01

Major depression is a common condition seen in the primary care setting, often presenting with somatic symptoms. It is potentially a chronic illness with considerable morbidity, and a high rate of relapse and recurrence. Major depression has a bidirectional relationship with chronic diseases, and a strong association with increased age and coexisting mental illnesses (e.g. anxiety disorders). Screening can be performed using clinical tools for major depression, such as the Patient Health Questionaire-2, Patient Health Questionaire-9 and Beck Depression Inventory, so that timely treatment can be initiated. An accurate diagnosis of major depression and its severity is essential for prompt treatment to reduce morbidity and mortality. This is the first of a series of articles that illustrates the approach to the management of major depression in primary care. Our next articles will cover suicide risk assessment in a depressed patient and outline the basic principles of management and treatment modalities. PMID:27872937

Majority and minority influence: A dual role interpretation

OpenAIRE

de Vries, N.K.; de Dreu, C.; Gordijn, E.; Schuurman, M.

1996-01-01

This chapter offers an analysis of majority vs. minority influence using the Heuristic-Systematic Model of persuasion (HSM). We evaluate evidence for and against leading perspectives such as Conversion Theory. Next, research and theory is reviewed suggesting that majority vs. minority influence differentially affect the processing of persuasive arguments. A dual-role interpretation of majority and minority influence is presented. First, numerical support for discrepant messages affects the de...

Performance profiles of major energy producers 1995, January 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-02-01

This publication examines developments in the operations of the major U.S. energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area.

Performance profiles of major energy producers 1995, January 1997

International Nuclear Information System (INIS)

1997-01-01

This publication examines developments in the operations of the major U.S. energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area

Performance profiles of major energy producers 1992

Energy Technology Data Exchange (ETDEWEB)

1994-01-13

Performance Profiles of Major Energy Producers 1992 is the sixteenth annual report of the Energy Information Administration`s (EIA) Financial Reporting System (FRS). The report examines financial and operating developments, with particular reference to the 25 major energy companies (the FRS companies) required to report annually on Form EIA-28. Financial information is reported by major lines of business, including oil and gas production, petroleum refining and marketing, and other energy operations. Domestic and international operations are examined separately in this report. The data are presented in the context of key energy market developments with a view toward identifying changing strategies of corporate development and measuring the apparent success of current ongoing operations.

Performance profiles of major energy producers 1992

International Nuclear Information System (INIS)

1994-01-01

Performance Profiles of Major Energy Producers 1992 is the sixteenth annual report of the Energy Information Administration's (EIA) Financial Reporting System (FRS). The report examines financial and operating developments, with particular reference to the 25 major energy companies (the FRS companies) required to report annually on Form EIA-28. Financial information is reported by major lines of business, including oil and gas production, petroleum refining and marketing, and other energy operations. Domestic and international operations are examined separately in this report. The data are presented in the context of key energy market developments with a view toward identifying changing strategies of corporate development and measuring the apparent success of current ongoing operations

Major intrinsic proteins (MIPs) in plants: a complex gene family with major impacts on plant phenotype.

Science.gov (United States)

Forrest, Kerrie L; Bhave, Mrinal

2007-10-01

The ubiquitous cell membrane proteins called aquaporins are now firmly established as channel proteins that control the specific transport of water molecules across cell membranes in all living organisms. The aquaporins are thus likely to be of fundamental significance to all facets of plant growth and development affected by plant-water relations. A majority of plant aquaporins have been found to share essential structural features with the human aquaporin and exhibit water-transporting ability in various functional assays, and some have been shown experimentally to be of critical importance to plant survival. Furthermore, substantial evidence is now available from a number of plant species that shows differential gene expression of aquaporins in response to abiotic stresses such as salinity, drought, or cold and clearly establishes the aquaporins as major players in the response of plants to conditions that affect water availability. This review summarizes the function and regulation of these genes to develop a greater understanding of the response of plants to water insufficiency, and particularly, to identify tolerant genotypes of major crop species including wheat and rice and plants that are important in agroforestry.

Game As Major Introducing Media To OPT For College

Directory of Open Access Journals (Sweden)

Inggrit Swastini Dewi

2017-10-01

Full Text Available Today's development requires people to have higher education and expertise in a particular field. Because of that, many universities or colleges are beginning to open new majors to suit the increasingly growing and diverse interests. However, the increasing number of majors could make it difficult for many high school students in determining the university or colleges and department they should take. A lack of understanding of their own personal interests and talents, as well as information about said universities or colleges and majors also add to the difficulty of choosing. Therefore, an interesting and simple media to help students to know their potential, provide information about the majors according to their interests, and help them determine the right path is needed. The concept of this major introducing game is based on sources such as interviews with interviewees and questionnaires. In the game, players can find out their interests, talents and appropriate majors, as well as courses and professions related to those majors. Aptitude test in this game is based on Holland’s Theory.

Association between canine leishmaniosis and Ehrlichia canis co-infection: a prospective case-control study.

Science.gov (United States)

Attipa, Charalampos; Solano-Gallego, Laia; Papasouliotis, Kostas; Soutter, Francesca; Morris, David; Helps, Chris; Carver, Scott; Tasker, Séverine

2018-03-20

In the Mediterranean basin, Leishmania infantum is a major cause of disease in dogs, which are frequently co-infected with other vector-borne pathogens (VBP). However, the associations between dogs with clinical leishmaniosis (ClinL) and VBP co-infections have not been studied. We assessed the risk of VBP infections in dogs with ClinL and healthy controls. We conducted a prospective case-control study of dogs with ClinL (positive qPCR and ELISA antibody for L. infantum on peripheral blood) and clinically healthy, ideally breed-, sex- and age-matched, control dogs (negative qPCR and ELISA antibody for L. infantum on peripheral blood) from Paphos, Cyprus. We obtained demographic data and all dogs underwent PCR on EDTA-blood extracted DNA for haemoplasma species, Ehrlichia/Anaplasma spp., Babesia spp., and Hepatozoon spp., with DNA sequencing to identify infecting species. We used logistic regression analysis and structural equation modelling (SEM) to evaluate the risk of VBP infections between ClinL cases and controls. From the 50 enrolled dogs with ClinL, DNA was detected in 24 (48%) for Hepatozoon spp., 14 (28%) for Mycoplasma haemocanis, 6 (12%) for Ehrlichia canis and 2 (4%) for Anaplasma platys. In the 92 enrolled control dogs, DNA was detected in 41 (45%) for Hepatozoon spp., 18 (20%) for M. haemocanis, 1 (1%) for E. canis and 3 (3%) for A. platys. No Babesia spp. or "Candidatus Mycoplasma haematoparvum" DNA was detected in any dog. No statistical differences were found between the ClinL and controls regarding age, sex, breed, lifestyle and use of ectoparasitic prevention. A significant association between ClinL and E. canis infection (OR = 12.4, 95% CI: 1.5-106.0, P = 0.022) was found compared to controls by multivariate logistic regression. This association was confirmed using SEM, which further identified that younger dogs were more likely to be infected with each of Hepatozoon spp. and M. haemocanis, and dogs with Hepatozoon spp. were more likely to

Diagnosis and incidence risk of clinical canine monocytic ehrlichiosis under field conditions in Southern Europe.

Science.gov (United States)

René-Martellet, Magalie; Lebert, Isabelle; Chêne, Jeanne; Massot, Raphaël; Leon, Marta; Leal, Ana; Badavelli, Stefania; Chalvet-Monfray, Karine; Ducrot, Christian; Abrial, David; Chabanne, Luc; Halos, Lénaïg

2015-01-06

Canine Monocytic Ehrlichiosis (CME), due to the bacterium Ehrlichia canis and transmitted by the brown dog tick Rhipicephalus sanguineus, is a major tick-borne disease in southern Europe. In this area, infections with other vector-borne pathogens (VBP) are also described and result in similar clinical expression. The aim of the present study was to evaluate the incidence risk of clinical CME in those endemic areas and to assess the potential involvement of other VBP in the occurrence of clinical and/or biological signs evocative of the disease. The study was conducted from April to November 2011 in veterinary clinics across Italy, Spain and Portugal. Sick animals were included when fitting at least three clinical and/or biological criteria compatible with ehrlichiosis. Serological tests (SNAP®4Dx, SNAP®Leish tests, Idexx, USA) and diagnostic PCR for E. canis, Anaplasma platys, Anaplasma phagocytophilum, Babesia spp, Hepatozoon canis and Leishmania infantum detection were performed to identify the etiological agents. Ehrlichiosis was considered when three clinical and/or biological suggestive signs were associated with at least one positive paraclinical test (serology or PCR). The annual incidence risk was calculated and data were geo-referenced for map construction. The probabilities of CME and other vector-borne diseases when facing clinical and/or biological signs suggestive of CME were then evaluated. A total of 366 dogs from 78 veterinary clinics were enrolled in the survey. Among them, 99 (27%) were confirmed CME cases, which allowed an estimation of the average annual incidence risk of CME amongst the investigated dog population to be 0.08%. Maps showed an increasing gradient of CME incidence risk from northern towards southern areas, in particular in Italy. It also suggested the existence of hot-spots of infections by VBP in Portugal. In addition, the detection of other VBP in the samples was common and the study demonstrated that a dog with clinical signs

Molecular Survey of Zoonotic Agents in Rodents and Other Small Mammals in Croatia.

Science.gov (United States)

Tadin, Ante; Tokarz, Rafal; Markotić, Alemka; Margaletić, Josip; Turk, Nenad; Habuš, Josipa; Svoboda, Petra; Vucelja, Marko; Desai, Aaloki; Jain, Komal; Lipkin, W Ian

2016-02-01

Croatia is a focus for many rodent-borne zoonosis. Here, we report a survey of 242 rodents and small mammals, including 43 Myodes glareolus, 131 Apodemus flavicollis, 53 Apodemus agrarius, three Apodemus sylvaticus, six Sorex araneus, four Microtus arvalis, one Microtus agrestis, and one Muscardinus avellanarius, collected at eight sites in Croatia over an 8-year period. Multiplex MassTag polymerase chain reaction (PCR) was used for detection of Borrelia, Rickettsia, Bartonella, Babesia, Ehrlichia, Anaplasma, Francisella tularensis, and Coxiella burnetii. Individual PCR assays were used for detection of Leptospira, lymphocytic choriomeningitis virus, orthopoxviruses, flaviviruses, hantaviruses, and Toxoplasma gondii. Of the rodents, 52 (21.5%) were infected with Leptospira, 9 (3.7%) with Borrelia miyamotoi, 5 (2%) with Borrelia afzelii, 29 (12.0%) with Bartonella, 8 (3.3%) with Babesia microti, 2 (0.8%) with Ehrlichia, 4 (1.7%) with Anaplasma, 2 (0.8%) with F. tularensis, 43 (17.8%) with hantaviruses, and 1 (0.4%) with an orthopoxvirus. Other agents were not detected. Multiple infections were found in 32 rodents (13.2%): dual infections in 26 rodents (10.7%), triple infections in four rodents (2.9%), and quadruple infections in two rodents (0.8%). Our findings indicate that rodents in Croatia harbor a wide range of bacteria and viruses that are pathogenic to humans. © The American Society of Tropical Medicine and Hygiene.

Prevalence of Selected Zoonotic and Vector-Borne Agents in Dogs and Cats on the Pine Ridge Reservation

Directory of Open Access Journals (Sweden)

A. Valeria Scorza

2017-09-01

Full Text Available The prevalence of intestinal parasites and vector-borne agents of dogs and cats in the Pine Ridge Reservation, South Dakota were determined. Fecal samples (84 dogs, 9 cats were examined by centrifugal floatation and by immunofluorescence assay (FA for Giardia and Cryptosporidium. PCR was performed on Giardia [beta-giardin (bg, triose phosphate isomerase (tpi, glutamate dehydrogenase genes (gdh] and Cryptosporidium [heat shock protein-70 gene (hsp] FA positive samples. Cat sera (n = 32 were tested for antibodies against Bartonella spp., Toxoplasma gondii, and FIV, and antigens of FeLV and Dirofilaria immitis. Dog sera (n = 82 were tested for antibodies against T. gondii, Borrelia burgdorferi, Ehrlichia canis, and Anaplasma phagocytophilum and D. immitis antigen. Blood samples (92 dogs, 39 cats were assessed by PCR for amplification of DNA of Bartonella spp., Ehrlichia spp., Anaplasma spp., haemoplasmas, and Babesia spp. (dogs only. The most significant results were Giardia spp. (32% by FA, Taenia spp. (17.8% and Cryptosporidium spp. (7.1%. The Giardia isolates typed as the dog-specific assemblages C or D and four Cryptosporidium isolates typed as C. canis. Antibodies against T. gondii were detected in 15% of the dogs. Antibodies against Bartonella spp. and against T. gondii were detected in 37.5% and 6% of the cats respectively. FeLV antigen was detected in 10% of the cats.

An Assessment of Whole Blood and Fractions by Nested PCR as a DNA Source for Diagnosing Canine Ehrlichiosis and Anaplasmosis

Directory of Open Access Journals (Sweden)

Tereza Emmanuelle de Farias Rotondano

2012-01-01

Full Text Available Ehrlichiosis and anaplasmosis are tick-borne diseases. Ehrlichia canis and Anaplasma platys infect mainly white cells and platelets, respectively. The main DNA source for PCR is peripheral blood, but the potential of blood cell fractions has not been extensively investigated. This study aims at assessment of whole blood (WB and blood fractions potential in nested PCR (nPCR to diagnose canine ehrlichiosis and anaplasmosis. The 16S rRNA gene was amplified in 71.4, 17.8, 31.57, and 30% of the WB, granulocyte (G, mononuclear cells (M, and buffy coat (BC samples. Compared to the WB, the sensitivity of the PCR was 42.86% for the M, and BC fractions, 21.43% for the G, and 33.33% for the blood clot (C. There was fair agreement between the WB and M, BC and C, and slight with the G. Fair agreement occurred between the nPCR and morulae in the blood smear. One animal was coinfected with A. platys and E. canis. This study provided the first evidence of A. platys infection in dogs in Paraíba, Brazil, and demonstrated that WB is a better DNA source than blood fractions to detect Ehrlichia and Anaplasma by nPCR, probably because of the plasma bacterial concentration following host cell lysis.

A transversal study on antibodies against selected pathogens in dromedary camels in the Canary Islands, Spain.

Science.gov (United States)

Mentaberre, Gregorio; Gutiérrez, Carlos; Rodríguez, Noé F; Joseph, Sunitha; González-Barrio, David; Cabezón, Oscar; de la Fuente, José; Gortazar, Christian; Boadella, Mariana

2013-12-27

The Canary Islands contain the most important dromedary camel (Camelus dromedarius) population in the European Union and are the main export point of dromedaries to continental Europe and Latin America. We investigated the presence of antibodies against relevant disease agents in 100 Canarian camel sera. Selected blood samples of the same animals were also tested by PCR. Sera were tested for antibodies against Bluetongue virus (BTV; 0%), Bovine Viral Diarrhoea virus (BVDV; 0%), Camelpox virus (CPV; 8% by serum neutralization, 16% by ELISA), Peste des Petits Ruminants virus (PPRV, 0%), Rift Valley Fever virus (RVFV; 0%) and West Nile Fever virus (WNV; 3%), the bacterial pathogens Anaplasma sp. (3%), Brucella sp. (1%), Coxiella burnetii (19%), Mycobacterium avium paratuberculosis (MAP; 22%), Mycobacterium tuberculosis complex (MTC; 10%) and Rickettsia sp. (83%), and the parasites Toxoplasma gondii (36%) and Neospora caninum (86%). The most remarkable findings were the detection of antibodies against CPV and the high antibody prevalence against C. burnetii, Rickettsia sp., T. gondii and N. caninum. By PCR, we found no C. burnetii, N. caninum and Anaplasma sp. DNA in the tested samples. However, Rickettsia sp. DNA was detected in six antibody positive tested samples. These results should be taken into consideration in order to implement adequate control measures and avoid a potential dissemination of infections to other territories. Copyright © 2013 Elsevier B.V. All rights reserved.

Comparative Analysis of Wolbachia Genomes Reveals Streamlining and Divergence of Minimalist Two-Component Systems

Science.gov (United States)

Christensen, Steen; Serbus, Laura Renee

2015-01-01

Two-component regulatory systems are commonly used by bacteria to coordinate intracellular responses with environmental cues. These systems are composed of functional protein pairs consisting of a sensor histidine kinase and cognate response regulator. In contrast to the well-studied Caulobacter crescentus system, which carries dozens of these pairs, the streamlined bacterial endosymbiont Wolbachia pipientis encodes only two pairs: CckA/CtrA and PleC/PleD. Here, we used bioinformatic tools to compare characterized two-component system relays from C. crescentus, the related Anaplasmataceae species Anaplasma phagocytophilum and Ehrlichia chaffeensis, and 12 sequenced Wolbachia strains. We found the core protein pairs and a subset of interacting partners to be highly conserved within Wolbachia and these other Anaplasmataceae. Genes involved in two-component signaling were positioned differently within the various Wolbachia genomes, whereas the local context of each gene was conserved. Unlike Anaplasma and Ehrlichia, Wolbachia two-component genes were more consistently found clustered with metabolic genes. The domain architecture and key functional residues standard for two-component system proteins were well-conserved in Wolbachia, although residues that specify cognate pairing diverged substantially from other Anaplasmataceae. These findings indicate that Wolbachia two-component signaling pairs share considerable functional overlap with other α-proteobacterial systems, whereas their divergence suggests the potential for regulatory differences and cross-talk. PMID:25809075

Molecular investigation of tick-borne pathogens in dogs from Luanda, Angola.

Science.gov (United States)

Cardoso, Luís; Oliveira, Ana Cristina; Granada, Sara; Nachum-Biala, Yaarit; Gilad, Matan; Lopes, Ana Patrícia; Sousa, Sérgio Ramalho; Vilhena, Hugo; Baneth, Gad

2016-05-10

No molecular data have been available on tick-borne pathogens that infect dogs from Angola. The occurrence of agents from the genera Anaplasma, Babesia, Ehrlichia and Hepatozoon was assessed in 103 domestic dogs from Luanda, by means of the polymerase chain reaction (PCR) and DNA sequence analysis. Forty-six dogs (44.7 %) were positive for at least one pathogen. Twenty-one animals (20.4 %) were found infected with Anaplasma platys, 18 (17.5 %) with Hepatozoon canis, six (5.8 %) with Ehrlichia canis, six (5.8 %) with Babesia vogeli, one (1.0 %) with Babesia gibsoni and one (1.0 %) with an unnamed Babesia sp. The molecular frequency of single infections taken together was 37.9 % and that of co-infections with several combinations of two pathogens accounted for 6.8 % of the animals. This is the first report of A. platys, B. vogeli, B. gibsoni, E. canis and H. canis infections diagnosed by PCR in domestic dogs from Angola. The present study provides evidence that dogs in Luanda are widely exposed to, and at risk of becoming infected with, tick-borne pathogens. Further investigation is needed, including a larger number of animals, canine populations from other cities and provinces of the country, as well as potential vector ticks, aiming at better characterizing and controlling canine vector-borne diseases in Angola.

Major dealers' expert power in distribution channels

Directory of Open Access Journals (Sweden)

Richard Chinomona

2011-06-01

Full Text Available The importance of major dealers’ expertise in distribution channels and effects on exchange relations is widely acknowledged by many SMEs in Africa and yet there seem to be a paucity of research on this matter. To address this dearth, the current study attempts to examine the impact of major dealers’ expert power on SME manufacturers’ channel cooperation and the mediating influence of their trust, relationship commitment and satisfaction. The conceptualized model and five hypotheses are empirically validated using a sample of 452 manufacturing SMEs in Zimbabwe. The findings indicate that major dealers’ expert power may influence SME manufacturers’ trust, relationship commitment, relationship satisfaction and channel cooperation in a significant way. Managerial implications of the research findings are provided.

Reporting Helicopter Emergency Medical Services in Major Incidents

DEFF Research Database (Denmark)

Fattah, Sabina; Johnsen, Anne Siri; Sollid, Stephen J M

2016-01-01

OBJECTIVE: Research on helicopter emergency medical services (HEMS) in major incidents is predominately based on case descriptions reported in a heterogeneous fashion. Uniform data reported with a consensus-based template could facilitate the collection, analysis, and exchange of experiences...... variables were determined by consensus. These variables were formatted in a template with 4 main categories: HEMS background information, the major incident characteristics relevant to HEMS, the HEMS response to the major incident, and the key lessons learned. CONCLUSION: Based on opinions from European...

[Major breakthroughs in the medical treatment

DEFF Research Database (Denmark)

Kirk, O.; Gerstoft, J.; Lundgren, J.D.

2009-01-01

The introduction of antiretroviral combination therapy for patients with HIV infection is described as an example of a breakthrough within the field of medical treatment. The background for the breakthrough and the phases thereof are described and for comparison, the circumstances of major breakt...... breakthroughs within other medical specialities are mentioned Udgivelsesdato: 2009/3/2......The introduction of antiretroviral combination therapy for patients with HIV infection is described as an example of a breakthrough within the field of medical treatment. The background for the breakthrough and the phases thereof are described and for comparison, the circumstances of major...

Minerals in thalassaemia major patients: An overview.

Science.gov (United States)

Ozturk, Zeynep; Genc, Gizem Esra; Gumuslu, Saadet

2017-05-01

Thalassaemia major (TM) is a hereditary blood disease characterised by reduced or absent production of beta globin chains. Erythrocyte transfusions are given to raise the haemoglobin level in patients with thalassaemia major. However, transfusions have been related to increased risk of iron overload and tissue damage related to excess iron. Both elevated oxidative stress due to iron overload and increased hemolysis lead to over utilisation of minerals required for antioxidant enzymes activities. Iron chelators have been used to prevent iron overload in thalassaemia major patients, but these chelators have the possibility of removing minerals from the body. Thalassaemia patients are more at risk for mineral deficiency because of increased oxidative stress and iron chelation therapies. Growth and maturational delay, cardiomyopathy, endocrinopathies and osteoporosis are the complications of thalassaemia. Minerals may play a particular role to prevent these complications. In the current review, we provide an overview of minerals including zinc (Zn), copper (Cu), selenium (Se), magnesium (Mg) and calcium (Ca) in thalassaemia major patients. We, also, underline that some complications of thalassaemia can be caused by an increased need for minerals or lack of the minerals. Copyright © 2017 Elsevier GmbH. All rights reserved.

Exploring Pair Programming Benefits for MIS Majors

Directory of Open Access Journals (Sweden)

April H. Reed

2016-12-01

Full Text Available Pair programming is a collaborative programming practice that places participants in dyads, working in tandem at one computer to complete programming assignments. Pair programming studies with Computer Science (CS and Software Engineering (SE majors have identified benefits such as technical productivity, program/design quality, academic performance, and increased satisfaction for their participants. In this paper, pair programming is studied with Management Information Systems (MIS majors, who (unlike CS and SE majors taking several programming courses typically take only one programming course and often struggle to develop advanced programming skills within that single course. The researchers conducted two pair programming experiments in an introductory software development course for MIS majors over three semesters to determine if pair programming could enhance learning for MIS students. The program results, researchers’ direct observations, and participants’ responses to a survey questionnaire were analyzed after each experiment. The results indicate that pair programming appears to be beneficial to MIS students’ technical productivity and program design quality, specifically the ability to create programs using high-level concepts. Additionally, results confirmed increased student satisfaction and reduced frustration, as the pairs worked collaboratively to produce a program while actively communicating and enjoying the process.

Academic Advising and Maintaining Major: Is There a Relation?

Directory of Open Access Journals (Sweden)

Maram S. Jaradat

2017-12-01

Full Text Available The purpose of this study is to investigate the effect of academic advising on changing or maintaining majors in university degrees. It is also a goal of the study to determine which semester students change their majors and whether advising contributes to that change. Through this correlational study, the researchers explored students’ perceptions about the academic advising they received and the relationship of its absence on students’ major change. The participants were 1725 undergraduate students from all year levels. The survey used to collect the data for this study is: the Influences on Choice of Major survey. Based on the findings, it was found that university advisors have a very poor effect on students’ decisions to select their majors as 45.6% of the 1725 participants indicated no influence of advising in their survey answers. Whereas career advancement opportunities, students’ interests, and job opportunities indicate a strong effect on their majors’ selections, as they score the highest means of 3.76, 3.73, and 3.64, respectively. In addition, findings show that students are most likely changing their majors in their second year, and specifically in the second semester. Second year major change scored 36.9% in the second semester and 30.9% in the first semester. More importantly, results indicate that there is a positive significant correlation between college advisors and major change in the second year (p = 0.000. It is to researchers’ understanding based on the findings that when students receive enough academic advising in the first year of study, and this advising continues steadily into the next year, the probability of students changing their majors decreases greatly.

Invertebrate vectors, parasites, and rickettsial agents in Guam

Directory of Open Access Journals (Sweden)

Johnson, J.

2012-12-01

Full Text Available We conducted a 3-week field study of ectoparasites of humans and domestic animals throughout Guam. Thirteen species of ectoparasitic arthropods were collected. Ectoparasites of medical or veterinary significance included the ticks Rhipicephalus sanguineus and Rhipicephalus microplus, fleas Ctenocephalides felis and Xenopsylla cheopsis, and the head louse Pediculus humanus capitis. Polymerase chain reaction based screening for rickettsial and protozoan pathogens detected pathogens in eight arthropods. These included Anaplasma platys, Coxiella burnetii, Babesia canis vogeli, and Hepatozoon canis.

Distance majorization and its applications.

Science.gov (United States)

Chi, Eric C; Zhou, Hua; Lange, Kenneth

2014-08-01

The problem of minimizing a continuously differentiable convex function over an intersection of closed convex sets is ubiquitous in applied mathematics. It is particularly interesting when it is easy to project onto each separate set, but nontrivial to project onto their intersection. Algorithms based on Newton's method such as the interior point method are viable for small to medium-scale problems. However, modern applications in statistics, engineering, and machine learning are posing problems with potentially tens of thousands of parameters or more. We revisit this convex programming problem and propose an algorithm that scales well with dimensionality. Our proposal is an instance of a sequential unconstrained minimization technique and revolves around three ideas: the majorization-minimization principle, the classical penalty method for constrained optimization, and quasi-Newton acceleration of fixed-point algorithms. The performance of our distance majorization algorithms is illustrated in several applications.

Major issues associated with DOE commercial recycling initiatives

International Nuclear Information System (INIS)

Motl, G.P.; Burns, D.D.; Rast, D.M.

1994-01-01

Major initiatives are underway within DOE to recycle large volumes of scrap material generated during cleanup of the DOE Weapons Complex. These recycling initiatives are driven not only by the desire to conserve natural resources, but also by the recognition that shallow level burial is not a politically acceptable option. The Fernald facility is in the vanguard of a number of major DOE recycling efforts. These early efforts have brought issues to light that can have a major impact on the ability of Fernald and other major DOE sites to expand recycling efforts in the future. Some of these issues are; secondary waste deposition, title to material and radioactive contaminants, mixed waste generated during recycling, special nuclear material possession limits, cost benefit, transportation of waste to processing facilities, release criteria, and uses for beneficially reused products

The construct validity of the Major Depression Inventory

DEFF Research Database (Denmark)

Nielsen, Marie Germund; Ørnbøl, Eva; Vestergaard, Mogens

2017-01-01

Objective We aimed to assess the measurement properties of the ten-item Major Depression Inventory when used on clinical suspicion in general practice by performing a Rasch analysis. Methods General practitioners asked consecutive persons to respond to the web-based Major Depression Inventory...... on clinical suspicion of depression. We included 22 practices and 245 persons. Rasch analysis was performed using RUMM2030 software. The Rasch model fit suggests that all items contribute to a single underlying trait (defined as internal construct validity). Mokken analysis was used to test dimensionality...... for gender, age, work status and education. The Rasch and Mokken analyses revealed two dimensions, but the Major Depression Inventory showed fit to one scale if items 9 and 10 were excluded. Conclusion Our study indicated scalability problems in the current version of the Major Depression Inventory...

Selecting a Business Major within the College of Business

Science.gov (United States)

Roach, David W.; McGaughey, Ronald E.; Downey, James P.

2012-01-01

This study employed a survey in examining the important influences that shape a student's selection of a major in the College of Business (COB). In particular, it compared these influences, by major, to assess which items were most (and least) important to the students majoring in accounting, general business, finance, management, marketing, and…

Major lipids, apolipoproteins, and risk of vascular disease

DEFF Research Database (Denmark)

Collaboration, Emerging Risk Factors; Di Angelantonio, Emanuele; Sarwar, Nadeem

2009-01-01

CONTEXT: Associations of major lipids and apolipoproteins with the risk of vascular disease have not been reliably quantified. OBJECTIVE: To assess major lipids and apolipoproteins in vascular risk. DESIGN, SETTING, AND PARTICIPANTS: Individual records were supplied on 302,430 people without...

Gamification for Non-Majors Mathematics: An Innovative Assignment Model

Science.gov (United States)

Leong, Siow Hoo; Tang, Howe Eng

2017-01-01

The most important ingredient of the pedagogy for teaching non-majors is getting their engagement. This paper proposes to use gamification to engage non-majors. An innovative game termed as Cover the Hungarian's Zeros is designed to tackle the common weakness of non-majors mathematics in solving the assignment problem using the Hungarian Method.…

Gender, Empathy, and the Choice of the Psychology Major

Science.gov (United States)

Harton, Helen C.; Lyons, Patrick C.

2003-01-01

We compared male and female psychology majors to psychology minors and nonmajors to understand the trends in a growing major in which women outnumber men. A total of 451 psychology majors, minors, and nonmajors from 4 institutions completed a questionnaire measuring empathy, career goals, and perceptions of the importance of empathy for therapy.…

The patient perspective in research on major depression

NARCIS (Netherlands)

Cuijpers, P.

2011-01-01

Although thousands of studies have examined the genetics, epidemiology, etiology, biology, treatment and prevention of major depressive disorder, we still lack very basic knowledge about what patients with depressive disorders need. Despite the thousands of studies that have been conducted on major

Majority and minority influence: A dual role interpretation

NARCIS (Netherlands)

de Vries, N.K.; de Dreu, C.; Gordijn, E.; Schuurman, M.

1996-01-01

This chapter offers an analysis of majority vs. minority influence using the Heuristic-Systematic Model of persuasion (HSM). We evaluate evidence for and against leading perspectives such as Conversion Theory. Next, research and theory is reviewed suggesting that majority vs. minority influence

Major dealers' expert power in distribution channels

OpenAIRE

Richard Chinomona; Marius Pretorius

2011-01-01

The importance of major dealers' expertise in distribution channels and effects on exchange relations is widely acknowledged by many SMEs in Africa and yet there seem to be a paucity of research on this matter. To address this dearth, the current study attempts to examine the relationship between major dealers' expert power and SME manufacturers' channel cooperation and the mediating influence of their trust, relationship commitment and satisfaction. The conceptualized model and five hypothes...

Anaplasma phagocytophilum in questing Ixodes ricinus ticks from Romania.

Science.gov (United States)

Matei, Ioana Adriana; Kalmár, Zsuzsa; Magdaş, Cristian; Magdaş, Virginia; Toriay, Hortenzia; Dumitrache, Mirabela Oana; Ionică, Angela Monica; D'Amico, Gianluca; Sándor, Attila D; Mărcuţan, Daniel Ioan; Domşa, Cristian; Gherman, Călin Mircea; Mihalca, Andrei Daniel

2015-04-01

Granulocytic anaplasmosis is a common vector-borne disease of humans and animals with natural transmission cycle that involves tick vectors, among which Ixodes ricinus is the most important. The present paper reports the prevalence and geographical distribution of A. phagocytophilum in 10,438 questing Ixodes ricinus ticks collected at 113 locations from 40 counties of Romania. The unfed ticks were examined for the presence of A. phagocytophilum by PCR targeting a portion of ankA gene. The overall prevalence of infection was 3.42%, with local prevalences ranging between 0.29% and 22.45%, with an average prevalence of 5.39% in the infected localities. The infection with A. phagocytophilum was detected in 72 out of 113 localities and in 34 out of 40 counties. The highest prevalence was recorded in females followed by males and nymphs. The results and the distribution model have shown a large distribution of A. phagocytophilum, covering Romania's entire territory. This study is the first large scale survey of the presence of A. phagocytophilum in questing I. ricinus ticks from Romania. Copyright © 2015 Elsevier GmbH. All rights reserved.

Neurobiology of Major Depressive Disorder

Directory of Open Access Journals (Sweden)

Rosa Villanueva

2013-01-01

Full Text Available We survey studies which relate abnormal neurogenesis to major depressive disorder. Clinically, descriptive gene and protein expression analysis and genetic and functional studies revised here show that individual alterations of a complex signaling network, which includes the hypothalamic-pituitary-adrenal axis; the production of neurotrophins and growth factors; the expression of miRNAs; the production of proinflammatory cytokines; and, even, the abnormal delivery of gastrointestinal signaling peptides, are able to induce major mood alterations. Furthermore, all of these factors modulate neurogenesis in brain regions involved in MDD, and are functionally interconnected in such a fashion that initial alteration in one of them results in abnormalities in the others. We highlight data of potential diagnostic significance and the relevance of this information to develop new therapeutic approaches. Controversial issues, such as whether neurogenesis is the basis of the disease or whether it is a response induced by antidepressant treatments, are also discussed.

Embedding Career Issues in Advanced Psychology Major Courses

Science.gov (United States)

Halonen, Jane S.; Dunn, Dana S.

2018-01-01

Despite the popularity of the psychology major, complaints regularly arise about the value of majoring in psychology. This article reviews the workforce advantages that accrue to successful psychology students and encourages new strategies for emphasizing the professional development goal in the American Psychological Association's…

Computer anxiety among university and college students majoring ...

African Journals Online (AJOL)

This study examined computer anxiety among university and college of education Physical and Health Education (PHE) majors. The influence of personal characteristics of gender, age and experience of PHE majors on computer anxiety level were analysed. The Computer Anxiety Scale (CAS) developed by Marcoulides ...

Doubling the number of physics majors who teach

Science.gov (United States)

Marder, Michael

2009-03-01

The American Physical Society has adopted a doubling initiative to increase the number of physics majors. One of the main motivations is to increase the number of physics majors certified to teach secondary physics. I will review some of the possible strategies for reaching this goal, and discuss some of the steps we have taken with UTeach, the program for secondary science and mathematics teacher preparation at The University of Texas at Austin.I will discuss the roles of curriculum revision, financial support, and community support in convincing majors to teach. Finally, I will talk about the expansion of UTeach into engineering.

Major Depressive Disorder

Directory of Open Access Journals (Sweden)

G Grobler

2013-08-01

Full Text Available The treatment guideline draws on several international guidelines: (iPractice Guidelines of the American Psychiatric Association (APAfor the Treatment of Patients with Major Depressive Disorder, SecondEdition;[1](ii Clinical Guidelines for the Treatment of DepressiveDisorders by the Canadian Psychiatric Association and the CanadianNetwork for Mood and Anxiety Treatments (CANMAT;[2](iiiNational Institute for Clinical Excellence (NICE guidelines;[3](iv RoyalAustralian and New Zealand College of Psychiatrists Clinical PracticeGuidelines Team for Depression (RANZCAP;[4](v Texas MedicationAlgorithm Project (TMAP Guidelines;[5](vi World Federation ofSocieties of Biological Psychiatry (WFSBP Treatment Guideline forUnipolar Depressive Disorder;[6]and (vii British Association forPsychopharmacology Guidelines.[7

Academic search in response to major scientific events

NARCIS (Netherlands)

Li, X.; de Rijke, M.

2017-01-01

In this paper, we look at the search behavior of users of an academic search engine and in particular, their query patterns following the occurrence of major scientific events. We select Nobel Prize announcements as major scientific events and observe how academic searchers behave in response to

Efecto de plantaciones dendroenergéticas en el carbono a nivel de suelo, en dos suelos contrastantes de la región de Biobío, Chile

Directory of Open Access Journals (Sweden)

Edwin Esquivel

2013-12-01

Full Text Available La biomasa forestal como fuente de energía proveniente de plantaciones dendroenergéticas, al compararla con combustibles fósiles, presenta la ventaja de producir energía carbono-neutral, dado el secuestro de carbono (C fijado en la biomasa producida y los aportes al suelo. Plantaciones forestales de corta rotación, altas densidades, y localizadas en terrenos marginales pueden representar una excelente oportunidad de producción de biomasa para la producción de energía o combustibles. Sin embargo, los beneficios en el corto plazo del aumento del C a nivel de suelo en sitios marginales han sido cuestionados. Se establecieron plantaciones dendroenergéticas con las especies Eucalyptus camaldulensis, E. nitens, E. globulus, y Acacia melanoxylon a densidades de 5.000, 7.500 y 10.000 plantas por hectárea, en dos sitios de producción forestal marginal con suelos contrastantes (arenales y granítico localizados en la Región del Biobío de Chile. Evaluaciones periódicas durante 4 años a 0-20 y 20-40 cm de profundidad, del nivel de C en cada uno de los suelos evaluados, sugiere efectos de la edad (tiempo desde el establecimiento de la plantación (P < 0,001. A pesar de los cambios observados en el tiempo, la escasa diferencia en los niveles observados de C en el suelo mineral para los 48 meses de estudio comparados a los primeros 2 meses post-plantación, sugiere una rápida capacidad de recuperación de los niveles de C del suelo en un corto periodo.

Differential diagnosis of bipolar disorder and major depressive disorder.

Science.gov (United States)

Hirschfeld, R M

2014-12-01

Patients with bipolar disorder spend approximately half of their lives symptomatic and the majority of that time suffering from symptoms of depression, which complicates the accurate diagnosis of bipolar disorder. Challenges in the differential diagnosis of bipolar disorder and major depressive disorder are reviewed, and the clinical utility of several screening instruments is evaluated. The estimated lifetime prevalence of major depressive disorder (i.e., unipolar depression) is over 3 and one-half times that of bipolar spectrum disorders. The clinical presentation of a major depressive episode in a bipolar disorder patient does not differ substantially from that of a patient with major depressive disorder (unipolar depression). Therefore, it is not surprising that without proper screening and comprehensive evaluation many patients with bipolar disorder may be misdiagnosed with major depressive disorder (unipolar depression). In general, antidepressants have demonstrated little or no efficacy for depressive episodes associated with bipolar disorder, and treatment guidelines recommend using antidepressants only as an adjunct to mood stabilizers for patients with bipolar disorder. Thus, correct identification of bipolar disorder among patients who present with depression is critical for providing appropriate treatment and improving patient outcomes. Clinical characteristics indicative of bipolar disorder versus major depressive disorder identified in this review are based on group differences and may not apply to each individual patient. The overview of demographic and clinical characteristics provided by this review may help medical professionals distinguish between major depressive disorder and bipolar disorder. Several validated, easily administered screening instruments are available and can greatly improve the recognition of bipolar disorder in patients with depression. Copyright © 2014 Elsevier B.V. All rights reserved.

Trends and prospects of international major commodity prices

Directory of Open Access Journals (Sweden)

Maria Cartas

2013-04-01

Full Text Available Trends and prospects of international major commodity prices. In 2012, the international commodity markets have seen declining prices, especially during the first half of the year, with some improvement mainly in the last quarter. On the whole, most of major commodity prices declined, following generally weaker demand and the uncertain global economic situation. The short term outlook shows broad declines of prices for all major commodity groups, including oil and excepting metal prices, which are expected to be sustained by the global economic recovery and increasing demand, mainly in China. This country represents a major player, with a great contribution to the movement of prices on most of international commodity markets, as she has a great role in the world consumption and trade of commodities, as well as in the world production of some of these goods, on the one hand, and enjoys huge financial resources, on the other.

Review of major plutonium pyrochemical technology

International Nuclear Information System (INIS)

Moser, W.S.; Navratil, J.D.

1983-01-01

The past twenty years have seen significant growth in the development and application of pyrochemical technology for processing of plutonium. For particular feedstocks and specific applications, non-aqueous high-temperature processes offer key advantages over conventional hydrometallurgical systems. Major processes in use today include: (1) direct oxide reduction for conversion of PuO 2 to metal, (2) molten salt extraction for americium removal from plutonium, (3) molten salt electrorefining for Pu purification, and (4) hydriding to remove plutonium from host substrates. This paper reviews current major pyrochemical processes from the classical calcination-hydrofluorination-bomb reduction sequence through new techniques under development. Each process is presented and brief descriptions of production equipment are given. 47 references, 5 figures

Examining Person--Environment Fit and Academic Major Satisfaction

Science.gov (United States)

Milsom, Amy; Coughlin, Julie

2017-01-01

Decisions regarding college majors have the potential to affect a person's overall academic performance and long-term career success. With Holland's (1997) trait-and-factor theory serving as a foundation, the authors examined relationships between person-environment fit, college major satisfaction, and grade point average of undergraduate students…

African Americans: College Majors and Earnings. Fact Sheet

Science.gov (United States)

Carnevale, Anthony P.; Fasules, Megan L.; Porter, Andrea; Landis-Santos Jennifer

2016-01-01

Access to college for African Americans has increased, but African Americans are highly concentrated in lower-paying majors. The college major, which has critical economic consequences throughout life, reflects personal choices but also reflects the fact that African-American students are concentrated in open-access four-year institutions that…

Undergraduate Neuroscience Majors: A Missed Opportunity for Psychiatry Workforce Development.

Science.gov (United States)

Goldenberg, Matthew N; Krystal, John H

2017-04-01

This study sought to determine whether and to what extent medical students with an undergraduate college major in neuroscience, relative to other college majors, pursue psychiatry relative to other brain-based specialties (neurology and neurosurgery) and internal medicine. The authors analyzed data from AAMC matriculation and graduation surveys for all students who graduated from US medical schools in 2013 and 2014 (n = 29,714). Students who majored in neuroscience, psychology, and biology were compared to all other students in terms of their specialty choice at both time points. For each major, the authors determined rates of specialty choice of psychiatry, neurology, neurosurgery, and, for comparison, internal medicine. This study employed Chi-square statistic to compare odds of various specialty choices among different majors. Among medical students with an undergraduate neuroscience major (3.5% of all medical students), only 2.3% preferred psychiatry at matriculation, compared to 21.5% who chose neurology, 13.1% neurosurgery, and 11% internal medicine. By graduation, psychiatry specialty choice increased to 5.1% among neuroscience majors while choice of neurology and neurosurgery declined. Psychology majors (OR = 3.16, 95% CI 2.60-4.47) but not neuroscience majors (OR 1.28, 0.92-1.77) were more likely than their peers to choose psychiatry. Psychiatry struggles to attract neuroscience majors to the specialty. This missed opportunity is an obstacle to developing the neuroscience literacy of the workforce and jeopardizes the neuroscientific future of our field. Several potential strategies to address the recruitment challenges exist.

Physics momentum 'stars' draw majors

CERN Multimedia

Lindström, I

2003-01-01

Over the past decade, the number of University of Arizona students declaring physics as their major has doubled, amid a national decline. According to a recent report by the National Task Force on Undergraduate Physics, it is the university's dedication to its undergraduate physics program which draws students in (1 page).

Major Depression Can Be Prevented

Science.gov (United States)

Munoz, Ricardo F.; Beardslee, William R.; Leykin, Yan

2012-01-01

The 2009 Institute of Medicine report on prevention of mental, emotional, and behavioral disorders (National Research Council & Institute of Medicine, 2009b) presented evidence that major depression can be prevented. In this article, we highlight the implications of the report for public policy and research. Randomized controlled trials have shown…

Dirichlet polynomials, majorization, and trumping

International Nuclear Information System (INIS)

Pereira, Rajesh; Plosker, Sarah

2013-01-01

Majorization and trumping are two partial orders which have proved useful in quantum information theory. We show some relations between these two partial orders and generalized Dirichlet polynomials, Mellin transforms, and completely monotone functions. These relations are used to prove a succinct generalization of Turgut’s characterization of trumping. (paper)

Panthaleus major /Duges/ of cereals in Bulgaria

Directory of Open Access Journals (Sweden)

V. Maneva

2016-12-01

Full Text Available Abstract. Until recently, Penthaleus major (Dugès has not been recognized as an economically significant pest for the cereal crops. After climatic changes, its population began to grow and inflict damages around the world. The aim of this study was to investigate its distribution in Bulgaria and establish whether it presents a danger to the cereal crops. In the autumn of 2015 and the spring of 2016, a monitoring survey was conducted to establish Penthaleus major (Dugès with the cereal crops in Bulgaria. Over 60 sowed fields were investigated from all around the country. Samples were taken to identify the pest. It was established that Penthaleus major (Dugès inflicted harm to the wheat in north-eastern (12-14 mites per stem and south-eastern Bulgaria (6-8 mites per stem. Its density was under the threshold of economic harm. There was not found infestation of barley, rye, oat and triticale. On the field boundaries bordering the areas attacked by the mite were reported the following weeds: Capsella bursa pastoris (L. Medic, Descurania sophia (L. Welb. et Berth, Senecio spp., Sisymbrium orientale Torn., Taraxsacum officinale Weber, Anthemis spp., Bromus arvensis L., Eragrostis pilosa (L. P.B. Lolium temulentum L., which can be habitat for Penthaleus major (Dugès.

Biomechanical analysis of psoas major muscle by MR imaging

International Nuclear Information System (INIS)

Nagura, Takeo

1997-01-01

Our aim was to investigate the biomechanical function of the psoas major muscle. First, we carried out anatomical and function-morphological observation of 2 cadavers (46-year-old man and 86-year-old woman). Second, we reconstituted the three-dimensional geometrical models of the psoas major muscle using MR multi-laminograms of the lumber spine regions from 15 normal adult men. Third, we calculated the moment against the lumber hip joint region and the lumber pelvic region. We also examined, the functional change of the psoas major muscle associated with various positional changes by using the model. The psoas major muscle developed the lateroflection moment and the axial compression force against the lumber vertebra and the anterior shear force against the lower lumber vertebra, and posterior shear force against the pelvic at the iliopubic eminence region. The lateroflection moment is largest at the hip joint. We could find no individual differences of the function in the psoas major muscle and a few change in functional activity by the positional change between the lumber and the hip joint. These results suggest that the psoas major muscle has the function to support and stabilize the lumber by compression force and the pelvic-hip joint by posterior shear force, and also the function as an actuator for the hip joint. These suggest that the psoas major muscle has the sufficient function and structure for human to take orthograde by 2 feet. (K.H.)

Geographic Differences in the Earnings of Economics Majors

Science.gov (United States)

Winters, John V.; Xu, Weineng

2014-01-01

Economics has been shown to be a relatively high-earning college major, but geographic differences in earnings have been largely overlooked. The authors of this article use the American Community Survey to examine geographic differences in both absolute earnings and relative earnings for economics majors. They find that there are substantial…

Increased transmission potential of Leishmania major/Leishmania infantum hybrids

OpenAIRE

Volf, Petr; Benkova, Ivana; Myskova, Jitka; Sadlova, Jovana; Campino, Lenea; Ravel, Christophe

2007-01-01

Development of Leishmania infantum/Leishmania major hybrids was studied in two sand fly species. In Phlebotomus papatasi, which supported development of L. major but not L. infantum, the hybrids produced heavy late-stage infections with high numbers of metacyclic promastigotes. In the permissive vector Lutzomyia longipalpis, all Leishmania strains included in this study developed well. Hybrids were found to express L. major lipophosphoglycan, apparently enabling them to survive in P. papatasi...

Understanding Business Majors' Learning Styles

Science.gov (United States)

Giordano, James; Rochford, Regina A.

2005-01-01

Recently, business education programs have experienced a decline in enrollment and an increase in attrition. To understand these issues and recommend solutions, the learning styles of 503 first-year business majors at an urban community college were examined. The results demonstrated that: (a) 94% of the participants were analytic learners; (b)…

Rediscovering Major N. Clark Smith.

Science.gov (United States)

Buckner, Reginald T.

1985-01-01

Historians of American music education have yet to recognize a Black music educator as important and worthy of observation. This article discusses a candidate--Major Nathaniel Clark Smith, a little-known Black music educator, composer of more than a hundred works, businessman, humanitarian, and teacher of numerous big-name jazz musicians. (RM)

Managemant of NASA's major projects

Science.gov (United States)

James, L. B.

1973-01-01

Approaches used to manage major projects are studied and the existing documents on NASA management are reviewed. The work consists of: (1) the project manager's role, (2) request for proposal, (3) project plan, (4) management information system, (5) project organizational thinking, (6) management disciplines, (7) important decisions, and (8) low cost approach.

INVESTIGACION Y DESARROLLO DE UN PAQUETE TECNOLOGICO PARA PRODUCIR ETANOL A PARTIR DE ALAMOS HIBRIDOS

OpenAIRE

PETIT-BREUILH SEPULVEDA, XIMENA PILAR

2013-01-01

El presente proyecto abordó la investigación y desarrollo de la producción de combustible lignocelulósico, específicamente Bioetanol a partir de híbridos de álamos. Una de las principales ventajas del uso de álamos, es que su producción sólo requiere suelos marginales, por lo que no compite directamente con la producción de alimentos o forestal (pino o eucaliptus). Después de varios años de estudio, se han conseguido rotaciones de 2 a 3 años, con producción de biomasa entre 25 y 40 ton/ha/...

El plurilingüismo y la parodia: dos armas de combate textual para el emperador tertuliano

OpenAIRE

González Calvo, Mainor

2015-01-01

El Emperador Tertuliano y la Legió'n de los Superlimpios es el texto que mejor propone la heteroglosia en el género novelístico en Costa Rica. Además, esta pluralidad de discursos (de procedencia vallecentraleña y de grupos sociales marginales) son integrados en la novela para dar una visión de la realidad burocrática muy diferente a la promulgada por los medios ideológicos estatales. El plurilingüismo y la parodia (términos explicados por el teórico ruso Mijail Bajtín) son dos armas lingüíst...

Beyrouth-Dubaï

OpenAIRE

Brones, Sophie; Moghadam, Amin

2017-01-01

Depuis le milieu des années 2000, l’émergence d’un marché de l’art contemporain au Moyen-Orient a généré une recomposition des polarités cultu­relles à l’échelle régionale. Cet article met en perspective deux villes, Dubaï et Beyrouth, dont les développements récents, du point de vue de la structuration des institutions culturelles et de l’urbanisation de zones marginales, témoignent de façons distinctes mais non moins comparables de l’émergence de nouvelles formes d’urbanité. Leur cohérence ...

Association between toll-like receptors expression and major depressive disorder.

Science.gov (United States)

Hung, Yi-Yung; Kang, Hong-Yo; Huang, Kai-Wei; Huang, Tiao-Lai

2014-12-15

Accumulating evidences suggest that Toll-like receptors (TLRs) were involved in the pathophysiology of major depressive disorder. TLR4 was thought to be associated with major depressive disorder in animal model, but the others were still unknown. In order to examine TLR1-9 mRNA expression levels in peripheral blood and their relationships with the psychopathology of major depressive disorder, 30 patients with major depressive disorder were compared with 29 healthy controls. The 17-item Hamilton Depression Rating Scale (HAMD-17) was used to assess the severity of major depression. The mRNA expression levels of TLRs were examined in parallel with a housekeeping gene using real-time polymerase chain reaction (RT-PCR). Analysis of covariance with age and body mass index adjustment revealed a significantly higher expression of TLR3, 4, 5 and 7 mRNA but lower expression of TLR1 and 6 in patients with major depressive disorder as compared with healthy controls. Multiple linear regression analysis revealed that TLR4 was an independent risk factor relating to severity of major depression. These findings suggest that TLRs, especially TLR4, may be involved in the psychopathology of major depression. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

Interaction of the tick immune system with transmitted pathogens

Czech Academy of Sciences Publication Activity Database

Hajdušek, Ondřej; Šíma, Radek; Ayllón, N.; Jalovecká, M.; Pernes, J.; de la Fuente, J.; Kopáček, Petr

2013-01-01

Roč. 3, Jul 2013 (2013), a26 ISSN 2235-2988 R&D Projects: GA ČR GAP506/10/2136; GA ČR GA13-11043S; GA ČR GP13-27630P; GA ČR GP13-12816P; GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : Anaplasma * Babesia * Borrelia * antimicrobial peptides * innate immunity * phagocytosis * tick * tick-borne diseases Subject RIV: EC - Immunology Impact factor: 2.620, year: 2013

Majoring in Information Systems: Reasons Why Students Select (or Not) Information Systems as a Major

Science.gov (United States)

Snyder, Johnny; Slauson, Gayla Jo

2014-01-01

Filling the pipeline for information systems workers is critical in the information era. Projected growth rates for jobs requiring information systems expertise are significantly higher than the projected growth rates for other jobs. Why then do relatively few students choose to major in information systems? This paper reviews survey results from…

Major Development Communication Paradigms and Practices ...

African Journals Online (AJOL)

info

major paradigms of development and communication practices on graphic ... mobilize, educate and persuade target audience to support human development ... facilitates the understanding of the themes, issues and facts of a campaign.

Major Benno Leesiku mälestuseks

Index Scriptorium Estoniae

2010-01-01

Järelehüüe 2006. aastal surnud Kaitseliidu juhile, Eesti Laskurliidu asepresidendile ja võimlemistreenerite klubi Kartek presidendile major Benno Leesikule, kes oleks 17. jaanuaril 2010. aastal saanud 50-aastaseks

Why Are Students Not Majoring in Information Systems?

Science.gov (United States)

Walstrom, Kent A.; Schambach, Thomas P.; Jones, Keith T.; Crampton, William J.

2008-01-01

The purpose of this study was to examine some of the factors that influence and impact business students when they select their major and, more particularly, to examine why students are not majoring in information systems. Students in an entry level business class responded that they were more knowledgeable about careers in management, marketing,…

Major KEEP Findings, 1971 - 1975.

Science.gov (United States)

Kamehameha Schools, Honolulu, HI. Kamehameha Early Education Project.

This report lists the 34 major research findings from the Kamehameha Early Education Program (KEEP) for the years 1971-1975. Each finding is accompanied by a listing of KEEP technical reports and working papers which contain information relevant to that finding. Included among areas covered in the findings are: (1) student motivation, (2) teacher…

Endocrinopathies in thalassemia major patient

Science.gov (United States)

Lubis, D. A.; Yunir, E. M.

2018-03-01

Advanced in chelation therapy and regular blood transfusion have marked improvements in the life expectancy of patients with thalassemia major, however these patients still have to deal with several complications. We report a 19-year-old male, presented with multiple endocrine complication-related thalassemia; hypogonadism, short stature, osteoporosis with history of fracture, and subclinical hypothyroid.

Epidemiology of major depressive disorder

NARCIS (Netherlands)

Stegenga, B.T.

2011-01-01

Major depressive disorder (MDD) is a serious health problem and will be the second leading cause of burden of disease worldwide by 2030. To be able to prevent MDD, insight into risk factors for the onset of MDD is of clear importance. On the other hand, if onset of MDD has occurred, one may argue

Subcortical brain alterations in major depressive disorder : findings from the ENIGMA Major Depressive Disorder working group

NARCIS (Netherlands)

Schmaal, L.; Veltman, D. J.; van Erp, T. G. M.; Saemann, P. G.; Frodl, T.; Jahanshad, N.; Loehrer, E.; Tiemeier, H.; Hofman, A.; Niessen, W. J.; Vernooij, M. W.; Ikram, M. A.; Wittfeld, K.; Grabe, H. J.; Block, A.; Hegenscheid, K.; Voelzke, H.; Hoehn, D.; Czisch, M.; Lagopoulos, J.; Hatton, S. N.; Hickie, I. B.; Goya-Maldonado, R.; Kraemer, B.; Gruber, O.; Couvy-Duchesne, B.; Renteria, M. E.; Strike, L. T.; Mills, N. T.; de Zubicaray, G. I.; McMahon, K. L.; Medland, S. E.; Martin, N. G.; Gillespie, N. A.; Wright, M. J.; Hall, G.B.; MacQueen, G. M.; Frey, E. M.; Carballedo, A.; van Velzen, L. S.; van Tol, M. J.; van der Wee, N. J.; Veer, I. M.; Walter, H.; Schnell, K.; Schramm, E.; Normann, C.; Schoepf, D.; Konrad, C.; Penninx, B. W. J. H.

The pattern of structural brain alterations associated with major depressive disorder (MDD) remains unresolved. This is in part due to small sample sizes of neuroimaging studies resulting in limited statistical power, disease heterogeneity and the complex interactions between clinical

Major and minor axis kinematics of 22 ellipticals

International Nuclear Information System (INIS)

Franx, M.; Illingworth, G.; Heckman, T.

1989-01-01

Rotation curves and velocity dispersion profiles have been determined for the major and the minor axes of 22 elliptical galaxies. Rotation was detected in all but one galaxy, even though the sample was biased toward round ellipticals. Minor axis rotation larger than major axis rotation was measured in two galaxies, NGC 4406 and NGC 7507. Roughly 10 percent of ellipticals may show large minor axis velocities relative to those on the major axis. A simple model is used to derive a rotational axis from the observed minor and major axis velocities to a typical accuracy of 6 deg. The rotational and photometric minor axes aligned to better than 10 deg for 60 percent of the sample, implying that the direction of the angular momentum is related to the orientation of the figure of the galaxy. IC 1459 has a kinematically distinct core with its angular momentum opposite to the angular momentum of the outer parts, and NGC 4406 has a core with its angular momentum perpendicular to that of the outer parts. 46 refs

The Ursa Major supercluster

International Nuclear Information System (INIS)

Schuch, N.J.

1983-01-01

An optical and a radio survey have been carried out. The optical observations consist of a spectroscopic survey in which redshift data for cluster galaxies and optical identifications of radio sources were obtained with the 98-inch Isaac Newton telescope at the Royal Greenwich Observatory, and the 200-inch Hale telescope; the photographic survey in B, V and R colors was made with the 48-inch Schmidt telescope at Palomar. Some results on the galaxy distribution in the Ursa Major supercluster are briefly discussed. (Auth.)

April 2006. 32 Major Orthopaedic Procedures

African Journals Online (AJOL)

user

2006-04-01

Apr 1, 2006 ... Major Orthopaedic Procedures: 17 Year Trends. Biruk Lambisso Wamisho1 ... financial and logistic constraints with poor compliance of ... Modern orthopaedic surgery is very expensive. A highly ..... Case management. Tribury.

Freshman Biology Majors' Misconceptions about Diffusion and Osmosis.

Science.gov (United States)

Odom, A. Louis; Barrow, Lloyd H.

The data for this study were obtained from a sample of 117 biology majors enrolled in an introductory biology course. The Diffusion and Osmosis Diagnostic Test, composed of 12 two-tier items, was administered to the students. Among the major findings are: (1) there was no significant difference in scores of male and female students; (2) math…

Metallogenetic characteristics of major fault in area No.212-318

International Nuclear Information System (INIS)

Zhang Yong

1994-01-01

Based on the distribution characteristics of major fault on the plan and assemblage form of major and subsidiary faults on the section, this paper expounds the relationship between major fault and uranium ore-formation, namely: different orders of fault structure control the spatial distribution of ore fields, ore deposits and ore bodies respectively, regional turning sites of the major fault control the ore fields; local turning sites of the major fault control ore deposits; different types of structural assemblages control ore bodies. Whether the matter compositions of fault structure are simple or not, it plays an absolutely important role in ore-formation. The complicated matter compositions of fault structures are favourable for ore-formation, conversely, simple compositions are unfavourable

Dynamic range majority data structures

DEFF Research Database (Denmark)

Elmasry, Amr Ahmed Abd Elmoneim; He, Meng; Munro, J. Ian

2011-01-01

Given a set P of n coloured points on the real line, we study the problem of answering range α-majority (or "heavy hitter") queries on P. More specifically, for a query range Q, we want to return each colour that is assigned to more than an α-fraction of the points contained in Q. We present a ne...

Proximity of US schools to major roadways: a nationwide assessment.

Science.gov (United States)

Kingsley, Samantha L; Eliot, Melissa N; Carlson, Lynn; Finn, Jennifer; MacIntosh, David L; Suh, Helen H; Wellenius, Gregory A

2014-01-01

Long-term exposure to traffic pollution has been associated with adverse health outcomes in children and adolescents. A significant number of schools may be located near major roadways, potentially exposing millions of children to high levels of traffic pollution, but this hypothesis has not been evaluated nationally. We obtained data on the location and characteristics of 114,644 US public and private schools, grades prekindergarten through 12, and calculated their distance to the nearest major roadway. In 2005-2006, 3.2 million students (6.2%) attended 8,424 schools (7.3%) located within 100 m of a major roadway, and an additional 3.2 million (6.3%) students attended 8,555 (7.5%) schools located 100-250 m from a major roadway. Schools serving predominantly Black students were 18% (95% CI, 13-23%) more likely to be located within 250 m of a major roadway. Public schools eligible for Title I programs and those with a majority of students eligible for free/reduced price meals were also more likely to be near major roadways. In conclusion, 6.4 million US children attended schools within 250 m of a major roadway and were likely exposed to high levels of traffic pollution. Minority and underprivileged children were disproportionately affected, although some results varied regionally.

Starting an Actuarial Science Major at a Liberal Arts College

Science.gov (United States)

Mills, Mark A.

2014-01-01

The article provides details of the process of starting an actuarial science major at a small, liberal arts college. Some critique of the major is included, as well as some challenges that may be faced by others wanting to start such a major at their institution.

THE COMPATIBILITY STUDENT CHOICE OF UNIVERSITY MAJORING; A PRELIMINARY STUDIES

Directory of Open Access Journals (Sweden)

Daharnis Daharnis

2016-06-01

Full Text Available The continuous improvements in order to optimize the basic education to higher education are still running. Based on that purpose, there are many factors to supporting the students' learning activities success; one of the factors is suitability with majors in university. The purpose of this study is to reveal the condition of the compatibility of students majoring with their interest, then to describe the information when the student choose their majoring. Samples in this study were 122 peoples, taken by random sampling from the Padang State University. Data obtained by distributing questionnaires. The results showed that there are students that their major do not match with their interest (22.13%, only 3.28% of students who feel compatible with their major. This result should be a major concern, particularly for counselor in schools for design counseling services to solve these problems. The result of this study used as a grand tour or a preliminary study for further research.