WorldWideScience

Sample records for anaplasma marginale major

  1. Anaplasma marginale major surface protein 1a: a marker of strain diversity with implications for control of bovine anaplasmosis.

    Science.gov (United States)

    Cabezas-Cruz, Alejandro; de la Fuente, José

    2015-04-01

    Classification of bacteria is challenging due to the lack of a theory-based framework. In addition, the adaptation of bacteria to ecological niches often results in selection of strains with diverse virulence, pathogenicity and transmission characteristics. Bacterial strain diversity presents challenges for taxonomic classification, which in turn impacts the ability to develop accurate diagnostics and effective vaccines. Over the past decade, the worldwide diversity of Anaplasma marginale, an economically important tick-borne pathogen of cattle, has become apparent. The extent of A. marginale strain diversity, formerly underappreciated, has contributed to the challenges of classification which, in turn, likely impacts the design and development of improved vaccines. Notably, the A. marginale surface protein 1a (MSP1a) is a model molecule for these studies because it serves as a marker for strain identity, is both an adhesin necessary for infection of cells and an immuno-reactive protein and is also an indicator of the evolution of strain diversity. Herein, we discuss a molecular taxonomic approach for classification of A. marginale strain diversity. Taxonomic analysis of this important molecule provides the opportunity to understand A. marginale strain diversity as it relates geographic and ecological factors and to the development of effective vaccines for control of bovine anaplasmosis worldwide. Copyright © 2015 Elsevier GmbH. All rights reserved.

  2. Seroprevalence of Bovine Anaplasmosis Caused by Anaplasma Marginale in Malaysia

    OpenAIRE

    Pong, Samantha; Nik-Him, Nik-Ahmad I. I

    2012-01-01

    Anaplasmosis, also known as yellow fever, is an infectious parasitic disease of cattle caused by the protozoan Anaplasma marginale. Anaplasma marginale infects the erythrocytes and causes severe anaemia, weakness, loss of appetite, fever, depression, abortion, decreased milk production, constipation, jaundice and sometimes death. In Malaysia, data on A. marginale infection is still behind compared to other parasites such as nematodes. Anaplasmosis in livestock has received little attention in...

  3. Anaplasma marginale and Anaplasma phagocytophilum: Rickettsiales pathogens of veterinary and public health significance.

    Science.gov (United States)

    Atif, Farhan Ahmad

    2015-11-01

    Anaplasma marginale and Anaplasma phagocytophilum are the most important tick-borne bacteria of veterinary and public health significance in the family Anaplasmataceae. The objective of current review is to provide knowledge on ecology and epidemiology of A. phagocytophilum and compare major similarities and differences of A. marginale and A. phagocytophilum. Bovine anaplasmosis is globally distributed tick-borne disease of livestock with great economic importance in cattle industry. A. phagocytophilum, a cosmopolitan zoonotic tick transmitted pathogen of wide mammalian hosts. The infection in domestic animals is generally referred as tick-borne fever. Concurrent infections exist in ticks, domestic and wild animals in same geographic area. All age groups are susceptible, but the prevalence increases with age. Movement of susceptible domestic animals from tick free non-endemic regions to disease endemic regions is the major risk factor of bovine anaplasmosis and tick-borne fever. Recreational activities or any other high-risk tick exposure habits as well as blood transfusion are important risk factors of human granulocytic anaplasmosis. After infection, individuals remain life-long carriers. Clinical anaplasmosis is usually diagnosed upon examination of stained blood smears. Generally, detection of serum antibodies followed by molecular diagnosis is usually recommended. There are problems of sensitivity and cross-reactivity with both the Anaplasma species during serological tests. Tetracyclines are the drugs of choice for treatment and elimination of anaplasmosis in animals and humans. Universal vaccine is not available for either A. marginale or A. phagocytophilum, effective against geographically diverse strains. Major control measures for bovine anaplasmosis and tick-borne fever include rearing of tick-resistant breeds, endemic stability, breeding Anaplasma-free herds, identification of regional vectors, domestic/wild reservoirs and control, habitat modification

  4. Identification of Anaplasma marginale type IV secretion system effector proteins.

    Directory of Open Access Journals (Sweden)

    Svetlana Lockwood

    Full Text Available Anaplasma marginale, an obligate intracellular alphaproteobacterium in the order Rickettsiales, is a tick-borne pathogen and the leading cause of anaplasmosis in cattle worldwide. Complete genome sequencing of A. marginale revealed that it has a type IV secretion system (T4SS. The T4SS is one of seven known types of secretion systems utilized by bacteria, with the type III and IV secretion systems particularly prevalent among pathogenic Gram-negative bacteria. The T4SS is predicted to play an important role in the invasion and pathogenesis of A. marginale by translocating effector proteins across its membrane into eukaryotic target cells. However, T4SS effector proteins have not been identified and tested in the laboratory until now.By combining computational methods with phylogenetic analysis and sequence identity searches, we identified a subset of potential T4SS effectors in A. marginale strain St. Maries and chose six for laboratory testing. Four (AM185, AM470, AM705 [AnkA], and AM1141 of these six proteins were translocated in a T4SS-dependent manner using Legionella pneumophila as a reporter system.The algorithm employed to find T4SS effector proteins in A. marginale identified four such proteins that were verified by laboratory testing. L. pneumophila was shown to work as a model system for A. marginale and thus can be used as a screening tool for A. marginale effector proteins. The first T4SS effector proteins for A. marginale have been identified in this work.

  5. Anaplasma phagocytophilum and Anaplasma marginale Elicit Different Gene Expression Responses in Cultured Tick Cells

    Directory of Open Access Journals (Sweden)

    Zorica Zivkovic

    2009-01-01

    Full Text Available The genus Anaplasma (Rickettsiales: Anaplasmataceae includes obligate tick-transmitted intracellular organisms, Anaplasma phagocytophilum and Anaplasma marginale that multiply in both vertebrate and tick host cells. Recently, we showed that A. marginale affects the expression of tick genes that are involved in tick survival and pathogen infection and multiplication. However, the gene expression profile in A. phagocytophilum-infected tick cells is currently poorly characterized. The objectives of this study were to characterize tick gene expression profile in Ixodes scapularis ticks and cultured ISE6 cells in response to infection with A. phagocypthilum and to compare tick gene expression responses in A. phagocytophilum- and A. marginale-infected tick cells by microarray and real-time RT-PCR analyses. The results of these studies demonstrated modulation of tick gene expression by A. phagocytophilum and provided evidence of different gene expression responses in tick cells infected with A. phagocytophilum and A. marginale. These differences in Anaplasma-tick interactions may reflect differences in pathogen life cycle in the tick cells.

  6. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B-cell epitopes are predominantly located in the HVR.

    Science.gov (United States)

    Abbott, Jeffrey R; Palmer, Guy H; Howard, Chris J; Hope, Jayne C; Brown, Wendy C

    2004-12-01

    Organisms in the genus Anaplasma express an immunodominant major surface protein 2 (MSP2), composed of a central hypervariable region (HVR) flanked by highly conserved regions. Throughout Anaplasma marginale infection, recombination results in the sequential appearance of novel MSP2 variants and subsequent control of rickettsemia by the immune response, leading to persistent infection. To determine whether immune evasion and selection for variant organisms is associated with a predominant response against HVR epitopes, T-cell and linear B-cell epitopes were localized by measuring peripheral blood gamma interferon-secreting cells, proliferation, and antibody binding to 27 overlapping peptides spanning MSP2 in 16 cattle. Similar numbers of MSP2-specific CD4(+) T-cell epitopes eliciting responses of similar magnitude were found in conserved and hypervariable regions. T-cell epitope clusters recognized by the majority of animals were identified in the HVR (amino acids [aa] 171 to 229) and conserved regions (aa 101 to 170 and 272 to 361). In contrast, linear B-cell epitopes were concentrated in the HVR, residing within hydrophilic sequences. The pattern of recognition of epitope clusters by T cells and of HVR epitopes by B cells is consistent with the influence of protein structure on epitope recognition.

  7. Detection and Characterisation of Anaplasma marginale and A. centrale in South Africa

    Directory of Open Access Journals (Sweden)

    Paidashe Hove

    2018-03-01

    Full Text Available Bovine anaplasmosis is endemic in South Africa and it has a negative economic impact on cattle farming. An improved understanding of Anaplasma marginale and Anaplasma marginale variety centrale (A. centrale transmission, together with improved tools for pathogen detection and characterisation, are required to inform best management practices. Direct detection methods currently in use for A. marginale and A. centrale in South Africa are light microscopic examination of tissue and organ smears, conventional, nested, and quantitative real-time polymerase chain reaction (qPCR assays, and a reverse line blot hybridisation assay. Of these, qPCR is the most sensitive for detection of A. marginale and A. centrale in South Africa. Serological assays also feature in routine diagnostics, but cross-reactions prevent accurate species identification. Recently, genetic characterisation has confirmed that A. marginale and A. centrale are separate species. Diversity studies targeting Msp1a repeats for A. marginale and Msp1aS repeats for A. centrale have revealed high genetic variation and point to correspondingly high levels of variation in A. marginale outer membrane proteins (OMPs, which have been shown to be potential vaccine candidates in North American studies. Information on these OMPs is lacking for South African A. marginale strains and should be considered in future recombinant vaccine development studies, ultimately informing the development of regional or global vaccines.

  8. Gamma irradiation attenuation of Anaplasma Marginale and its possible use as vaccine against bovine anaplasmosis

    International Nuclear Information System (INIS)

    Castro Z, J.; Pupiales T, N.

    1986-01-01

    Bovine Anaplasmosis is one of the limiting in the cattle development at Colombia and others tropical countries. Bovine Anaplasmosis is an infectious disease caused by a microorganism called Anaplasma Marginale, it with invades the red globules producing erythrofagocitosis. In this job, were irradiated with different gamma beam intensity; microorganisms of Anaplasma Marginale, those which were used as innocuous. Animals of the groups (I,II,III) presented good protection against the disease; animals of the Group IV presented mild symptoms with subsequent recovery and strong symptoms

  9. Transmisión de Anaplasma marginale por garrapatas

    Directory of Open Access Journals (Sweden)

    Kelly A. Brayton

    2012-01-01

    Full Text Available Anaplasma marginale, patógeno de distribución mundial, es transmitido por garrapatas Ixódidas. Comprender su complejo desarrollo dentro de la garrapata vector, permitirá la predicción de brotes y ofrecerá oportunidades para controlar su transmisión. En este trabajo se revisa su ciclo básico de desarrollo junto con los estudios recientes acerca de las diferencias de transmisión entre cepas, que delinean aspectos de la interacción patógeno - vector. Bacterias, virus o protozoarios transmitidos por artrópodos causan enfermedades severas, tanto en humanos como en animales. Las enfermedades infecciosas transmitidas por garrapatas, entre las que incluimos a la Anaplasmosis (A. marginale, babesiosis (Babesia bigemina, B. bovis, B. divergens y Theileriosis (Theileria annulata, T. parva, se encuentran entre las más importantes en el ámbito mundial, con pérdidas cercanas a los siete mil millones de dólares anualmente; y, a pesar de su impacto, permanecen escasamente bajo control, basado primordialmente en la aplicación de acaricidas, para interrumpir su transmisión. La aparición de garrapatas resistentes a múltiples sustancias acaricidas, representa una amenaza en este tipo de control y, como resultado, hay un resurgimiento de la investigación para el desarrollo de nuevas estrategias para su control. Nuevas opciones para prevenir la transmisión de patógenos de animales por garrapatas, será el resultado de entender las interacciones garrapata patógeno; proceso que culmina con el desarrollo de la infección y transmisión exitosa. En todos los casos de patógenos transmitidos por garrapatas, el desarrollo de la infección se realiza coordinamente a los momentos de adhesión y alimentación del vector sobre el animal. Esto sucede por la interdependencia en la señalización entre el patógeno y el vector al alimentarse y, por ello, será susceptible de intervención.

  10. Knockout of an outer membrane protein operon of anaplasma marginale by transposon mutagenesis

    Science.gov (United States)

    Large amounts of data generated by genomics, transcriptomics and proteomics technologies have increased our understanding of the biology of Anaplasma marginale. However, these data have also led to new assumptions that require testing, ideally through classic genetic mutation. One example is the def...

  11. Detection of genetic diversity of Anaplasma marginale isolates in Minas Gerais, Brazil

    Czech Academy of Sciences Publication Activity Database

    Pohl, A.E.; Cabezas Cruz, Alejandro; Ribeiro, M.F.B.; Goncalves da Silvera, J.; Silaghi, C.; Pfister, K.; Friche Passos, L.M.

    2013-01-01

    Roč. 22, č. 1 (2013), s. 129-135 ISSN 1984-2961 Institutional support: RVO:60077344 Keywords : Anaplasma marginale * MSP1a * DNA sequencing * microsatellites * tandem repeats * Brazil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.961, year: 2013

  12. Prevalence of Anaplasma marginale in different tick species from Ngorongoro Crater, Tanzania.

    Science.gov (United States)

    Fyumagwa, Robert D; Simmler, Pascale; Meli, Marina L; Hoare, Richard; Hofmann-Lehmann, Regina; Lutz, Hans

    2009-04-06

    In 2001, Ngorongoro Crater was infested with high density of ticks on grassland, livestock and wildlife which was also associated with high mortality. Adult ticks were collected, identified, processed for nucleic acids extraction and a molecular analysis was performed to determine the range of tick species harboring Anaplasma marginale. The real-time PCR was used in the amplification of rickettsia DNA in tick pools (n=527) from 11 identified tick species. Six tick species were detected with A. marginale DNA including Amblyomma gemma, Rhipicephalus appendiculatus, R. compositus, R.decoloratus, R. praetextatus and R. pulchellus. The detection rate in each tick species was 3%, 0.7%, 2%, 13%, 1.8%, and 6.2%, respectively. Five of the positive tick species excluding R.decoloratus have previously not been described to transmit A. marginale. High diversity of tick species detected with A. marginale in Ngorongoro Crater is likely to increase a risk to susceptible animals of contracting the infection.

  13. Immune responses in cattle vaccinated with gamma-irradiated Anaplasma marginale

    International Nuclear Information System (INIS)

    Sharma, S.P.; Bansal, G.C.

    1986-01-01

    The infectivity and immunogenecity of gamma-irradiated Anaplasma marginale organisms were studied in bovine calves. The severity of Anaplasma infection based on per cent infected red blood cells, haematological values and mortality was more in animals immunized with blood exposed to 60 kR in comparison to those inoculated with blood irradiated at 70, 80 and 90 kR. The immunizing controls demonstrated a significantly high parasitaemia, marked anaemia and more deaths. Marked and prolonged cell-mediated and humoral immune responses detectable in the first 3 weeks of post-immunization may be responsible for conferring of protective immunity. (author)

  14. Anaplasma Marginale isolation from infected bovine erythrocytes or from its floating culture

    International Nuclear Information System (INIS)

    Canon Q, Y.

    1986-01-01

    Isolation of Anaplasma Marginale is of great importance because this is the cause of anaplasmosis in cattle. Anaplasmosis is a mortal disease and spreads easily. To isolate the anaplasm, four different experiments were developed; in the first experiment, the parasite was isolated from parasitic blood, by means of three methods; osmotic shock, sonic vibration and treatment with hemolisine. In the second experiment, the parasite source was the top of the bacteriologic culture of anaplasma marginale obtained by means of slow centrifugation. In the third experiment, it was used parasitic blood diluted in PBS and liquid nitrogen criopreserved. In the fourth experiment.it was used parasitic blood which was separated by means of sonic oscillation. This method was more adequate to free the parasite from the host cell. Differential centrifugation was the best method to separate parasite of the stroma and ghost cells

  15. Transplacental transmission of Anaplasma marginale in beef cattle chronically infected in southern Brazil

    Directory of Open Access Journals (Sweden)

    Hermann Eduardo Gonzalez Grau

    Full Text Available In this study, we have investigated the incidence of transplacental transmission of Anaplasma marginale in chronically infected cows with no history of acute anaplasmosis during gestation. In addition, we evaluated various techniques for detection of transplacental transmission ofA. marginale. Blood samples were collected from 30 cows at three different periods: at the time of artificial insemination, at gestational diagnosis, and after calving. Also, blood was collected from the newborn calves, including one sample before colostrum intake, and another three days after birth. A. marginale-specific antibodies were detected in 100% of the cows with an indirect fluorescent antibody test (IFAT, and in 97% of them, using an indirect enzyme-linked immunosorbent assay (ELISA. Also, we observed that all of the three-day-old newborn calves were seropositive by IFAT. According to polymerase chain reaction, 63.3% of the cows were carriers of A. marginale, as well as 6.7% of the newborn calves. This represented a transplacental transmission rate of 10.5%. Furthermore, a correlation of 93.3% was observed between the two serodiagnostic techniques, demonstrating that both ELISA and IFAT can be used in epidemiological surveys of A. marginale. These results confirm the occurrence of transplacental transmission of A. marginale in chronically infected cows and suggest the importance of this transmission route in areas of enzootic instability.

  16. Effect of gamma irradiation on anaplasma marginale in bovines

    International Nuclear Information System (INIS)

    Romero, H.Q.; Fernandez, M.V.G. de; Meza, B.R.; Rodriguez, E.

    1981-01-01

    Because the costs of treatment of anaplasmosis are very high, it was considered of great usefulness to obtain the modification of the pathogenecity and the antigenecity of A. marginale by means of gamma radiation ( 60 Co) to obtain a vaccine. This would be reflected favorably in saving lives as well as to obviate losses of meat and dairy production and the elimination of the risks derived from the introduction of selected cattle into the tropics. The main purpose of this study was to determine the optimal modification of the pathogenecity of A. marginale in splenectomized calves and adult cows, among 4 different radiation doses. (author)

  17. Anaplasma marginale infection in cattle from south-western Amazonia Infecção por Anaplasma marginale em bovinos na Amazônia Sul Ocidental, Brasil

    Directory of Open Access Journals (Sweden)

    Luciana Gatto Brito

    2010-03-01

    Full Text Available The present study provides the first epidemiological data regarding infection by Anaplasma marginale in cattle reared in south-western Brazilian Amazonia. One simple procedure was adapted for the extraction of DNA from blood clots collected in seven microregions of Rondônia State and two mesoregions of Acre State. PCR method was used to asses the frequency of A. marginale infections in 4 to12-month-old cattle. The cattle infection was investigated by polymerase chain reaction (PCR using the specific primer "msp5" for A. marginale. The DNA amplifications revealed that the mean frequency of A. marginale infection was 98.6% (1,627/1,650 in samples from Rondonia, and 92.87% (208/225 in samples from Acre. The high frequency of A. marginale infections in 4 to 12-month-old cattle indicate a situation of enzootic stability in the studied areas and are comparable to those detected by immunodiagnosis in different endemic regions in Brazil. The DNA extraction of clotted blood method described here can be used for epidemiological studies on anaplasmosis and other bovine hemoparasites.O presente estudo fornece os primeiros dados epidemiológicos relativos a infecção por Anaplasma marginale em bovinos criados na Amazônia Sul Ocidental brasileira. Foi adaptado um procedimento simples para a extração de DNA a partir de coágulos sanguíneos coletados em sete microrregiões do estado de Rondônia e duas mesoregiões do estado do Acre. A técnica da reação em cadeia da polimerase (PCR foi aplicada para avaliar a freqüência da infecção por A. marginale em bovinos com idade entre 4 e 12 meses. Após a extração do DNA de cada amostra, a infecção nos bovinos foi investigada pela amplificação do gene "msp5" de A. marginale. As técnicas de amplificação do DNA revelaram que a freqüência de infecção por A. marginale foi de 98,6% (1.627/1.650 nas amostras provenientes de Rondônia e de 92,87% (208/225 nas amostras do Acre. A alta freqüência da

  18. Prevalence of Babesia spp. and Anaplasma marginale in cattle in the municipality of Palma, MG

    Directory of Open Access Journals (Sweden)

    Marluce Aparecida Mattos Paula

    2015-12-01

    Full Text Available ABSTRACT. Paula M.A.M., Oliveira F.C.R., Melo Jr O.A. & Frazão-Teixeira E. [Prevalence of Babesia spp. and Anaplasma marginale in cattle in the municipality of Palma, MG.] Prevalência de Babesia spp. e Anaplasma marginale em bovinos no município de Palma, MG. Revista Brasileira de Medicina Veterinária, 37(4: 359-365, 2015. Laboratório de Biologia Estrutural, Instituto Oswaldo Cruz/ Fiocruz, Avenida Brasil, 4365, Manguinhos, Rio de Janeiro, RJ 21040-361, Brasil. E-mail: edwards.teixeira@ioc.fiocruz.br We verified the prevalence of hemoparasites in 40 cattle with ages varying from one month to 12 years old, in two farms of the Municipality of Palma, Minas Gerais state, Brazil. Two blood smear samples were collected from each animal: one from the tail tip and another from the ear tip. The smears were fixed, stained and observed under 100X lighted microscope magnifying glass. Twenty- -seven out of 40 animals studied (67.5% had at least one species of hemoparasite. Among these, 21 (52.5% were infected with Babesia spp., 10 (25% with Anaplasma marginale and four (10% parasitized with both hemoparasites. The studied region is potentially enzootic for the detected parasites and there is high risk for clinical cases of tick-borne disease. Both anatomic points, tail and ear tips, are good spots for blood collection and smear confection for hemoparasite investigation.

  19. Molecular detection and characterization of Babesia bovis, Babesia bigemina, Theileria species and Anaplasma marginale isolated from cattle in Kenya.

    Science.gov (United States)

    Adjou Moumouni, Paul Franck; Aboge, Gabriel Oluga; Terkawi, Mohamad Alaa; Masatani, Tatsunori; Cao, Shinuo; Kamyingkird, Ketsarin; Jirapattharasate, Charoonluk; Zhou, Mo; Wang, Guanbo; Liu, Mingming; Iguchi, Aiko; Vudriko, Patrick; Ybanez, Adrian Patalinghug; Inokuma, Hisashi; Shirafuji-Umemiya, Rika; Suzuki, Hiroshi; Xuan, Xuenan

    2015-09-30

    Infections with Babesia bovis, Babesia bigemina, Theileria species and Anaplasma marginale are endemic in Kenya yet there is a lack of adequate information on their genotypes. This study established the genetic diversities of the above tick-borne hemoparasites infecting cattle in Kenya. Nested PCR and sequencing were used to determine the prevalence and genetic diversity of the above parasites in 192 cattle blood samples collected from Ngong and Machakos farms. B. bovis spherical body protein 4, B. bigemina rhoptry-associated protein 1a, A. marginale major surface protein 5, Theileria spp. 18S rRNA, T. parva p104 and T. orientalis major piroplasm surface protein were used as the marker genes. B. bovis, B. bigemina, T. parva, T. velifera, T. taurotragi, T. mutans and A. marginale were prevalent in both farms, whereas T. ovis, Theileria sp. (buffalo) and T. orientalis were found only in Ngong farm. Co-infections were observed in more than 50 % of positive samples in both farms. Babesia parasites and A. marginale sequences were highly conserved while T. parva and T. orientalis were polymorphic. Cattle-derived T. parva was detected in Machakos farm. However, cattle and buffalo-derived Theileria were detected in Ngong farm suggesting interactions between cattle and wild buffaloes. Generally, the pathogens detected in Kenya were genetically related to the other African isolates but different from the isolates in other continents. The current findings reaffirm the endemicity and co-infection of cattle with tick-borne hemoparasites, and the role of wildlife in pathogens transmission and population genetics in Kenya.

  20. Molecular detection and genetic diversity of bovine Babesia spp., Theileria orientalis, and Anaplasma marginale in beef cattle in Thailand.

    Science.gov (United States)

    Jirapattharasate, Charoonluk; Adjou Moumouni, Paul Franck; Cao, Shinuo; Iguchi, Aiko; Liu, Mingming; Wang, Guanbo; Zhou, Mo; Vudriko, Patrick; Efstratiou, Artemis; Changbunjong, Tanasak; Sungpradit, Sivapong; Ratanakorn, Parntep; Moonarmart, Walasinee; Sedwisai, Poonyapat; Weluwanarak, Thekhawet; Wongsawang, Witsanu; Suzuki, Hiroshi; Xuan, Xuenan

    2017-02-01

    Babesia spp., Theileria orientalis, and Anaplasma marginale are significant tick-borne pathogens that affect the health and productivity of cattle in tropical and subtropical areas. In this study, we used PCR to detect the presence of Babesia bovis, Babesia bigemina, and T. orientalis in 279 beef cattle from Western Thailand and A. marginale in 608 beef cattle from the north, northeastern, and western regions. The PCRs were performed using species-specific primers based on the B. bovis spherical body protein 2 (BboSBP2), B. bigemina rhoptry-associated protein 1a (BbiRAP-1a), T. orientalis major piroplasm surface protein (ToMPSP), and A. marginale major surface protein 4 (AmMSP4) genes. To determine the genetic diversity of the above parasites, amplicons of B. bovis and B. bigemina ITS1-5.8s rRNA gene-ITS2 regions (B. bovis ITS, B. bigemina ITS), ToMPSP, and AmMSP4 genes were sequenced for phylogenetic analysis. PCR results revealed that the prevalence of B. bovis, B. bigemina, T. orientalis, and A. marginale in the Western region was 11.1, 12.5, 7.8, and 39.1 %, respectively. Coinfections of two or three parasites were observed in 17.9 % of the animals sampled. The study revealed that the prevalence of A. marginale in the western region was higher than in the north and northeastern regions (7 %). Sequence analysis showed the BboSBP2 gene to be more conserved than B. bovis ITS in the different isolates and, similarly, the BbiRAP-1a was more conserved than B. bigemina ITS. In the phylogenetic analysis, T. orientalis MPSP sequences were classified into types 3, 5, and 7 as previously reported. A. marginale MSP4 gene sequences shared high identity and similarity with each other and clustered with isolates from other countries. This study provides information on the prevalence and genetic diversity of tick-borne pathogens in beef cattle and highlights the need for effective strategies to control these pathogens in Thailand.

  1. Subdominant Outer Membrane Antigens in Anaplasma marginale: Conservation, Antigenicity, and Protective Capacity Using Recombinant Protein.

    Directory of Open Access Journals (Sweden)

    Deirdre R Ducken

    Full Text Available Anaplasma marginale is a tick-borne rickettsial pathogen of cattle with a worldwide distribution. Currently a safe and efficacious vaccine is unavailable. Outer membrane protein (OMP extracts or a defined surface protein complex reproducibly induce protective immunity. However, there are several knowledge gaps limiting progress in vaccine development. First, are these OMPs conserved among the diversity of A. marginale strains circulating in endemic regions? Second, are the most highly conserved outer membrane proteins in the immunogens recognized by immunized and protected animals? Lastly, can this subset of OMPs recognized by antibody from protected vaccinates and conserved among strains recapitulate the protection of outer membrane vaccines? To address the first goal, genes encoding OMPs AM202, AM368, AM854, AM936, AM1041, and AM1096, major subdominant components of the outer membrane, were cloned and sequenced from geographically diverse strains and isolates. AM202, AM936, AM854, and AM1096 share 99.9 to 100% amino acid identity. AM1041 has 97.1 to 100% and AM368 has 98.3 to 99.9% amino acid identity. While all four of the most highly conserved OMPs were recognized by IgG from animals immunized with outer membranes, linked surface protein complexes, or unlinked surface protein complexes and shown to be protected from challenge, the highest titers and consistent recognition among vaccinates were to AM854 and AM936. Consequently, animals were immunized with recombinant AM854 and AM936 and challenged. Recombinant vaccinates and purified outer membrane vaccinates had similar IgG and IgG2 responses to both proteins. However, the recombinant vaccinates developed higher bacteremia after challenge as compared to adjuvant-only controls and outer membrane vaccinates. These results provide the first evidence that vaccination with specific antigens may exacerbate disease. Progressing from the protective capacity of outer membrane formulations to

  2. Anaplasma marginale attenuated by irradiation, its potential use as vaccine

    International Nuclear Information System (INIS)

    Gil, A.; Pupiales, N.; Castro, J.; Higuera, B.; Orrego, J.

    1986-01-01

    Five groups of 5 calves each were inoculated: group 1 (control) with 5 x 10 8 non-irradiated parasites (day 0) and group 2 with the same dose of irradiated (900 Gy) parasites on day 0. Both groups showed clinical signs of the infection, although group 2 was less severely affected. On day 41 group 3 was inoculated with blood (1 x 10 9 parasites) from an animal in group 2. These parasites were irradiated again (900 Gy) prior to inoculation. On day 59 group 4 was inoculated with blood (1 x 10 9 parasites) from the same animal in group 2. This inoculum was irradiated a second time (900 Gy) and the cells were washed and culture ''IN VITRO'' for 4 days prior to inoculation. Parasitaemia increased abruptly in group 3 (peak = 25%) concomitant with a sudden drop in hematocrit. Two animals died, the others required treatment. Group 4 had a transient and low parasitaemia (peak = 2%) and normal hematocrit values. On day 201 all animals including a new control (group 5) of 5 animals, were inoculated with 2 x 10 9 heterologous parasites. All 5 control animals reached 20% parasitaemia and averaged a -40% hematocrit decrease when treated. In contrast, the remaining animals had from -20% to normal hematocrit values and from 5.6% to non-detectable parasitaemias. All inoculated calves showed high antibody titers which increased once the parasitaemia was overcome, and after challenge. It appears that two (900 Gy) irradiations effectively attenuated A. marginale, conferring an active and long lasting protection. However, inoculum cells had to be washed and cultured to prevent hemolitic shock

  3. Immune response of calves inoculated with proteins ofAnaplasma marginale bound to an immunostimulant complex

    Directory of Open Access Journals (Sweden)

    Marcela Ribeiro Gasparini

    Full Text Available Despite our current knowledge of the immunology, pathology, and genetics of Anaplasma marginale, prevention in cattle is currently based on old standbys, including live attenuated vaccines, antibiotic treatment, and maintaining enzootic stability in cattle herds. In the present study, we evaluated the use of an immunostimulant complex (ISCOMATRIX adjuvant, associated with a pool of recombinant major surface proteins (rMSP1a, rMSP1b, rMSP4 and rMSP5 to improve the humoral immune response triggered in calves mainly by IgG2. Ten calves were divided in three groups: 4 calves were inoculated with the ISCOMATRIX/rMSPs (G1; 2 calves were inoculated with ISCOMATRIX adjuvant (G2; and 4 calves received saline (G3. Three inoculations were administered at 21-day intervals. In G1, the calves showed significant increases in total IgG, IgG1 and IgG2 levels 21 days after the second inoculation, compared to the control group (p < 0.05, and G1 calves remained above the cut-off value 28 days after the third inoculation (p < 0.05. The post-immunized sera from calves in G1 reacted specifically for each of the rMSPs used. In conclusion, the ISCOMATRIX/rMSPs induced antigen-specific seroconversion in calves. Therefore, additional testing to explore the protection induced by rMSPs, both alone and in conjunction with proteins previously identified as subdominant epitopes, is warranted.

  4. Antigenic variation of Anaplasma marginale msp2 occurs by combinatorial gene conversion.

    Science.gov (United States)

    Brayton, Kelly A; Palmer, Guy H; Lundgren, Anna; Yi, Jooyoung; Barbet, Anthony F

    2002-03-01

    The rickettsial pathogen Anaplasma marginale establishes lifelong persistent infection in the mammalian reservoir host, during which time immune escape variants continually arise in part because of variation in the expressed copy of the immunodominant outer membrane protein MSP2. A key question is how the small 1.2 Mb A. marginale genome generates sufficient variants to allow long-term persistence in an immunocompetent reservoir host. The recombination of whole pseudogenes into the single msp2 expression site has been previously identified as one method of generating variants, but is inadequate to generate the number of variants required for persistent infection. In the present study, we demonstrate that recombination of a whole pseudogene is followed by a second level of variation in which small segments of pseudogenes recombine into the expression site by gene conversion. Evidence for four short sequential changes in the hypervariable region of msp2 coupled with the identification of nine pseudogenes from a single strain of A. marginale provides for a combinatorial number of possible expressed MSP2 variants sufficient for lifelong persistence.

  5. Comparação entre diversos antígenos para o diagnóstico de Anaplasma marginale por ELISA Comparison between several antigens for diagnosis of Anaplasma marginale by ELISA

    Directory of Open Access Journals (Sweden)

    Carlos A.N. Ramos

    2010-01-01

    Full Text Available Anaplasmose bovina é uma doença com grande importância nas regiões tropicais e subtropicais do mundo por determinar perdas econômicas devido à mortalidade e redução da produtividade. É causada por Anaplasma marginale, uma riquétsia intraeritrocítica obrigatória cujo controle requer, além de uma vacina eficiente, uma acurada identificação de bovinos cronicamente infectados. Apesar de existirem atualmente diversos métodos de diagnóstico dessa riquétsia, os métodos sorológicos, em particular o ensaio de imunoadsorção enzimática-ELISAs, são os mais utilizados devido à sua versatilidade e praticidade. No entanto, devido ao grande número de antígenos disponíveis, atualmente torna-se necessária uma avaliação para definir quais antígenos apresentam um melhor desempenho no diagnóstico da anaplasmose. Soros de bovinos positivos e negativos para A. marginale por PCR, e soros de animais provenientes do Brasil e Costa Rica, foram testados em ELISAs baseados em MSP1a, MSP2 e MSP5 recombinantes, um pool das três proteínas recombinantes, e antígeno de lisado de corpúsculos iniciais da riquétsia (CI. Utilizando soro de bovinos positivos para A. marginale por PCR, uma maior sensibilidade foi observada no ELISA CI. No entanto, uma maior especificidade, com soro de bovinos negativos a PCR, foi observada com os ELISAs recombinantes. O porcentual de bovinos positivos do Brasil e Costa Rica foi maior com ELISA CI. Razões para essas diferenças são discutidas.Bovine anaplasmosis is a major disease in tropical and subtropical regions of the world by determine economical loss due mortality and productive reduction. The disease is caused by Anaplasma marginale, an intraerythrocytic rickettsia whose control requires, besides an efficient vaccine, the accurate identification of chronically infected cattle. Although the existence of diverse methods of diagnosis of this rickettsia, the serological methods, in particular the enzyme

  6. Insights into mechanisms of bacterial antigenic variation derived from the complete genome sequence of Anaplasma marginale.

    Science.gov (United States)

    Palmer, Guy H; Futse, James E; Knowles, Donald P; Brayton, Kelly A

    2006-10-01

    Persistence of Anaplasma spp. in the animal reservoir host is required for efficient tick-borne transmission of these pathogens to animals and humans. Using A. marginale infection of its natural reservoir host as a model, persistent infection has been shown to reflect sequential cycles in which antigenic variants emerge, replicate, and are controlled by the immune system. Variation in the immunodominant outer-membrane protein MSP2 is generated by a process of gene conversion, in which unique hypervariable region sequences (HVRs) located in pseudogenes are recombined into a single operon-linked msp2 expression site. Although organisms expressing whole HVRs derived from pseudogenes emerge early in infection, long-term persistent infection is dependent on the generation of complex mosaics in which segments from different HVRs recombine into the expression site. The resulting combinatorial diversity generates the number of variants both predicted and shown to emerge during persistence.

  7. Identification of a vertically transmitted strain from Anaplasma marginale (UFMG3): Molecular and phylogenetic characterization, and evaluation of virulence.

    Science.gov (United States)

    Silvestre, Bruna T; Silveira, Júlia A G; Meneses, Rodrigo M; Facury-Filho, Elias J; Carvalho, Antônio U; Ribeiro, Múcio F B

    2016-02-01

    Bovine anaplasmosis is a disease caused by the intraerythrocytic rickettsia species Anaplasma marginale and results in great economic losses in tropical and subtropical regions. Vertical transmission is an important phenomenon that contributes to the persistence of different strains of the agent within the same herd. The identification of new strains and genetic characterization studies are essential to understanding their epidemiology and virulence and for vaccine development. The aim of this study was to perform molecular and phylogenetic characterizations of a new vertically transmitted strain from A. marginale and to evaluate its virulence by experimental inoculation of rickettsia-free calves. Thirty newborn Holstein calves were subjected to molecular tests for the detection of A. marginale, Babesia bovis and Babesia bigemina. Calves positive for A. marginale (n=3) were splenectomized and monitored for the clinical manifestations of anaplasmosis. Blood samples from one of the calves that presented rickettsemia of 42.8% and spontaneous recovery of clinical parameters were used for molecular and phylogenetic characterization (msp1a gene), and inoculum production was used for the evaluation of virulence. This strain was identified as UFMG3. Three tandem repeat forms (13 and MGI19) were identified from the analysis of the msp1a gene, in which the form MGI19 appeared twice. Analysis of these repeats revealed the presence of the sequences QASTSS and SSASGQQQESS and of aspartic acid (D) at position 20 of both repeats. Phylogenetic analysis showed a close relationship among the UFMG3, MGI19 and UFMG2 strains. For virulence evaluation, six Holstein calves were inoculated intravenously with 2×10(7)A. marginale UFMG3-infected erythrocytes. The calves showed maximum rickettsemia of 5.1%, a moderate decrease in packed cell volume and spontaneous recovery of clinical parameters without the need for treatment. The results of experimental inoculation suggest that the strain A

  8. Molecular identification of Anaplasma marginale in two autochthonous South American wild species revealed an identical new genotype and its phylogenetic relationship with those of bovines.

    Science.gov (United States)

    Guillemi, Eliana C; de la Fourniere, Sofía; Orozco, Marcela; Peña Martinez, Jorge; Correa, Elena; Fernandez, Javier; Lopez Arias, Ludmila; Paoletta, Martina; Corona, Belkis; Pinarello, Valérie; Wilkowsky, Silvina E; Farber, Marisa D

    2016-05-26

    Anaplasma marginale is a well-known cattle pathogen of tropical and subtropical world regions. Even though, this obligate intracellular bacterium has been reported in other host species different than bovine, it has never been documented in Myrmecophaga tridactyla (giant anteater) or Hippocamelus antisense (taruca), which are two native endangered species. Samples from two sick wild animals: a Myrmecophaga tridactyla (blood) and a Hippocamelus antisense (blood and serum) were studied for the presence of A. marginale DNA through msp5 gene fragment amplification. Further characterization was done through MSP1a tandem repeats analysis and MLST scheme and the genetic relationship among previously characterized A. marginale sequences were studied by applying, eBURST algorithm and AMOVA analysis. Anaplasma marginale DNA was identified in the Myrmecophaga tridactyla and Hippocamelus antisense samples. Through molecular markers, we identified an identical genotype in both animals that was not previously reported in bovine host. The analysis through eBURST and AMOVA revealed no differentiation between the taruca/anteater isolate and the bovine group. In the present publication we report the identification of A. marginale DNA in a novel ruminant (Hippocamelus antisense) and non-ruminant (Myrmecophaga tridactyla) host species. Genotyping analysis of isolates demonstrated the close relatedness of the new isolate with the circulation population of A. marginale in livestock. Further analysis is needed to understand whether these two hosts contribute to the anaplasmosis epidemiology.

  9. Uso de inóculo padronizado de Anaplasma marginale e da quimioprofilaxia no controle da anaplasmose bovina

    Directory of Open Access Journals (Sweden)

    Ribeiro M.F.B.

    2003-01-01

    Full Text Available O uso de inóculo homólogo padronizado de Anaplasma marginale foi comparado à prática de quimioprofilaxia com diidrato de oxitetraciclina na redução da riquetsemia e do volume globular (VG causada pela anaplasmose bovina. Os animais que receberam o inóculo (10(7 hemácias com Anaplasma marginaleapresentaram, ao serem desafiados em campo, riquetsemia média de 1,2% e redução média de VG de 23,0%, significativamente inferiores às do grupo-controle (P<0,05. No experimento de quimioprofilaxia os animais que receberam três doses de diidrato de oxitetraciclina (20mg/kg, com intervalos de 25 dias, apresentaram riquetsemia de 2,7% e redução de 36,3% no VG, significativamente inferiores às do grupo-controle (P<0,05. Ambas as medidas preventivas testadas foram eficientes na redução da intensidade da riquetsemia e na queda do VG.

  10. Genetic characterization of Anaplasma marginale strains from Tunisia using single and multiple gene typing reveals novel variants with an extensive genetic diversity.

    Science.gov (United States)

    Ben Said, Mourad; Ben Asker, Alaa; Belkahia, Hanène; Ghribi, Raoua; Selmi, Rachid; Messadi, Lilia

    2018-05-12

    Anaplasma marginale, which is responsible for bovine anaplasmosis in tropical and subtropical regions, is a tick-borne obligatory intraerythrocytic bacterium of cattle and wild ruminants. In Tunisia, information about the genetic diversity and the phylogeny of A. marginale strains are limited to the msp4 gene analysis. The purpose of this study is to investigate A. marginale isolates infecting 16 cattle located in different bioclimatic areas of northern Tunisia with single gene analysis and multilocus sequence typing methods on the basis of seven partial genes (dnaA, ftsZ, groEL, lipA, secY, recA and sucB). The single gene analysis confirmed the presence of different and novel heterogenic A. marginale strains infecting cattle from the north of Tunisia. The concatenated sequence analysis showed a phylogeographical resolution at the global level and that most of the Tunisian sequence types (STs) formed a separate cluster from a South African isolate and from all New World isolates and strains. By combining the characteristics of each single locus with those of the multi-loci scheme, these results provide a more detailed understanding on the diversity and the evolution of Tunisian A. marginale strains. Copyright © 2018 Elsevier GmbH. All rights reserved.

  11. Frequency of antibodies to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burdgorferi in cattle from the northeastern region of the state of Pará, Brazil Freqüência de anticorpos para Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax e Borrelia burgdorferi em bovinos do nordeste do Estado do Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Daniel S. Guedes Junior

    2008-06-01

    Full Text Available Babesiosis, anaplasmosis, and trypanosomosis are relevant diseases, potentially causing morbidity in cattle, leading to economic losses. Borreliosis is import as a potential zoonosis. The objective of this study was to determine, by indirect enzyme-linked immunosorbent assay (ELISA, the frequency of seropositive cattle to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burgdorferi in cattle from the Northeastern region of Pará, Brazil. Sera samples from 246 female adult cattle from municipalities of Castanhal and São Miguel do Guamá were used. Crude antigens ELISAs were used to detect antibodies to all agents, except to A. marginale, to which an indirect ELISA with recombinant major surface 1a protein (MSP1a antigen was used. Overall frequencies of seropositive animals were: B. bigemina - 99.2%; B. bovis - 98.8%; A. marginale - 68.3%; T. vivax - 93.1% and B. burgdorferi - 54.9%. The frequencies of seropositive cattle to B. bovis and B. bigemina suggest a high rate of transmission of these organisms by tick in the studied region, which can be classified as enzootically stable to these hemoprotozoans. The low frequency of seropositive cattle to A. marginale may be attributed to a lower sensitivity of the recombinant antigen ELISA utilized or a distinct rate of inoculation of this rickettsia by ticks, as compared with Babesia sp. transmission. The high frequency of seropositive cattle to T. vivax indicates that this hemoprotozoan is prevalent in herds from the Northeastern region of Pará. The rate of animal that showed homologues antibodies to B. burgdorferi indicates the presence of the tickborne spirochaetal agent in the cattle population in the studied region.A babesiose, a anaplasmose e a tripanossomose são enfermidades relevantes, potencialmente causadoras de morbidade em bovinos, levando a perdas econômicas. A borreliose assume importância como zoonose potencial. O objetivo desse estudo foi determinar

  12. Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System.

    Science.gov (United States)

    Zhang, Bing; Cavallaro, Antonio S; Mody, Karishma T; Zhang, Jun; Deringer, James R; Brown, Wendy C; Mahony, Timothy J; Yu, Chengzhong; Mitter, Neena

    2016-11-05

    Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale . Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris . When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm), 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

  13. Eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos naturalmente infectados por Anaplasma marginale

    Directory of Open Access Journals (Sweden)

    L.R. Alberton

    2015-08-01

    Full Text Available O agente de maior importância, em relação à anaplasmose bovina, é o Anaplasma marginale. Os principais sinais clínicos dessa enfermidade são anemia hemolítica, icterícia, dispneia, taquicardia, febre, fadiga, lacrimejamento, sialorreia, micção frequente, anorexia, perda de peso, aborto e morte. A terapia antimicrobiana é o principal protocolo terapêutico. O objetivo do presente trabalho foi avaliar a eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos leiteiros naturalmente infectados por Anaplasma marginale. Para isso, foram avaliados 48 zebuínos mestiços que apresentavam os sinais clínicos sugestivos da doença. Os animais foram submetidos à coleta de sangue para a realização de hemograma e à extração de DNA para a confirmação da presença de A. marginale, por meio da reação em cadeia pela polimerase (PCR. Os animais foram divididos em três grupos experimentais, para realização dos protocolos terapêuticos, utilizando-se dipropionato de imidocarb, oxitetraciclina e enrofloxacina. Trinta e seis animais (75% apresentaram reação positiva ao PCR. Os animais positivos não apresentaram diferenças significativas quanto ao hemograma e ao leucograma quando comparados com os negativos, no entanto os níveis de proteínas séricas foram inferiores nos animais positivos (P<0,05. Os três protocolos terapêuticos foram capazes de reduzir a infecção ao longo do tratamento (P<0,01, porém, após cinco dias de tratamento, a enrofloxacina apresentou maior efetividade em relação aos demais (P<0,01. Após o final do tratamento, nenhum protocolo foi capaz de eliminar totalmente a infecção pelo A. marginale em bovinos naturalmente infectados e manejados a campo.

  14. Prevalencia y detección por PCR anidada de Anaplasma marginale en bovinos y garrapatas en la zona central del Litoral ecuatoriano

    Directory of Open Access Journals (Sweden)

    Ariel Escobar Troya

    2015-09-01

    Full Text Available La bacteria que provoca la anaplasmosis en bovinos se conoce como Anaplasma marginale, es potencialmente transmitida de forma biológica por garrapatas, moscas y fómites o mediante sangre infectada como consecuencia del uso incorrecto de herramientas quirúrgicas. Hasta la fecha, Ecuador carece de estudios actualizados sobre procedimientos eficientes para el diagnóstico específico y, erradicación de A. marginale a través del control de estos insectos, por lo que resulta de gran importancia desarrollar e implementar trabajos relacionados con el uso de esta herramienta molecular, para la detección de la bacteria en vectores de transmisión que provocan la enfermedad en bovinos. En este trabajo, se extrajo ADN eficazmente con el método de Salting Out. Un total de 255 muestras fueron analizadas por PCR anidada, distribuidas del siguiente modo|108| Riphicephalus (Boophilus microplus, |85| bovinos, de estos el 13.46% y 85.48% dieron positivas para la rickettsia, las muestras de Amblyomma spp. |62| todas fueron negativas. El índice de concordancia Kappa |total de bovinos infestados frente a Riphicephalus (Boophilus microplus|, no fue significativo (0.28. Subsiguientemente, se determinó por χ2 (p=0.66 que la presencia o ausencia de la enfermedad es independiente del lugar de donde proviene el bovino.

  15. Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System

    Directory of Open Access Journals (Sweden)

    Bing Zhang

    2016-11-01

    Full Text Available Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale. Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris. When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm, 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

  16. Epitope-based vaccines with the Anaplasma marginale MSP1a functional motif induce a balanced humoral and cellular immune response in mice.

    Directory of Open Access Journals (Sweden)

    Paula S Santos

    Full Text Available Bovine anaplasmosis is a hemoparasitic disease that causes considerable economic loss to the dairy and beef industries. Cattle immunized with the Anaplasma marginale MSP1 outer membrane protein complex presents a protective humoral immune response; however, its efficacy is variable. Immunodominant epitopes seem to be a key-limiting factor for the adaptive immunity. We have successfully demonstrated that critical motifs of the MSP1a functional epitope are essential for antibody recognition of infected animal sera, but its protective immunity is yet to be tested. We have evaluated two synthetic vaccine formulations against A. marginale, using epitope-based approach in mice. Mice infection with bovine anaplasmosis was demonstrated by qPCR analysis of erythrocytes after 15-day exposure. A proof-of-concept was obtained in this murine model, in which peptides conjugated to bovine serum albumin were used for immunization in three 15-day intervals by intraperitoneal injections before challenging with live bacteria. Blood samples were analyzed for the presence of specific IgG2a and IgG1 antibodies, as well as for the rickettsemia analysis. A panel containing the cytokines' transcriptional profile for innate and adaptive immune responses was carried out through qPCR. Immunized BALB/c mice challenged with A. marginale presented stable body weight, reduced number of infected erythrocytes, and no mortality; and among control groups mortality rates ranged from 15% to 29%. Additionally, vaccines have significantly induced higher IgG2a than IgG1 response, followed by increased expression of pro-inflammatory cytokines. This is a successful demonstration of epitope-based vaccines, and protection against anaplasmosis may be associated with elicitation of effector functions of humoral and cellular immune responses in murine model.

  17. Immune response and biochemistry of calves immunized with rMSP1a ( Anaplasma marginale using carbon nanotubes as carrier molecules

    Directory of Open Access Journals (Sweden)

    Bruna Torres Silvestre

    2018-05-01

    Full Text Available Abstract Vaccination against Anaplasma marginale has been considered an important control strategy for bovine anaplasmosis. Recently, mice immunized with rMSP1 a linked to carbon nanotubes (MWNT showed significant immune responses, generating a new possibility for use of an inactivated vaccine. The objective of this study was to investigate the cellular and humoral responses in calves immunized with MWNT+rMSP1a , associated with inactivated vaccine of A. marginale produced in vitro, and evaluate the toxic effects of the MWNT on renal and hepatic function. rMSP1a was covalently linked to MWNT. Inactivated vaccine (AmUFMG2 was produced by cultivating A. marginale in IDE8 cells. Twenty-four Holstein calves were divided (four groups and immunized subcutaneously with PBS and non-carboxylated MWNT (control, G1, AmUFMG2 (G2, MWNT+rMSP1a (G3, and AmUFMG2 with MWNT+rMSP1a (G4. Blood samples were collected for total leukocyte counts, biochemical profiling and evaluation of the cellular and humoral response. Immunization with MWNT+rMSP1a induced increase in the total number of leukocytes, NK cells, in the lymphocyte populations and higher levels of antibodies compared to calves immunized only with AmUFMG2. Furthermore, MWNT did not induce changes in the biochemical profile. These data indicate that MWNT+rMSP1a were able to induce the immune responses more efficiently than AmUFMG2 alone, without generating toxicity.

  18. Induced immune response of Escherichia coli BL21 expressing recombinant MSP1a and MSP1b proteins of Anaplasma marginale

    Directory of Open Access Journals (Sweden)

    Katia Tamekuni

    2009-11-01

    Full Text Available This work aims to evaluate the potential of immunization with E. coli BL21 expressing the recombinant rMSP1a and rMSP1b proteins of Anaplasma marginale. E. coli BL21 was transformed with recombinant plasmids pET102/msp1α and pET101/msp1β, and rMSP1a and rMSP1b were expressed after induction by IPTG. BALB/c mice were vaccinated with formolized BL21/rMSP1a and BL21/rMSP1b, and the production in mice sera of whole IgG was determined by ELISA. The mice immunized with BL21/rMSP1a showed a better humoral response for whole IgG when compared to the mice immunized with BL21/rMSP1b; these mice exhibited a small response after the second vaccination. Sera of mice immunized with BL21/rMSP1a reacted via western blot with BL21 and rMSP1a, with molecular masses varying from 70 to 105 kDa. Sera of mice immunized with BL21/rMSP1b reacted with BL21 and rMSP1b with a molecular mass of 100 kDa. These results demonstrate that BL21 containing rMSP1a and rMSP1b in the outer membrane were able to produce an immune response in mice, reinforcing its use in vaccine models against bovine anaplasmosis.Esse trabalho avaliou o potencial de imunização de Escherichia coli BL21 expressando as proteínas recombinantes rMSP1a e rMSP1b de Anaplasma marginale. A E. coli BL21 foi transformada com os plasmídios recombinantes pET102/msp1α e pET101/msp1β e as proteínas rMSP1a e rMSP1b foram expressas após indução com IPTG. Camundongos BALB/c foram vacinados com BL21/rMSP1a e BL21/rMSP1b formolisadas, e a produção de IgG total foi determinada pelo teste de ELISA nos soros dos camundongos imunizados. Os camundongos imunizados com a BL21/rMSP1a mostraram uma melhor resposta humoral para IgG total, comparada à resposta apresentada pelos camundongos imunizados com BL21/rMSP1b; estes camundongos exibiram uma menor resposta após a segunda vacinação. Soros de camundongos imunizados BL21/rMSP1a reagiram pelo western blot com BL21 e rMSP1a, com massa molecular variando de 70 a

  19. Functional and Immunological Relevance of Anaplasma marginale Major Surface Protein 1a Sequence and Structural Analysis

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Passos, L.M.F.; Lis, K.; Kenneil, R.; Valdés, James J.; Ferrolho, J.; Tonk, Miray; Pohl, A.E.; Grubhoffer, Libor; Zweygarth, E.; Shkap, V.; Ribeiro, M.F.B.; Estrada-Pena, A.; Kocan, K.M.; de la Fuente, J.

    2013-01-01

    Roč. 8, č. 6 (2013), e65243 E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 238511 - POSTICK Institutional support: RVO:60077344 Keywords : CD4(+) T-lymphocytes * B-cell epitopes * salivary glands Subject RIV: EC - Immunology Impact factor: 3.534, year: 2013

  20. Caracterização da imunogenicidade das proteínas recombinantes Virb9, Virb10 e fator termo instável de Elongação de Peptídeos de Anaplasma marginale em camundongos

    Directory of Open Access Journals (Sweden)

    Ana Beatriz Canevari Castelão

    2012-10-01

    Full Text Available Considerando as limitações dos atuais métodos de controle contra a anaplasmose bovina, o desenvolvimento de uma vacina efetiva se faz necessário. A partir do advento da análise genômica e proteômica, novas proteínas de membrana de Anaplasma marginale foram identificadas como possíveis candidatas a componentes de uma vacina, tais como, VirB9,VirB10 e Fator Termo Instavél de Elongação de Peptídeos (EF-Tu. Embora estas proteínas ainda não estejam bem caracterizadas na membrana de A. marginale, a produção destas na forma recombinante (rVirB 9, rVirB10 e rEF-Tutem sido realizada, mas as mesmas ainda não foram exploradas em formulações vacinais. Neste trabalho, avaliou-se ouso de rVirB9, rVirB10 e rEF-Tu emulsionadas em adjuvante Montanide em camundongos. Nas condições testadas, verificou-se a indução de forte resposta imune humoral com a produção de IgG1 e IgG2a, sendo que as proporções dos níveis de produção destas subclasses indicam predomínio de IgG1. Entretanto, esplenócitos de animais, que foram injetados com rVirB9 ou rVirB10, produziram interferon-gama acima do limite de detecção do ensaio após estimulação in vitro, sinalizando assim resposta celular específica. Assim, novas avaliações serão realizadas com a finalidade de modular o perfil de resposta imune obtido em bovinos e avaliar a proteção contra A. marginale.

  1. Frequency of Anaplasma marginale (Theiler 1910 and Babesia sp in mestizo bovine Zebu, in the Municipality of Ixiamas county Abel Iturralde Department of The La Paz, Bolivia

    Directory of Open Access Journals (Sweden)

    Mercado Alvaro

    2011-08-01

    Full Text Available The present work one carries out in the Municipality of Ixiamas County Abel Iturralde of the department of Peace-Bolivia, between May and August of 2010. The objective was to determine the presence of Anaplama sp and Babesia sp, through sanguine smear, they took 160 samples of blood, 40 bovine of the four areas they have been evaluated. The results indicate the presence of Anaplasma sp 6,90%, 6,20% in females and 9,70% in males, this represents 2,50% for the area TO, 5,00% area B, 17,50% area C and 2,50% area D. According to the category 12,50% in calves, 0,00% in torillos, 4,80% in bulls, 6,20% in cows and 14,30% in heifers. The presence of Babesia sp 3,13%, with relationship to the sex 3,10% in females and 3,22% in males, being observed 2,50% in the area TO, 5,00% in the area B, 5,00% in the area C and 0,00% in the area D, according to the category 0,00% in calves, torillos 4,80% bulls, 2,73% vacates and 7,14% in heifers.

  2. Effect of milk production system on the enzootic stability to Anaplasma marginale and Babesia bovis in calves in the Campo das Vertentes region of Minas Gerais state, BrazilEfeito do sistema de produção de leite sobre a estabilidade enzoótica para Anaplasma marginale e Babesia bovis em bezerras na região do Campo das Vertentes de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães Rocha

    2012-04-01

    Full Text Available We conducted a cross-sectional observational study, in order to determine the frequency of anti-A. marginale and anti-B. bovis antibodies in calves from four to 12 months of age from ten farms that producing B type milk and an equal number that produce raw milk refrigerated, located in the Campo das Vertentes region of Minas Gerais state, in the period September 2008 to August 2009. Blood smears were performed, serologic testing by indirect immunofluorescence technique (IFAT, given the packed cell volume, rickettsemia, and the clinical scores of animals infected by A. marginale. In the farms that produce B type milk, the overall average frequency of seropositive calves was 94.47% (166/176 and 89.20% (157/176 for A. marginale and B. bovis, respectively. Already on the farms that produce raw milk refrigerated, the overall average frequency of A. marginale was 92.59% (149/161 and for B. bovis from 86.30% (139/161, and there was no significant difference (p > 0.05 in the frequency of calves infected for both hemoparasitic between the two systems of milk production. Statistically significant (p 0.05 among calves from properties that produce B type milk and raw milk refrigerated. The results of this study indicate that, in the Campos das Vertentes region of Minas Gerais, the production system does not interfere with the enzootic stability for A. marginale and B. bovis in calves from dairy farms B milk or raw milk refrigerated, with low probability of anaplasmosis and/or babesiosis in adults animals.Foi realizado um estudo observacional do tipo transversal, com o objetivo de determinar a frequência de anticorpos anti-A. marginale e B. bovis em 337 bezerras com idade entre quatro a 12 meses, oriundas de dez propriedades produtoras de leite B e igual número de fazendas de leite cru refrigerado (leite C, na região do Campo das Vertentes de Minas Gerais, no período de setembro de 2008 a agosto de 2009. Foram realizados esfregaços sangu

  3. Validation of an improved anaplasma antibody cELISA kit for detection of anaplasma ovis antibody in domestic sheep at the U.S. Sheep Experiment Station in Dubois, ID

    Science.gov (United States)

    An accurate and simple-to-perform new version of a competitive ELISA (cELISA) kit that became commercially available in 2015 for testing of cattle for antibody to Anaplasma marginale was validated for detection of Anaplasma ovis antibody in domestic sheep. True positives and negatives were identifie...

  4. Diversidad genética de la región variable de los genes msp1a y msp4 en cepas de Anaplasma marginale de México

    Directory of Open Access Journals (Sweden)

    Rafael Jiménez Ocampo

    2012-01-01

    Full Text Available La anaplasmosis es de difícil control debido a la diversidad genética de la rickettsia. La proteína Msp1a, compuesta de repetidos variables de entre 23 y 31 aminoácidos en su región variable y la proteína Msp4, son dos de las proteínas de superficie más estudiadas en A. marginale y han sido ampliamente usadas como marcadores genéticos en la caracterización de cepas de A. marginale de diferentes orígenes geográficos. En este trabajo se analizaron, la región variable de la proteína Msp1a y la proteína Msp4 de 10 cepas mexicanas. En el caso de Msp1a, se observó un patrón de segregación que contiene los repetidos (alpha, beta, beta, gama en diferentes modalidades a lo largo de aislamientos del Golfo de México, principalmente en zonas de estabilidad enzoótica, mientras que la máxima variabilidad se presentó en Tamaulipas, en aislamientos de un brote de la enfermedad, es decir en zonas de inestabilidad. La diversidad observada no es tan extensa como se esperaba y, misma que se puede explicar por la presión que el sistema inmune del hospedero ejerce contra la rickettsia y los mecanismos de esta última para evadirla. En el caso de la proteína Msp4, la secuencia fue altamente conservada tanto en nucleótidos como en aminoácidos para los aislados en estudio, aunque, se observan diferencias con lo previamente reportado en México para este marcador.

  5. Anaplasma ovis genetic diversity detected by major surface protein 1a and its prevalence in small ruminants.

    Science.gov (United States)

    Aktas, Munir; Özübek, Sezayi

    2018-04-01

    Anaplasma ovis is a widely distributed tick-borne rickettsial pathogen of sheep, goats, and wild ruminants. The aims of this study were to assess the prevalence, associations of Anaplasma ovis in sheep and goats, as well as its genetic diversity based on analysis of the msp1α gene. A total of 416 DNA samples from sheep (n = 236) and goats (n = 180) from four provinces in southeastern Turkey were analyzed by PCR. The overall A. ovis prevalence was 18% (CI 14.4-22.1). The infection rates of A. ovis varied from 15.9% to 21.8% in sampled provinces, and they were not significantly different. There was no difference between Anaplasma ovis infection in sheep (20.3%, CI 15.4-26.0) and goats (15.0%, CI 10.1-21.1) or in infection rate of animals 1 year (16.4%, CI 12.4-21.2). A significant association between A. ovis infection and the presence of Rhipicephalus bursa and Rhipicephalus turanicus was observed (P diversity of A. ovis were found in small ruminants in Turkey. Copyright © 2018 Elsevier B.V. All rights reserved.

  6. Molecular Epidemiological Survey and Genetic Characterization of Anaplasma Species in Mongolian Livestock.

    Science.gov (United States)

    Ochirkhuu, Nyamsuren; Konnai, Satoru; Odbileg, Raadan; Murata, Shiro; Ohashi, Kazuhiko

    2017-08-01

    Anaplasma species are obligate intracellular rickettsial pathogens that cause great economic loss to the animal industry. Few studies on Anaplasma infections in Mongolian livestock have been conducted. This study examined the prevalence of Anaplasma marginale, Anaplasma ovis, Anaplasma phagocytophilum, and Anaplasma bovis by polymerase chain reaction assay in 928 blood samples collected from native cattle and dairy cattle (Bos taurus), yaks (Bos grunniens), sheep (Ovis aries), and goats (Capra aegagrus hircus) in four provinces of Ulaanbaatar city in Mongolia. We genetically characterized positive samples through sequencing analysis based on the heat-shock protein groEL, major surface protein 4 (msp4), and 16S rRNA genes. Only A. ovis was detected in Mongolian livestock (cattle, yaks, sheep, and goats), with 413 animals (44.5%) positive for groEL and 308 animals (33.2%) positive for msp4 genes. In the phylogenetic tree, we separated A. ovis sequences into two distinct clusters based on the groEL gene. One cluster comprised sequences derived mainly from sheep and goats, which was similar to that in A. ovis isolates from other countries. The other divergent cluster comprised sequences derived from cattle and yaks and appeared to be newly branched from that in previously published single isolates in Mongolian cattle. In addition, the msp4 gene of A. ovis using same and different samples with groEL gene of the pathogen demonstrated that all sequences derived from all animal species, except for three sequences derived from cattle and yak, were clustered together, and were identical or similar to those in isolates from other countries. We used 16S rRNA gene sequences to investigate the genetically divergent A. ovis and identified high homology of 99.3-100%. However, the sequences derived from cattle did not match those derived from sheep and goats. The results of this study on the prevalence and molecular characterization of A. ovis in Mongolian livestock can facilitate

  7. Epidemiology of Babesia, Anaplasma and Trypanosoma species using a new expanded reverse line blot hybridization assay.

    Science.gov (United States)

    Paoletta, Martina Soledad; López Arias, Ludmila; de la Fournière, Sofía; Guillemi, Eliana Carolina; Luciani, Carlos; Sarmiento, Néstor Fabián; Mosqueda, Juan; Farber, Marisa Diana; Wilkowsky, Silvina Elizabeth

    2018-02-01

    Vector-borne hemoparasitic infections are a major problem that affects livestock industries worldwide, particularly in tropical and subtropical regions. In this work, a reverse line blot (RLB) hybridization assay was developed for the simultaneous detection and identification of Anaplasma, Babesia and bovine trypanosomes, encompassing in this way the most relevant hemoparasites that affect cattle. A total of 186 bovine blood samples collected from two different ecoepidemiological regions of northeast Argentina, with and without tick control, were analyzed with this new RLB. High diversity of parasites, such as Babesia bovis, B. bigemina, Anaplasma marginale and three different Trypanosoma species, was found. High rates of coinfections were also detected, and significant differences were observed not only in the prevalence of parasites but also in the level of coinfections between the two analyzed areas. Regarding the Trypanosoma genus, we provide molecular evidence of the presence of T. vivax and T. theileri for the first time in Argentina. Besides, since the RLB is a prospective tool, it allowed the identification of a yet unknown bovine trypanosome which could not be assigned to any of the bovine species known so far. In the present study we provide new insights on the prevalence of several pathogens that directly impact on livestock production in Argentina. The RLB assay developed here allows to identify simultaneously numerous pathogenic species which can also be easily expanded to detect other blood borne pathogens. These characteristics make the RLB hybridization assay an essential tool for epidemiological survey of all vector-borne pathogens. Copyright © 2017 Elsevier GmbH. All rights reserved.

  8. Spatio-temporal variations and genetic diversity of Anaplasma spp. in cattle from the North of Tunisia.

    Science.gov (United States)

    Belkahia, Hanène; Ben Said, Mourad; El Mabrouk, Narjesse; Saidani, Mariem; Cherni, Chayma; Ben Hassen, Mariem; Bouattour, Ali; Messadi, Lilia

    2017-09-01

    In cattle, anaplasmosis is a tick-borne rickettsial disease caused by Anaplasma marginale, A. centrale, A. phagocytophilum, and A. bovis. To date, no information concerning the seasonal dynamics of single and/or mixed infections by different Anaplasma species in bovines are available in Tunisia. In this work, a total of 1035 blood bovine samples were collected in spring (n=367), summer (n=248), autumn (n=244) and winter (n=176) from five different governorates belonging to three bioclimatic zones from the North of Tunisia. Molecular survey of A. marginale, A. centrale and A. bovis in cattle showed that average prevalence rates were 4.7% (minimum 4.1% in autumn and maximum 5.6% in summer), 7% (minimum 3.9% in winter and maximum 10.7% in autumn) and 4.9% (minimum 2.7% in spring and maximum 7.3% in summer), respectively. A. phagocytophilum was not detected in all investigated cattle. Seasonal variations of Anaplasma spp. infection and co-infection rates in overall and/or according to each bioclimatic area were recorded. Molecular characterization of A. marginale msp4 gene indicated a high sequence homology of revealed strains with A. marginale sequences from African countries. Alignment of 16S rRNA A. centrale sequences showed that Tunisian strains were identical to the vaccine strain from several sub-Saharan African and European countries. The comparison of the 16S rRNA sequences of A. bovis variants showed a perfect homology between Tunisian variants isolated from cattle, goats and sheep. These present data are essential to estimate the risk of bovine anaplasmosis in order to develop integrated control policies against multi-species pathogen communities, infecting humans and different animal species, in the country. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Anaplasma spp. in dogs and owners in north-western Morocco.

    Science.gov (United States)

    Elhamiani Khatat, Sarah; Daminet, Sylvie; Kachani, Malika; Leutenegger, Christian M; Duchateau, Luc; El Amri, Hamid; Hing, Mony; Azrib, Rahma; Sahibi, Hamid

    2017-04-24

    Anaplasma phagocytophilum is an emerging tick-borne zoonotic pathogen of increased interest worldwide which has been detected in northern Africa. Anaplasma platys is also present in this region and could possibly have a zoonotic potential. However, only one recent article reports on the human esposure to A. phagocytophilum in Morocco and no data are available on canine exposure to both bacteria. Therefore, we conducted a cross-sectional epidemiological study aiming to assess both canine and human exposure to Anaplasma spp. in Morocco. A total of 425 dogs (95 urban, 160 rural and 175 working dogs) and 11 dog owners were sampled from four cities of Morocco. Canine blood samples were screened for Anaplasma spp. antibodies by an enzyme-linked immunosorbent assay (ELISA) and for A. phagocytophilum and A. platys DNA by a real-time polymerase chain reaction (RT-PCR) targeting the msp2 gene. Human sera were tested for specific A. phagocytophilum immunoglobulin G (IgG) using a commercial immunofluorescence assay (IFA) kit. Anaplasma spp. antibodies and A. platys DNA were detected in 21.9 and 7.5% of the dogs, respectively. Anaplasma phagocytophilum DNA was not amplified. Anaplasma platys DNA was significantly more frequently amplified for working dogs. No statistically significant differences in the prevalence of Anaplasma spp. antibodies or A. platys DNA detection were observed between sexes, age classes or in relation to exposure to ticks. A total of 348 Rhipicephalus sanguineus (sensu lato) ticks were removed from 35 urban and working dogs. The majority of dog owners (7/10) were seroreactive to A. phagoyctophilum IgG (one sample was excluded because of hemolysis). This study demonstrates the occurrence of Anaplasma spp. exposure and A. platys infection in dogs, and A. phagocytophilum exposure in humans in Morocco.

  10. Detection and phylogenetic characterisation of novel Anaplasma and Ehrlichia species in Amblyomma triguttatum subsp. from four allopatric populations in Australia.

    Science.gov (United States)

    Gofton, Alexander W; Waudby, Helen P; Petit, Sophie; Greay, Telleasha L; Ryan, Una M; Irwin, Peter J

    2017-08-01

    Anaplasma and Ehrlichia spp. are tick-borne pathogens that can cause severe disease in domestic animals, and several species are responsible for emerging zoonoses in the northern hemisphere. Until recently, the only members of these genera reported in Australia (A. marginale, A. centrale, and A. platys) were introduced from other continents, through the importation of domestic animals and their associated ticks. However, unique Anaplasma and Ehrlichia 16S rRNA gene sequences were recently detected for the first time in native Australian ticks, particularly in Amblyomma triguttatum subsp. ticks from southwest Western Australia (WA). We used molecular techniques to survey Am. triguttatum subsp. ticks from four allopatric populations in southern and western Australia for Anaplasma and Ehrlichia species, and described here the phylogeny of these novel organisms. An A. bovis variant (genotype Y11) was detected in ticks from two study sites; Yanchep National Park (12/280, 4.3%) and Barrow Island (1/69, 1.4%). Phylogenetic analysis of 16S rRNA and groEL gene sequences concluded that A. bovis genotype Y11 is a unique genetic variant, distinct from other A. bovis isolates worldwide. Additionally, a novel Ehrlichia species was detected in Am. triguttatum subsp. from three of the four study sites; Yanchep National Park (18/280, 6.4%), Bungendore Park (8/46, 17.4%), and Innes National Park (9/214, 4.2%), but not from Barrow Island. Phylogenetic analysis of 16S, groEL, gltA, and map1 gene sequences revealed that this Ehrlichia sp. is most closely related to, but clearly distinct from, E. ruminantium and Ehrlichia sp. Panola Mountain. We propose to designate this new species 'Candidatus Ehrlichia occidentalis'. Anaplasma bovis genotype Y11 and 'Candidatus E. occidentalis' are the first Anaplasma and Ehrlichia species to be recorded in native Australian ticks. Copyright © 2017 Elsevier GmbH. All rights reserved.

  11. Molecular biological identification of Babesia, Theileria, and Anaplasma species in cattle in Egypt using PCR assays, gene sequence analysis and a novel DNA microarray.

    Science.gov (United States)

    El-Ashker, Maged; Hotzel, Helmut; Gwida, Mayada; El-Beskawy, Mohamed; Silaghi, Cornelia; Tomaso, Herbert

    2015-01-30

    In this preliminary study, a novel DNA microarray system was tested for the diagnosis of bovine piroplasmosis and anaplasmosis in comparison with microscopy and PCR assay results. In the Dakahlia Governorate, Egypt, 164 cattle were investigated for the presence of piroplasms and Anaplasma species. All investigated cattle were clinically examined. Blood samples were screened for the presence of blood parasites using microscopy and PCR assays. Seventy-one animals were acutely ill, whereas 93 were apparently healthy. In acutely ill cattle, Babesia/Theileria species (n=11) and Anaplasma marginale (n=10) were detected. Mixed infections with Babesia/Theileria spp. and A. marginale were present in two further cases. A. marginale infections were also detected in apparently healthy subjects (n=23). The results of PCR assays were confirmed by DNA sequencing. All samples that were positive by PCR for Babesia/Theileria spp. gave also positive results in the microarray analysis. The microarray chips identified Babesia bovis (n=12) and Babesia bigemina (n=2). Cattle with babesiosis were likely to have hemoglobinuria and nervous signs when compared to those with anaplasmosis that frequently had bloody feces. We conclude that clinical examination in combination with microscopy are still very useful in diagnosing acute cases of babesiosis and anaplasmosis, but a combination of molecular biological diagnostic assays will detect even asymptomatic carriers. In perspective, parallel detection of Babesia/Theileria spp. and A. marginale infections using a single microarray system will be a valuable improvement. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

  12. Alpha proteobacteria of genus Anaplasma (Rickettsiales: Anaplasmataceae): Epidemiology and characteristics of Anaplasma species related to veterinary and public health importance.

    Science.gov (United States)

    Atif, Farhan Ahmad

    2016-05-01

    The Anaplasma species are important globally distributed tick-transmitted bacteria of veterinary and public health importance. These pathogens, cause anaplasmosis in domestic and wild animal species including humans. Rhipicephalus, Ixodes, Dermacentor and Amblyomma genera of ticks are the important vectors of Anaplasma. Acute anaplasmosis is usually diagnosed upon blood smear examination followed by antibodies and nucleic acid detection. All age groups are susceptible but prevalence increases with age. Serological cross-reactivity is one of the important issues among Anaplasma species. They co-exist and concurrent infections occur in animals and ticks in same geographic area. These are closely related bacteria and share various common attributes which should be considered while developing vaccines and diagnostic assays. Movement of susceptible animals from non-endemic to endemic regions is the major risk factor of bovine/ovine anaplasmosis and tick-borne fever. Tetracyclines are currently available drugs for clearance of infection and treatment in humans and animals. Worldwide vaccine is not yet available. Identification, elimination of reservoirs, vector control (chemical and biological), endemic stability, habitat modification, rearing of tick resistant breeds, chemotherapy and tick vaccination are major control measures of animal anaplasmosis. Identification of reservoirs and minimizing the high-risk tick exposure activities are important control strategies for human granulocytic anaplasmosis.

  13. The Life and Death of Anaplasma

    Centers for Disease Control (CDC) Podcasts

    Dr. Setu Vora, medical director of critical care and physician director of performance improvement at Backus Hospital in Norwich, Connecticut, reads his poem The Life and Death of Anaplasma and discusses the poem’s origins.

  14. Molecular and phylogenetic analysis of Anaplasma spp. in sheep and goats from six provinces of China.

    Science.gov (United States)

    Zhang, Yan; Lv, Yali; Zhang, Feifei; Zhang, Wenjing; Wang, Jinhong; Cui, Yanyan; Wang, Rongjun; Jian, Fuchun; Zhang, Longxian; Ning, Changshen

    2016-12-30

    Members of the genus Anaplasma are important emerging tick-borne pathogens in both humans and animals in tropical and subtropical areas. Here, we investigated the presence of Anaplasma spp. in 621 sheep and 710 goats from six provinces of China. Polymerase chain reaction (PCR) and DNA sequencing were conducted to determine the prevalence of Anaplasma (A.) phagocytophilum, A. ovis and A. bovis targeting the 16S ribosomal RNA or the major surface protein 4 gene. PCR revealed Anaplasma in 39.0% (240/621) of sheep and 45.5% (323/710) of goats. The most frequently detected species was A. ovis (88/621, 14.2% for sheep; 129/710, 18.2% for goats), followed by A. bovis (60/621, 9.7% for sheep; 74/710, 10.4% for goats) and A. phagocytophilum (33/621, 5.3% for sheep; 15/710, 2.1% for goats). Additionally, eight sheep and 20 goats were found to be infected with three pathogens simultaneously. DNA sequencing confirmed the presence of these three Anaplasma species in the investigated areas, and phylogenetic analysis indicated that there was geographic segregation to a certain extent, as well as a relationship between the host and cluster of A. ovis. The results of the present study provide valuable data that helps understand the epidemiology of anaplasmosis in ruminants from China.

  15. The Life and Death of Anaplasma

    Centers for Disease Control (CDC) Podcasts

    2012-03-30

    Dr. Setu Vora, medical director of critical care and physician director of performance improvement at Backus Hospital in Norwich, Connecticut, reads his poem The Life and Death of Anaplasma and discusses the poem’s origins.  Created: 3/30/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 4/2/2012.

  16. Anaplasma, Ehrlichia and Rickettsia species infections in cats

    NARCIS (Netherlands)

    Pennisi, Maria Grazia; Hofmann-Lehmann, Regina; Radford, Alan D; Tasker, Séverine; Belák, Sándor; Addie, Diane D; Boucraut-Baralon, Corine; Egberink, Herman; Frymus, Tadeusz; Gruffydd-Jones, Tim; Hartmann, Katrin; Horzinek, Marian C; Hosie, Margaret J; Lloret, Albert; Lutz, Hans; Marsilio, Fulvio; Thiry, Etienne; Truyen, Uwe; Möstl, Karin

    2017-01-01

    OVERVIEW: Anaplasma species, Ehrlichia species and Rickettsia species are vector-borne pathogens infecting a wide variety of mammals, but causing disease in very few of them. Infection in cats: Anaplasma phagocytophilum is the most important feline pathogen among these rickettsial organisms, and

  17. Arnaldo Saraiva y las literaturas marginales y marginalizadas

    Directory of Open Access Journals (Sweden)

    Carlos Nogueira

    2014-04-01

    Full Text Available This article focuses on Arnaldo Saraiva’s studies and teaching in the area of the socalled marginal or marginalized literatures of Portugal and Brazil, and on the unusually significant impact they have had on successive generations of teachers, cultural agents and literary scholars. RESUMEN: El presente trabajo versa sobre los estudios y la actividad docente de Arnaldo Saraiva en el área de las llamadas literaturas marginales o marginalizadas de Portugal y de Brasil, así como el impacto extrañamente significativo que aquellos han tenido en sucesivas generaciones de profesores, agentes culturales o estudiosos de la literatura.

  18. High Prevalence of Anaplasma spp. in Small Ruminants in Morocco.

    Science.gov (United States)

    Ait Lbacha, H; Alali, S; Zouagui, Z; El Mamoun, L; Rhalem, A; Petit, E; Haddad, N; Gandoin, C; Boulouis, H-J; Maillard, R

    2017-02-01

    The prevalence of infection by Anaplasma spp. (including Anaplasma phagocytophilum) was determined using blood smear microscopy and PCR through screening of small ruminant blood samples collected from seven regions of Morocco. Co-infections of Anaplasma spp., Babesia spp, Theileria spp. and Mycoplasma spp. were investigated and risk factors for Anaplasma spp. infection assessed. A total of 422 small ruminant blood samples were randomly collected from 70 flocks. Individual animal (breed, age, tick burden and previous treatment) and flock data (GPS coordinate of farm, size of flock and livestock production system) were collected. Upon examination of blood smears, 375 blood samples (88.9%) were found to contain Anaplasma-like erythrocytic inclusion bodies. Upon screening with a large spectrum PCR targeting the Anaplasma 16S rRNA region, 303 (71%) samples were found to be positive. All 303 samples screened with the A. phagocytophilum-specific PCR, which targets the msp2 region, were found to be negative. Differences in prevalence were found to be statistically significant with regard to region, altitude, flock size, livestock production system, grazing system, presence of clinical cases and application of tick and tick-borne diseases prophylactic measures. Kappa analysis revealed a poor concordance between microscopy and PCR (k = 0.14). Agreement with PCR is improved by considering microscopy and packed cell volume (PCV) in parallel. The prevalence of double infections was found to be 1.7, 2.5 and 24% for Anaplasma-Babesia, Anaplasma-Mycoplasma and Anaplasma-Theileria, respectively. Co-infection with three or more haemoparasites was found in 1.6% of animals examined. In conclusion, we demonstrate the high burden of anaplasmosis in small ruminants in Morocco and the high prevalence of co-infections of tick-borne diseases. There is an urgent need to improve the control of this neglected group of diseases. © 2015 Blackwell Verlag GmbH.

  19. EL MISTICISMO de los espíritus marginales

    Directory of Open Access Journals (Sweden)

    JOSÉ JORGE DE CARVALHO

    2001-01-01

    Full Text Available EL ARTÍCULO OFRECE UNA VISIÓN PANORÁMICA DE LAS MANIFESTACIONES RELIGIOSAS brasileñas marginales con relación al cristianismo dominante, entre las cuales se destacan el espiritismo kardecista y las varias formas de religiones de origen africano, todas de tradición oral. Un punto común a esas expresiones religiosas es la experiencia del trance y la posesión, que busco teorizar con la idea de la apófasis radical. En la segunda mitad del ensayo presento una antología de textos sagrados afrobrasileños, los cuales comento en una perspectiva de simbología comparada. Ellos señalan la presencia de un misticismo análogo al de los místicos de las llamadas "grandes religiones" o "religiones del libro". Propongo, entonces, incluir esas tradiciones marginales como parte constitutiva de la experiencia religiosa de la humanidad como un todo.

  20. Detection of Rickettsia and Anaplasma from hard ticks in Thailand.

    Science.gov (United States)

    Malaisri, Premnika; Hirunkanokpun, Supanee; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2015-12-01

    We collected a total of 169 adult hard ticks and 120 nymphs from under the leaves of plants located along tourist nature trails in ten localities. The results present data examining the vector competence of ticks of different genera and the presence of Rickettsia and Anaplasma species. The ticks belonged to three genera, Amblyomma, Dermacentor, and Haemaphysalis, comprising 11 species. Rickettsia bacteria were detected at three collection sites, while Anaplasma bacteria were detected at only one site. Phylogenetic analysis revealed new rickettsia genotypes from Thailand that were closely related to Rickettsia tamurae, Rickettsia monacensis, and Rickettsia montana. This study was also the first to show that Anaplasma bacteria are found in Haemaphysalis shimoga ticks and are closely related evolutionarily to Anaplasma bovis. These results provide additional information for the geographical distribution of tick species and tick-borne bacteria in Thailand and can therefore be applied for ecotourism management. © 2015 The Society for Vector Ecology.

  1. Estimated seroprevalence of Anaplasma spp. and spotted fever group Rickettsia exposure among herders and livestock in Mongolia.

    Science.gov (United States)

    von Fricken, Michael E; Lkhagvatseren, Sukhbaatar; Boldbaatar, Bazartseren; Nymadawa, Pagbajab; Weppelmann, Thomas A; Baigalmaa, Bekh-Ochir; Anderson, Benjamin D; Reller, Megan E; Lantos, Paul M; Gray, Gregory C

    2018-01-01

    To better understand the epidemiology of tick-borne disease in Mongolia, a comprehensive seroprevalence study was conducted investigating exposure to Anaplasma spp. and spotted fever group (SFG) Rickettsia spp. in nomadic herders and their livestock across three provinces from 2014 to 2015. Blood was collected from 397 herders and 2370 livestock, including sheep, goats, cattle, horses and camels. Antibodies against Anaplasma spp. and SFG Rickettsia were determined by indirect immunofluorescence using commercially available slides coated with Anaplasma phagocytophilum and Rickettsia rickettsii antigens. Logistic regression was used to determine if the odds of previous exposure differed by gender, location, and species, with or without adjustment for age. To examine the association between seroprevalence and environmental variables we used ArcGIS to circumscribe the five major clusters where human and animal data were collected. Anaplasma spp. exposure was detected in 37.3% (136/365) of humans and 47.3% (1120/2370) of livestock; SFG Rickettsia exposure was detected in 19.5% (73/374) humans and 20.4% (478/2342) livestock. Compared to the southern province (aimag) of Dornogovi, located in the Gobi Desert, humans were significantly more likely to be exposed to Anaplasma spp. and SFG Rickettsia in the northern provinces of Tov (OR=7.3, 95% CI: 3.5, 15.1; OR=3.3, 95% CI: 1.7, 7.5), and Selenge (OR=6.9, 95% CI: 3.4, 14.0; OR=2.2, 95% CI: 1.1, 4.8). The high seroprevalence of Anaplasma spp. and SFG Rickettsia in humans and livestock suggests that exposure to tick-borne pathogens may be common in herders and livestock in Mongolia, particularly in the more northern regions of the country. Until more is known about these pathogens in Mongolia, physicians and veterinarians in the countryside should consider testing for Anaplasma and SFG Rickettsia infections and treating clinically compatible cases, while public health authorities should expand surveillance efforts for these

  2. Prevalence of Anaplasma phagocytophilum in North Carolina Eastern Black Bears ( Ursus americanus ).

    Science.gov (United States)

    Westmoreland, Lori S H; Stoskopf, Michael K; Maggi, Ricardo G

    2016-10-01

    We detected Anaplasma phagocytophilum by DNA amplification in whole blood from free-ranging, hunter-killed American black bears ( Ursus americanus ) from the east coast of North Carolina, US. Molecular prevalence for Anaplasma phagocytophilum was 3% from 68 black bears. No DNA of other Anaplasma or Ehrlichia spp. was identified.

  3. Prevalence of Anaplasma phagocytophilum infection and effect on lamb growth

    Directory of Open Access Journals (Sweden)

    Steinshamn Håvard

    2011-05-01

    Full Text Available Abstract Background A major challenge in sheep farming during the grazing season along the coast of south-western Norway is tick-borne fever (TBF caused by the bacteria Anaplasma phagocytophilum that is transmitted by the tick Ixodes ricinus. Methods A study was carried out in 2007 and 2008 to examine the prevalence of A. phagocytophilum infection and effect on weaning weight in lambs. The study included 1208 lambs from farms in Sunndal Ram Circle in Møre and Romsdal County in Mid-Norway, where ticks are frequently observed. All lambs were blood sampled and serum was analyzed by an indirect fluorescent antibody assay (IFA to determine an antibody status (positive or negative to A. phagocytophilum infection. Weight and weight gain and possible effect of infection were analyzed using ANOVA and the MIXED procedure in SAS. Results The overall prevalence of infection with A. phagocytophilum was 55%. A lower weaning weight of 3% (1.34 kg, p A. phagocytophilum infection compared to seronegative lambs at an average age of 137 days. Conclusions The results show that A. phagocytophilum infection has an effect on lamb weight gain. The study also support previous findings that A. phagocytophilum infection is widespread in areas where ticks are prevalent, even in flocks treated prophylactic with acaricides.

  4. Anaplasma phagocytophilum in ticks in Slovenia

    Directory of Open Access Journals (Sweden)

    Knap Nataša

    2010-11-01

    Full Text Available Abstract Ticks act as vectors of many pathogens of domestic animals and humans. Anaplasma phagocytophilum in Europe is transmitted by the ixodid tick vector Ixodes ricinus. A. phagocytophilum causes a disease with diverse clinical signs in various hosts. A great genetic diversity of the groESL operon of A. phagocytophilum has been found in ticks elsewhere. In Slovenia, the variety of the groESL operon was conducted only on deer samples. In this study, the prevalence of infected ticks was estimated and the diversity of A. phagocytophilum was evaluated. On 8 locations in Slovenia, 1924 and 5049 (6973 I. ricinus ticks were collected from vegetation in the years 2005 and 2006, respectively. All three feeding stages of the tick's life cycle were examined. The prevalence of ticks infected with A. phagocytophilum in the year 2005 and in the year 2006 was 0.31% and 0.63%, respectively, and it did not differ considerably between locations. The similarity among the sequences of groESL ranged from 95.6% to 99.8%. They clustered in two genetic lineages along with A. phagocytophilum from Slovenian deer. One sequence formed a separate cluster. According to our study, the prevalence of A. phagocytophilum in ticks is comparable to the findings in other studies in Europe, and it does not vary considerably between locations and tick stages. According to groESL operon analysis, two genetic lineages have been confirmed and one proposed. Further studies on other genes would be useful to obtain more information on genetic diversity of A. phagocytophilum in ticks in Slovenia.

  5. Construcción de Distribuciones Multivariadas con Marginales Dependientes Usando Cópulas en R

    OpenAIRE

    Jaramillo-Elorza, M. C; Lozano, J. A

    2014-01-01

    Las cópulas se han convertido en una herramienta popular para la construcción de modelos multivariados en campos donde la dependencia multivariada es de gran interés. El propósito de este trabajo es presentar las cópulas tanto en su concepto teórico, como en su implementación en el software estadístico R y profundizar en la construcción de distribuciones multivariadas con marginales dependientes, usando la clase mvdc del paquete copula, la cual permite utilizar varias y diferentes marginales ...

  6. Natural Anaplasma phagocytophilum infection in ticks from a forest area of Selenge province, Mongolia

    Directory of Open Access Journals (Sweden)

    G Javkhlan

    2014-03-01

    Full Text Available Anaplasma phagocytophilum is a zoonotic agent of public health importance, infecting both humans and animals. An investigation of the presence of Anaplasma phagocytophilum as well as Anaplasma platys was conducted in a forest area of Selenge province, Mongolia, where ticks are widely distributed and tick-borne diseases are highly endemic. Ticks were collected and tested using polymerase chain reaction based on groEL methodology. Anaplasma phagocytophilum was detected in 14 (6% of Ixodes persulcatus ticks and four (1% Dermacentor nuttalli ticks; infection of Anaplasma platys was detected in 1% of Ixodes persulcatus ticks and 10% of Dermacentor nuttalli ticks. The phylogenetic tree showed that the Anaplasma phagocytophilum clustered with the Russian group, most likely due to similar geographical locations. This finding is significant for both veterinary and public health officials given that these agents can cause both animal and human illness.

  7. Investigating the Adult Ixodid Tick Populations and Their Associated Anaplasma, Ehrlichia, and Rickettsia Bacteria at a Rocky Mountain Spotted Fever Hotspot in Western Tennessee.

    Science.gov (United States)

    Trout Fryxell, Rebecca T; Hendricks, Brain M; Pompo, Kimberly; Mays, Sarah E; Paulsen, Dave J; Operario, Darwin J; Houston, Allan E

    2017-08-01

    Ehrlichiosis and rickettsiosis are two common bacterial tick-borne diseases in the southeastern United States. Ehrlichiosis is caused by ehrlichiae transmitted by Amblyomma americanum and rickettsiosis is caused by rickettsiae transmitted by Amblyomma maculatum and Dermacentor variabilis. These ticks are common and have overlapping distributions in the region. The objective of this study was to identify Anaplasma, Ehrlichia, and Rickettsia species associated with questing ticks in a Rocky Mountain spotted fever (RMSF) hotspot, and identify habitats, time periods, and collection methods for collecting questing-infected ticks. Using vegetation drags and CO 2 -baited traps, ticks were collected six times (May-September 2012) from 100 sites (upland deciduous, bottomland deciduous, grassland, and coniferous habitats) in western Tennessee. Adult collections were screened for Anaplasma and Ehrlichia (simultaneous polymerase chain reaction [PCR]) and Rickettsia using genus-specific PCRs, and resulting positive amplicons were sequenced. Anaplasma and Ehrlichia were only identified within A. americanum (Ehrlichia ewingii, Ehrlichia chaffeensis, Panola Mountain Ehrlichia, and Anaplasma odocoilei sp. nov.); more Ehrlichia-infected A. americanum were collected at the end of June regardless of habitat and collection method. Rickettsia was identified in three tick species; "Candidatus Rickettsia amblyommii" from A. americanum, R. parkeri and R. andeanae from A. maculatum, and R. montanensis ( = montana) from D. variabilis. Overall, significantly more Rickettsia-infected ticks were identified as A. americanum and A. maculatum compared to D. variabilis; more infected-ticks were collected from sites May-July and with dragging. In this study, we report in the Tennessee RMSF hotspot the following: (1) Anaplasma and Ehrlichia are only found in A. americanum, (2) each tick species has its own Rickettsia species, (3) a majority of questing-infected ticks are collected May-July, (4) A

  8. NNDSS - Table II. Ehrlichiosis and Anaplasmosis, Anaplasma phagocytophilum infection to Ehrlichia chaffeensis infection

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis and Anaplasmosis, Anaplasma phagocytophilum infection to Ehrlichia chaffeensis infection - 2018. In this Table, provisional cases of...

  9. Molecular detection of Rickettsia, Anaplasma, Coxiella and Francisella bacteria in ticks collected from Artiodactyla in Thailand.

    Science.gov (United States)

    Sumrandee, Chalao; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2016-07-01

    A total of 79 ticks collected from Sambar deer (Cervus unicolor), Barking deer (Muntiacus muntjak) and Wild boar (Sus scrofa) were examined by PCR for the presence of Rickettsia, Anaplasma, Coxiella, and Francisella bacteria. Of the 79 ticks, 13% tested positive for Rickettsia, 15% tested positive for Anaplasma, 4% tested positive for Coxiella, and 3% tested positive for Francisella. Interestingly, triple infection with Anaplasma, Rickettsia and Francisella was determined in a Dermacentor auratus tick. Moreover, another triple infection with Rickettsia, Anaplasma, and Coxiella was found in a Haemaphysalis lagrangei tick. Double infection of Rickettsia with Coxiella was also detected in another H. lagrangei tick. From the phylogenetic analyses, we found a Rickettsia sp. with a close evolutionary relationship to Rickettsia bellii in the H. lagrangei tick. We also found the first evidence of a Rickettsia sp. that is closely related to Rickettsia tamurae in Rhipicephalus (Boophilus) microplus ticks from Thailand. H. lagrangei and Haemaphysalis obesa ticks collected from Sambar deer tested positive for Anaplasma species form the same clade with Anaplasma bovis. In contrast, other H. lagrangei ticks collected from Sambar deer and D. auratus ticks collected from Wild boar were also reported for the first time to be infected with an Anaplasma species that is closely related to Anaplasma platys. The phylogenetic analysis of the 16S rRNA gene of Coxiella bacteria revealed that Coxiella symbionts from H. lagrangei formed a distinctly different lineage from Coxiella burnetii (a human pathogen). Additionally, Francisella bacteria identified in D. auratus ticks were found to be distantly related to a group of pathogenic Francisella species. The identification of these bacteria in several feeding ticks suggests the risk of various emerging tick-borne diseases and endosymbionts in humans, wildlife, and domestic animals in Thailand. Copyright © 2016 Elsevier GmbH. All rights

  10. La sexualidad en los jóvenes de sectores marginales. Un informe de avance

    OpenAIRE

    Aigneren Aburto, José Miguel

    2004-01-01

    La sexualidad en los jovenes de sectores marginales. El problema es la sexualidad de los adolescentes en un mundo de pobreza e inequidad. Este estudio tiene como objetivo general describir los crudos productos sexuales de la miseria y los mitos que envenenan a la juventud marginal. Es un intento de retratar a aquellos adolescentes que conocen el sexo en la escuela del submundo que esconden los cordones de extrema pobreza del Medellín de hoy. Los resultados citados corresponden a realidades co...

  11. El impuesto al valor agregado en los contratos de campos marginales

    OpenAIRE

    Niquinga Salazar, Oscar Javier

    2007-01-01

    Esta investigación dirigida por los métodos de investigación sistemático, exegético, y teleológico, pretende analizar los contratos petroleros de Campos Marginales utilizados por la legislación ecuatoriana y específicamente, el papel de Impuesto al Valor Agregado en la producción de la Curva Base; ésta, se convierte en una figura contractual innovadora que ha producido una interesante discusión a nivel nacional; sin embargo, la propuesta de este trabajo va encaminado a encontra...

  12. Prevalence of Anaplasma phagocytophilum infection in feral cats in Massachusetts.

    Science.gov (United States)

    Galemore, Erin R; Labato, Mary A; O'Neil, Elizabeth

    2018-01-01

    The primary objective of this study was to determine the prevalence of Anaplasma phagocytophilum infection and exposure in adult feral cats in Massachusetts, an endemic area for A phagocytophilum and its tick vector Ixodes scapularis . The secondary objective was to determine if there were correlations between A phagocytophilum infection and the presence of anemia and thrombocytopenia. Blood samples were collected between June and December 2015 from 175 apparently healthy adult feral cats that were presented to trap and release spay/neuter centers in Massachusetts. Complete blood count, blood smear evaluation, SNAP 4Dx Plus test (IDEXX) and A phagocytophilum PCR were performed on all samples to document acute infection (PCR-positive and/or inclusions observed on blood smear) and exposure to A phagocytophilum (SNAP 4Dx Plus-positive for A phagocytophilum antibodies). The prevalence of exposure to A phagocytophilum in feral cats in Massachusetts was 9.7%, whereas the prevalence of acute infection was 6.9%. All blood smears were negative for Anaplasma species inclusions; therefore, acute infection was defined as testing positive on PCR analysis. No statistically significant correlations were identified for cats that were positive for A phagocytophilum on PCR analysis or SNAP 4Dx Plus test and the presence of anemia or thrombocytopenia. The prevalence of A phagocytophilum exposure in feral cats approaches 10% and is higher than the previously reported national average prevalence of 4.3% in the USA. A phagocytophilum infection may be an emerging infectious disease in cats. Further research is needed to determine the prevalence of clinical illness associated with A phagocytophilum infection in cats living in endemic areas.

  13. The prevalence of Anaplasma phagocytophilum in questing Ixodes ricinus ticks in SW Poland.

    Science.gov (United States)

    Kiewra, Dorota; Zaleśny, Grzegorz; Czułowska, Aleksandra

    2014-01-01

    Ticks constitute important vectors of human and animal pathogens. Besides the Lyme borreliosis and tick-borne encephalitis, other pathogens such as Babesia spp., Rickettsia spp., and Anaplasma phagocytophilum, are of increasing public health interest. In Poland, as in other European countries, Ixodes ricinus, the most prevalent tick species responsible for the majority of tick bites in humans, is the main vector of A. phagocytophilum. The aim of the study was to estimate the infection level of I. ricinus with A. phagocytophilum in selected districts, not previously surveyed for the presence of this agent. Sampling of questing ticks was performed in 12 forested sites, located in four districts (Legnica, Milicz, Lubań, and Oława) in SW Poland. Altogether, 792 ticks (151 females, 101 males, and 540 nymphs) representing I. ricinus were checked for the presence of A. phagocytophilum. The average infection level was 4.3%, with higher rate reported for adult ticks. The highest percentage of infected adults was observed in Milicz (17.4%) and the lowest in Oława (6.8%). The abundance of questing I. ricinus in all examined sites as well as the infection with A. phagocytophilum indicate for the first time the risk for HGA transmission in SW Poland.

  14. Molecular detection of Anaplasma platys, Anaplasma phagocytophilum and Wolbachia sp. but not Ehrlichia canis in Croatian dogs.

    Science.gov (United States)

    Huber, Doroteja; Reil, Irena; Duvnjak, Sanja; Jurković, Daria; Lukačević, Damir; Pilat, Miroslav; Beck, Ana; Mihaljević, Željko; Vojta, Lea; Polkinghorne, Adam; Beck, Relja

    2017-11-01

    The bacteria Anaplasma platys, Anaplasma phagocytophilum and Ehrlichia canis are tick-borne agents that cause canine vector-borne disease. The prevalence of these pathogens in South Eastern Europe is unknown with the exception of an isolated case of A. platys detected in a dog imported into Germany from Croatia. To gain a better insight into their presence and prevalence, PCR-based screening for these bacterial pathogens was performed on domesticated dogs from different regions of Croatia. Blood samples from 1080 apparently healthy dogs from coastal and continental parts of Croatia as well as tissue samples collected from 63 deceased dogs with a history of anaemia and thrombocytopenia were collected for molecular screening by an Anaplasmataceae-specific 16S rRNA conventional PCR. Positive samples were confirmed using a second Anaplasmataceae-specific PCR assay with the PCR product sequenced for the purpose of bacterial species identification. All sequenced isolates were georeferenced and a kernel intensity estimator was used to identify clusters of greater case intensity. 42/1080 (3.8%; CI 2.7-5.0) of the healthy dogs were PCR positive for bacteria in the Anaplasmataceae. Sequencing of the 16S rRNA gene amplified from these positive samples revealed the presence of A. platys in 2.5% (CI 1.6-3.4%, 27 dogs), A. phagocytophilum in 0.3% (CI 0-0.6%, 3 dogs) and a Wolbachia endosymbiont in 1.1% (CI 0.4-1.6%, 12 dogs) of dogs screened in this study. Necropsied dogs were free from infection. Notably, no evidence of E. canis infection was found in any animal. This survey represents a rare molecular study of Anaplasmataceae in dogs in South Eastern Europe, confirming the presence of A. platys and A. phagocytophilum but not E. canis. The absence of E. canis was surprising given it has been described in all other Mediterranean countries surveyed and raises questions over the regional vector capacity of the Rhipicephalus sanguineus tick.

  15. Anaplasma phagocytophilum in Danish sheep: confirmation by DNA sequencing

    Directory of Open Access Journals (Sweden)

    Thamsborg Stig M

    2009-12-01

    Full Text Available Abstract Background The presence of Anaplasma phagocytophilum, an Ixodes ricinus transmitted bacterium, was investigated in two flocks of Danish grazing lambs. Direct PCR detection was performed on DNA extracted from blood and serum with subsequent confirmation by DNA sequencing. Methods 31 samples obtained from clinically normal lambs in 2000 from Fussingø, Jutland and 12 samples from ten lambs and two ewes from a clinical outbreak at Feddet, Zealand in 2006 were included in the study. Some of the animals from Feddet had shown clinical signs of polyarthritis and general unthriftiness prior to sampling. DNA extraction was optimized from blood and serum and detection achieved by a 16S rRNA targeted PCR with verification of the product by DNA sequencing. Results Five DNA extracts were found positive by PCR, including two samples from 2000 and three from 2006. For both series of samples the product was verified as A. phagocytophilum by DNA sequencing. Conclusions A. phagocytophilum was detected by molecular methods for the first time in Danish grazing lambs during the two seasons investigated (2000 and 2006.

  16. Intrauterine Transmission of Anaplasma phagocytophilum in Persistently Infected Lambs

    Directory of Open Access Journals (Sweden)

    Snorre Stuen

    2018-02-01

    Full Text Available Anaplasma phagocytophilum, which causes the disease tick-borne fever (TBF, is the most important tick-borne pathogen in European animals. TBF may contribute to severe welfare challenges and economic losses in the Norwegian sheep industry. The bacterium causes a persistent infection in sheep and several other animal species. The objective of this study was to investigate whether intrauterine transmission occurs in persistently infected sheep. The study included thirteen 5–6-month-old unmated ewes, of which twelve were experimentally infected with A. phagocytophilum (GenBank acc. no. M73220. Four to six weeks later, all ewes were mated, and nine became pregnant. Blood samples were collected from these ewes and their offspring. If the lamb died, tissue samples were collected. The samples were analyzed with real-time PCR (qPCR targeting the msp2 gene. PCR-positive samples were further analyzed by semi-nested PCR and 16S rDNA sequencing. A total of 20 lambs were born, of which six died within two days. Six newborn lambs (30% were PCR-positive (qPCR, of which one was verified by 16S rDNA sequencing. The present study indicates that intrauterine transmission of A. phagocytophilum in persistently infected sheep may occur. The importance of these findings for the epidemiology of A. phagocytophilum needs to be further investigated.

  17. A molecular epidemiological survey of Babesia, Hepatozoon, Ehrlichia and Anaplasma infections of dogs in Japan

    Science.gov (United States)

    KUBO, Shotaro; TATENO, Morihiro; ICHIKAWA, Yasuaki; ENDO, Yasuyuki

    2015-01-01

    Tick-borne diseases are often encountered in canine clinical practice. In the present study, a molecular epidemiological survey of dogs in Japan was conducted to understand the prevalence and geographical distribution of Babesia spp., Hepatozoon spp., Ehrlichia spp. and Anaplasma spp. Pathogen-derived DNA in blood samples obtained from 722 dogs with a history of exposure to ticks and/or fleas was examined by PCR. The prevalence of Babesia gibsoni, Babesia odocoilei-like species, Hepatozoon canis and Ehrlichia spp./Anaplasma spp. was 2.4% (16/722), 0.1% (1/722), 2.5% (18/722) and 1.5% (11/722), respectively. While B. gibsoni and Ehrlichia spp./Anaplasma spp. were detected in the western part of Japan, H. canis was detected in Tohoku area in addition to western and central parts of Japan. PMID:25947226

  18. Remodeling of tick cytoskeleton in response to infection with Anaplasma phagocytophilum

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Alberdi, P.; Valdés, James J.; Villar, M.; de la Fuente, J.

    2017-01-01

    Roč. 22, Jun 1 (2017), s. 1830-1844 ISSN 1093-4715 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : cytoskeleton * proteomics * transcriptomics * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology

  19. Anaplasma phagocytophilum Infection Subverts Carbohydrate Metabolic Pathways in the Tick Vector, Ixodes scapularis

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Alberdi, P.; Valdés, James J.; Villar, M.; de la Fuente, J.

    2017-01-01

    Roč. 7, 7 February (2017), č. článku 23. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : proteomics * transcriptomics * glucose metabolism * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016

  20. Ixodes scapularis Tick Cells Control Anaplasma phagocytophilum Infection by Increasing the Synthesis of Phosphoenolpyruvate from Tyrosine

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Espinosa, P. J.; Obregon, D. A.; Alberdi, P.; de la Fuente, J.

    2017-01-01

    Roč. 7, AUG 17 (2017), č. článku 375. ISSN 2235-2988 Institutional support: RVO:60077344 Keywords : proteomics * transcriptomics * phosphoenolpyruvate * glycerol-3-phosphate * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.300, year: 2016

  1. Ixodes scapularis saliva mitigates inflammatory cytokine secretion during Anaplasma phagocytophilum stimulation of immune cells

    Czech Academy of Sciences Publication Activity Database

    Chen, G.; Severo, M. S.; Sohail, M.; Sakhon, O. S.; Wikel, S. K.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2012-01-01

    Roč. 5, č. 1 (2012), s. 229 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Tick * Ixodes scapularis * Saliva * Anaplasma phagocytophilum * Rickettsial agent Subject RIV: EC - Immunology Impact factor: 3.246, year: 2012 http://www.parasitesandvectors.com/content/5/1/229

  2. Detection and identification of Anaplasma phagocytophilum, Borrelia burgdorferi, and Rickettsia helvetica in Danish Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Skarphédinsson, Sigurdur; Lyholm, Birgitte Fjendbo; Ljungberg, Marianne

    2007-01-01

    % of adult ticks. The difference in prevalence between Anaplasma and Borrelia in adult ticks supports the idea that their maintenance cycles in nature may be different. Ticks were also infected with Rickettsia helvetica. Our study indicates that A. phagocytophilum prevalence in ticks in Denmark is as high...

  3. Neonatal Anaplasma platys infection in puppies: Further evidence for possible vertical transmission

    Czech Academy of Sciences Publication Activity Database

    Matei, I.A.; Stuen, S.; Modrý, David; Degan, A.; D'Amico, G.; Mihalca, A. D.

    2017-01-01

    Roč. 219, 1 January (2017), s. 40-41 ISSN 1090-0233 Institutional support: RVO:60077344 Keywords : Anaplasma platys * canine * vertical transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.802, year: 2016

  4. Molecular and serological prevalence of Toxoplasma gondii and Anaplasma spp. infection in goats from Chongqing Municipality, China

    Directory of Open Access Journals (Sweden)

    Zhou Zuoyong

    2018-01-01

    Full Text Available Toxoplasmosis and anaplasmosis are severe zoonotic diseases, the former caused by Toxoplasma gondii and the latter by Anaplasma spp. In the present study, 332 goat blood samples were randomly collected from Chongqing Municipality, China to screen for T. gondii and Anaplasma spp. We used a polymerase chain reaction (PCR to detect DNA, and enzyme-linked immunosorbent assay (ELISA to test for T. gondii antibodies. The prevalence of T. gondii and Anaplasma spp. was 38% and 35% respectively by PCR, and 42% for T. gondii antibodies by ELISA. The co-infection rate by T. gondii and Anaplasma was 13%, where the two predominant pathogens co-infecting were Anaplasma phagocytophilum + A. bovis (10%, followed by T. gondii + A. phagocytophilum (9.64%. While co-infection by three pathogens varied ranging from 1.81% to 5.72%, less than 1% of goats were found to be positive for four pathogens. This is the first investigation of T. gondii and Anaplasma spp. infection in goats from Chongqing.

  5. Incidencia de los Hábitos Alimenticios en los Niveles de Rendimiento Académico Escolar en las Instituciones Educativas Secundarias Urbano Marginales de Juliaca

    OpenAIRE

    Aguilar Roque, Gaylee Yemira

    2015-01-01

    El presente trabajo de investigación denominado “INCIDENCIA DE LOS HÁBITOS ALIMENTICIOS EN LOS NIVELES DE RENDIMIENTO ACADÉMICO ESCOLAR EN LAS INSTITUCIONES EDUCATIVAS SECUNDARIAS URBANO - MARGINALES DE JULIACA”, cuyo objetivo general es establecer la importancia del consumo de cereales andinos y productos procesados en los niveles de rendimiento académico de los estudiantes de las I.E.S. de las zonas urbano – marginales de la ciudad de Juliaca. Este estudio nos permite establec...

  6. REDES COMUNITARIAS: UN DESAFÍO PARA ESCUELAS URBANO-MARGINALES

    Directory of Open Access Journals (Sweden)

    Mirta Giacobbe Tovani

    2009-01-01

    Full Text Available Las ideas básicas de este trabajo son conocer y comprender el entramado de la red de relaciones entre los distintos actores de las instituciones: escuela y organismos de la comunidad y su incidencia en la calidad educativa / calidad de vida. Analizamos la visión de los distintos actores educativos acerca de la inserción de la escuela en la comunidad. Tomamos como punto de partida el análisis de las relaciones entre calidad educativa y calidad de vida, en poblaciones urbano-marginales. Realizamos en primer lugar una investigación exploratoria, para conocer las características generales de escuelas que reciben población marginal. En una segunda etapa seleccionamos cuatro escuelas, que tomamos como casos e indagamos sus problemáticas. En ellas observamos gran dificultad para la construcción de redes comunitarias desde la institución escolar. Si bien responden a los problemas puntuales, mediante cambios o innovaciones planificados dinámica y flexiblemente, no existen soluciones duraderas debido a la falta de una convocatoria que comprometa a todas las instituciones de la comunidad constituyendo una efectiva relación en red. Estos resultados alcanzados en la investigación son producto de la triangulación de los datos estadísticos, documentales e históricos así como de los procedentes de la observación participante y de la información de las entrevistas en profundidad.

  7. First case of Anaplasma platys infection in a dog from Croatia

    Directory of Open Access Journals (Sweden)

    Dyachenko Viktor

    2012-03-01

    Full Text Available Abstract Background It is known that Anaplasma (A. platys, the causative agent of infectious canine cyclic thrombocytopenia, is endemic in countries of the Mediterranean basin. However, few reports are available from the Balkans. This case report describes a dog, which was imported from Croatia to Germany in May 2010. One month later the dog was presented to a local veterinarian in Germany due to intermittent/recurrent diarrhoea. Diagnostic tests were performed to identify infections caused by Anaplasma spp., Ehrlichia spp., Hepatozoon canis, Babesia spp., Leishmania spp., Borrelia burgdorferi and/or Dirofilaria immitis. Findings Haematological examination of a blood smear revealed basophilic inclusions in thrombocytes, which were confirmed as A. platys with a species-specific real-time PCR. Additionally, an infection with Babesia (B. vogeli was also detected (PCR and serology. No specific antibodies against Anaplasma antigen were detectable. Although the dog showed no specific clinical signs, thrombocytopenia, anaemia and elevated C-reactive protein (CRP were observed. Sequencing of a 1,348-bp partial ribosomal RNA gene revealed highest homology to A. platys sequences from Thailand, Japan and France. Conclusions A. platys was detected for first time in a dog imported from Croatia. As the dog was also co-infected by B. vogeli, unique serological and haematological findings were recorded. Thrombocytopenia, anaemia and elevated values of C-reactive protein were the laboratory test abnormalities observed in this case. A. platys infections should be considered in dogs coming from Croatia and adjacent regions.

  8. An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.

    Science.gov (United States)

    Oliva Chávez, Adela S; Fairman, James W; Felsheim, Roderick F; Nelson, Curtis M; Herron, Michael J; Higgins, LeeAnn; Burkhardt, Nicole Y; Oliver, Jonathan D; Markowski, Todd W; Kurtti, Timothy J; Edwards, Thomas E; Munderloh, Ulrike G

    2015-01-01

    Anaplasma phagocytophilum, the causative agent of Human Granulocytic Anaplasmosis (HGA), is an obligately intracellular α-proteobacterium that is transmitted by Ixodes spp ticks. However, the pathogen is not transovarially transmitted between tick generations and therefore needs to survive in both a mammalian host and the arthropod vector to complete its life cycle. To adapt to different environments, pathogens rely on differential gene expression as well as the modification of proteins and other molecules. Random transposon mutagenesis of A. phagocytophilum resulted in an insertion within the coding region of an o-methyltransferase (omt) family 3 gene. In wild-type bacteria, expression of omt was up-regulated during binding to tick cells (ISE6) at 2 hr post-inoculation, but nearly absent by 4 hr p.i. Gene disruption reduced bacterial binding to ISE6 cells, and the mutant bacteria that were able to enter the cells were arrested in their replication and development. Analyses of the proteomes of wild-type versus mutant bacteria during binding to ISE6 cells identified Major Surface Protein 4 (Msp4), but also hypothetical protein APH_0406, as the most differentially methylated. Importantly, two glutamic acid residues (the targets of the OMT) were methyl-modified in wild-type Msp4, whereas a single asparagine (not a target of the OMT) was methylated in APH_0406. In vitro methylation assays demonstrated that recombinant OMT specifically methylated Msp4. Towards a greater understanding of the overall structure and catalytic activity of the OMT, we solved the apo (PDB_ID:4OA8), the S-adenosine homocystein-bound (PDB_ID:4OA5), the SAH-Mn2+ bound (PDB_ID:4PCA), and SAM- Mn2+ bound (PDB_ID:4PCL) X-ray crystal structures of the enzyme. Here, we characterized a mutation in A. phagocytophilum that affected the ability of the bacteria to productively infect cells from its natural vector. Nevertheless, due to the lack of complementation, we cannot rule out secondary mutations.

  9. An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.

    Directory of Open Access Journals (Sweden)

    Adela S Oliva Chávez

    Full Text Available Anaplasma phagocytophilum, the causative agent of Human Granulocytic Anaplasmosis (HGA, is an obligately intracellular α-proteobacterium that is transmitted by Ixodes spp ticks. However, the pathogen is not transovarially transmitted between tick generations and therefore needs to survive in both a mammalian host and the arthropod vector to complete its life cycle. To adapt to different environments, pathogens rely on differential gene expression as well as the modification of proteins and other molecules. Random transposon mutagenesis of A. phagocytophilum resulted in an insertion within the coding region of an o-methyltransferase (omt family 3 gene. In wild-type bacteria, expression of omt was up-regulated during binding to tick cells (ISE6 at 2 hr post-inoculation, but nearly absent by 4 hr p.i. Gene disruption reduced bacterial binding to ISE6 cells, and the mutant bacteria that were able to enter the cells were arrested in their replication and development. Analyses of the proteomes of wild-type versus mutant bacteria during binding to ISE6 cells identified Major Surface Protein 4 (Msp4, but also hypothetical protein APH_0406, as the most differentially methylated. Importantly, two glutamic acid residues (the targets of the OMT were methyl-modified in wild-type Msp4, whereas a single asparagine (not a target of the OMT was methylated in APH_0406. In vitro methylation assays demonstrated that recombinant OMT specifically methylated Msp4. Towards a greater understanding of the overall structure and catalytic activity of the OMT, we solved the apo (PDB_ID:4OA8, the S-adenosine homocystein-bound (PDB_ID:4OA5, the SAH-Mn2+ bound (PDB_ID:4PCA, and SAM- Mn2+ bound (PDB_ID:4PCL X-ray crystal structures of the enzyme. Here, we characterized a mutation in A. phagocytophilum that affected the ability of the bacteria to productively infect cells from its natural vector. Nevertheless, due to the lack of complementation, we cannot rule out secondary

  10. Anaplasma phagocytophilum MSP4 and HSP70 Proteins Are Involved in Interactions with Host Cells during Pathogen Infection

    Directory of Open Access Journals (Sweden)

    Marinela Contreras

    2017-07-01

    Full Text Available Anaplasma phagocytophilum transmembrane and surface proteins play a role during infection and multiplication in host neutrophils and tick vector cells. Recently, A. phagocytophilum Major surface protein 4 (MSP4 and Heat shock protein 70 (HSP70 were shown to be localized on the bacterial membrane, with a possible role during pathogen infection in ticks. In this study, we hypothesized that A. phagocytophilum MSP4 and HSP70 have similar functions in tick-pathogen and host-pathogen interactions. To address this hypothesis, herein we characterized the role of these bacterial proteins in interaction and infection of vertebrate host cells. The results showed that A. phagocytophilum MSP4 and HSP70 are involved in host-pathogen interactions, with a role for HSP70 during pathogen infection. The analysis of the potential protective capacity of MSP4 and MSP4-HSP70 antigens in immunized sheep showed that MSP4-HSP70 was only partially protective against pathogen infection. This limited protection may be associated with several factors, including the recognition of non-protective epitopes by IgG in immunized lambs. Nevertheless, these antigens may be combined with other candidate protective antigens for the development of vaccines for the control of human and animal granulocytic anaplasmosis. Focusing on the characterization of host protective immune mechanisms and protein-protein interactions at the host-pathogen interface may lead to the discovery and design of new effective protective antigens.

  11. The Prostaglandin E2-EP3 Receptor Axis Regulates Anaplasma phagocytophilum-Mediated NLRC4 Inflammasome Activation.

    Directory of Open Access Journals (Sweden)

    Xiaowei Wang

    2016-08-01

    Full Text Available Rickettsial agents are sensed by pattern recognition receptors but lack pathogen-associated molecular patterns commonly observed in facultative intracellular bacteria. Due to these molecular features, the order Rickettsiales can be used to uncover broader principles of bacterial immunity. Here, we used the bacterium Anaplasma phagocytophilum, the agent of human granulocytic anaplasmosis, to reveal a novel microbial surveillance system. Mechanistically, we discovered that upon A. phagocytophilum infection, cytosolic phospholipase A2 cleaves arachidonic acid from phospholipids, which is converted to the eicosanoid prostaglandin E2 (PGE2 via cyclooxygenase 2 (COX2 and the membrane associated prostaglandin E synthase-1 (mPGES-1. PGE2-EP3 receptor signaling leads to activation of the NLRC4 inflammasome and secretion of interleukin (IL-1β and IL-18. Importantly, the receptor-interacting serine/threonine-protein kinase 2 (RIPK2 was identified as a major regulator of the immune response against A. phagocytophilum. Accordingly, mice lacking COX2 were more susceptible to A. phagocytophilum, had a defect in IL-18 secretion and exhibited splenomegaly and damage to the splenic architecture. Remarkably, Salmonella-induced NLRC4 inflammasome activation was not affected by either chemical inhibition or genetic ablation of genes associated with PGE2 biosynthesis and signaling. This divergence in immune circuitry was due to reduced levels of the PGE2-EP3 receptor during Salmonella infection when compared to A. phagocytophilum. Collectively, we reveal the existence of a functionally distinct NLRC4 inflammasome illustrated by the rickettsial agent A. phagocytophilum.

  12. ORF Alignment: NC_004842 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Anaplasma ... marginale str. St. Maries] ... Length = 114 ... Query: 16 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWL...DKASGARTEKTEWHSIVVFSEG 75 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWL...DKASGARTEKTEWHSIVVFSEG Sbjct: 1 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWLDKASGARTEKTEWHSIVVFSEG 60 ...

  13. Development of duplex PCR for simultaneous detection of Theileria spp. and Anaplasma spp. in sheep and goats.

    Science.gov (United States)

    Cui, Yanyan; Zhang, Yan; Jian, Fuchun; Zhang, Longxian; Wang, Rongjun; Cao, Shuxuan; Wang, Xiaoxing; Yan, Yaqun; Ning, Changshen

    2017-05-01

    Theileria spp. and Anaplasma spp., which are important tick-borne pathogens (TBPs), impact the health of humans and animals in tropical and subtropical areas. Theileria and Anaplasma co-infections are common in sheep and goats. Following alignment of the relevant DNA sequences, two primer sets were designed to specifically target the Theileria spp. 18S rRNA and Anaplasma spp. 16S rRNA gene sequences. Genomic DNA from the two genera was serially diluted tenfold for testing the sensitivities of detection of the primer sets. The specificities of the primer sets were confirmed when DNA from Anaplasma and Theileria (positive controls), other related hematoparasites (negative controls) and ddH 2 O were used as templates. Fifty field samples were also used to evaluate the utility of single PCR and duplex PCR assays, and the detection results were compared with those of the PCR methods previously published. An optimized duplex PCR assay was established from the two primer sets based on the relevant genes from the two TBPs, and this assay generated products of 298-bp (Theileria spp.) and 139-bp (Anaplasma spp.). The detection limit of the assay was 29.4 × 10 -3  ng per μl, and there was no cross-reaction with the DNA from other hematoparasites. The results showed that the newly developed duplex PCR assay had an efficiency of detection (P > 0.05) similar to other published PCR methods. In this study, a duplex PCR assay was developed that can simultaneously identify Theileria spp. and Anaplasma spp. in sheep and goats. This duplex PCR is a potentially valuable assay for epidemiological studies of TBPs in that it can detect cases of mixed infections of the pathogens. Copyright © 2017 Elsevier Inc. All rights reserved.

  14. Violencia basada en género en zonas urbanas y urbano-marginales de Lima y Callao, 2007 - 2010

    Directory of Open Access Journals (Sweden)

    Pedro Mascaro-Sánchez

    2012-04-01

    Full Text Available Objetivos: Determinar y comparar las características de la violencia en pobladores de zonas urbanas y urbano-marginales. Diseño: Estudio epidemiológico descriptivo. Institución: Escuela de Obstetricia, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Participantes: Mujeres de Lima y Callao. Intervenciones: Entre los años 2007 y 2010, se aplicó una entrevista estructurada a 3 971 mujeres de zonas urbanas y urbano-marginales de Lima y Callao. Se incluyó mujeres residentes de la zona, excluyéndose aquellas con problemas psicológicos evidentes y problemas del habla. Los datos fueron analizados con estadísticas descriptivas y con el estadístico chi cuadrado, significativo a un nivel p<0,05. Principales medidas de resultados: Violencia física. Resultados: De las entrevistadas, 39% tenía entre 20 y 24 años de edad. El 47% identificó violencia física, siendo similar en zonas urbanas y urbano-marginales. Los empujones y bofetadas fueron la forma más frecuente de violencia en ambas áreas. Con respecto al estudio de la violencia psicológica, fueron más frecuentes la utilización de gritos y celos por posesividad, también en ambas áreas. El gasto de la pareja sin la consulta fue ligeramente mayor para el área urbano marginal (49% que para el área urbana (42%. El intento de tener relaciones sexuales contra su voluntad fue el tipo de violencia más frecuente (37%, más en el área urbana (41% que en el área urbano marginal (34%. Conclusiones: Se evidenció episodios de violencia física, psicológica, económica y sexual similares para el área urbana y el área urbano-marginal, siendo la violencia sexual más frecuente en el área urbana.

  15. Spatial distribution of Anaplasma phagocytophilum and Hepatozoon canis in red foxes (Vulpes vulpes) in Hungary.

    Science.gov (United States)

    Tolnai, Z; Sréter-Lancz, Z; Sréter, T

    2015-07-01

    In recent years, Ehrlichia canis and Hepatozoon canis transmitted by Rhipicephalus sanguineus were reported from Hungary. The aim of the present study was to reveal the spatial distribution pattern of pathogens transmitted by R. sanguineus in a sentinel species, red fox (Vulpes vulpes) in Hungary and to analyse the relationship of these patterns with landscape and climate by geographical information systems. Fox carcasses, representing 0.5% of the total fox population were randomly selected out of all the foxes of Hungary. The spleen samples of the animals were tested by real-time PCR for Anaplasma platys, Babesia vogeli, E. canis and H. canis infection. Positive results were confirmed by conventional PCR followed by sequencing. The prevalence of H. canis infection was 22.2% (95% CI=18.4-26.4%), and this parasite was detected in all areas including the mountain regions of Hungary. These findings indicate that other tick species or other transmission routes (oral and transplacental) might be in the background of the countrywide distribution of H. canis. Anaplasma platys was not found; nevertheless, the prevalence of Anaplasma phagocytophilum infection transmitted by Ixodes ricinus was 12.5% (95% CI=9.7-16.1%) in foxes. B. vogeli and E. canis infection was not detected. There was no correlation between environmental parameter values in the home range of foxes and A. phagocytophilum or H. canis infection, which is in line with that observed in the case of tick species infesting foxes in Hungary. The results of this study indicate that R. sanguineus, if present, might be rare in Hungary. Our baseline study can be used for future evaluation of the effect of climate change on the spreading and emergence of R. sanguineus transmitted pathogens in Hungary. Copyright © 2015 Elsevier GmbH. All rights reserved.

  16. Molecular Detection of Anaplasma bovis in Cattle from Central Part of Iran

    Directory of Open Access Journals (Sweden)

    Vahid Noaman

    2010-09-01

    Full Text Available Anaplasma bovis is a leukocytotropic agent of bovine anaplasmosis and there is no available information about molecular study on this agent in cattle of Iran. In this study a total 150 cattle blood samples were collected from central part of Iran. The presence of A. bovis examined using light microscopic detection and species-specific nested polymerase chain reaction (nested-PCR based on 16S rRNA gene. Of the 150 cattle, 4 (2.66 % was positive for A. bovis by nested-PCR. These data is the first A. bovis DNA presence in cattle from central part of Iran.

  17. Test of the sheep ked Melophagus ovinus (L) as a vector of Anaplasma ovis Lestoquard.

    Science.gov (United States)

    Zaugg, J L; Coan, M E

    1986-05-01

    The sheep ked Melophagus ovinus was evaluated as a possible vector of Anaplasma ovis. In 4 tests, 45 to 293 keds were transferred from sheep with acute anaplasmosis, low level parasitemia, or carrier state of anaplasmosis to individual splenectomized ewes. Keds were confined in stockinette cages attached to the dorsal midline of the recipient hosts for 10 days. Throughout the 90-day observation periods after the keds were transferred, no clinical, serologic, or hematologic evidence of anaplasmosis was detected in any of the ked-recipient ewes. Results indicate that sheep keds probably are not mechanical or biological vectors of the ovine anaplasmosis organism.

  18. Detection of Ehrlichia spp., Anaplasma spp., Rickettsia spp., and Other Eubacteria in Ticks from the Thai-Myanmar Border and Vietnam

    OpenAIRE

    Parola, Philippe; Cornet, Jean-Paul; Sanogo, Yibayiri Osée; Miller, R. Scott; Thien, Huynh Van; Gonzalez, Jean-Paul; Raoult, Didier; Telford III, Sam R.; Wongsrichanalai, Chansuda

    2003-01-01

    A total of 650 ticks, including 13 species from five genera, were collected from animals, from people, or by flagging of the vegetation at sites on the Thai-Myanmar border and in Vietnam. They were tested by PCR to detect DNA of bacteria of the order Rickettsiales. Three Anaplasma spp. were detected in ticks collected in Thailand, including (i) Anaplasma sp. strain AnDa465, which was considered a genotype of Anaplasma platys (formerly Ehrlichia platys) and which was obtained from Dermacentor ...

  19. Coinfection of sheep with Anaplasma, Theileria and Babesia species in the Kurdistan Region, Iraq.

    Science.gov (United States)

    Renneker, S; Abdo, J; Bakheit, M A; Kullmann, B; Beyer, D; Ahmed, J; Seitzer, U

    2013-11-01

    Infections of small ruminants with Anaplasma, Theileria and Babesia species are widely distributed in the old world and are of great economic impact. In Iraq, data on disease occurrence in sheep caused by above-mentioned infectious agents are scarce. This study provides information on various haemoparasitic agents infecting sheep in the Kurdistan Region, Iraq, using molecular diagnostic tools. Altogether, 195 samples originating from three governorates in the Kurdistan Region, namely Duhok, Erbil and Sulaimaniya, were analysed. The following pathogens were identified: Anaplasma ovis (62.6%), Theileria ovis (14.35%), T. lestoquardi (7.7%), T. uilenbergi (5.6%) and Babesia ovis (1.5%). T. uilenbergi is detected for the first time in Iraq. Coinfection of sheep with different pathogens could be observed in this study, and it was found that 45 of 195 (23%) of the samples contained more than one pathogen. Even triple-positive samples were identified in 3% of the investigated animals. In conclusion, we confirm the coinfection of sheep with various haemoparasitic pathogen species in the Kurdistan Region of Iraq. Further investigations are needed to reveal the epidemiology of the diseases, the respective tick vectors, and, in the case of coinfection, pathogens' interaction and possible cross-protection. © 2013 Blackwell Verlag GmbH.

  20. One particular Anaplasma phagocytophilum ecotype infects cattle in the Camargue, France.

    Science.gov (United States)

    Dugat, Thibaud; Leblond, Agnès; Keck, Nicolas; Lagrée, Anne-Claire; Desjardins, Isabelle; Joulié, Aurélien; Pradier, Sophie; Durand, Benoit; Boulouis, Henri-Jean; Haddad, Nadia

    2017-08-02

    Anaplasma phagocytophilum is a zoonotic tick-borne pathogen responsible for granulocytic anaplasmosis, a mild to a severe febrile disease that affects man and several animal species, including cows and horses. In Europe, I. ricinus is the only proven vector for this pathogen, but studies suggest that other tick genera and species could be involved in its transmission. Our objective was to assess the presence and genetic diversity of A. phagocytophilum in domestic animals and different tick species from the Camargue region, located in the south of France. A total of 140 ticks and blood samples from 998 cattle and 337 horses were collected in Camargue and tested for the presence of A. phagocytophilum DNA by msp2 quantitative real-time PCR. Molecular typing with four markers was performed on positive samples. Anaplasma phagocytophilum DNA was detected in 6/993 (0.6%) cows, 1/20 (5%) Haemaphysalis punctata, 1/57 (1.75%) Rhipicephalus pusillus, and was absent in horses (0%). All cattle A. phagocytophilum presented a profile identical to an A. phagocytophilum variant previously detected in Dermacentor marginatus, Hyalomma marginatum, and Rhipicephalus spp. in Camargue. Our results demonstrate that one particular A. phagocytophilum variant infects cattle in Camargue, where I. ricinus is supposed to be rare or even absent. Dermacentor marginatus, Rhipicephalus spp. and Hyalomma spp., and possibly other tick species could be involved in the transmission of this variant in this region.

  1. Molecular detection of Anaplasma bovis, Ehrlichia canis and Hepatozoon felis in cats from Luanda, Angola.

    Science.gov (United States)

    Oliveira, Ana Cristina; Luz, Maria Francisca; Granada, Sara; Vilhena, Hugo; Nachum-Biala, Yaarit; Lopes, Ana Patrícia; Cardoso, Luís; Baneth, Gad

    2018-03-20

    Molecular identification of tick-borne pathogen infection in cats from Africa is scarce. The presence of bacterial (Anaplasma and Ehrlichia) and protozoal (Babesia and Hepatozoon) agents was investigated in blood samples from 102 domestic cats from Luanda, Angola, by polymerase chain reaction and DNA sequencing. Three cats (2.9%) were found infected with Ehrlichia canis, three (2.9%) with Hepatozoon felis and one (1.0%) with Anaplasma bovis. The prevalence of infections with one single agent was 4.9%, and that of infection with two agents (i.e. E. canis and H. felis) was 1.0%. In total, six cats (5.9%) were found infected with at least one of the detected tick-borne agents. This is the first report of A. bovis, E. canis and H. felis in cats from Angola. To the best of our knowledge, A. bovis is also being reported for the first time in domestic cats outside of Japan. Cats are at a low to moderate risk of being infected with tick-borne agents in Luanda.

  2. Ticks circulate Anaplasma, Ehrlichia, Babesia and Theileria parasites in North of Iran.

    Science.gov (United States)

    Bekloo, Ahmad Jafar; Bakhshi, Hasan; Soufizadeh, Ayoub; Sedaghat, Mohammad Mehdi; Bekloo, Romina Jafar; Ramzgouyan, Maryam Roya; Chegeni, Asadollah Hosseini; Faghihi, Faezeh; Telmadarraiy, Zakkyeh

    2017-12-15

    Ticks serve as important vectors of some pathogens of medical importance all over the world and identification of their rate of infection plays an important role for further control of diseases. In the current study, we investigated on ticks collected from north of Iran where raising and caring livestock are the main task of the people in order to find evidences of infection of Babesia, Theileria, Anaplasma and Ehrlichia microbial agents. Totally, 609 hard tick species from two genera Hyalomma and Rhipicephalus including; Hy. scupense, Hy. dromedarii, Hy. rufipes, Hy. marginatum, Hy. asiaticum, Hy. anatolicum, R. bursa, R. sanguineus and R. turanicus were identified. Molecular analysis revealed the presence of Anaplasma, Ehrlichia, Babesia and Theileria microorganism agents in all collected tick species except Hy. asiaticum and R. turanicus. To the best of our knowledge, this is the first report on identification of B. occultans in Hyalomma anatolicum and B. ovis in Hyalomma sp in Iran. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Molecular detection of Anaplasma phagocytophilum DNA in the lesser horseshoe bat (Rhinolophus hipposideros) guano.

    Science.gov (United States)

    Afonso, E; Goydadin, A-C

    2018-05-30

    Although bats are increasingly recognised as potential reservoir hosts of human zoonotic pathogens, bacteria in bats are still poorly studied. To investigate the DNA faecal prevalence of the bacterium Anaplasma phagocytophilum, we sampled 23 lesser horseshoe bat (Rhinolophus hipposideros) maternity colonies located in buildings (churches, barns) in rural villages of eastern France. A total of 552 faecal samples were collected from 278 individuals. Anaplasma phagocytophilum DNA was detected in the faeces of 63 individuals (22.7%). Such high prevalence might suggest persistent infection in bats and/or a frequent consumption of insect preys carrying bacteria. Faecal DNA prevalence varied highly among colonies but was not related to the colony size. Faecal DNA prevalence was the highest in the Jura Department, where the density of ticks is known to be the highest across the study area. Because the sampled bats live in close proximity to humans, we discuss how concerning the presence of A. phagocytophilum DNA in bat guano is for humans frequenting places of worship that shelter bats. We also advocate future research to understand what a high faecal DNA prevalence in bat guano really implicates in terms of bacteria transmission.

  4. The Prostaglandin E2-EP3 Receptor Axis Regulates Anaplasma phagocytophilum-Mediated NLRC4 Inflammasome Activation

    Czech Academy of Sciences Publication Activity Database

    Wang, X.; Shaw, D.K.; Hammond, H.L.; Sutterwala, F.S.; Rayamajhi, M.; Shirey, K.A.; Perkins, D.J.; Bonventre, J.V.; Velayutham, T.S.; Evans, S.M.; Rodino, K.G.; VieBrock, L.; Scanlon, K.M.; Carbonetti, N.H.; Carlyon, J.A.; Miao, E.A.; McBride, J.W.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2016-01-01

    Roč. 12, č. 8 (2016), č. článku e1005803. E-ISSN 1553-7374 Institutional support: RVO:60077344 Keywords : Rickettsial agents * Anaplasma phagocytophilum * prostaglandin E2-EP3 Receptor Axis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.003, year: 2015

  5. High infection of Anaplasma and Ehrlichia spp. among tick species collected from different geographical locations of Iran

    Directory of Open Access Journals (Sweden)

    Leila Tajedin

    2016-10-01

    Full Text Available Objective: To ascertain the prevalence of the Anaplasma/Ehrlichia infections in tick population within four provinces of Iran. Methods: A total of 384 tick specimens were collected from domestic animals inhabiting in four provinces (East Azerbaijan, Gilan, South Khorasan and Yazd. Specimens were identified based on morphological analysis. The detection of Anaplasma spp./Ehrlichia spp. within tick samples was carried out by nested PCR amplification of the 16S ribosomal RNA gene accompanied by DNA sequencing and analysis for verification. Results: A total of 10 tick species were identified as follows: Ornithodoros lahorensis (O. lahorensis (44.8%, Hyalomma dromedarii (15.6%, Dermacentor marginatus (13.5%, Hyalomma anatolicum (11.2%, Hyalomma asiaticum (5.7%, Hyalomma marginatum (4.9%, Rhipicephalus sanguineus (2.3%, Hyalomma detritum (1.0%, Dermacentor niveus (0.5% and Argas persicus (0.3%. The percentage distribution of Anaplasma/Ehrlichia was 55.5% (213 across 384 studied ticks. Conclusions: To the best of our knowledge, this is the first report of Anaplasma ovis infection in O. lahorensis in Iran. We also conjecture the prevalence of Ehrlichia spp. in Yazd Province based on sequencing results; also, it is suggested that O. lahorensis is a potential vector in the studied area. This survey highlights the importance of Argasidae family to verify and correlate their threat in causing anaplasmosis and other diseases in animals.

  6. Anaplasma phagocytophilum MSP4 and HSP70 Proteins Are Involved in Interactions with Host Cells during Pathogen Infection

    Czech Academy of Sciences Publication Activity Database

    Contreras, M.; Alberdi, P.; Mateos-Hernández, L.; Fernández de Mera, I.G.; García-Pérez, A. L.; Vancová, Marie; Villar, M.; Ayllón, N.; Cabezas Cruz, Alejandro; Valdés, James J.; Stuen, S.; Gortazar, C.; de la Fuente, J.

    2017-01-01

    Roč. 7, JUL 5 (2017), č. článku 307. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : anaplasmosis * immunology * hl60 * tick * vaccine * sheep * Anaplasma phagocytophilum Subject RIV: EC - Immunology OBOR OECD: Immunology Impact factor: 4.300, year: 2016

  7. Molecular detection of Anaplasma platys infection in free-roaming dogs and ticks from Kenya and Ivory Coast

    Czech Academy of Sciences Publication Activity Database

    Matei, I.A.; D'Amico, G.; Yao, P.K.; Ionică, A.M.; Kanyari, P. W. N.; Daskalaki, A.A.; Dumitrache, M.O.; Sándor, A.D.; Gherman, C.M.; Qablan, M.; Modrý, David; Mihalca, A. D.

    2016-01-01

    Roč. 9, MAR 16 (2016), č. článku 157. ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Africa * Anaplasma platys * carnivores * Kenya * Ivory Coast Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.080, year: 2016

  8. Longitudinal field study on bovine Babesia spp. and Anaplasma phagocytophilum infections during a grazing season in Belgium.

    Science.gov (United States)

    Lempereur, Laetitia; Lebrun, Maude; Cuvelier, Pascale; Sépult, Géraldine; Caron, Yannick; Saegerman, Claude; Shiels, Brian; Losson, Bertrand

    2012-04-01

    Anaplasmosis and babesiosis are major tick-borne diseases with a high economic impact but are also a public health concern. Blood samples collected in the spring, summer, and autumn of 2010 from 65 cows in seven different farms in Belgium were monitored with an indirect immunofluorescence antibody test to assess seroprevalence against these pathogens. Seroprevalences to Babesia spp. were measured as 10.7%, 20%, and 12.3% in spring, summer, and autumn, respectively, whereas seroprevalences to Anaplasma phagocytophilum were 30.8%, 77%, and 56.9%, respectively. A total of 805 Ixodes ricinus ticks were collected at the same time from both cattle (feeding ticks) and grazed pastures (questing ticks). The infection level of ticks, assessed by PCR assay, for Babesia spp. DNA was 14.6% and 7.9% in feeding and questing ticks, respectively, whereas 21.7% and 3% of feeding and questing ticks were found be positive for A. phagocytophilum cDNA. Fifty-five PCR-positive samples were identified by sequencing as Babesia sp. EU1, of which five from feeding ticks were positive for both A. phagocytophilum and Babesia sp. EU1. The high density of wild cervids in the study area could explain these observations, as deer are considered to be the main hosts for adults of I. ricinus. However, the absence of Babesia divergens both in feeding and questing ticks is surprising, as the study area is known to be endemic for cattle babesiosis. Increasing cervid populations and comorbidity could play an import role in the epidemiology of these tick-borne diseases.

  9. Monoinfections caused by Borrelia burgdorferi and Borrelia burgdorferi / Anaplasma phagocytophilum co-infections in forestry workers and farmers

    Directory of Open Access Journals (Sweden)

    Małgorzata Tokarska-Rodak

    2015-10-01

    Full Text Available Background: The presence of co-infections induced by tick-borne pathogens in humans is an important epidemiological phenomenon. This issue has attracted growing attention of doctors and people working under conditions of an increased risk of being exposed to tick bites. Material and Methods: The research group consisted of 93 individuals with current anti-immunoglobulin M/G (IgM/ IgG Borrelia burgdorferi or IgG anti-Anaplasma phagocytophilum. The respondents were identified during the screening survey in a group of farmers and foresters occupationally exposed to tick bites. The aim of the work was to analyse the frequency of antibodies to specific antigens of B. burgdorferi and the levels of cytokines in forestry workers and farmers with B. burgdorferi monoinfections and B. burgdorferi / A. phagocytophilum co-infections. Statistical analysis was performed using the Chi2, Mann-Whitney U and Kruskal-Wallis tests. Results: There is a stronger generation of IgG antibodies to B. burgdorferi antigens in patients with B. burgdorferi / A. phagocytophilum co-infections, such as variable major protein-like sequence expressed (VlsE (p < 0.05, p19 (p < 0.02, p17 (p < 0.05 and complement regulator-acquiring surface protein 3 (CRASP3 (p < 0.02 compared to persons with B. burgdorferi monoinfections. The discrepancies in the synthesis of cytokines interleukin 6 (IL-6, IL-10, and tumor necrosis factor α (TNF-α have not been found in persons with B. burgdorferi monoinfections and B. burgdorferi / A. phagocytophilum co-infection. Conclusions: The immune response directed against B. burgdorferi is stronger in patients co-infected with B. burgdorferi and A. phagocytophilum than in those with monoinfection. Med Pr 2015;66(5:645–651

  10. Whole genome transcription profiling of Anaplasma phagocytophilum in human and tick host cells by tiling array analysis

    Directory of Open Access Journals (Sweden)

    Chavez Adela

    2008-07-01

    Full Text Available Abstract Background Anaplasma phagocytophilum (Ap is an obligate intracellular bacterium and the agent of human granulocytic anaplasmosis, an emerging tick-borne disease. Ap alternately infects ticks and mammals and a variety of cell types within each. Understanding the biology behind such versatile cellular parasitism may be derived through the use of tiling microarrays to establish high resolution, genome-wide transcription profiles of the organism as it infects cell lines representative of its life cycle (tick; ISE6 and pathogenesis (human; HL-60 and HMEC-1. Results Detailed, host cell specific transcriptional behavior was revealed. There was extensive differential Ap gene transcription between the tick (ISE6 and the human (HL-60 and HMEC-1 cell lines, with far fewer differentially transcribed genes between the human cell lines, and all disproportionately represented by membrane or surface proteins. There were Ap genes exclusively transcribed in each cell line, apparent human- and tick-specific operons and paralogs, and anti-sense transcripts that suggest novel expression regulation processes. Seven virB2 paralogs (of the bacterial type IV secretion system showed human or tick cell dependent transcription. Previously unrecognized genes and coding sequences were identified, as were the expressed p44/msp2 (major surface proteins paralogs (of 114 total, through elevated signal produced to the unique hypervariable region of each – 2/114 in HL-60, 3/114 in HMEC-1, and none in ISE6. Conclusion Using these methods, whole genome transcription profiles can likely be generated for Ap, as well as other obligate intracellular organisms, in any host cells and for all stages of the cell infection process. Visual representation of comprehensive transcription data alongside an annotated map of the genome renders complex transcription into discernable patterns.

  11. Análisis de la dinámica relacional generada por las websites de Internet en el desarrollo de los turismos marginales

    Directory of Open Access Journals (Sweden)

    José Mª Prat

    2012-01-01

    Full Text Available El conocimiento de los actores turísticos del territorio, y de sus relaciones, es un elemento básico para la gestión activa de cualquier destino turístico. Como que, gracias a las nuevas tecnologías de la información y a la popularizacióndel uso de Internet, se han creado una gran cantidad de relaciones sociales gracias a las websites, interrelacionadas, que han permitido una rápida y amplia difusión promocional de aquellos destinos que ofrecen unas alternativas turísticas más marginales, como respuesta a los nuevos planteamientos post-fordistas del turismo, generándose una dinámica relacional que se ha beneficiado del rápido desarrollo de las TIC's. En este trabajo se han analizado dichas relaciones entre websites, en el caso del desarrollo de dos turismos marginales, el naturista y el swinger, en Cap d'Agde, en el sur de Francia, comprobándose la existencia de una relación directa entre la dinámica relacional del territorio y elgrado de desarrollo de los turismos marginales.

  12. Usos marginales de los marcadores del discurso. Su efecto en la comprensión lectora en español como lengua extranjera

    Directory of Open Access Journals (Sweden)

    María Fernanda Pelayo

    2003-04-01

    Full Text Available En este trabajo abordamos lo que hemos denominado usos marginales de los marcadores del discurso y cómo afectan a la comprensión lectora en español como lengua extranjera. Tras un análisis y definición de estos usos no ortodoxos de los marcadores del discurso, realizamos una clasificación preliminar de los mismos. Finalmente, diseñamos y llevamos a cabo un estudio empírico acerca de la manera en que los usos marginales de los marcadores del discurso podrían afectar a la comprensión lectora de textos en español como lengua extranjera. Losresultados obtenidos en este estudio experimental muestran que existe una tendencia bastante generalizada que nos hace aventurarnos a concluir que efectivamente los lectores de español como lengua extranjera muestran tenerproblemas para comprender textos en los que se han empleado usos marginales de los marcadores del discurso. Por otra parte, el uso ortodoxo de los marcadores del discurso parece favorecer la comprensión adecuada del texto.

  13. NCBI nr-aa BLAST: CBRC-ACAR-01-1026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1026 ref|YP_153799.1| hypothetical protein AM518 [Anaplasma marginale ...str. St. Maries] gb|AAV86544.1| hypothetical protein AM518 [Anaplasma marginale str. St. Maries] YP_153799.1 3.7 24% ...

  14. NCBI nr-aa BLAST: CBRC-LAFR-01-0905 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0905 ref|YP_153919.1| hypothetical protein AM688 [Anaplasma marginale ...str. St. Maries] gb|AAV86664.1| hypothetical protein AM688 [Anaplasma marginale str. St. Maries] YP_153919.1 5e-08 62% ...

  15. Babesia canis vogeli, Ehrlichia canis, and Anaplasma platys infection in a dog.

    Science.gov (United States)

    Al Izzi, Salah; Martin, Donald S; Chan, Roxanne Y Y; Leutenegger, Christian M

    2013-12-01

    A 12-month-old male neutered mixed breed dog was presented with a history of diarrhea, lethargy, emaciation, polydypsia, and sniffling. Physical examination findings included pale mucous membranes, increased heart and respiratory rates, and normal rectal temperature (38°C). Hematologic abnormalities included anemia and thrombocytopenia. Biochemical abnormalities included hypoalbuminemia, hyperbilirubinemia, and elevated ALP and ALT activities. A SNAP 4Dx test result was positive for Ehrlichia canis. Babesia canis vogeli organisms were found in the peripheral blood films, while morulae of E canis were not seen. Real-time polymerase chain reaction testing confirmed the presence of both B c vogeli and E canis organisms, and also was positive for Anaplasma platys infection. The dog recovered following treatment with doxycycline and imidocarb dipropionate, with normal hematology and biochemical profiles. © 2013 American Society for Veterinary Clinical Pathology.

  16. Molecular Characterization and Phylogenetic Analysis of Anaplasma spp. and Ehrlichia spp. Isolated from Various Ticks in Southeastern and Northwestern Regions of Iran.

    Science.gov (United States)

    Jafar Bekloo, Ahmad; Ramzgouyan, Maryam Roya; Shirian, Sadegh; Faghihi, Faezeh; Bakhshi, Hassan; Naseri, Fatemeh; Sedaghat, Mehdi; Telmadarraiy, Zakkyeh

    2018-05-01

    Anaplasma/Ehrlichia species are tick-transmitted pathogens that cause infections in humans and numerous domestic and wild animal species. There is no information available on the molecular characteristics and phylogenetic position of Anaplasma/Ehrlichia spp. isolated from tick species from different geographic locations in Iran. The aim of this study was to determine the prevalence, molecular characteristics, and phylogenetic relationship of both Anaplasma spp. and Ehrlichia spp. in tick species isolated from different domestic animals from two different geographical locations of Iran. A total of 930 ticks were collected from 93 cattle, 250 sheep, and 587 goats inhabiting the study areas. The collected ticks were then investigated for the presence of Anaplasma/Ehrlichia spp. using nested PCR based on the 16S rRNA gene, followed by sequencing. Sequence analysis was done based on the data published in the GenBank on Anaplasma/Ehrlichia spp. isolates using bioinformatic tools such as the standard nucleotide BLAST. Genome of Anaplasma or Ehrlichia spp. was detected in 14 ticks collected in Heris, including 5 Dermacentor marginatus, 1 Haemaphysalis erinacei, 3 Hyalomma anatolicum, and 4 Rhipicephalus sanguineus, also in 29 ticks collected in Chabahar, including 14 R. sanguineus, 8 D. marginatus, 3 Hyalomma Anatolicum, and 4 Hyalomma dromedarii. Partial analysis of the 16S rRNA gene sequence of positive samples collected from goats and sheep showed that they were infected with Anaplasma/Ehrlichia spp. that were 94-98% identical to ovine Anaplasma and 91-96% identical to Neoehrlichia and Ehrlichia spp. The various ticks identified in this study suggest the possible emergence of tick-borne diseases in animals and humans in these regions. R. sanguineus and D. marginatus seem to be predominant vectors responsible for anaplasmosis in these regions. Partial sequence analysis of the 16S rRNA gene showed that A. ovis is genetically polymorphic in these regions. Furthermore, an

  17. Detection of Anaplasma phagocytophilum DNA in Ixodes Ticks (Acari: Ixodidae) from Madeira Island and Setúbal District, Mainland Portugal

    Science.gov (United States)

    Santos-Silva, Maria Margarida; Almeida, Victor Carlos; Bacellar, Fátima; Dumler, John Stephen

    2004-01-01

    A total of 278 Ixodes ticks, collected from Madeira Island and Setúbal District, mainland Portugal, were examined by polymerase chain reaction (PCR) for the presence of Anaplasma phagocytophilum. Six (4%) of 142 Ixodes ricinus nymphs collected in Madeira Island and 1 nymph and 1 male (2%) of 93 I. ventalloi collected in Setúbal District tested positive for A. phagocytophilum msp2 genes or rrs. Infection was not detected among 43 I. ricinus on mainland Portugal. All PCR products were confirmed by nucleotide sequencing to be identical or to be most closely related to A. phagocytophilum. To our knowledge, this is the first evidence of A. phagocytophilum in ticks from Setúbal District, mainland Portugal, and the first documentation of Anaplasma infection in I. ventalloi. Moreover, these findings confirm the persistence of A. phagocytophilum in Madeira Island's I. ricinus. PMID:15498168

  18. Detection of Anaplasma phagocytophilum DNA in Ixodes ticks (Acari: Ixodidae) from Madeira Island and Setubal District, mainland Portugal.

    Science.gov (United States)

    Santos, Ana Sofia; Santos-Silva, Maria Margarida; Almeida, Victor Carlos; Bacellar, Fátima; Dumler, John Stephen

    2004-09-01

    A total of 278 Ixodes ticks, collected from Madeira Island and Setubal District, mainland Portugal, were examined by polymerase chain reaction (PCR) for the presence of Anaplasma phagocytophilum. Six (4%) of 142 Ixodes ricinus nymphs collected in Madeira Island and 1 nymph and 1 male (2%) of 93 I. ventalloi collected in Setubal District tested positive for A. phagocytophilum msp2 genes or rrs. Infection was not detected among 43 I. ricinus on mainland Portugal. All PCR products were confirmed by nucleotide sequencing to be identical or to be most closely related to A. phagocytophilum. To our knowledge, this is the first evidence of A. phagocytophilum in ticks from Setubal District, mainland Portugal, and the first documentation of Anaplasma infection in I. ventalloi. Moreover, these findings confirm the persistence of A. phagocytophilum in Madeira Island's I. ricinus.

  19. Detection of Anaplasma sp. phylogenetically related to A. phagocytophilum in a free-living bird in Brazil

    Directory of Open Access Journals (Sweden)

    Anna Claudia Baumel Mongruel

    2017-08-01

    Full Text Available Abstract Wild animals play an important role in carrying vectors that may potentially transmit pathogens. Several reports highlighted the participation of wild animals on the Anaplasma phagocytophilum cycle, including as hosts of the agent. The aim of this study was to report the molecular detection of an agent phylogenetically related to A. phagocytophilum isolated from a wild bird in the Midwest of the state of Paraná, Brazil. Fifteen blood samples were collected from eleven different bird species in the Guarapuava region. One sample collected from a Penelope obscura bird was positive in nested PCR targeting the 16S rRNA gene of Anaplasma spp. The phylogenetic tree based on the Maximum Likelihood analysis showed that the sequence obtained was placed in the same clade with A. phagocytophilum isolated from domestic cats in Brazil. The present study reports the first molecular detection of a phylogenetically related A. phagocytophilum bacterium in a bird from Paraná State.

  20. First report of Anaplasma ovis in pupal and adult Melophagus ovinus (sheep ked) collected in South Xinjiang, China.

    Science.gov (United States)

    Zhao, Li; He, Bo; Li, Kai-Rui; Li, Fei; Zhang, Lu-Yao; Li, Xian-Qiang; Liu, Yong-Hong

    2018-04-19

    Melophagus ovinus (sheep ked) is a blood-feeding ectoparasite that belongs to the family Hippoboscidae (Diptera: Hippoboscoidea) and mainly parasitizes sheep. The life-cycle of M. ovinus consists of three stages: larva, pupa and adult. It has a worldwide distribution and has been found in four provinces of China, especially South Xinjiang. In addition to causing direct damage to animal hosts, M. ovinus serves as a vector for disease transmission. In this study, our aim was to investigate the presence of Anaplasma spp. in pupal and adult M. ovinus. A total of 93 specimens (including eight pupal specimens) of M. ovinus collected in South Xinjiang were selected for isolation of genomic DNA, followed by PCR amplification and sequencing of the msp4 gene of Anaplasma spp. The sequences were analyzed in MEGA 7.0 software and via online BLAST. PCR and sequencing results showed that all the specimens collected in 2013 were free of Anaplasma spp., whereas three and 25 specimens (including five pupal specimens) collected in 2016 and 2017, respectively, tested positive for Anaplasma spp. The analysis of 24 msp4 gene sequences (from four pupal specimens) confirmed the presence of A. ovis in M. ovinus specimens collected in South Xinjiang, China. The detected A. ovis isolates belong to Genotypes II and III. To the best of our knowledge, this is the first report of the detection of A. ovis DNA in pupal M. ovinus, confirming the vertical transmission of A. ovis in M. ovinus and the potential of M. ovinus to serve as a vector for A. ovis.

  1. Seroprevalence and risk factors associated with Ehrlichia canis, Anaplasma spp., Borrelia burgdorferi sensu lato, and D. immitis in hunting dogs from southern Italy.

    Science.gov (United States)

    Piantedosi, Diego; Neola, Benedetto; D'Alessio, Nicola; Di Prisco, Francesca; Santoro, Mario; Pacifico, Laura; Sgroi, Giovanni; Auletta, Luigi; Buch, Jesse; Chandrashekar, Ramaswamy; Breitschwerdt, Edward B; Veneziano, Vincenzo

    2017-10-01

    Canine vector-borne diseases (CVBDs) are caused by a range of pathogens transmitted to dogs by arthropods. The present study investigates Ehrlichia canis, Anaplasma spp., Borrelia burgdorferi sensu lato, and Dirofilaria immitis seroprevalences in hunting dogs from southern Italy. Dogs (no. 1335) were tested using a commercial in-clinic enzyme-linked immunosorbent assay kit. Odds ratios (ORs) were calculated by logistic regression analysis to identify risk factors. Overall, 138/1335 dogs (10.3%) were seroreactive to at least one CVBD pathogen. E. canis, Anaplasma spp., B. burgdorferi s.l., and D. immitis seroprevalences were 7.6, 4.4, 0.3, and 0.2%, respectively. E. canis and Anaplasma spp. co-exposures were found in 30 dogs (2.2%), compared with Anaplasma spp. and B. burgdorferi s.l. co-exposures in 2 dogs (0.1%). Adult age was a risk factor for E. canis (OR 2.35) seroreactivity whereas hunting fur-bearing animals for E. canis (OR 4.75) and Anaplasma spp. (OR 1.87), respectively. The historical presence of tick infestation was identified as a risk factor for positivity to E. canis (OR 2.08) and Anaplasma spp. (OR 2.15). Finally, larger dog pack size was significantly associated with E. canis (OR 1.85) and Anaplasma spp. (OR 2.42) exposures. The results of the present survey indicated that hunting dog populations are at relative risk of CVBDs in southern Italy. Further studies are needed to evaluate the role of hunting dogs in the epidemiology of vector-borne organisms due to sharing common environments with wild, sympatric animal populations.

  2. Deficiencia de Vitamina A y Estado Nutricional Antropométrico en niños MarginalesUrbanos y Rurales en el Estado Zulia, Venezuela

    OpenAIRE

    Amaya-Castellanos, Daisy; Viloria-Castejón, Haydée; Ortega, Pablo; Gómez, Gisela; Urrieta, Jesús R; Lobo, Pablo; Estévez, Jesús

    2002-01-01

    El presente estudio transversal fue realizado para estimar la prevalencia de deficiencia de vitamina A (DVA) y desnutrición proteico-energética en una población infantil (24 a 85 meses) de tres barrios marginales urbanos de Maracaibo Estado Zulia, Venezuela (n=173) y de una zona rural (n=34), vecina a Maracaibo, por medio del análisis del retinol sérico y mediciones antropométricas, aplicando puntuación Z a los indicadores Talla//Edad (ZT//E); Peso//Edad (ZP//E) y Peso//Talla (ZP//T), compara...

  3. Human Exposure to Anaplasma phagocytophilum in Two Cities of Northwestern Morocco

    Science.gov (United States)

    Elhamiani Khatat, Sarah; Sahibi, Hamid; Hing, Mony; Alaoui Moustain, Ismail; El Amri, Hamid; Benajiba, Mohammed; Kachani, Malika; Duchateau, Luc; Daminet, Sylvie

    2016-01-01

    Anaplasma phagocytophilum is an emerging tick-borne zoonosis with extensive increased interest. Epidemiological data are available in several regions of the USA, Europe and Asia in contrast to other parts of the world such as North Africa. Blood samples of 261 healthy individuals divided in two groups i.e., dog handlers and blood donors were analysed. Indirect immunofluorescent assay using a commercial kit was performed to detect specific A. phagocytophilum IgG. Two dilutions were used to assess the prevalence of seroreactive samples. Demographic variables were assessed as potential risk factors using exact logistic regression. Seropositivity rates reached 37% and 27% in dog handlers and 36% and 22% in blood donors. No statistically significant differences were found in the prevalence rates between the two groups. Analysis of risk factors such as gender, age groups, outdoor activities, self-reported previous exposure to ticks, or contact with domestic animals (dogs, cats, ruminants and horses) did not shown any significant difference. A. phagocytophilum exposure was common in both high-risk population and blood donors in Morocco. PMID:27532208

  4. Mixed Ehrlichia canis, Hepatozoon canis, and presumptive Anaplasma phagocytophilum infection in a dog.

    Science.gov (United States)

    Mylonakis, Mathio E; Koutinas, Alex F; Baneth, Gad; Polizopoulou, Zoe; Fytianou, Anna

    2004-01-01

    A 5-month-old, female, mongrel dog was admitted to the Clinic of Companion Animal Medicine, Aristotle University of Thessaloniki, Greece, with depression, anorexia, fever, peripheral lymphadenopathy, splenomegaly, oculonasal discharge, nonregenerative anemia, and mild thrombocytopenia. Cytology of Giemsa-stained buffy coat, bone marrow, and lymph node aspiration smears revealed numerous morulae in mononuclear leukocytes and in neutrophils, and Hepatozoon canis gamonts in neutrophils. The dog was seropositive to Ehrlichia canis (immunofluorescence assay [IFA]) and Hepatozoon canis (ELISA) but not to Anaplasma phagocytophilum (IFA). A nested polymerase chain reaction performed on bone marrow aspirates was positive for E canis. This method was not applied for the detection of A phagocytophilum. Treatment with doxycycline and imidocarb dipropionate resulted in both clinical and parasitologic cure. This is the first reported case of a mixed infection with E canis, H canis, and presumptive A phagocytophilum. The findings emphasize the value of cytology in offering a quick and inexpensive diagnosis in mixed tick-borne infections of dogs.

  5. Anaplasma phagocytophilum-Related Defects in CD8, NKT, and NK Lymphocyte Cytotoxicity

    Directory of Open Access Journals (Sweden)

    Diana G. Scorpio

    2018-04-01

    Full Text Available Human granulocytic anaplasmosis, caused by the tick-transmitted Anaplasma phagocytophilum, is not controlled by innate immunity, and induces a proinflammatory disease state with innate immune cell activation. In A. phagocytophilum murine infection models, hepatic injury occurs with production of IFNγ thought to be derived from NK, NKT cells, and CD8 T lymphocytes. Specific A. phagocytophilum ligands that drive inflammation and disease are not known, but suggest a clinical and pathophysiologic basis strikingly like macrophage activation syndrome (MAS and hemophagocytic syndrome (HPS. We studied in vivo responses of NK, NKT, and CD8 T lymphocytes from infected animals for correlates of lymphocyte-mediated cytotoxicity and examined in vitro interactions with A. phagocytophilum-loaded antigen-presenting cells (APCs. Murine splenocytes were examined and found deficient in cytotoxicity as determined by CD107a expression in vitro for specific CTL effector subsets as determined by flow cytometry. Moreover, A. phagocytophilum-loaded APCs did not lead to IFNγ production among CTLs in vitro. These findings support the concept of impaired cytotoxicity with A. phagocytophilum presentation by APCs that express MHC class I and that interact with innate and adaptive immune cells with or after infection. The findings strengthen the concept of an enhanced proinflammatory phenotype, such as MAS and HPS disease states as the basis of disease and severity with A. phagocytophilum infection, and perhaps by other obligate intracellular bacteria.

  6. Anaplasma phagocytophilum Manipulates Host Cell Apoptosis by Different Mechanisms to Establish Infection

    Directory of Open Access Journals (Sweden)

    Pilar Alberdi

    2016-07-01

    Full Text Available Anaplasma phagocytophilum is an emerging zoonotic pathogen that causes human and animal granulocytic anaplasmosis and tick-borne fever of ruminants. This obligate intracellular bacterium evolved to use common strategies to establish infection in both vertebrate hosts and tick vectors. Herein, we discuss the different strategies used by the pathogen to modulate cell apoptosis and establish infection in host cells. In vertebrate neutrophils and human promyelocytic cells HL-60, both pro-apoptotic and anti-apoptotic factors have been reported. Tissue-specific differences in tick response to infection and differential regulation of apoptosis pathways have been observed in adult female midguts and salivary glands in response to infection with A. phagocytophilum. In tick midguts, pathogen inhibits apoptosis through the Janus kinase/signal transducers and activators of transcription (JAK/STAT pathway, while in salivary glands, the intrinsic apoptosis pathways is inhibited but tick cells respond with the activation of the extrinsic apoptosis pathway. In Ixodes scapularis ISE6 cells, bacterial infection down-regulates mitochondrial porin and manipulates protein processing in the endoplasmic reticulum and cell glucose metabolism to inhibit apoptosis and facilitate infection, whereas in IRE/CTVM20 tick cells, inhibition of apoptosis appears to be regulated by lower caspase levels. These results suggest that A. phagocytophilum uses different mechanisms to inhibit apoptosis for infection of both vertebrate and invertebrate hosts.

  7. Diversity of ankA and msp4 genes of Anaplasma phagocytophilum in Slovenia.

    Science.gov (United States)

    Strašek Smrdel, Katja; von Loewenich, Friederike D; Petrovec, Miroslav; Avšič Županc, Tatjana

    2015-03-01

    Granulocytic anaplasmosis is a tick transmitted emerging disease in Europe and worldwide. The agent, Anaplasma phagocytophilum is transmitted by ticks of the genus Ixodes and causes infections in humans and domestic animals. The analysis of different target genes showed that in nature several genetic variants of A. phagocytophilum were present. The purpose of our study was to genetically characterize A. phagocytophilum strains from eight humans, 16 dogs, 12 wild boars, one bear and 18 tick pools from Slovenia. Therefore, the ankA and msp4 genes of A. phagocytophilum were chosen. The same genetic ankA and msp4 variant of A. phagocytophilum was detected in humans, wild boar and a part of the pooled ticks indicating that it circulates in a zoonotic cycle between wild boar and ticks. In dogs, three ankA variants of A. phagocytophilum were detected. One of them was identical to the one that was found in humans. In contrast, all dogs harboured the same msp4 variant as humans and wild boar. In ticks, numerous ankA and msp4 variants were present. Copyright © 2014 Elsevier GmbH. All rights reserved.

  8. Epigenetic silencing of host cell defense genes enhances intracellular survival of the rickettsial pathogen Anaplasma phagocytophilum.

    Directory of Open Access Journals (Sweden)

    Jose C Garcia-Garcia

    2009-06-01

    Full Text Available Intracellular bacteria have evolved mechanisms that promote survival within hostile host environments, often resulting in functional dysregulation and disease. Using the Anaplasma phagocytophilum-infected granulocyte model, we establish a link between host chromatin modifications, defense gene transcription and intracellular bacterial infection. Infection of THP-1 cells with A. phagocytophilum led to silencing of host defense gene expression. Histone deacetylase 1 (HDAC1 expression, activity and binding to the defense gene promoters significantly increased during infection, which resulted in decreased histone H3 acetylation in infected cells. HDAC1 overexpression enhanced infection, whereas pharmacologic and siRNA HDAC1 inhibition significantly decreased bacterial load. HDAC2 does not seem to be involved, since HDAC2 silencing by siRNA had no effect on A. phagocytophilum intracellular propagation. These data indicate that HDAC up-regulation and epigenetic silencing of host cell defense genes is required for A. phagocytophilum infection. Bacterial epigenetic regulation of host cell gene transcription could be a general mechanism that enhances intracellular pathogen survival while altering cell function and promoting disease.

  9. Remodeling of tick cytoskeleton in response to infection with Anaplasma phagocytophilum.

    Science.gov (United States)

    Cabezas-Cruz, Alejandro; Alberdi, Pilar; Valdes, James J; Villar, Margarita; de la Fuente, Jose

    2017-06-01

    The obligate intracellular pathogen Anaplasma phagocytophilum infects vertebrate and tick hosts. In this study, a genome-wide search for cytoskeleton components was performed in the tick vector, Ixodes scapularis . The available transcriptomics and proteomics data was then used to characterize the mRNA and protein levels of I. scapularis cytoskeleton components in response to A. phagocytophilum infection. The results showed that cytoskeleton components described in other model organisms were present in the I. scapularis genome. One type of intermediate filaments (lamin), a family of septins that was recently implicated in the cellular response to intracellular pathogens, and several members of motor proteins (kinesins and dyneins) that could be implicated in the cytoplasmic movements of A. phagocytophilum were found. The results showed that levels of tubulin, actin, septin, actin-related proteins and motor proteins were affected by A. phagocytophilum , probably to facilitate infection in I. scapularis . Functional studies demonstrated a role for selected cytoskeleton components in pathogen infection. These results provided a more comprehensive view of the cytoskeletal components involved in the response to A. phagocytophilum infection in ticks.

  10. Superinfection occurs in Anaplasma phagocytophilum infected sheep irrespective of infection phase and protection status

    Directory of Open Access Journals (Sweden)

    Bergström Karin

    2009-10-01

    Full Text Available Abstract Background Anaplasma phagocytophilum infection in domestic ruminants is widespread in the coastal areas of southern Norway. The bacteria may persist in mammalian hosts. Several genetic variants of A. phagocytophilum exist. In the present study, we investigate whether superinfection occurs in the acute and persistent phase of the infection. Methods Five-month-old lambs of the Norwegian Dala breed were experimentally infected with two 16S rRNA gene variants of A. phagocytophilum, i.e. A. phagocytophilum variant 1 (GenBank accession number M73220 and variant 2 (GenBank acc. no. AF336220. Eighteen lambs were used, two lambs in each group. Eight groups were experimentally inoculated with either variant 1 or 2 on day 0. Six of these groups were then challenged with the other variant on either days 7, 42 or 84, respectively. One group was left uninfected. The occurrence of A. phagocytophilum in blood samples was determined using semi-nested PCR analysis and gene sequencing. Specific antibodies were measured by an indirect immunofluorescence antibody assay (IFA. Results A. phagocytophilum variant 1 and 2 differed significantly with regards to clinical reaction and cross-immunity in infected lambs. Both variants were found in the blood after challenge. However, variant 1 was detected most frequently. Conclusion The present experiment indicates that superinfection of different genotypes occurs during the acute as well as the persistent phase of an A. phagocytophilum infection, even in lambs protected against the challenged infection.

  11. Detection of Ehrlichia spp., Anaplasma spp., Rickettsia spp., and other eubacteria in ticks from the Thai-Myanmar border and Vietnam.

    Science.gov (United States)

    Parola, Philippe; Cornet, Jean-Paul; Sanogo, Yibayiri Osée; Miller, R Scott; Thien, Huynh Van; Gonzalez, Jean-Paul; Raoult, Didier; Telford III, Sam R; Wongsrichanalai, Chansuda

    2003-04-01

    A total of 650 ticks, including 13 species from five genera, were collected from animals, from people, or by flagging of the vegetation at sites on the Thai-Myanmar border and in Vietnam. They were tested by PCR to detect DNA of bacteria of the order RICKETTSIALES: Three Anaplasma spp. were detected in ticks collected in Thailand, including (i) Anaplasma sp. strain AnDa465, which was considered a genotype of Anaplasma platys (formerly Ehrlichia platys) and which was obtained from Dermacentor auratus ticks collected from dogs; (ii) Anaplasma sp. strain AnAj360, which was obtained from Amblyomma javanense ticks collected on a pangolin; and (iii) Anaplasma sp. strain AnHl446, which was closely related to Anaplasma bovis and which was detected in Haemaphysalis lagrangei ticks collected from a bear. Three Ehrlichia spp. were identified, including (i) Ehrlichia sp. strain EBm52, which was obtained from Boophilus microplus ticks collected from cattle from Thailand; (ii) Ehrlichia sp. strain EHh324, which was closely related to Ehrlichia chaffeensis and which was detected in Haemaphysalis hystricis ticks collected from wild pigs in Vietnam; and (iii) Ehrlichia sp. strain EHh317, which was closely related to Ehrlichia sp. strain EBm52 and which was also detected in H. hystricis ticks collected from wild pigs in Vietnam. Two Rickettsia spp. were detected in Thailand, including (i) Rickettsia sp. strain RDla420, which was detected in Dermacentor auratus ticks collected from a bear, and (ii) Rickettsia sp. strain RDla440, which was identified from two pools of Dermacentor larvae collected from a wild pig nest. Finally, two bacteria named Eubacterium sp. strain Hw124 and Eubacterium sp. strain Hw191 were identified in Haemaphysalis wellingtoni ticks collected from chicken in Thailand; these strains could belong to a new group of bacteria.

  12. Intraoperative bleeding in dogs from Grenada seroreactive to Anaplasma platys and Ehrlichia canis.

    Science.gov (United States)

    Lanza-Perea, M; Zieger, U; Qurollo, B A; Hegarty, B C; Pultorak, E L; Kumthekar, S; Bruhl-Day, R; Breitschwerdt, E B

    2014-01-01

    Frequent exposure of Grenadian dogs to Rhipicephalus sanguineus results in Anaplasma platys, and Ehrlichia canis seroreactivity. During elective surgeries, substantial intraoperative hemorrhage occurs in some seroreactive dogs. To assess hemostatic parameters and bleeding tendencies as well as prevalence of PCR positivity in apparently healthy A. platys and E. canis seroreactive and seronegative free-roaming dogs from Grenada. Forty-seven elective surgery dogs allocated to 4 groups: Seronegative control (n = 12), A. platys (n = 10), E. canis (n = 14) and A. platys, and E. canis (n = 11) seroreactive. Preoperatively, hemostasis was assessed by platelet count, prothrombin time, activated partial thromboplastin time, and buccal mucosal bleeding time. Intra- and postoperative bleeding scores were subjectively assigned. Blood, spleen, bone marrow, and lymph node aspirates were tested by PCR. Bleeding scores in dogs coseroreactive for A. platys and E. canis were higher (P = .015) than those of seronegative dogs. A. platys DNA was amplified from 7/21 (33%) A. platys seroreactive dogs and from 1 E. canis seroreactive dog; E. canis DNA was amplified from 21/25 (84%) E. canis seroreactive dogs. E. canis DNA was amplified most often from blood, whereas A. platys DNA was amplified most often from bone marrow. Apparently healthy, free-roaming dogs coseropositive for A. platys and E. canis may have increased intraoperative bleeding tendencies despite normal hemostatic parameters. Future investigations should explore the potential for vascular injury as a cause for bleeding in these dogs. Improved tick control is needed for dogs in Grenada. Copyright © 2014 by the American College of Veterinary Internal Medicine.

  13. Canine infection with Borrelia burgdorferi, Dirofilaria immitis, Anaplasma spp. and Ehrlichia spp. in Canada, 2013-2014.

    Science.gov (United States)

    Herrin, Brian H; Peregrine, Andrew S; Goring, Jonas; Beall, Melissa J; Little, Susan E

    2017-05-19

    Canine test results generated by veterinarians throughout Canada from 2013-2014 were evaluated to assess the geographical distribution of canine infection with Borrelia burgdorferi, Dirofilaria immitis, Ehrlichia spp., and Anaplasma spp. The percent positive test results of 115,636 SNAP® 4Dx® Plus tests from dogs tested were collated by province and municipality to determine the distribution of these vector-borne infections in Canada. A total of 2,844/115,636 (2.5%) dogs tested positive for antibody to B. burgdorferi. In contrast, positive test results for D. immitis antigen and antibodies to Ehrlichia spp. and Anaplasma spp. were low, with less than 0.5% of dogs testing positive for any one of these three agents nationwide. Provincial seroprevalence for antibodies to B. burgdorferi ranged from 0.5% (Saskatchewan)-15.7% (Nova Scotia); the areas of highest percent positive test results were in proximity to regions in the USA considered endemic for Lyme borreliosis, including Nova Scotia (15.7%) and Eastern Ontario (5.1%). These high endemic foci, which had significantly higher percent positive test results than the rest of the nation (P Canada. Using dogs as sentinels for these pathogens can aid in recognition of the public and veterinary health threat that each pose.

  14. DETECTION OF ANTIBODIES TO ANAPLASMA, BARTONELLA AND COXIELLA IN RURAL INHABITANTS OF THE CARIBBEAN AREA OF COLOMBIA

    Directory of Open Access Journals (Sweden)

    Salim Máttar

    2006-12-01

    Full Text Available Objetivo. Establecer la seroprevalencia de Bartonella spp, Anaplasma phagocytophilum (antesErlichia y Coexiella burnetii. Materiales y métodos. Se analizaron sueros representativos de unsector de la población en el año 2003, recolectados de personas que trabajan en actividades delcampo en los departamentos de Córdoba y Sucre que sirvieron como población base de las muestrasque se obtuvieron. Los trabajadores rurales elegidos a participar tenían entra 16 – 65 años deedad. Los sueros fueron examinados por IFA para detección de anticuerpos contra IgG para Bartonellaspp, Erlichia Anaplasma phagocytophilum y Coexiella burnetii. Resultados. La seroprevalencia deanticuerpos de todos los microorganismos estudiados fue de 56.8%. De 81 muestras de sueroanalizadas el 26.6% fueron seropositivas contra C. burnetii, el 37.7% tuvieron anticuerpos contraBartonella y el 20% de los individuos evaluados fueron seropositivos para Anaplasmaphagocytophilum. Conclusiones. Nuestros datos indican que la prevalencia de anticuerpos contraBartonella, A. phagocytophilum y C. burnetii son altos en nuestra región. Los resultados indicanque estas enfermedades zoonoticas son muy comunes en las personas que residen en el área delcaribe colombiano. Este estudio demuestra por primera vez la presencia de estos microorganismosen Colombia.

  15. Anaplasma phagocytophilum increases the levels of histone modifying enzymes to inhibit cell apoptosis and facilitate pathogen infection in the tick vector Ixodes scapularis

    Czech Academy of Sciences Publication Activity Database

    Cabezas-Cruz, A.; Alberdi, P.; Ayllón, N.; Valdés, James J.; Pierce, R.; Villar, M.; de la Fuente, J.

    2016-01-01

    Roč. 11, č. 4 (2016), s. 303-319 ISSN 1559-2294 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : Anaplasma * epigenetic s * histone modifying enzyme * histone * pathogen * tick Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.394, year: 2016

  16. Occurrence of Hepatozoon canis (Adeleorina: Hepatozoidae) and Anaplasma spp. (Rickettsiales: Anaplasmataceae) in black-backed jackals (Canis mesomelas) in South Africa.

    Science.gov (United States)

    Penzhorn, Barend L; Netherlands, Edward C; Cook, Courtney A; Smit, Nico J; Vorster, Ilse; Harrison-White, Robert F; Oosthuizen, Marinda C

    2018-03-20

    Domestic dogs are not native to sub-Saharan Africa, which may account for their susceptibility to Babesia rossi, of which endemic black-backed jackals (Canis mesomelas) are natural reservoirs. There is virtually no information on the occurrence of potentially pathogenic haemogregarines (e.g. Hepatozoon canis) or even rickettsial bacteria (e.g. Ehrlichia spp. and Anaplasma spp.) in indigenous canids in sub-Saharan Africa. Such organisms could pose a risk to domestic dogs, as well as to populations of endangered indigenous canid species. Genomic DNA extracted from blood samples taken from 126 free-ranging and 16 captive black-backed jackals was subjected to reverse line blot (RLB) hybridization assay; 82 (57.8%) specimens reacted only with the Ehrlichia/Anaplasma genera-specific probe. Full-length bacterial 16S rRNA gene of five of these specimens was cloned and the recombinants sequenced. The ten 16S rDNA sequences obtained were most closely related, with approximately 99% identity, to Anaplasma sp. South African Dog, various uncultured Anaplasma spp., as well as various Anaplasma phagocytophilum genotypes. Ninety-one specimens were screened for haemogregarines through PCR amplification using the 18S rRNA gene; 20 (21.9%) specimens reacted positively, of which 14 (15.4%) were confirmed positive for Hepatozoon genotypes from within H. canis. Two (2.2%) specimens were found positive for two different Hepatozoon genotypes. Sequence analyses confirmed the presence of 16S rDNA sequences closely related to A. phagocytophilum and Anaplasma sp. South African Dog as well as two H. canis genotypes in both free-ranging and captive black-backed jackals. Distinguishing between closely related lineages may provide insight into differences in pathogenicity and virulence of various Anaplasma and H. canis genotypes. By building up a more comprehensive understanding of the range and diversity of the bacteria and eukaryotic organisms (piroplasms and haemogregarines) in the blood of

  17. Influence des paramètres d'un laser ER: YAG sur l'adaptation marginale d'une restauration à faible contraction

    OpenAIRE

    Peeters, Frédéric

    2013-01-01

    Quarante molaires ont été réparties en cinq groupes. C'est avec un laser de type Er:YAG que des cavités occlusales ont été faites sur les dents des quatre premiers groupes et cela avec certains paramètres définis et spécifiques à chacun. Les dents du dernier groupe quant à elles, ont subi un traitement conventionnel de fraisage. L’obturation des cavités a été faite avec le même matériau, une résine composite à faible taux de contraction. L'adaptation marginale de chaque dent a ensuite été com...

  18. Prevalencia de caries de infancia temprana en niños menores de 6 años de edad, residentes en poblados urbano marginales de Lima Norte

    OpenAIRE

    Villena Sarmiento, Rita; Pachas Barrionuevo, Flor; Sánchez Huamán, Yhedina; Carrasco Loyola, Milagros

    2014-01-01

    La prevalencia de caries de infancia temprana es un problema de salud pública prevenible y que afecta a un gran número de niños. El propósito de este trabajo fue determinar la prevalencia yseveridad de la caries dental en niños de 6-71 meses de edad de comunidades urbano marginales de Lima. Se evaluaron a 332 niños con los criterios de caries dental de la OMS, con equipo noinvasivo, bajo luz natural, y con técnica de rodilla-rodilla para los más pequeños. Fueron calibrados 3 odontólogos en el...

  19. Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents--analyzing the host-pathogen-vector interface in a metropolitan area.

    Science.gov (United States)

    Silaghi, Cornelia; Woll, Dietlinde; Hamel, Dietmar; Pfister, Kurt; Mahling, Monia; Pfeffer, Martin

    2012-09-05

    The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice), were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures.

  20. Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents – Analyzing the host-pathogen-vector interface in a metropolitan area

    Directory of Open Access Journals (Sweden)

    Silaghi Cornelia

    2012-09-01

    Full Text Available Abstract Background The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Methods Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice, were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. Results 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Conclusion Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures.

  1. Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents – Analyzing the host-pathogen-vector interface in a metropolitan area

    Science.gov (United States)

    2012-01-01

    Background The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Methods Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice), were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. Results 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Conclusion Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures. PMID:22950642

  2. Redes comunitarias: un desafío para escuelas urbano-marginales (COMMUNITY NETWORKS: A CHALLENGE FOR URBAN MARGINAL SCHOOLS

    Directory of Open Access Journals (Sweden)

    Moscoloni Bicchi Nora

    2009-04-01

    Full Text Available Resumen: Las ideas básicas de este trabajo son conocer y comprender el entramado de la red de relaciones entre los distintos actores de las instituciones: escuela y organismos de la comunidad y su incidencia en la calidad educativa / calidad de vida. Analizamos la visión de los distintos actores educativos acerca de la inserción de la escuela en la comunidad. Tomamos como punto de partida el análisis de las relaciones entre calidad educativa y calidad de vida, en poblaciones urbano-marginales. Realizamos en primer lugar una investigación exploratoria, para conocer las características generales de escuelas que reciben población marginal. En una segunda etapa seleccionamos cuatro escuelas, que tomamos como casos e indagamos sus problemáticas. En ellas observamos gran dificultad para la construcción de redes comunitarias desde la institución escolar. Si bien responden a los problemas puntuales, mediante cambios o innovaciones planificados dinámica y flexiblemente, no existen soluciones duraderas debido a la falta de una convocatoria que comprometa a todas las instituciones de la comunidad constituyendo una efectiva relación en red. Estos resultados alcanzados en la investigación son producto de la triangulación de los datos estadísticos, documentales e históricos así como de los procedentes de la observación participante y de la información de las entrevistas en profundidad.Abstract:The basic ideas of this work are to know and understand the fabric of the network of relationships between the different institutions involved in school and community agencies and their impact on the quality of education / quality of life. The vision of the different actors of education about the insertion of the school in the community is analyzed from the point of view of the school. The analysis started studying how the quality of education is related to the quality of life in marginalized urban populations. At first an exploratory research was

  3. Structure of the type IV secretion system in different strains of Anaplasma phagocytophilum

    Directory of Open Access Journals (Sweden)

    Al-Khedery Basima

    2012-11-01

    Full Text Available Abstract Background Anaplasma phagocytophilum is an intracellular organism in the Order Rickettsiales that infects diverse animal species and is causing an emerging disease in humans, dogs and horses. Different strains have very different cell tropisms and virulence. For example, in the U.S., strains have been described that infect ruminants but not dogs or rodents. An intriguing question is how the strains of A. phagocytophilum differ and what different genome loci are involved in cell tropisms and/or virulence. Type IV secretion systems (T4SS are responsible for translocation of substrates across the cell membrane by mechanisms that require contact with the recipient cell. They are especially important in organisms such as the Rickettsiales which require T4SS to aid colonization and survival within both mammalian and tick vector cells. We determined the structure of the T4SS in 7 strains from the U.S. and Europe and revised the sequence of the repetitive virB6 locus of the human HZ strain. Results Although in all strains the T4SS conforms to the previously described split loci for vir genes, there is great diversity within these loci among strains. This is particularly evident in the virB2 and virB6 which are postulated to encode the secretion channel and proteins exposed on the bacterial surface. VirB6-4 has an unusual highly repetitive structure and can have a molecular weight greater than 500,000. For many of the virs, phylogenetic trees position A. phagocytophilum strains infecting ruminants in the U.S. and Europe distant from strains infecting humans and dogs in the U.S. Conclusions Our study reveals evidence of gene duplication and considerable diversity of T4SS components in strains infecting different animals. The diversity in virB2 is in both the total number of copies, which varied from 8 to 15 in the herein characterized strains, and in the sequence of each copy. The diversity in virB6 is in the sequence of each of the 4 copies in

  4. Molecular detection and characterization of Anaplasma platys in dogs and ticks in Cuba.

    Science.gov (United States)

    Silva, Claudia Bezerra da; Santos, Huarrisson Azevedo; Navarrete, Maylín González; Ribeiro, Carla Carolina Dias Uzedo; Gonzalez, Belkis Corona; Zaldivar, Maykelin Fuentes; Pires, Marcus Sandes; Peckle, Maristela; Costa, Renata Lins da; Vitari, Gabriela Lopes Vivas; Massard, Carlos Luiz

    2016-07-01

    Canine cyclic thrombocytopenia, an infectious disease caused by Anaplasma platys is a worldwide dog health problem. This study aimed to detect and characterize A. platys deoxyribonucleic acid (DNA) in dogs and ticks from Cuba using molecular methods. The study was conducted in four cities of Cuba (Habana del Este, Boyeros, Cotorro and San José de las Lajas). Blood samples were collected from 100 dogs in these cities. The animals were inspected for the detection of tick infestation and specimens were collected. Genomic DNA was extracted from dog blood and ticks using a commercial kit. Genomic DNA samples from blood and ticks were tested by a nested polymerase chain reaction (nPCR) to amplify 678 base pairs (bp) from the 16S ribosomal DNA (rDNA) of A. platys. Positive samples in nPCR were also subjected to PCR to amplify a fragment of 580bp from the citrate synthase (gltA) gene and the products were sequenced. Only Rhipicephalus sanguineus sensu lato (s.l.) was found on dogs, and 10.20% (n=5/49) of these ticks plus sixteen percent (16.0%, n=16/100) of dogs were considered positive for A. platys by nPCR targeting the 16S rDNA gene. All analyzed gltA and 16S rDNA sequences showed a 99-100% identity with sequences of A. platys reported in around the world. Phylogenetic analysis showed two defined clusters for the 16S rDNA gene and three defined clusters for the gltA gene. Based on the gltA gene, the deduced amino acid sequence showed two mutations at positions 88 and 168 compared with the sequence DQ525687 (GenBank ID from Italian sample), used as a reference in the alignment. A preliminary study on the epidemiological aspects associated with infection by A. platys showed no statistical association with the variables studied (p>0.05). This is the first evidence of the presence of A. platys in dogs and ticks in Cuba. Further studies are needed to evaluate the epidemiological aspects of A. platys infection in Cuban dogs. Copyright © 2016 Elsevier GmbH. All rights

  5. First evidence of Anaplasma platys and Hepatozoon canis co-infection in a dog from Romania--a case report.

    Science.gov (United States)

    Andersson, Martin; Turcitu, Mihai A; Stefanache, Mircea; Tamba, Paula; Barbuceanu, Florica; Chitimia, Lidia

    2013-06-01

    Anaplasma platys was first identified and described in North America as a Rickettsia-like, platelet-specific organism in dogs with infectious canine cyclic thrombocytopenia. In Europe, A. platys has so far mainly been described for some Mediterranean countries. Here, we describe a case of A. platys infection in a dog from Romania, confirmed by PCR. Additionally, the dog had a co-infection with Hepatozoon canis. To the best of our knowledge, this is the first case of A. platys infection in Romania and the first case of a co-infection with A. platys and H. canis altogether. Both pathogens should be considered as possible disease agents in dogs suffering from disease associated with tick bite in south-eastern Europe. Copyright © 2013 Elsevier GmbH. All rights reserved.

  6. The infection of questing Dermacentor reticulatus ticks with Babesia canis and Anaplasma phagocytophilum in the Chernobyl exclusion zone.

    Science.gov (United States)

    Karbowiak, Grzegorz; Vichová, Bronislavá; Slivinska, Kateryna; Werszko, Joanna; Didyk, Julia; Peťko, Branislav; Stanko, Michal; Akimov, Igor

    2014-08-29

    Tick occurrence was studied in the Chernobyl exclusion zone (CEZ) during the August-October 2009-2012. Dermacentor reticulatus ticks were collected using the flagging method and then screened for infection with Anaplasma phagocytophilum and Babesia canis by a PCR method incorporating specific primers and sequence analysis. The prevalence of infection with B. canis canis and A. phagocytophilum was found to be 3.41% and 25.36%, respectively. The results present the first evidence of B. canis canis and A. phagocytophilum in questing D. reticulatus ticks from the Chernobyl exclusion zone. They also reveal the presence of tick-borne disease foci in areas with no human activity, and confirm that they can be maintained in areas after a nuclear disaster with radioactive contamination. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Clinical and molecular features of one case of human infection with Anaplasma phagocytophilum from Podlaskie Province in eastern Poland

    Directory of Open Access Journals (Sweden)

    Renata Welc-Falęciak

    2015-09-01

    Full Text Available The article focuses on the clinical and laboratory diagnosis of human granulocytic anaplasmosis (HGA caused by Anaplasma phagocytophilum infection in one of 28 patients (3.6%; n=1/28 tested samples with early Lyme borreliosis. The clinical and laboratory results of a 42-year-old patient fulfilled criteria of confirm anaplasmosis and suggest an acute stage of illness. The described case provides strong presumptive evidence that infection in this patient was acquired with a pathogenic strain of A. phagocytophilum through a tick bite. A positive DNA with PCR for A. phagocytophilum infection was sequenced and analyzed phylogenetically. Physicians should consider the possibility of anaplasmosis in patients with early Lyme borreliosis, and A. phagocytophilum should be considered as a differential diagnosis in all patients from an endemic region of potential high risk factors for tick-borne diseases.

  8. A putative marker for human pathogenic strains of Anaplasma phagocytophilum correlates with geography and host, but not human tropism.

    Science.gov (United States)

    Foley, Janet; Stephenson, Nicole; Cubilla, Michelle Pires; Qurollo, Barbara; Breitschwerdt, Edward B

    2016-03-01

    Anaplasma phagocytophilum is an Ixodes species tick-transmitted bacterium that is capable of infecting a variety of host species, although there is a diversity of bacterial strains with differing host tropism. Recent analysis of A. phagocytophilum strains suggested that "drhm", a gene locus designated "distantly related to human marker" (drhm), which was predicted to be an integral membrane protein with possible transporter functions was not present in available canine and human isolates. By assessing 117 strains from 14 host species from across the US, we extended this analysis. Phylogenetic clades were associated with geography, but not host species. Additionally, a virulent clade that lacks drhm and infects dogs, horses, and humans in northeastern US was identified. Copyright © 2015 Elsevier GmbH. All rights reserved.

  9. First molecular evidence of Anaplasma ovis and Rickettsia spp. in keds (Diptera: Hippoboscidae) of sheep and wild ruminants.

    Science.gov (United States)

    Hornok, Sándor; de la Fuente, José; Biró, Nóra; Fernández de Mera, Isabel G; Meli, Marina L; Elek, Vilmos; Gönczi, Eniko; Meili, Theres; Tánczos, Balázs; Farkas, Róbert; Lutz, Hans; Hofmann-Lehmann, Regina

    2011-10-01

    To evaluate the presence of rickettsial agents in hippoboscid flies with molecular methods, 81 sheep keds (Melophagus ovinus) were collected from 23 sheep, 144 deer keds (Lipoptena cervi) were caught in the environment, and a further 463 and 59 individuals of the latter species were obtained from fresh carcasses of 29 red deer and 17 roe deer, respectively. DNA was extracted individually or in pools. Anaplasma ovis was demonstrated in all examined sheep keds, and from one pool of free-living deer keds. Rickettsia helvetica or other, unidentified rickettsiae were also present in one pool of sheep keds, and in four pools of deer keds from both red deer and roe deer. This is the first account of polymerase chain reaction positivity of hippoboscid flies for A. ovis and rickettsiae. These results raise the possibility that-apart from cattle and roe deer as already reported-sheep and red deer might also play a reservoir role in the epidemiology of rickettsioses.

  10. Anaplasma phagocytophilum, Bartonella spp., haemoplasma species and Hepatozoon spp. in ticks infesting cats: a large-scale survey.

    Science.gov (United States)

    Duplan, Florent; Davies, Saran; Filler, Serina; Abdullah, Swaid; Keyte, Sophie; Newbury, Hannah; Helps, Chris R; Wall, Richard; Tasker, Séverine

    2018-03-20

    Ticks derived from cats have rarely been evaluated for the presence of pathogens. The aim of this study was to determine the prevalence of Anaplasma phagocytophilum, Bartonella spp., haemoplasma species and Hepatozoon spp. in ticks collected from cats in the UK. Five hundred and forty DNA samples extracted from 540 ticks collected from cats presenting to veterinarians in UK practices were used. Samples underwent a conventional generic PCR assay for detection of Hepatozoon spp. and real-time quantitative PCR assays for detection of Anaplasma phagocytophilum and three feline haemoplasma species and a generic qPCR for detection of Bartonella spp. Feline 28S rDNA served as an endogenous internal PCR control and was assessed within the haemoplasma qPCR assays. Samples positive on the conventional and quantitative generic PCRs were submitted for DNA sequencing for species identification. Feline 28S rDNA was amplified from 475 of the 540 (88.0%) ticks. No evidence of PCR inhibition was found using an internal amplification control. Of 540 ticks, 19 (3.5%) contained DNA from one of the tick-borne pathogens evaluated. Pathogens detected were: A. phagocytophilum (n = 5; 0.9%), Bartonella spp. (n = 7; 1.3%) [including Bartonella henselae (n = 3; 0.6%) and Bartonella clarridgeiae (n = 1; 0.2%)], haemoplasma species (n = 5; 0.9%), "Candidatus Mycoplasma haemominutum" (n = 3; 0.6%), Mycoplasma haemofelis (n = 1; 0.2%), "Candidatus Mycoplasma turicensis" (n = 1; 0.2%), Hepatozoon spp. (n = 2; 0.4%), Hepatozoon felis (n = 1; 0.2%) and Hepatozoon silvestris (n = 1; 0.2%). These data provide important information on the prevalence of tick-borne pathogens in ticks infesting cats, with the identification of haemoplasma species, A. phagocytophilum, H. felis and Bartonella spp. (including B. henselae and B. clarridgeiae). This study also documents the first report of H. silvestris in ticks collected from domestic cats.

  11. Infections and risk factors for livestock with species of Anaplasma, Babesia and Brucella under semi-nomadic rearing in Karamoja Region, Uganda.

    Science.gov (United States)

    Lolli, Chiara; Marenzoni, Maria Luisa; Strona, Paolo; Lappo, Pier Giorgio; Etiang, Patrick; Diverio, Silvana

    2016-03-01

    A survey was conducted to estimate the prevalence of Anaplasma, Babesia and Brucella spp. infections in cattle, goats and sheep in the Karamoja Region of Uganda and to identify possible risk factors existing in this semi-nomadic and pastoral area. Low cost laboratory tests were used to diagnose infections (Rose Bengal test for Brucella spp. antibodies and direct microscopic examination for Anaplasma and Babesia spp.). Multivariable logistic regression models were applied to identify possible risk factors linked to gender, animal species, age (only for cattle) and districts. A total of 3935 cattle, 729 goats and 306 sheep of five districts of the Karamoja Region were tested. Seroprevalence for Brucella was 9.2 % (CI, 95 %: 8.4-10), for Anaplasma 19.5 % (CI 95 %: 18.4-20.6) and for Babesia 16 % (CI 95 %: 15-17.1). Significant differences in infections prevalence were observed against risk factors associated with districts and species. Cattle were the species with higher risk of the infections. Female gender was identified as at risk only for Brucella spp. infection. Cattle more than one year old had greater likelihood to be Brucella seropositive. Co-infections of Anaplasma and Babesia spp. were statistically associated, especially in goats and sheep. Further studies to identify risk factors related to host species and geographical districts are needed. The influence on the semi-nomadic agro-pastoral system in Karamoja of animal raids and animal mixing should be further investigated. Findings were important to sensitize Karamojong undertaking measures on infection control, especially on cattle, which are their main source of food.

  12. Responsabilidad Social Matriz de indicadores sustentables que refleja el impacto de la forestación en tierras marginales del Partido de Bahía Blanca, Argentina

    Directory of Open Access Journals (Sweden)

    Regina del Carmen Durán Durán

    2009-01-01

    Full Text Available Actualmente, se han empezado a considerar otras obligaciones que tienen las empresas para con su comunidad; se trata de aspectos vinculados con las dimensiones sociales y ambientales. Desde este contexto, nuestro trabajo tiene como punto de partida el concepto de responsabilidad social desde la noción de sustentabilidad. El objetivo es evaluar la forestación como instrumento para mejorar la sostenibilidad de los sistemas productivos tradicionales en tierras marginales del Partido de Bahía Blanca, mitigando los impactos del desarrollo no responsable de la producción primaria. Para ello, se han identificado técnicas de manejo generadoras de externalidades positivas en otras actividades agropecuarias complementarias, donde existen limitantes edafológicas, apoyándose en las tres dimensiones del concepto de sustentabilidad: ecológica, económica, sociopolítica y cultural. De igual forma, se diseñó una matriz de evaluación y ponderación de impactos, que contempla indicadores cuantitativos y cualitativos, de cuya aplicación surge la forestación como una alternativa sustentable

  13. Ehrlichia canis and Anaplasma platys in ticks of dogs in Cuiaba, Mato GrossoEhrlichia canis e Anaplasma platys em carrapatos de cães de Cuiabá, Mato Grosso

    Directory of Open Access Journals (Sweden)

    Valéria Dutra

    2012-06-01

    Full Text Available Diseases transmitted by arthropods such as Rhipicephalus sanguineus, are caused by a spectrum of pathogens. Among these are the canine monocytic ehrlichiosis and cyclical thrombocytopenia with a cosmopolitan distribution. Aiming to verify the presence of DNA of Anaplasma platys and Ehrlichia canis in ticks R. sanguineus collected in the period 2008 to 2009 of 380 infected dogs. Ticks, after maceration, were subjected to DNA extraction and then nested PCR was performed for amplification of A. platys and E. canis. Of these, 81 (29.7% amplified DNA from ehrlichiais agents, where 38 (17.9% amplified in E. canis and 32 (15.7% for A. platys. The observation of two pathogens, combined with worldwide distribution of the tick R. sanguineus, demonstrates the high risk of infection with these pathogens in dogs in the city of Cuiaba. Doenças transmitidas por artrópodes, como o Rhipicephalus sanguineus, são causadas por um espectro de patógenos. Dentre estas, estão a erliquiose monocítica canina e trombocitopenia cíclica com distribuição cosmopolita. Com o objetivo de verificar a presença de DNA de Anaplasma platys e Ehrlichia canis em carrapatos R. sanguineus coletados no período de 2008 a 2009 de 380 cães infestados. Os carrapatos, após a maceração, foram submetidos a extração de DNA e, em seguida, foi realizada a Nested PCR para a amplificação da espécie A. platys e E. canis. Destes, 81 (29.7% amplificaram o DNA dos agentes ehrlichiais, onde 38 (17.9% amplificaram para E. canis e 32 (15.7% para A. platys. A observação dos dois patógenos, combinado com distribuição mundial do carrapato R. sanguineus, demonstra o elevado risco de infecção por esses patógenos de cães na cidade de Cuiabá.

  14. Molecular epidemiology of the emerging zoonosis agent Anaplasma phagocytophilum (Foggie, 1949) in dogs and ixodid ticks in Brazil.

    Science.gov (United States)

    Santos, Huarrisson A; Thomé, Sandra M G; Baldani, Cristiane D; Silva, Claudia B; Peixoto, Maristela P; Pires, Marcus S; Vitari, Gabriela L V; Costa, Renata L; Santos, Tiago M; Angelo, Isabele C; Santos, Leandro A; Faccini, João L H; Massard, Carlos L

    2013-12-11

    Anaplasma phagocytophilum is an emerging pathogen of humans, dogs and other animals, and it is transmitted by ixodid ticks. The objective of the current study was a) detect A. phagocytophilum in dogs and ixodid ticks using real-time Polymerase Chain Reaction (qPCR); and b) Determine important variables associated to host, environment and potential tick vectors that are related to the presence of A. phagocytophilum in dogs domiciled in Rio de Janeiro, Brazil. We tested blood samples from 398 dogs and samples from 235 ticks, including 194 Rhipicephalus sanguineus sensu lato, 15 Amblyomma cajennense, 8 Amblyomma ovale and 18 pools of Amblyomma sp. nymphs. A semi-structured questionnaire was applied by interviewing each dog owner. Deoxyribonucleic acid obtained from ticks and dog buffy coat samples were amplified by qPCR (msp2 gene). The sequencing of 16S rRNA and groESL heat shock operon genes and a phylogenetic analysis was performed. The multiple logistic regression model was created as a function of testing positive dogs for A. phagocytophilum. Among the 398 blood samples from dogs, 6.03% were positive for A. phagocytophilum. Anaplasma phagocytophilum was detected in one A. cajennense female tick and in five R. sanguineus sensu lato ticks (four males and one female). The partial sequences of the 16S rRNA, and groESL genes obtained were highly similar to strains of A. phagocytophilum isolated from wild birds from Brazil and human pathogenic strains. The tick species collected in positive dogs were R. sanguineus sensu lato and A. cajennense, with A.cajennense being predominant. Tick infestation history (OR = 2.86, CI = 1.98-14.87), dog size (OR = 2.41, IC: 1.51-12.67), the access to forest areas (OR = 3:51, CI: 1.52-16.32), hygiene conditions of the environment in which the dogs lived (OR = 4.35, CI: 1.86-18.63) and Amblyomma sp. infestation (OR = 6.12; CI: 2.11-28.15) were associated with A. phagocytophilum infection in dogs. This is the

  15. Candidatus Neoehrlichia mikurensis and Anaplasma phagocytophilum: prevalences and investigations on a new transmission path in small mammals and ixodid ticks.

    Science.gov (United States)

    Obiegala, Anna; Pfeffer, Martin; Pfister, Kurt; Tiedemann, Tim; Thiel, Claudia; Balling, Anneliese; Karnath, Carolin; Woll, Dietlinde; Silaghi, Cornelia

    2014-12-04

    Small mammals are crucial for the life history of ixodid ticks, but their role and importance in the transmission cycle of tick-borne pathogens is mostly unknown. Candidatus Neoehrlichia mikurensis (CNM) and Anaplasma phagocytophilum are both tick-borne pathogens, and rodents are discussed to serve as main reservoir hosts for CNM but not for the latter especially in Germany. Analysing the prevalence of both pathogens in small mammals and their ticks in endemic regions may help to elucidate possible transmission paths in small mammal populations and between small mammals and ticks. In 2012 and 2013, small mammals were trapped at three different sites in Germany. DNA was extracted from different small mammal tissues, from rodent neonates, foetuses and from questing and attached ticks. DNA samples were tested for CNM and A. phagocytophilum by real-time PCR. Samples positive for A. phagocytophilum were further characterized at the 16S rRNA gene locus. CNM was detected in 28.6% of small mammals and in 2.2% of questing and 3.8% of attached ticks. Altogether 33 positive ticks were attached to 17 different hosts, while positive ticks per host ranged between one and seven. The prevalences for this pathogen differed significantly within small mammal populations comparing sites (χ(2): 13.3987; p: 0.0004) and between sexes. Male rodents had an approximately two times higher chance of infection than females (OR: 1.9652; 95% CI: 1.32-2.92). The prevalence for CNM was 31.8% (95% CI: 22-44) in rodent foetuses and neonates (23 of 67) from positive dams, and 60% (95% CI: 35.7-80.25) of positive gravid or recently parturient rodents (9 out of 15) had at least one positive foetus or neonate. Anaplasma phagocytophilum was detected at a low percentage in rodents (0-5.6%) and host-attached ticks (0.5-2.9%) with no significant differences between rodent species. However, attached nymphs were significantly more often infected than attached larvae (χ(2): 25.091; p: <0.0001). This study

  16. Molecular detection of Dirofilaria immitis, Hepatozoon canis, Babesia spp., Anaplasma platys and Ehrlichia canis in dogs on Costa Rica.

    Science.gov (United States)

    Wei, Lanjing; Kelly, Patrick; Ackerson, Kate; El-Mahallawy, Heba S; Kaltenboeck, Bernhard; Wang, Chengming

    2014-03-01

    Although vector-borne diseases are important causes of morbidity and mortality in dogs in tropical areas, there is little information on these conditions in Costa Rica. In PCRs of blood from dogs in Costa Rica, we did not detect DNAs of Rickettsia (R.) felis and Coxiella (C.) burnetii but we did find evidence of infection with Dirofilaria (D.) immitis (9/40, 22.5%), Hepatozoon (H.) canis (15/40, 37.5%), Babesia spp. (10/40, 25%; 2 with B. gibsoni and 8 with B. vogeli), Anaplasma (A.) platys (3/40, 7.5%) and Ehrlichia (E.) canis (20/40, 50%). Nine dogs (22.5%) were free of any vector-borne pathogens while 14 (35%) were infected with a single pathogen, 11 (27.5%) with two, 4 (10%) with three, 1 (2.5%) with four, and 1 (2.5%) with five pathogens. Dogs in Costa Rica are commonly infected with vector-borne agents.

  17. Comparative strain analysis of Anaplasma phagocytophilum infection and clinical outcomes in a canine model of granulocytic anaplasmosis.

    Science.gov (United States)

    Scorpio, Diana G; Dumler, J Stephen; Barat, Nicole C; Cook, Judith A; Barat, Christopher E; Stillman, Brett A; DeBisceglie, Kristen C; Beall, Melissa J; Chandrashekar, Ramaswamy

    2011-03-01

    A pilot study was conducted to determine whether existing human or canine strains of Anaplasma phagocytophilum would reproduce clinical disease in experimentally inoculated dogs similar to dogs with naturally acquired granulocytic anaplasmosis. Six hounds were inoculated intravenously with one human and two canine strains of A. phagocytophilum that were propagated in vitro in HL-60 cells or in infected autologous neutrophils. Infected dogs were monitored for lethargy, anorexia, petechiae, lymphadenopathy, and fever. Dogs were assessed for complete blood count (CBC), serum chemistry, and serology (IFA and SNAP® 4Dx®); for A. phagocytophilum blood load by quantitative polymerase chain reaction; and for cytokine production. Prominent clinical signs were generalized lymphadenopathy and scleral injection; only one dog developed fever lasting 4 days. Notable laboratory alterations included sustained leukopenia and thrombocytopenia in all dogs. A. phagocytophilum morulae were noted in blood between days 10 and 11, although all dogs retained A. phagocytophilum DNA in blood through day 60. All dogs seroconverted by days 10-15 by IFA, and by days 17-30 by SNAP 4Dx; cytokine analyses revealed 10-fold increases in interleukin-2 and interleukin-18 in the neutrophil-propagated 98E4 strain-infected dog. All A. phagocytophilum strains produced infection, although canine 98E4 strain reproduced clinical signs, hematologic changes, and inflammatory cytokine elevations most consistent with granulocytic anaplasmosis when recognized clinically. Therefore, this strain should be considered for use in future studies of A. phagocytophilum canine infection models.

  18. Infection of Anaplasma phagocytophilum and Ehrlichia spp. in Opossums and Dogs in Campeche, Mexico: The Role of Tick Infestation

    Directory of Open Access Journals (Sweden)

    Edgar Rojero-Vázquez

    2017-12-01

    Full Text Available In recent years, some tick-borne diseases such as anaplasmosis and ehrlichiosis became widespread worldwide, threatening the health of humans, domestic animals and wildlife. The aims of this study were to determine the presence of Anaplasma phagocytophilum, Ehrlichia canis, and Ehrlichia chaffeensis in 102 opossums (Didelphis spp. and 44 owned free-ranging dogs in southeastern Mexico using a specific polymerase chain reaction (PCR. A. phagocytophilum was detected in opossums and dogs with a prevalence of 3 and 27%, respectively. E. canis was only present in 7% of dogs, while we didn't detect E. chaffeensis in any host. We report the first evidence of infections of A. phagocytophilum in Didelphis virginiana and D. marsupialis in Mexico. The infection rates and patterns we found of A. phagocytophilum suggest that dogs are more directly involved in the ecology of this pathogen than opossums. Despite the small prevalence found, our results are of public health concern because of the zoonotic capabilities of A. phagocytophilum, the high tick infestation rates found and because both opossums and free-ranging dogs can achieve high population densities in the region.

  19. Molecular epidemiology of Anaplasma platys, Ehrlichia canis and Babesia vogeli in stray dogs in Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Claudia M. Ribeiro

    Full Text Available ABSTRACT: Hemoparasitic infections are tick-borne diseases, which affect animals and humans. Considering the importance of canine hemoparasitic infections in veterinary clinics, this study aimed to determine the occurrence of Anaplasma platys, Ehrlichia canis and Babesia vogeli in blood samples from 182 dogs not domiciled in the city of Pato Branco, southwestern region of Paraná State, Brazil, using polymerase chain reaction (PCR. The prevalence of A. platys and B. vogeli was 32.9% and 10.9% respectively, and A. platys infection prevailed (p<0.001. The number of dogs positive for A. platys was larger in Winter (p<0.05. All blood samples were negative for E. canis. In the dogs, infestation by Amblyomma cajennense predominated over that by Rhipicephalus sanguineus (p<0.001; but there was no significant association between PCR and the variables presence of ticks, sex and age. Dogs infected by A. platys and B. vogeli showed thrombocytopenia, lymphopenia and leukocytosis; but there was no correlation between such hematological changes and infection by hemoparasites. This appears to be the first molecular study that demonstrates the existence of A. platys and B. vogeli in dogs from the southwestern region of Paraná.

  20. Major depression

    Science.gov (United States)

    Depression - major; Depression - clinical; Clinical depression; Unipolar depression; Major depressive disorder ... providers do not know the exact causes of depression. It is believed that chemical changes in the ...

  1. Molecular characterization and specific detection of Anaplasma species (AP-sd) in sika deer and its first detection in wild brown bears and rodents in Hokkaido, Japan.

    Science.gov (United States)

    Moustafa, Mohamed Abdallah Mohamed; Lee, Kyunglee; Taylor, Kyle; Nakao, Ryo; Sashika, Mariko; Shimozuru, Michito; Tsubota, Toshio

    2015-12-01

    A previously undescribed Anaplasma species (herein referred to as AP-sd) has been detected in sika deer, cattle and ticks in Japan. Despite being highly similar to some strains of A. phagocytophilum, AP-sd has never been detected in humans. Its ambiguous epidemiology and the lack of tools for its specific detection make it difficult to understand and interpret the prevalence of this Anaplasma species. We developed a method for specific detection, and examined AP-sd prevalence in Hokkaido wildlife. Our study included 250 sika deer (Cervus nippon yesoensis), 13 brown bears (Ursus arctos yesoensis) and 252 rodents including 138 (Apodemus speciosus), 45 (Apodemus argenteus), 42 (Myodes rufocanus) and 27 (Myodes rutilus) were collected from Hokkaido island, northern Japan, collected during 2010 to 2015. A 770 bp and 382 bp segment of the 16S rRNA and gltA genes, respectively, were amplified by nested PCR. Results were confirmed by cloning and sequencing of the positive PCR products. A reverse line blot hybridization (RLB) based on the 16S rRNA gene was then developed for the specific detection of AP-sd. The prevalence of AP-sd by nested PCR in sika deer was 51% (128/250). We detected this Anaplasma sp. for the first time in wild brown bears and rodents with a prevalence of 15% (2/13) and 2.4% (6/252), respectively. The sequencing results of the 16S rRNA and gltA gene amplicons were divergent from the selected A. phagocytophilum sequences in GenBank. Using a newly designed AP-sd specific probe for RLB has enabled us to specifically detect this Anaplasma species. Besides sika deer and cattle, wild brown bears and rodents were identified as potential reservoir hosts for AP-sd. This study provided a high throughput molecular method that specifically detects AP-sd, and which can be used to investigate its ecology and its potential as a threat to humans in Japan. Copyright © 2015 Elsevier B.V. All rights reserved.

  2. Detection of Borrelia lusitaniae, Rickettsia sp. IRS3, Rickettsia monacensis, and Anaplasma phagocytophilum in Ixodes ricinus collected in Madeira Island, Portugal.

    Science.gov (United States)

    de Carvalho, Isabel Lopes; Milhano, Natacha; Santos, Ana Sofia; Almeida, Victor; Barros, Silvia C; De Sousa, Rita; Núncio, Maria Sofia

    2008-08-01

    A total of 300 Ixodes ricinus ticks were tested by polymerase chain reaction (PCR) for the presence of Borrelia spp., Rickettsia spp., and Anaplasma phagocytophilum. Sequence analysis demonstrated 8 (2.7%) ticks infected with B. lusitaniae, 60 (20%) with Rickettsia spp., and 1 (0.3%) with A. phagocytophilum. Seven (2.3%) ticks were coinfected with B. lusitaniae and Rickettsia spp., 2 (0.6%) with R. monacensis, and 5 (1.7%) with Rickettsia sp. IRS3. The results of this study suggest simultaneous transmission of multiple tick-borne agents on Madeira Island, Portugal.

  3. OCORRÊNCIA DE Anaplasma bovis (Donatien & Lestoquard, 1936, Dumler et al. 2001 NA REGIÃO DE BOM JESUS DO ITABAPOANA, RJ

    Directory of Open Access Journals (Sweden)

    Orlando Augusto Melo Junior

    2010-12-01

    Full Text Available In the present study, 400 capillary blood smears collected from the ear and the tail of 200 bovines were microscopically examinedfor the presence of hemoparasites. The diagnosis was based on the direct research, semonstrating the etiologic agent inclusions. Eleven bovines (5.5% were considered infected by Anaplasma bovis, confirming the presence of this hemoparasite in the city of Bom Jesus do Itabapoana, the first city of the northwesten region of the state of Rio de Janeiro to register such occurrence.

  4. EL NIVEL EDUCATIVO Y SOCIOECONÓMICO DEL HOGAR Y HABILIDADES PRE-LECTORAS EN ESCUELAS URBANO Y URBANO-MARGINALES DE LA PROVINCIA DE MENDOZA-ARGENTINA

    Directory of Open Access Journals (Sweden)

    Yanina Canales Jara

    2016-01-01

    Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

  5. Retrospective study of hemoparasites in cattle in southern Italy by reverse line blot hybridization.

    Science.gov (United States)

    Ceci, Luigi; Iarussi, Fabrizio; Greco, Beatrice; Lacinio, Rosanna; Fornelli, Stefania; Carelli, Grazia

    2014-06-01

    Tick-borne diseases are widespread in tropical and temperate regions and are responsible for important economic losses in those areas. In order to assess the presence and prevalence of various pathogens in southern Italy, we retrospectively analyzed cattle blood samples collected for a previous study in 2000 using reverse line blot (RLB) hybridization. The study had been carried out in three regions of southern Italy on 1,500 randomly selected and apparently healthy adult cattle. RLB showed that 43.7% of the cattle were positive for nine different species of hemoparasites with either a single infection or a mixed infection. Theileria buffeli was the most common species found, being present in 27.3% of the animals, followed by Anaplasma marginale in 18.1%, Anaplasma centrale in 13.8%, Babesia bigemina and Anaplasma bovis in 4.2%, Anaplasma phagocytophilum in 1.7%, Babesia bovis in 1.6%, Babesia major in 0.2% and Babesia divergens in 0.1%. Complete blood counts showed different degrees of anemia in 363 animals (24.2%) and of these, 169 were RLB-positive for at least one pathogen. Among the ticks that were collected from the cattle, the following species were identified: Rhipicephalus bursa, Ixodes ricinus, Hyalomma marginatum, Boophilus annulatus, Dermacentor marginatus and Haemaphysalis (sulcata, parva, inermis and punctata). The results obtained confirmed the spread of endemic tick-borne pathogens in the regions studied.

  6. Vaccinomics Approach to the Identification of Candidate Protective Antigens for the Control of Tick Vector Infestations and Anaplasma phagocytophilum Infection

    Directory of Open Access Journals (Sweden)

    Marinela Contreras

    2017-08-01

    Full Text Available Anaplasma phagocytophilum is an emerging tick-borne pathogen causing human granulocytic anaplasmosis (HGA, tick-borne fever (TBF in small ruminants, and other forms of anaplasmosis in different domestic and wild animals. The main vectors of this pathogen are Ixodes tick species, particularly I. scapularis in the United States and I. ricinus in Europe. One of the main limitations for the development of effective vaccines for the prevention and control of A. phagocytophilum infection and transmission is the identification of effective tick protective antigens. The objective of this study was to apply a vaccinomics approach to I. scapularis-A. phagocytophilum interactions for the identification and characterization of candidate tick protective antigens for the control of vector infestations and A. phagocytophilum infection. The vaccinomics pipeline included the use of quantitative transcriptomics and proteomics data from uninfected and A. phagocytophilum-infected I. scapularis ticks for the selection of candidate protective antigens based on the variation in tick mRNA and protein levels in response to infection, their putative biological function, and the effect of antibodies against these proteins on tick cell apoptosis and pathogen infection. The characterization of selected candidate tick protective antigens included the identification and characterization of I. ricinus homologs, functional characterization by different methodologies including RNA interference, immunofluorescence, gene expression profiling, and artificial tick feeding on rabbit antibodies against the recombinant antigens to select the candidates for vaccination trials. The vaccinomics pipeline developed in this study resulted in the identification of two candidate tick protective antigens that could be selected for future vaccination trials. The results showed that I. scapularis lipocalin (ISCW005600 and lectin pathway inhibitor (AAY66632 and I. ricinus homologs constitute

  7. Anaplasma phagocytophilum and Babesia spp. in roe deer (Capreolus capreolus), fallow deer (Dama dama) and mouflon (Ovis musimon) in Germany.

    Science.gov (United States)

    Kauffmann, Melanie; Rehbein, Steffen; Hamel, Dietmar; Lutz, Walburga; Heddergott, Mike; Pfister, Kurt; Silaghi, Cornelia

    2017-02-01

    Infections with the tick-borne pathogens Anaplasma phagocytophilum and Babesia spp. can cause febrile disease in several mammalian species, including humans. Wild ruminants in Europe are suggested to serve as reservoir hosts for particular strains or species of these pathogens. The aims of this study were to investigate the occurrence of A. phagocytophilum and Babesia spp. in roe deer (Capreolus capreolus), fallow deer (Dama dama) and mouflon (Ovis musimon orientalis) in Germany, and the diversity and host association of genetic variants of A. phagocytophilum and Babesia species. From 2009 to 2010, 364 spleen samples from 153 roe deer, 43 fallow deer and 168 mouflon from 13 locations in Germany were tested for DNA of A. phagocytophilum and Babesia spp. by real-time PCR or conventional PCR, respectively. Variants of A. phagocytophilum were investigated with a nested PCR targeting the partial 16S rRNA gene, and species of piroplasms were identified by sequencing. DNA of A. phagocytophilum was detected in 303 (83.2%) samples: roe deer, 96.1% (147/153); fallow deer, 72.1% (31/43); and mouflon, 74.4% (125/168). Sequence analysis of 16S rRNA-PCR products revealed the presence of nine different genetic variants. DNA of Babesia spp. was found in 113 (31.0%) samples: roe deer, 62.8% (96/153); fallow deer, 16.3% (6/43); and mouflon, 6.5% (11/168). Babesia capreoli, Babesia sp. EU1 (referred to also as B. venatorum), B. odocoilei-like and a Theileria species were identified. Co-infections with A. phagocytophilum and Babesia spp. were detected in 30.0% of the animals which were tested positive for A. phagocytophilum and/or Babesia spp. Roe deer had a significantly higher percentage of co-infections (60.8%), followed by fallow deer (14.0%) and mouflon (6.5%). Thus, the results suggest that roe deer plays a key role in the endemic cycles of the pathogens investigated. Copyright © 2016 Elsevier Ltd. All rights reserved.

  8. Major Links.

    Science.gov (United States)

    Henderson, Tona

    1995-01-01

    Provides electronic mail addresses for resources and discussion groups related to the following academic majors: art, biology, business, chemistry, computer science, economics, health sciences, history, literature, math, music, philosophy, political science, psychology, sociology, and theater. (AEF)

  9. Major Roads

    Data.gov (United States)

    Minnesota Department of Natural Resources — This data set contains roadway centerlines for major roads (interstates and trunk highways) found on the USGS 1:24,000 mapping series. These roadways are current...

  10. Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud

    Directory of Open Access Journals (Sweden)

    Élise Prébin

    2009-03-01

    Full Text Available Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud. Cet article a pour sujet ma relation à la société sud-coréenne, non seulement en tant qu’anthropologue mais aussi en tant que personne adoptée d’origine coréenne. Il relate la manière dont plusieurs sortes de relations ont dû être gérées pendant le terrain. Il a fallu d’un côté me rapprocher de mes informateurs pour pouvoir mener un terrain classique dans une société inconnue, comprendre une culture autre et traiter un sujet relevant des sciences sociales : le retour des adoptés étrangers dans leur pays d’origine. De l’autre, il a fallu établir une bonne distance avec ma famille biologique coréenne en m’en éloignant momentanément. Ma relation avec elle était en effet instable du fait qu’elle reposait sur une contradiction : mon statut d’étrangère en dépit de l’intimité que supposaient les liens du sang. Pourtant, cette relation continue entre ma famille biologique et moi-même a éclairé certaines ambiguïtés relatives au statut des adoptés dans la société sud-coréenne que le temps limité du terrain n’avait pas permis de saisir. Cet article ébauche donc une réflexion épistémologique sur la pertinence d’éléments biographiques dans le traitement anthropologique de certains sujets. Je montre en l’occurrence comment le don en mariage d’une fille biologique adoptée conjure de manière satisfaisante un don en adoption toujours problématique.Finding the right distance: stranger, marginal, ethnologist and relative in south Korea. The topic of this article is my relation to the South Korean society, not only as a social anthropologist but also as a Korean adoptee. I relate the way I had to manage contrasted relations while conducting fieldwork. On one hand, I endeavoured to get closer to my informants in order to conduct classic fieldwork in an unknown society, to understand a different culture

  11. Molecular and serological detection of Theileria equi, Babesia caballi and Anaplasma phagocytophilum in horses and ticks in Maranhão, Brazil

    Directory of Open Access Journals (Sweden)

    Rita de Maria Seabra Nogueira

    Full Text Available ABSTRACT: Equine piroplasmosis is a tick-borne disease caused by the intraeytrhocytic protozoans Babesia caballi and Theileria equi. It has been reported as a main equine parasitic disease. In addition, Anaplasma phagocytophilum, the causative agent of granulocytic ehrlichiosis, causes a seasonal disease in horses. Both diseases, can be detrimental to animal health. In this sense, blood samples and ticks were collected from 97 horses raised in the microregion of Baixada Maranhense, Maranhão State, Brazil. Serum samples were subjected to Indirect Fluorescence Antibody Test (IFAT and blood samples and ticks to Polymerase Chain Reaction (PCR to evaluate the infection by Theileria equi, Babesia caballi and Anaplasma phagocytophilum. The overall seroprevalence was 38.14%, 18.55% and 11.34% for T. equi, B. caballi and A. phagocytophilum, respectively. The results of PCR from blood samples showed 13.40% and 3.09% positive samples to T. equi and B. caballi, respectively. A total of 170 tick specimens were collected and identified as Dermacentor nitens, Amblyomma cajennense sensu lato and Rhipicephalus (Boophilus microplus. It was detected 2.35% (4/170 and 0.59% (1/170 positive tick samples by PCR for T. equi and B. caballi, respectively. All samples were negative to A. phagocytophilum. No statically difference (p>0.05 was observed when gender, age, use of ectoparasiticide and tick presence were analyzed. A BLASTn analysis of the sequenced samples indicated 97 to 100% similarity with T. equi 18S rRNA gene sequences in GenBank and 98 to 100% with B. caballi. Genetic analysis classified the obtained sequences as T. equi and B. caballi cluster, respectively. It can be concluded that these pathogens occur and are circulating in the studied area.

  12. Efficacy of sarolaner in the prevention of Borrelia burgdorferi and Anaplasma phagocytophilum transmission from infected Ixodes scapularis to dogs.

    Science.gov (United States)

    Honsberger, Nicole A; Six, Robert H; Heinz, Thomas J; Weber, Angela; Mahabir, Sean P; Berg, Thomas C

    2016-05-30

    The efficacy of sarolaner (Simparica™, Zoetis) to prevent transmission primarily of Borrelia burgdorferi and secondarily of Anaplasma phagocytophilum from infected wild-caught Ixodes scapularis to dogs was evaluated in a placebo-controlled laboratory study. Twenty-four purpose-bred laboratory Beagles seronegative for B. burgdorferi and A. phagocytophilum antibodies were allocated randomly to one of three treatment groups: placebo administered orally on Days 0 and 7, or sarolaner at 2mg/kg administered orally on Day 0 (28 days prior to tick infestation) or on Day 7 (21 days prior to tick infestation). On Day 28, each dog was infested with approximately 25 female and 25 male wild caught adult I. scapularis that were determined to have prevalence of 57% for B. burgdorferi and 6.7% for A. phagocytophilum by PCR. In situ tick counts were conducted on Days 29 and 30. On Day 33, all ticks were counted and removed. Acaricidal efficacy was calculated based on the reduction of geometric mean live tick counts in the sarolaner-treated groups compared to the placebo-treated group for each tick count. Blood samples collected from each dog on Days 27, 49, 63, 77, 91 and 104 were tested for the presence of B. burgdorferi and A. phagocytophilum antibodies using the SNAP(®) 4Dx(®) Plus Test, and quantitatively assayed for B. burgdorferi antibodies using an ELISA test. Skin biopsies collected on Day 104 were tested for the presence of B. burgdorferi by bacterial culture and PCR. Geometric mean live tick counts for placebo-treated dogs were 14.8, 12.8, and 19.1 on Days 29, 30, and 33, respectively. The percent reductions in mean live tick counts at 1, 2, and 5 days after infestation were 86.3%, 100%, and 100% for the group treated with sarolaner 21 days prior to infestation, and 90.9%, 97.1%, and 100% for the group treated with sarolaner 28 days prior to infestation. Geometric mean live tick counts for both sarolaner-treated groups were significantly lower than those for the

  13. Targeting ticks for control of selected hemoparasitic diseases of cattle.

    Science.gov (United States)

    Kocan, K M

    1995-03-01

    Development in and transmission of hemoparasites by tick vectors are phenomena closely synchronized with the tick feeding cycle. In all known life cycles, initial infection of tick tissues occurs in midgut epithelial cells and transmission is effected as ticks feed after parasites have developed and multiplied in salivary glands. Many factors reviewed affect development and transmission of hemoparasites by ticks including age of ticks, artificial temperature, climate and/or season, tick stage or sex, hemoparasite variation, concurrent infection of ticks with other pathogens, host cell susceptibility, transovarial transmission, effect of hemoparasites on tick biology, and the effect of infecting parasitemia level in cattle on infection rates in ticks. Four hemoparasites of cattle, Anaplasma marginale, Cowdria ruminantium, Theileria parva, and Babesia spp., are all dependent on ticks for biological transmission. Babesia is transmitted transovarially whereas the other three are transmitted transstadially. Mechanical transfer of infective blood via fomites and mouthparts of biting arthropods is also a major means of transmission for Anaplasma marginale but not of the others. Potential control methods for hemoparasites that target parasites as they are developing in their respective tick hosts include tick control, vaccines (against ticks and parasites), and drugs (against ticks and parasites). Successful application of control strategies will be dependent upon thorough understanding of parasite developmental cycles, biology of the tick vectors and the immune response of cattle to ticks and to hemoparasites. The most effective control measures will be those that are targeted against both ticks and the hemoparasites they vector.

  14. Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago.

    Science.gov (United States)

    Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto

    2016-07-01

    Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island. Copyright © 2016

  15. High throughput pyrosequencing technology for molecular differential detection of Babesia vogeli, Hepatozoon canis, Ehrlichia canis and Anaplasma platys in canine blood samples.

    Science.gov (United States)

    Kaewkong, Worasak; Intapan, Pewpan M; Sanpool, Oranuch; Janwan, Penchom; Thanchomnang, Tongjit; Kongklieng, Amornmas; Tantrawatpan, Chairat; Boonmars, Thidarut; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai

    2014-06-01

    Canine babesiosis, hepatozoonosis, ehrlichiosis, and anaplasmosis are tick-borne diseases caused by different hemopathogens. These diseases are causes of morbidity and mortality in dogs. The classic method for parasite detection and differentiation is based on microscopic observation of blood smears. The limitations of the microscopic method are that its performance requires a specially qualified person with professional competence, and it is ineffective in differentiating closely related species. This study applied PCR amplification with high throughput pyrosequencing for molecular differential detection of the following 4 hemoparasites common to tropical areas in dog blood samples: Babesia vogeli, Hepatozoon canis, Ehrlichia canis, and Anaplasma platys. PCR was initially used to amplify specific target regions of the ribosomal RNA genes of each parasite using 2 primer pairs that included 18S rRNA for protozoa (B. vogeli and H. canis) and 16S rRNA for rickettsia (E. canis and A. platys). Babesia vogeli and H. canis were discriminated using 9 nucleotide positions out of 30 base pairs, whereas E. canis and A. platys were differentiated using 15 nucleotide positions out of 34 base pairs that were determined from regions adjacent to 3' ends of the sequencing primers. This method provides a challenging alternative for a rapid diagnosis and surveillance of these tick-borne diseases in canines. Copyright © 2014 Elsevier GmbH. All rights reserved.

  16. Anaplasma phagocytophilum inhibits human neutrophil apoptosis via upregulation of bfl-1, maintenance of mitochondrial membrane potential and prevention of caspase 3 activation.

    Science.gov (United States)

    Ge, Yan; Yoshiie, Kiyotaka; Kuribayashi, Futoshi; Lin, Mingqun; Rikihisa, Yasuko

    2005-01-01

    The inhibition of neutrophil apoptosis plays a central role in human granulocytic anaplasmosis. Intracellular signalling pathways through which the obligatory intracellular bacterium Anaplasma phagocytophilum inhibits the spontaneous apoptosis of human peripheral blood neutrophils were investigated. bfl-1 mRNA levels in uninfected neutrophils after 12 h in culture were reduced to approximately 5-25% of 0 h levels, but remained high in infected neutrophils. The eukaryotic RNA synthesis inhibitor, actinomycin D, prevented the maintenance of bfl-1 mRNA levels by A. phagocytophilum. Differences in mcl-1, bax, bcl-w, bad or bak mRNA levels in infected versus uninfected neutrophils were not remarkable. By using mitochondrial fluorescent dyes, Mitotracker Red and JC-1, it was found that most uninfected neutrophils lost mitochondrial membrane potential after 10-12 h incubation, whereas A. phagocytophilum-infected neutrophils maintained high membrane potential. Caspase 3 activity and the degree of apoptosis were lower in dose-dependent manner in A. phagocytophilum-infected neutrophils at 16 h post infection, as compared to uninfected neutrophils. Anti-active caspase 3 antibody labelling showed less positively stained population in infected neutrophils compared to those in uninfected neutrophils after 12 h incubation. These results suggest that A. phagocytophilum inhibits human neutrophil apoptosis via transcriptional upregulation of bfl-1 and inhibition of mitochondria-mediated activation of caspase 3.

  17. Molecular Survey on Rickettsia spp., Anaplasma phagocytophilum, Borrelia burgdorferi Sensu Lato, and Babesia spp. in Ixodes ricinus Ticks Infesting Dogs in Central Italy.

    Science.gov (United States)

    Morganti, Giulia; Gavaudan, Stefano; Canonico, Cristina; Ravagnan, Silvia; Olivieri, Emanuela; Diaferia, Manuela; Marenzoni, Maria Luisa; Antognoni, Maria Teresa; Capelli, Gioia; Silaghi, Cornelia; Veronesi, Fabrizia

    2017-11-01

    Dogs are a common feeding hosts for Ixodes ricinus and may act as reservoir hosts for zoonotic tick-borne pathogens (TBPs) and as carriers of infected ticks into human settings. The aim of this work was to evaluate the presence of several selected TBPs of significant public health concern by molecular methods in I. ricinus recovered from dogs living in urban and suburban settings in central Italy. A total of 212 I. ricinus specimens were collected from the coat of domestic dogs. DNA was extracted from each specimen individually and tested for Rickettsia spp., Borrelia burgdorferi sensu lato, Babesia spp., and Anaplasma phagocytophilum, using real-time and conventional PCR protocols, followed by sequencing. Sixty-one ticks (28.8%) tested positive for TBPs; 57 samples were infected by one pathogen, while four showed coinfections. Rickettsia spp. was detected in 39 specimens (18.4%), of which 32 were identified as Rickettsia monacensis and seven as Rickettsia helvetica. Twenty-two samples (10.4%) tested positive for A. phagocytophilum; Borrelia lusitaniae and Borrelia afzelii were detected in two specimens and one specimen, respectively. One tick (0.5%) was found to be positive for Babesia venatorum (EU1). Our findings reveal the significant exposure of dogs to TBPs of public health concern and provide data on the role of dogs in the circulation of I. ricinus-borne pathogens in central Italy.

  18. Prevalence of Babesia canis, Borrelia burgdorferi sensu lato, and Anaplasma phagocytophilum in hard ticks collected from meadows of Lubelskie Voivodship (eastern Poland

    Directory of Open Access Journals (Sweden)

    Dzięgiel Beata

    2014-03-01

    Full Text Available The aim of the study was to assess the distribution of Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, and Babesia canis in adult females and males of Ixodes ricinus and Dermacentor reticulatus ticks, inhabiting meadows near large forest complexes throughout the Lubelskie Voivodship (eastern region of Poland. Ticks were collected using the flagging method. Among 720 ticks collected, 506 were identified as D. reticulatus, and 214 as I. ricinus. DNA of B. canis and B. burgdorferi s.l. was detected in 21.3% and 0.6% of D. reticulatus ticks, respectively. In I. ricinus ticks, DNA specific to B. burgdorferi s.l. and A. phagocytophilum was detected in 5.6% and 10.3%, respectively. Co-infections of B. burgdorferi s.l. and A. phagocytophilum were found in two I. ricinus ticks. These results indicate that the Lublin region is an area at risk of tick-borne diseases of humans and animals, which must be considered in clinical practice.

  19. SEROLOGICAL EVIDENCE OF EXPOSURE TO Anaplasma phagocytophilum IN HORSES FROM THE RIO DE JANEIRO STATE MOUNTED POLICE BRED IN THE URBAN ZONE

    Directory of Open Access Journals (Sweden)

    Marcia Farias Rolim

    2015-07-01

    Full Text Available Anaplasma phagocytophilum is an emergent hemoparasite in regions where ticks are regularly found. In order to investigate the rate of anti-A. phagocytophilum antibody in horses of the Mounted Police of Rio de Janeiro state and therefore the presence of this agent, 41 horses from the Cavalry Squadron (CS and 50 from the Regiment of Mounted Police (RMP were selected. For the serologic diagnosis the Indirect Fluorescent Antibody test was performed. In the present work, among 91 equine sera samples anti-A. phagocytophilum antibodies, with titer ≥ 1:80, were detected in 11 animals (12%, being five (5% from males and six (7% females, with no statistical difference. The adult animals with ages varying between five and 14 years presented the highest rate of positive reaction, although antibodies were detected in animals of all ages. We did not observe statistic differences in relation to the presence of anti-A. phagocytophilum antibodies among the animals bred in the CS and RMP. The presence of anti-A.phagocytophilim antibodies in horses of the Mounted Police with no clinical signs is indicative that the parasite is present in the enzootic form among the horses of the urban area. The circulation of the parasite among the animals is not dependent of the presence of tick infestations.

  20. Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

    Science.gov (United States)

    Beckley, Carl S; Shaban, Salisu; Palmer, Guy H; Hudak, Andrew T; Noh, Susan M; Futse, James E

    2016-01-01

    Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc) were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B. bigemina prevalence

  1. Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

    Directory of Open Access Journals (Sweden)

    Carl S Beckley

    Full Text Available Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B

  2. Allocation of the transmission service cost with base in marginal costs of the transmission network expansion; Asignacion del costo del servicio de transmision con base en costos marginales de expansion de la red de transmision

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Casillas, Manuel E.; Nieva Gomez, Rolando [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    The transmission charges to the users must be completely defined in those systems where the restructuring has broken up the traditional functions of the companies; in order to introduce competition in the generation and commercialization segments of the electrical energy. The fundamentals of a method used are explained to assure the transmission service cases between their users. The method is based on the marginal expansion costs of the transmission network. Their more known applications have been in competitive markets of energy, in particular, where the energy price is the same one in all the localities. Nevertheless, it can be used under other forms of organization of the electrical industry. In order to illustrate results, the obtained ones from their application to the most important part of the transmission network of the Mexican system that operates interconnected, are presented. [Spanish] Los cargos de transmision a los usuarios deben estar completamente definidos en aquellos sistemas donde la reestructuracion ha desagregado las funciones tradicionales de las empresas; para introducir competencia en los segmentos de generacion y comercializacion de la energia electrica. Se explican los fundamentos de un metodo utilizado para asegurar los casos del servicio de transmision entre sus usuarios. El metodo se basa en los costos marginales de expansion de la red de transmision. Sus aplicaciones mas conocidas han sido en mercados competitivos de energia, en particular, donde el precio de la energia es el mismo en todas las localidades. Sin embargo, puede utilizarse bajo otras formas de organizacion de la industria electrica. Con el proposito de ilustrar resultados, se muestran los obtenidos de su aplicacion a la parte mas importante de la red de transmision del sistema mexicano que opera interconectada.

  3. Prevalence of Ehrlichia canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, Bartonella vinsonii berkhoffii, and Rickettsia spp. in dogs from Grenada.

    Science.gov (United States)

    Yabsley, Michael J; McKibben, John; Macpherson, Calum N; Cattan, Peggy F; Cherry, Natalie A; Hegarty, Barbara C; Breitschwerdt, Edward B; O'Connor, Tom; Chandrashekar, Ramaswamy; Paterson, Tara; Perea, Marta Lanza; Ball, Geoffrey; Friesen, Stanley; Goedde, Jill; Henderson, Brooke; Sylvester, Wayne

    2008-02-14

    To identify the tick-borne pathogens in dogs from Grenada, we conducted a serologic survey for Ehrlichia canis in 2004 (104 dogs) and a comprehensive serologic and molecular survey for a variety of tick-borne pathogens in 2006 (73 dogs). In 2004 and 2006, 44 and 32 dogs (42.3% and 43.8%) were seropositive for E. canis, respectively. In 2006, several tick-borne pathogens were identified by serology and PCR. DNA of E. canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, and Bartonella sp. were identified in 18 (24.7%), 14 (19.2%), 5 (7%), 5 (7%), and 1 (1.4%) dogs, respectively. Six (8.2%) dogs were seropositive for Bartonella vinsonii subsp. berkhoffii. All dogs were seronegative and PCR-negative for Rickettsia spp. Coinfection with two or three pathogens was observed in eight dogs. Partial 16S rRNA E. canis and A. platys sequences were identical to sequences in GenBank. Partial 18S rRNA gene sequences from the Grenadian H. canis were identical to each other and had one possible mismatch (ambiguous base) from H. canis detected from Spain and Brazil. Grenadian B. c. vogeli sequences were identical to B. c. vogeli from Brazil and Japan. All of the detected pathogens are transmitted, or suspected to be transmitted, by Rhipicephalus sanguineus. Results of this study indicate that dogs from Grenada are infected with multiple tick-borne pathogens; therefore, tick-borne diseases should be included as differentials for dogs exhibiting thrombocytopenia, leukopenia, fever, or lethargy. One pathogen, E. canis, is also of potential public health significance.

  4. A comparative study of clinical manifestations, haematological and serological responses after experimental infection with Anaplasma phagocytophilum in two Norwegian sheep breeds

    Directory of Open Access Journals (Sweden)

    Sandstedt Karin

    2011-02-01

    Full Text Available Abstract Background It has been questioned if the old native Norwegian sheep breed, Old Norse Sheep (also called Norwegian Feral Sheep, normally distributed on coastal areas where ticks are abundant, is more protected against tick-borne infections than other Norwegian breeds due to a continuously high selection pressure on pasture. The aim of the present study was to test this hypothesis in an experimental infection study. Methods Five-months-old lambs of two Norwegian sheep breeds, Norwegian White (NW sheep and Old Norse (ON sheep, were experimentally infected with a 16S rRNA genetic variant of Anaplasma phagocytophilum (similar to GenBank accession number M73220. The experiment was repeated for two subsequent years, 2008 and 2009, with the use of 16 lambs of each breed annually. Ten lambs of each breed were inoculated intravenously each year with 0.4 ml A. phagocytophilum-infected blood containing approximately 0.5 × 106 infected neutrophils/ml. Six lambs of each breed were used as uninfected controls. Half of the primary inoculated lambs in each breed were re-challenged with the same infectious dose at nine (2008 and twelve (2009 weeks after the first challenge. The clinical, haematological and serological responses to A. phagocytophilum infection were compared in the two sheep breeds. Results The present study indicates a difference in fever response and infection rate between breeds of Norwegian sheep after experimental infection with A. phagocytophilum. Conclusion Although clinical response seems to be less in ON-lambs compared to NW-lambs, further studies including more animals are needed to evaluate if the ON-breed is more protected against tick-borne infections than other Norwegian breeds.

  5. Genome-wide Anaplasma phagocytophilum AnkA-DNA interactions are enriched in intergenic regions and gene promoters and correlate with infection-induced differential gene expression.

    Directory of Open Access Journals (Sweden)

    J Stephen Dumler

    2016-09-01

    Full Text Available Anaplasma phagocytophilum, an obligate intracellular prokaryote, infects neutrophils and alters cardinal functions via reprogrammed transcription. Large contiguous regions of neutrophil chromosomes are differentially expressed during infection. Secreted A. phagocytophilum effector AnkA transits into the neutrophil or granulocyte nucleus to complex with DNA in heterochromatin across all chromosomes. AnkA binds to gene promoters to dampen cis-transcription and also has features of matrix attachment region (MAR-binding proteins that regulate three-dimensional chromatin architecture and coordinate transcriptional programs encoded in topologically-associated chromatin domains. We hypothesize that identification of additional AnkA binding sites will better delineate how A. phagocytophilum infection results in reprogramming of the neutrophil genome. Using AnkA-binding ChIP-seq, we showed that AnkA binds broadly throughout all chromosomes in a reproducible pattern, especially at: i intergenic regions predicted to be matrix attachment regions (MARs; ii within predicted lamina-associated domains; and iii at promoters ≤3,000 bp upstream of transcriptional start sites. These findings provide genome-wide support for AnkA as a regulator of cis-gene transcription. Moreover, the dominant mark of AnkA in distal intergenic regions known to be AT-enriched, coupled with frequent enrichment in the nuclear lamina, provides strong support for its role as a MAR-binding protein and genome re-organizer. AnkA must be considered a prime candidate to promote neutrophil reprogramming and subsequent functional changes that belie improved microbial fitness and pathogenicity.

  6. Serological survey of Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, and Ehrlichia canis infections in rural and urban dogs in Central Italy

    Directory of Open Access Journals (Sweden)

    Valentina Virginia Ebani

    2014-11-01

    Full Text Available [b]Introduction[i][/i][/b][i]. Borrelia burgdorferi [/i]sensu lato (s.l. and Anaplasma phagocytophilum are well known zoonotic pathogens, whereas[i] Ehrlichia canis[/i] is usually considered to be of veterinary concern, although on the basis of recent reports it also seems to be able to infect humans. [b]objective[/b]. The aim of the study was to determine the seroprevalence of [i]B. burgdorferi [/i]s.l., A. phagocytophilum and [i]E. canis[/i] in an Italian canine population, and to verify if there are differences between dogs living in urban areas and those from a rural environment. [b]materials and method.[/b] Blood sera of 1,965 dogs, 1,235 from cities and 730 from rural areas, were tested by indirect immunofluorescent assay (IFAT. [b]results[/b]. The overall seroprevalence was highest for E. canis (7.07%, followed by [i]A. phagocytophilum[/i] (4.68%, and [i]B. burgdorferi[/i] s.l. (1.47%. Rural dogs showed the highest seroprevalence to [i]B. burgdorferi[/i] s.l. and [i]A. phagocytophilum[/i]. No significant differences were observed between rural and urban [i]E. canis[/i]-positive dogs. A low percentage (1.32% of dogs with dual seropositivity was detected, and no triple positive reactions were observed. No significant differences were detected in the seroprevalence of the three agents in relationship to the age and gender of the dogs. Seroprevalence in the five years considered were not statistically different, except for the lowest rate for [i]E. canis[/i] observed in 2012. [b]conclusions[/b]. The results confirm the presence of [i]B. burgdorferi[/i] s.l., [i]A. phagocytophilum[/i] and [i]E. canis[/i] in Italian dogs in both urban and rural areas. Monitoring pet dogs, which share the same environment with their owners, is useful for identifying the presence of tick-borne disease agents of both veterinary and public health significance

  7. Tissue-specific signatures in the transcriptional response to Anaplasma phagocytophilum infection of Ixodes scapularis and Ixodes ricinus tick cell lines

    Directory of Open Access Journals (Sweden)

    Pilar eAlberdi

    2016-02-01

    Full Text Available Anaplasma phagocytophilum are transmitted by Ixodes spp. ticks and have become one of the most common and relevant tick-borne pathogens due to their impact on human and animal health. Recent results have increased our understanding of the molecular interactions between Ixodes scapularis and A. phagocytophilum through the demonstration of tissue-specific molecular pathways that ensure pathogen infection, development and transmission by ticks. However, little is known about the Ixodes ricinus genes and proteins involved in the response to A. phagocytophilum infection. The tick species I. scapularis and I. ricinus are evolutionarily closely related and therefore similar responses are expected in A. phagocytophilum-infected cells. However, differences may exist between I. scapularis ISE6 and I. ricinus IRE/CTVM20 tick cells associated with tissue-specific signatures of these cell lines. To address this hypothesis, the transcriptional response to A. phagocytophilum infection was characterized by RNA sequencing and compared between I. scapularis ISE6 and I. ricinus IRE/CTVM20 tick cell lines. The transcriptional response to infection of I. scapularis ISE6 cells resembled that of tick hemocytes while the response in I. ricinus IRE/CTVM20 cells was more closely related to that reported previously in infected tick midguts. The inhibition of cell apoptosis by A. phagocytophilum appears to be a key adaptation mechanism to facilitate infection of both vertebrate and tick cells and was used to investigate further the tissue-specific response of tick cell lines to pathogen infection. The results supported a role for the intrinsic pathway in the inhibition of cell apoptosis by A. phagocytophilum infection of I. scapularis ISE6 cells. In contrast, the results in I. ricinus IRE/CTVM20 cells were similar to those obtained in tick midguts and suggested a role for the JAK/STAT pathway in the inhibition of apoptosis in tick cells infected with A. phagocytophilum

  8. El nivel educativo y socioeconómico del hogar y habilidades pre-lectoras en escuelas urbano y urbano-marginales de la provincia de Mendoza-Argentina

    Directory of Open Access Journals (Sweden)

    Yanina Canales, Jara

    2016-05-01

    Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

  9. Prevalence of Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi sensu lato, Anaplasma spp. and Leishmania infantum in apparently healthy and CVBD-suspect dogs in Portugal - a national serological study

    Directory of Open Access Journals (Sweden)

    Cardoso Luís

    2012-03-01

    Full Text Available Abstract Background Canine vector-borne diseases (CVBDs are caused by a wide range of pathogens transmitted to dogs by arthropods including ticks and insects. Many CVBD-agents are of zoonotic concern, with dogs potentially serving as reservoirs and sentinels for human infections. The present study aimed at assessing the seroprevalence of infection with or exposure to Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi sensu lato, Anaplasma spp. and Leishmania infantum in dogs in Portugal. Methods Based on 120 veterinary medical centres from all the regions of mainland and insular Portugal, 557 apparently healthy and 628 CVBD-suspect dogs were sampled. Serum, plasma or whole blood was tested for qualitative detection of D. immitis antigen and antibodies to E. canis, B. burgdorferi s. l., Anaplasma spp. and L. infantum with two commercial in-clinic enzyme-linked immunosorbent assay kits. Odds ratios (OR were calculated by logistic regression analysis to identify independent risk factors of exposure to the vector-borne agents. Results Total positivity levels to D. immitis, E. canis, B. burgdorferi, Anaplasma spp., L. infantum, one or more agents and mixed agents were 3.6%, 4.1%, 0.2%, 4.5%, 4.3%, 14.0% and 2.0% in the healthy group, and 8.9%, 16.4%, 0.5%, 9.2%, 25.2%, 46.3% and 11.6% in the clinically suspect group, respectively. Non-use of ectoparasiticides was a risk factor for positivity to one or more agents both in the apparently healthy (OR = 2.1 and CVBD-suspect (OR = 1.5 dogs. Seropositivity to L. infantum (OR = 7.6, E. canis (OR = 4.1 and D. immitis (OR = 2.4 were identified as risk factors for the presence of clinical signs compatible with CVBDs. Positivity to mixed agents was not found to be a risk factor for disease. Conclusions Dogs in Portugal are at risk of becoming infected with vector-borne pathogens, some of which are of zoonotic concern. CVBDs should be considered by practitioners and prophylactic measures must be put in

  10. Immunisation of smallholder dairy cattle against anaplasmosis and babesiosis in Malawi

    DEFF Research Database (Denmark)

    Tjørnehøj, Kirsten; Lawrence, J. A.; Kafuwa, P. T.

    1997-01-01

    A field study was conducted in the Southern Region of Malawi to evaluate the possible benefits of immunisation of improved dairy cattle against Anaplasma marginale, Babesia bigemina and Babesia bovis. Friesian crossbred heifers were immunised when they were being reared on Government farms. They ...

  11. Molecular approaches to detect and study the organisms causing ...

    African Journals Online (AJOL)

    This review will summarise the molecular approaches used to detect and analyse the genomes of Babesia bovis, B. bigemina and Anaplasma marginale which cause bovine babesiosis and anaplasmosis. These tick borne diseases are widely distributed in Africa, Asia, Australia, and Central and South America and for ...

  12. Major Sport Venues

    Data.gov (United States)

    Department of Homeland Security — The Major Public Venues dataset is composed of facilities that host events for the National Association for Stock Car Auto Racing, Indy Racing League, Major League...

  13. Major Depression Among Adults

    Science.gov (United States)

    ... Depressive Episode Among Adolescents Data Sources Share Major Depression Definitions Major depression is one of the most ... Bethesda, MD 20892-9663 Follow Us Facebook Twitter YouTube Google Plus NIMH Newsletter NIMH RSS Feed NIMH ...

  14. Prospects after Major Trauma

    NARCIS (Netherlands)

    Holtslag, H.R.

    2007-01-01

    Introduction. After patients survived major trauma, their prospects, in terms of the consequences for functioning, are uncertain, which may impact severely on patient, family and society. The studies in this thesis describes the long-term outcomes of severe injured patients after major trauma. In

  15. The risk of exposure to Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Babesia sp. and co-infections in Ixodes ricinus ticks on the territory of Niepołomice forest (southern Poland).

    Science.gov (United States)

    Asman, Marek; Nowak, Magdalena; Cuber, Piotr; Strzelczyk, Joanna; Szilman, Ewa; Szilman, Piotr; Trapp, Gizela; Siuda, Krzysztof; Solarz, Krzysztof; Wiczkowski, Andrzej

    2013-01-01

    Niepołomice Forest is located about 20 kilometers east of Cracow (Malopolska province, southern Poland). Its natural and touristic values, as well as wide range of hosts occurring within indicate this to be an area of high risk of exposure to Ixodes ricinus and tick-borne diseases it transfers. I. ricinus is a common species in Poland and Europe. Its seasonal activity begins in Poland in the early spring, and ends with late autumn. A total number of 129 specimens of I. ricinus was collected by flagging in Niepołomice Forest. DNA was isolated by ammonia method from 30 randomly-selected individuals. PCR was used to detect tick-borne pathogens with primers specific for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato and Babesia sp. Molecular studies confirmed the presence of all three pathogens in I. ricinus. A. phagocytophilum was found in 76.7%, Babesia sp., 60%, B. burgdorferi s. l., in 3.3% of studied ticks. A. phagocytophilum co-infection with Babesia sp., was found in 46.7% of the specimens. A co-infection of all three tested pathogens was recorded in one case (3.3%). In Poland the problem of tick-borne diseases is a growing issue, therefore people residing in southern Polish touristic areas should be informed about the prevention and protection against ticks.

  16. Major operations and activities

    Energy Technology Data Exchange (ETDEWEB)

    Black, D.G.

    1995-06-01

    This section of the 1994 Hanford Site Environmental Report summarizes the major operations and activities on the site. These operations and activities include site management, waste management, environmental restoration and corrective actions, and research and technology development.

  17. A major safety overhaul

    CERN Multimedia

    2003-01-01

    A redefined policy, a revamped safety course, an environmental project... the TIS (Technical Inspection and Safety) Division has begun a major safety overhaul. Its new head, Wolfgang Weingarten, explains to the Bulletin why and how this is happening.

  18. Allegheny County Major Rivers

    Data.gov (United States)

    Allegheny County / City of Pittsburgh / Western PA Regional Data Center — This dataset contains locations of major rivers that flow through Allegheny County. These shapes have been taken from the Hydrology dataset. The Ohio River,...

  19. Major operations and activities

    International Nuclear Information System (INIS)

    Black, D.G.

    1995-01-01

    This section of the 1994 Hanford Site Environmental Report summarizes the major operations and activities on the site. These operations and activities include site management, waste management, environmental restoration and corrective actions, and research and technology development

  20. Canine leishmaniosis caused by Leishmania major and Leishmania tropica: comparative findings and serology.

    Science.gov (United States)

    Baneth, Gad; Yasur-Landau, Daniel; Gilad, Matan; Nachum-Biala, Yaarit

    2017-03-13

    Infection and clinical disease associated with Leishmania major and Leishmania tropica, two common agents of human cutaneous leishmaniosis, have rarely been reported in dogs. This study describes dogs infected with these Leishmania spp. prevalent in the Middle East and North Africa, and compares the serological response of dogs infected with Leishmania infantum, L. major or L. tropica to whole promastigote antigen enzyme-linked immunosorbent assay (ELISA) of each species and to rK39 dipstick. Leishmania major infection in a 5-month-old male dog was associated with alopecic and ulcerative periocular and limb skin lesions which responded to allopurinol treatment. Infection was detected by skin and blood polymerase chain reaction (PCR) and confirmed by DNA sequencing but the dog was seronegative. Leishmania tropica infection was detected in a 3-month-old female dog co-infected with Babesia vogeli and Anaplasma platys and with no skin lesions. PCR and DNA sequencing of the blood and parasite culture were positive for L. tropica. Sera from 11 dogs infected with L. infantum, L. major or L. tropica were reactive with all three Leishmania spp. antigens except for sera from a dog with L. major infection. No significant differences were found between reactivity of dog sera to the antigen of the infecting species, or to the other Leishmania spp. antigens. Sera from dogs infected with L. infantum and L. tropica were positive with the rK39 antigen kit, while dogs with L. major infection were seronegative. Skin lesions in L. major infected dogs from this study and previous reports (n = 2) were ulcerative and located on the muzzle, feet and foot pads and not associated with generalized lymphadenomegaly and splenomegaly. In previous L. tropica infections, skin lesions were proliferative mucocutaneous in young dogs (n = 2), or associated with widespread dermatitis, lymphadenomegaly and splenomegaly in older dogs with similarity to L. infantum infection (n = 2). This

  1. Major international sport profiles.

    Science.gov (United States)

    Patel, Dilip R; Stier, Bernhard; Luckstead, Eugene F

    2002-08-01

    Sports are part of the sociocultural fabric of all countries. Although different sports have their origins in different countries, many sports are now played worldwide. International sporting events bring athletes of many cultures together and provide the opportunity not only for athletic competition but also for sociocultural exchange and understanding among people. This article reviews five major sports with international appeal and participation: cricket, martial arts, field hockey, soccer, and tennis. For each sport, the major aspects of physiological and biomechanical demands, injuries, and prevention strategies are reviewed.

  2. Major New Initiatives

    Indian Academy of Sciences (India)

    First page Back Continue Last page Overview Graphics. Major New Initiatives. Multi-party multi-rate video conferencing OOPS. Live Lecture OOPS. Rural ATM Machine Vortex. Finger print detection HP-IITM. Medical Diagnostic kit NeuroSynaptic. LCD projection system TeNeT. Web Terminal MeTeL Midas. Entertainment ...

  3. Major planning enquiries

    Energy Technology Data Exchange (ETDEWEB)

    Shore, P

    1978-11-01

    This is a speech delivered by the U.K. Secretary of State for the Environment in Manchester (UK) on September 13th 1978. It outlines the Minister's views on the role and significance of major planning inquiries - such as that proposed to be held on the Commercial Demonstration Fast Reactor. (CDFR) (author).

  4. Major Biomass Conference

    Science.gov (United States)

    Top Scientists, Industry and Government Leaders to Gather for Major Biomass Conference America, South America and Europe will focus on building a sustainable, profitable biomass business at the Third Biomass Conference of the Americas in Montreal. Scheduled presentations will cover all biomass

  5. Unity in Major Themes

    DEFF Research Database (Denmark)

    Booss-Bavnbek, Bernhelm; Davis, Philip J.

    We describe and explain the desire, common among mathematicians, both for unity and independence in its major themes. In the dialogue that follows, we express our spontaneous and considered judgment and reservations; by contrasting the development of mathematics as a goal-driven process as opposed...

  6. Molecular detection of tick-borne bacteria and protozoa in cervids and wild boars from Portugal.

    Science.gov (United States)

    Pereira, André; Parreira, Ricardo; Nunes, Mónica; Casadinho, Afonso; Vieira, Maria Luísa; Campino, Lenea; Maia, Carla

    2016-05-10

    Wildlife can act as reservoir of different tick-borne pathogens, such as bacteria, parasites and viruses. The aim of the present study was to assess the presence of tick-borne bacteria and protozoa with veterinary and zoonotic importance in cervids and wild boars from the Centre and South of Portugal. One hundred and forty one blood samples from free-ranging ungulates including 73 red deer (Cervus elaphus), 65 wild boars (Sus scrofa) and three fallow deer (Dama dama) were tested for the presence of Anaplasma marginale/A. ovis, A. phagocytophilum, Anaplasma/Ehrlichia spp., Babesia/Theileria spp., Borrelia burgdorferi (sensu lato) (s.l.), and Rickettsia spp. DNA by PCR. Anaplasma spp. DNA was detected in 33 (43.4 %) cervids (31 red deer and two fallow deer) and in two (3.1 %) wild boars while Theileria spp. were found in 34 (44.7 %) cervids (32 red deer and two fallow deer) and in three (4.6 %) wild boar blood samples. Sequence analysis of msp4 sequences identified A. marginale, A. ovis, while the analysis of rDNA sequence data disclosed the presence of A. platys and A. phagocytophilum and T. capreoli and Theileria sp. OT3. Anaplasma spp./Theileria spp. mixed infections were found in 17 cervids (22.4 %) and in two wild boars (3.1 %). All samples were negative for Babesia sp., B. burgdorferi (s.l.), Ehrlichia sp. or Rickettsia sp. This is the first detection of Anaplasma marginale, A. ovis, A. phagocytophilum, A. platys, Theileria capreoli and Theileria sp. OT3 in cervids and wild boars from Portugal. Further studies concerning the potential pathogenicity of the different species of  Anaplasma and Theileria infecting wild ungulates, the identification of their vector range, and their putative infectivity to domestic livestock and humans should be undertaken.

  7. Investigação molecular de Ehrlichia spp. e Anaplasma platys em felinos domésticos: alterações clínicas, hematológicas e bioquímicas

    Directory of Open Access Journals (Sweden)

    Elisabete S Correa

    2011-10-01

    Full Text Available Ehrlichia sp. e Anaplasma platys são micro-organismos Gram negativos, parasitos intracelulares obrigatórios, residindo em vacúolos citoplasmáticos de leucócitos e plaquetas, encontrados no sangue periférico ou em tecidos. Poucos relatos têm sido feitos sobre erliquiose e anaplasmose em gatos no Brasil, os quais são baseados na presença de mórulas em leucócitos e plaquetas, ou pela detecção de anticorpos. O objetivo deste trabalho foi investigar a infecção natural por Ehrlichia sp. e A.platys em gatos no Município de Campos dos Goytacazes-RJ, através da hematoscopia e pela detecção do DNA desses agentes. Foram utilizadas amostras de sangue total e de soro de 91 gatos, independente de raça, sexo e idade. Realizaram-se hemograma, bioquímica sérica e PCR, utilizando oligonucleotídes para Ehrlichia sp. e A.platys. Os dados de hematoscopia mostraram que 9,89% dos gatos apresentaram mórulas em macroplaquetas. O DNA de A.platys foi detectado em 13,18% dos 91 animais e em 44,44% das amostras positivas à hematoscopia. O DNA de Ehrlichia sp. não foi detectado em nenhuma amostra. Nenhuma alteração foi observada nos sinais clínicos nem nos resultados laboratoriais nos animais estudados. Os dados sugerem que os felinos domésticos podem atuar como potenciais reservatórios para A. platys, como forma não sintomática das enfermidades relacionadas

  8. The Ursa Major supercluster

    International Nuclear Information System (INIS)

    Schuch, N.J.

    1983-01-01

    An optical and a radio survey have been carried out. The optical observations consist of a spectroscopic survey in which redshift data for cluster galaxies and optical identifications of radio sources were obtained with the 98-inch Isaac Newton telescope at the Royal Greenwich Observatory, and the 200-inch Hale telescope; the photographic survey in B, V and R colors was made with the 48-inch Schmidt telescope at Palomar. Some results on the galaxy distribution in the Ursa Major supercluster are briefly discussed. (Auth.)

  9. Securing Major Events

    International Nuclear Information System (INIS)

    Loeoef, Susanna

    2013-01-01

    When asked why the IAEA should provide nuclear security support to countries that organize large public events, Nuclear Security Officer Sophia Miaw answers quickly and without hesitation. ''Imagine any major public event such as the Olympics, a football championship, or an Expo. If a dirty bomb were to be exploded at a site where tens of thousands of people congregate, the radioactive contamination would worsen the effects of the bomb, increase the number of casualties, impede a rapid emergency response, and cause long term disruption in the vicinity,'' she said. Avoiding such nightmarish scenarios is the driving purpose behind the assistance the IAEA offers States that host major sporting or other public events. The support can range from a single training course to a comprehensive programme that includes threat assessment, training, loaned equipment and exercises. The type and scope of assistance depends on the host country's needs. ''We incorporate nuclear security measures into their security plan. We don't create anything new,'' Miaw said

  10. Major Depressive Disorder

    Directory of Open Access Journals (Sweden)

    G Grobler

    2013-08-01

    Full Text Available The treatment guideline draws on several international guidelines: (iPractice Guidelines of the American Psychiatric Association (APAfor the Treatment of Patients with Major Depressive Disorder, SecondEdition;[1](ii Clinical Guidelines for the Treatment of DepressiveDisorders by the Canadian Psychiatric Association and the CanadianNetwork for Mood and Anxiety Treatments (CANMAT;[2](iiiNational Institute for Clinical Excellence (NICE guidelines;[3](iv RoyalAustralian and New Zealand College of Psychiatrists Clinical PracticeGuidelines Team for Depression (RANZCAP;[4](v Texas MedicationAlgorithm Project (TMAP Guidelines;[5](vi World Federation ofSocieties of Biological Psychiatry (WFSBP Treatment Guideline forUnipolar Depressive Disorder;[6]and (vii British Association forPsychopharmacology Guidelines.[7

  11. Diagnosis of hemoparasitosis trough the spread-smear technique using a drop of blood clot

    OpenAIRE

    Neusa Saltiél Stobbe; Eunice Leonora Chaplin; Maria das Graças de Souza Paiva; Nilton Rogério Santos Silva; Flávio A. Pacheco Araújo; Elinor Fortes

    1992-01-01

    The spread-smear technique using a drop of blood clot and stained by diluted and undimitcd Giemsa stain was evaluated for the search of blood cell types and recognition of Babesia bovis, Babesia bigemina and Anaplasma marginale hemoparasites. The blood clot samples were taken from a 6 month-old calf experimentally inoculated with the blood from a Cattle Tick Fever carrier. The Technique was sumitable for the observation of different blood cells and for the recognition of the hemoparasites.

  12. Weaving History through the Major

    Science.gov (United States)

    Mayfield, Betty

    2014-01-01

    The benefits of including the study of the history of mathematics in the education of mathematics majors have been discussed at length elsewhere. Many colleges and universities now offer a History of Mathematics course for mathematics majors, for mathematics education majors, or for general credit. At Hood College, we emphasize our commitment to…

  13. Do Biology Majors Really Differ from Non–STEM Majors?

    Science.gov (United States)

    Cotner, Sehoya; Thompson, Seth; Wright, Robin

    2017-01-01

    Recent calls to action urge sweeping reform in science education, advocating for improved learning for all students—including those majoring in fields beyond the sciences. However, little work has been done to characterize the differences—if any exist—between students planning a career in science and those studying other disciplines. We describe an attempt to clarify, in broad terms, how non–STEM (science, technology, engineering, and mathematics) majors differ from life sciences majors, and how they are similar. Using survey responses and institutional data, we find that non–STEM majors are not unilaterally science averse; non–STEM majors are more likely than biology majors to hold misconceptions about the nature of science, yet they are not completely ignorant of how science works; non–STEM majors are less likely than biology majors to see science as personally relevant; and non–STEM majors populations are likely to be more diverse—with respect to incoming knowledge, perceptions, backgrounds, and skills—than a biology majors population. We encourage science educators to consider these characteristics when designing curricula for future scientists or simply for a well-informed citizenry. PMID:28798210

  14. Interdisciplinary Project Experiences: Collaboration between Majors and Non-Majors

    Science.gov (United States)

    Smarkusky, Debra L.; Toman, Sharon A.

    2014-01-01

    Students in computer science and information technology should be engaged in solving real-world problems received from government and industry as well as those that expose them to various areas of application. In this paper, we discuss interdisciplinary project experiences between majors and non-majors that offered a creative and innovative…

  15. Do Biology Majors Really Differ from Non-STEM Majors?

    Science.gov (United States)

    Cotner, Sehoya; Thompson, Seth; Wright, Robin

    2017-01-01

    Recent calls to action urge sweeping reform in science education, advocating for improved learning for all students-including those majoring in fields beyond the sciences. However, little work has been done to characterize the differences-if any exist-between students planning a career in science and those studying other disciplines. We describe an attempt to clarify, in broad terms, how non-STEM (science, technology, engineering, and mathematics) majors differ from life sciences majors, and how they are similar. Using survey responses and institutional data, we find that non-STEM majors are not unilaterally science averse; non-STEM majors are more likely than biology majors to hold misconceptions about the nature of science, yet they are not completely ignorant of how science works; non-STEM majors are less likely than biology majors to see science as personally relevant; and non-STEM majors populations are likely to be more diverse-with respect to incoming knowledge, perceptions, backgrounds, and skills-than a biology majors population. We encourage science educators to consider these characteristics when designing curricula for future scientists or simply for a well-informed citizenry. © 2017 S. Cotner et al. CBE—Life Sciences Education © 2017 The American Society for Cell Biology. This article is distributed by The American Society for Cell Biology under license from the author(s). It is available to the public under an Attribution–Noncommercial–Share Alike 3.0 Unported Creative Commons License (http://creativecommons.org/licenses/by-nc-sa/3.0).

  16. Unconventional Internships for English Majors.

    Science.gov (United States)

    Otto, Don H.

    After five years of research, the English department at St. Cloud (Minnesota) State University created an internship program for English majors. The philosophy behind the program is that the typical experience of the English major in college is excellent preparation for what the college graduate will be doing in most careers in business,…

  17. Do You Have Major Depression?

    Science.gov (United States)

    ... of this page please turn Javascript on. Feature: Depression Do You Have Major Depression? Past Issues / Fall 2009 Table of Contents Simple ... member may have major depression. —NIMH Types of Depression Just like other illnesses, such as heart disease, ...

  18. Anaplasma phagocytophilum: deceptively simple or simply deceptive?

    Czech Academy of Sciences Publication Activity Database

    Severo, M. S.; Stephens, K. D.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2012-01-01

    Roč. 7, č. 6 (2012), s. 719-731 ISSN 1746-0913 Institutional support: RVO:60077344 Keywords : obligate intracellular bacterium * rickettsial agents * ticks * vector-borne diseases Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.018, year: 2012

  19. Detection of Theileria annulata in blood samples of carrier cattle by PCR.

    Science.gov (United States)

    d'Oliveira, C; van der Weide, M; Habela, M A; Jacquiet, P; Jongejan, F

    1995-01-01

    We report the detection of Theileria annulata, the causative agent of tropical theileriosis, by PCR in blood samples obtained from carrier cattle. The assay employs primers specific for the gene encoding the 30-kDa major merozoite surface antigen of T. annulata. A 721-bp fragment was amplified from blood samples taken monthly from calves experimentally infected with one of four different stocks of T. annulata originating in either Mauritania, Portugal, Spain, or Turkey. At the end of the experiment, five animals carried the infection for 12 months and two animals remained infected for 15 months. DNAs from six other Theileria species, T. parva, T. mutans, T. sergenti, T. buffeli, T. velifera, and T. taurotragi, were not amplified. Moreover, DNAs from four other hemoparasites (Anaplasma centrale, Anaplasma marginale, Babesia bovis, and Babesia bigemina) were also not amplified. As a control, primers derived from the small subunit rRNA gene of Theileria spp. amplified a 1.1-kb DNA fragment from all Theileria species examined but not from the other four hemoparasites. As few as two to three parasites per microliter of infected blood in a 50-microliters sample volume were detected by Southern or microplate hybridization with a T. annulata-specific cDNA probe. In addition, 92 field samples obtained from cattle in Spain were tested; 22% were positive in blood smears, 40% were positive by immunofluorescent antibody test, and 75% were positive for T. annulata by PCR. The method provides a useful diagnostic tool for detecting T. annulata carrier cattle. PMID:8567902

  20. Bovine babesiosis and anaplasmosis complex: diagnosis and evaluation of the risk factors from Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Lucimar Souza Amorim

    Full Text Available Direct diagnoses were made by using - blood smears and nested PCR (nPCR tests on 309 blood samples from crossbred dairy cattle in the municipality of Ibicaraí, Bahia. From diagnostic blood smear slides, the observed parasitic frequencies were 31.1% for Anaplasma marginale and 20.4% for Babesia sp. From nPCR diagnoses, they were 63% for A. marginale, 34% for Babesia bigemina and 20.4% for Babesia bovis. There were significant differences (P <0.01 between the two diagnostic methods (nPCR and blood smear slides. The compliance obtained from the kappa test was 0.41 and 0.48 for A. marginale and Babesia sp., respectively. The tick samples from the six farms analyzed using nPCR were only positive for A. marginale. Evaluation of the risk factors relating to the presence of ticks and the age of the animals showed that there was a significant association (P <0.01 with the frequency of animals infected with both pathogens. Therefore, under the conditions studied, nPCR proved to be a good tool for diagnosing the agents of the bovine babesiosis and anaplasmosis complex because of its sensitivity and specificity in comparison with blood smears. The municipality of Ibicaraí is an area with endemic prevalence of bovine babesiosis and anaplasmosis confirmed by nPCR and A. marginale is the main agent of the disease.

  1. Stenting of major airway constriction

    International Nuclear Information System (INIS)

    Wu Xiaomei

    2002-01-01

    Objective: To investigate the correlated issues in the stenting treatment of major airway constriction. Methods: Nineteen cases of major airway stenting procedure were studied retrospectively. The clinical choice of stents of different advantages or deficiencies were discussed. The importance of intravenous anesthesia supporting, life-parameters monitoring during the procedures and the prevention of complications were analysed. Results: Under intravenous and local anesthesia, 19 Wallstents had been successively placed and relieved 19 cases of major airway constrictions due to malignant or benign diseases (15 of tumors, 3 of tuberculosis, 1 of tracheomalacia). Intravenous anesthesia and life-parameters monitoring had made the procedures more safe and precise. Conclusions: Major airway stenting is an reliable method for relieving tracheobronchial stenosis; and intravenous anesthesia supporting and life-parameters monitoring guarantee the satisfactions of procedures

  2. Major hazards onshore and offshore

    International Nuclear Information System (INIS)

    1992-01-01

    This symposium continues the tradition of bringing together papers on a topic of current interest and importance in terms of process safety - in this case, Major Hazards Onshore and Offshore. Lord Cullen in his report on the Piper Alpha disaster has, in effect, suggested that the experience gained in the control of major hazards onshore during the 1980s should be applied to improve safety offshore during the 1990s. This major three-day symposium reviews what has been learned so far with regard to major hazards and considers its present and future applications both onshore and offshore. The topics covered in the programme are wide ranging and deal with all aspects of legislation, the application of regulations, techniques for evaluating hazards and prescribing safety measures in design, construction and operation, the importance of the human factors, and recent technical developments in protective measures, relief venting and predicting the consequences of fires and explosions. (author)

  3. Liquid in the major incision

    International Nuclear Information System (INIS)

    Herrera Jaramillo, Diego Alberto; Ortega Jaramillo, Hector

    2003-01-01

    We present the case of a patient with spill pleural extending in the left major incision. In the chest thorax PA, we could observe one of the complex radiographic appearances that take the reconfiguration of fluid in this localization, being this appearance dependent of the patient's position. Some points are also discussed on the anatomy of the major incisions and some of their radiographic characteristics

  4. Major Decisions: Motivations for Selecting a Major, Satisfaction, and Belonging

    Science.gov (United States)

    Soria, Krista M.; Stebleton, Michael

    2013-01-01

    In this paper, we analyzed the relationship between students' motivations for choosing academic majors and their satisfaction and sense of belonging on campus. Based on a multi-institutional survey of students who attended large, public, research universities in 2009, the results suggest that external extrinsic motivations for selecting a major…

  5. Personality, academic majors and performance

    DEFF Research Database (Denmark)

    Vedel, Anna; Thomsen, Dorthe Kirkegaard; Larsen, Lars

    2015-01-01

    Personality–performance research typically uses samples of psychology students without questioning their representativeness. The present article reports two studies challenging this practice. Study 1: group differences in the Big Five personality traits were explored between students (N = 1067......) in different academic majors (medicine, psychology, law, economics, political science, science, and arts/humanities), who were tested immediately after university enrolment. Study 2: six and a half years later the students’ academic records were obtained, and predictive validity of the Big Five personality...... traits and their subordinate facets was examined in the various academic majors in relation to Grade Point Average (GPA). Significant group differences in all Big Five personality traits were found between students in different academic majors. Also, variability in predictive validity of the Big Five...

  6. Trastornos por consumo de alcohol (AUDIT en adolescentes y jovenes marginales de bandas juveniles de Mexico Transtornos por consumo de álcool (AUDIT em adolescentes e jovens marginais de bandos juvenis do México Alcohol consumption disorder (AUDIT for marginal adolescents and youth from juvenile gangs of Mexico

    Directory of Open Access Journals (Sweden)

    Francisco Rafael Guzmán Facundo

    2007-12-01

    Full Text Available Adolescentes y jóvenes que pertenecen a bandas juveniles con frecuencia son omitidos de las encuestas nacionales sobre consumo de alcohol y drogas. El objetivo del estudio fue conocer los trastornos por consumo de alcohol, y analizar el efecto de factores personales sobre estos, en 125 adolescentes y jóvenes margínales de bandas juveniles de Monterrey, NL. México. Los resultados indicaron que 70% mostró consumo excesivo, 62% se clasificó con consumo perjudicial y el 50% con dependencia. Los factores que más contribuyeron en la predicción del consumo excesivo fueron la edad, sexo y el bajo nivel educativo, para el consumo perjudicial fueron la edad y problemas de salud mental, y para el consumo dependiente fueron la edad, los años de escolaridad y los problemas de salud mental. Estos resultados posibilitarán la reflexión de la necesidad de diseñar programas adecuados dirigidos a la prevención en este grupo de jóvenes marginales.Adolescentes e jovens que pertencem a bandos juvenis com freqüência são omitidos dos estudos nacionais sobre consumo de álcool e drogas. O objetivo da presente pesquisa foi conhecer os transtornos por consumo de álcool e analisar o efeito de fatores pessoais sobre estes, em 125 adolescentes e jovens marginais de bandos juvenis do México. Os resultados mostraram que 70% têm consumo excessivo, 62% se classificou em um consumo prejudicial, e o 50% com dependência. Os fatores que maior contribuíram na predição do consumo excessivo foram a idade, sexo e o baixo nível educacional, para o consumo prejudicial foram a idade e os problemas de saúde mental, e para o consumo dependente foram a idade, os anos de escolaridade e os problemas de saúde mental. Estes resultados possibilitaram a reflexão da necessidade de elaboração de programas adequados direcionados à prevenção neste grupo de jovens.Adolescents and youngers who are involved in gangs, are frequently excluded from the national surveys about

  7. Major disruption process in tokamak

    International Nuclear Information System (INIS)

    Kurita, Gen-ichi; Azumi, Masafumi; Tuda, Takashi; Takizuka, Tomonori; Tsunematsu, Toshihide; Tokuda, Shinji; Itoh, Kimitaka; Takeda, Tatsuoki

    1981-11-01

    The major disruption in a cylindrical tokamak is investigated by using the multi-helicity code, and the destabilization of the 3/2 mode by the mode coupling with the 2/1 mode is confirmed. The evolution of the magnetic field topology caused by the major disruption is studied in detail. The effect of the internal disruption on the 2/1 magnetic island width is also studied. The 2/1 magnetic island is not enhanced by the flattening of the q-profile due to the internal disruption. (author)

  8. Las calles y los barrios marginales de Daca

    OpenAIRE

    LeBeau, Nellie; Tuckfield, Hugh

    2017-01-01

    Cada año, alrededor de medio millón de personas busca alojamiento en Daca, a causa del nexo entre el cambio climático, la pobreza y la degradación del medio ambiente. Muchas de estas personas terminan viviendo en las calles.

  9. Margins in Swedish district heating systems; Marginaler i Fjaerrvaermesystem

    Energy Technology Data Exchange (ETDEWEB)

    Selinder, Patrik; Zinko, Heimo [ZW Energiteknik AB, Nykoeping (Sweden)

    2003-03-01

    It can be assumed on good reasons that the Swedish district heating nets are designed with relatively large margins concerning the transportable power. This is done historically to be able to transport the necessary power that can be called for on the coldest winter days but which occur rarely and also due to the former (until 2001) applied recommendations for the dimensioning of hot water flows. The aim of this project was to investigate the possibilities of reducing the connecting power to customers, both from a technical and from the customer point of view. The heating system of a building in Sweden is normally dimensioned according to a certain outdoor air temperature (DUT in Swedish). According to the Swedish Building Code, DUT20 is defined for a given location in such a way that if the heating system is designed for this temperature, the room temperature is allowed to decrease by 3 deg C in the average once in 20 years. That means that for economical reasons, a power deficiency is accounted for in the case of strong cold. The value of DUT is depending on the thermal inertia of the building. Buildings with high thermal inertia can have a higher DUT and vice versa. A reduced system size can in principle mean smaller size of pipes and consumer substations and more power available for additional customers to be connected. In principle, that means a more profitable district heating operation. Besides costs, another problem with oversized capacities are possible operational problems due to slow dynamic system responses, for instance at restarting occasions after a pump stop. A smaller valve size will result in a better system dynamic and may result in a more compliant system operation and increased delivery quality. By choosing just right DUT for every building and abandoning safety margins, it is shown in the report that the connecting power can be reduced in especially medium light to heavy buildings with larger time constants. However, this also means that the occasions with power deficiency will occur more often. The lower limit for the reduction of connection power is depending on the level of comfort the customers are prepared to accept. These questions have been discussed with selected customer representatives. The mentioned practice of oversizing of the heating power deliverable to the buildings presents a relatively large margin for reduction of consumable power without decreasing the level of heating comfort too much. In the report this method is recommended under the name 'stingy' (= adequate) dimensioning; it is still according to the recommendation of the Swedish building code based on DUT20 and following the regulations of the Swedish District Heating Association for the domestic hot water dimensioning. The result will be a decrease of about 30% of the connected power in most buildings, and somewhat more in the heaviest buildings. Further reduction of the connecting power will implicate a more strong impact on the heating comfort. We call this 'deficiency dimensioning' and we cannot really recommend it apart from some special customer groups who might accept this heating quality by receiving some kind of economic compensation.

  10. Une étude marginale de littérature

    Directory of Open Access Journals (Sweden)

    Bibiane Fréché

    2011-07-01

    Full Text Available Rencontrer une note, selon un propos célèbre prêté au dramaturge Noel Coward, « is like going downstairs to answer the doorbel while making love ». (p. 11Andréas Pfersmann est maître de conférence à l’Université de la Polynésie française. Il étudie depuis près de vingt ans l’annotation. Tout aussi marginal que marginalisé dans les études françaises, le sujet n’est pas neuf pour autant. Les scientifiques allemands planchent depuis la fin du XIXe siècle sur le sujet et le monde anglo-saxon lui...

  11. Major KEEP Findings, 1971 - 1975.

    Science.gov (United States)

    Kamehameha Schools, Honolulu, HI. Kamehameha Early Education Project.

    This report lists the 34 major research findings from the Kamehameha Early Education Program (KEEP) for the years 1971-1975. Each finding is accompanied by a listing of KEEP technical reports and working papers which contain information relevant to that finding. Included among areas covered in the findings are: (1) student motivation, (2) teacher…

  12. Dynamic range majority data structures

    DEFF Research Database (Denmark)

    Elmasry, Amr Ahmed Abd Elmoneim; He, Meng; Munro, J. Ian

    2011-01-01

    Given a set P of n coloured points on the real line, we study the problem of answering range α-majority (or "heavy hitter") queries on P. More specifically, for a query range Q, we want to return each colour that is assigned to more than an α-fraction of the points contained in Q. We present a ne...

  13. Understanding Business Majors' Learning Styles

    Science.gov (United States)

    Giordano, James; Rochford, Regina A.

    2005-01-01

    Recently, business education programs have experienced a decline in enrollment and an increase in attrition. To understand these issues and recommend solutions, the learning styles of 503 first-year business majors at an urban community college were examined. The results demonstrated that: (a) 94% of the participants were analytic learners; (b)…

  14. Epidemiology of major depressive disorder

    NARCIS (Netherlands)

    Stegenga, B.T.

    2011-01-01

    Major depressive disorder (MDD) is a serious health problem and will be the second leading cause of burden of disease worldwide by 2030. To be able to prevent MDD, insight into risk factors for the onset of MDD is of clear importance. On the other hand, if onset of MDD has occurred, one may argue

  15. Rediscovering Major N. Clark Smith.

    Science.gov (United States)

    Buckner, Reginald T.

    1985-01-01

    Historians of American music education have yet to recognize a Black music educator as important and worthy of observation. This article discusses a candidate--Major Nathaniel Clark Smith, a little-known Black music educator, composer of more than a hundred works, businessman, humanitarian, and teacher of numerous big-name jazz musicians. (RM)

  16. Endocrinopathies in thalassemia major patient

    Science.gov (United States)

    Lubis, D. A.; Yunir, E. M.

    2018-03-01

    Advanced in chelation therapy and regular blood transfusion have marked improvements in the life expectancy of patients with thalassemia major, however these patients still have to deal with several complications. We report a 19-year-old male, presented with multiple endocrine complication-related thalassemia; hypogonadism, short stature, osteoporosis with history of fracture, and subclinical hypothyroid.

  17. Physics momentum 'stars' draw majors

    CERN Multimedia

    Lindström, I

    2003-01-01

    Over the past decade, the number of University of Arizona students declaring physics as their major has doubled, amid a national decline. According to a recent report by the National Task Force on Undergraduate Physics, it is the university's dedication to its undergraduate physics program which draws students in (1 page).

  18. Major Depression Can Be Prevented

    Science.gov (United States)

    Munoz, Ricardo F.; Beardslee, William R.; Leykin, Yan

    2012-01-01

    The 2009 Institute of Medicine report on prevention of mental, emotional, and behavioral disorders (National Research Council & Institute of Medicine, 2009b) presented evidence that major depression can be prevented. In this article, we highlight the implications of the report for public policy and research. Randomized controlled trials have shown…

  19. Dirichlet polynomials, majorization, and trumping

    International Nuclear Information System (INIS)

    Pereira, Rajesh; Plosker, Sarah

    2013-01-01

    Majorization and trumping are two partial orders which have proved useful in quantum information theory. We show some relations between these two partial orders and generalized Dirichlet polynomials, Mellin transforms, and completely monotone functions. These relations are used to prove a succinct generalization of Turgut’s characterization of trumping. (paper)

  20. Managemant of NASA's major projects

    Science.gov (United States)

    James, L. B.

    1973-01-01

    Approaches used to manage major projects are studied and the existing documents on NASA management are reviewed. The work consists of: (1) the project manager's role, (2) request for proposal, (3) project plan, (4) management information system, (5) project organizational thinking, (6) management disciplines, (7) important decisions, and (8) low cost approach.

  1. Distance majorization and its applications.

    Science.gov (United States)

    Chi, Eric C; Zhou, Hua; Lange, Kenneth

    2014-08-01

    The problem of minimizing a continuously differentiable convex function over an intersection of closed convex sets is ubiquitous in applied mathematics. It is particularly interesting when it is easy to project onto each separate set, but nontrivial to project onto their intersection. Algorithms based on Newton's method such as the interior point method are viable for small to medium-scale problems. However, modern applications in statistics, engineering, and machine learning are posing problems with potentially tens of thousands of parameters or more. We revisit this convex programming problem and propose an algorithm that scales well with dimensionality. Our proposal is an instance of a sequential unconstrained minimization technique and revolves around three ideas: the majorization-minimization principle, the classical penalty method for constrained optimization, and quasi-Newton acceleration of fixed-point algorithms. The performance of our distance majorization algorithms is illustrated in several applications.

  2. Neurobiology of Major Depressive Disorder

    Directory of Open Access Journals (Sweden)

    Rosa Villanueva

    2013-01-01

    Full Text Available We survey studies which relate abnormal neurogenesis to major depressive disorder. Clinically, descriptive gene and protein expression analysis and genetic and functional studies revised here show that individual alterations of a complex signaling network, which includes the hypothalamic-pituitary-adrenal axis; the production of neurotrophins and growth factors; the expression of miRNAs; the production of proinflammatory cytokines; and, even, the abnormal delivery of gastrointestinal signaling peptides, are able to induce major mood alterations. Furthermore, all of these factors modulate neurogenesis in brain regions involved in MDD, and are functionally interconnected in such a fashion that initial alteration in one of them results in abnormalities in the others. We highlight data of potential diagnostic significance and the relevance of this information to develop new therapeutic approaches. Controversial issues, such as whether neurogenesis is the basis of the disease or whether it is a response induced by antidepressant treatments, are also discussed.

  3. Epidemiology of major depressive disorder

    OpenAIRE

    Stegenga, B.T.

    2011-01-01

    Major depressive disorder (MDD) is a serious health problem and will be the second leading cause of burden of disease worldwide by 2030. To be able to prevent MDD, insight into risk factors for the onset of MDD is of clear importance. On the other hand, if onset of MDD has occurred, one may argue that different course patterns of MDD can be identified and that it is essential to examine their relationship to symptoms and function over time. Insight into these course patterns could assist in p...

  4. Aostra claims major oilsands breakthrough

    International Nuclear Information System (INIS)

    Anon.

    1991-01-01

    This paper reports that Alberta Oil Sands Technology and Research Authority (Aostra) has completed a horizontal well in-situ steam injection project it calls a major breakthrough in commercially producing bitumen from the bast Athabasca oilsands deposit in Alberta. Aostra the its $71 million (Canadian) proof of concept pilot underground test facility (UTF) near Fort McMurray, achieved a 60% bitumen recovery rate, compared with less than 20% recovery typically achieved with Alberta bitumen. More than 100,000 bbl of bitumen was produced during the project

  5. Vanpooling: the three major approaches

    Energy Technology Data Exchange (ETDEWEB)

    Sears, P.M.

    1979-08-01

    The manual provides technical assistance to existing or prospective vanpool sponsors. It is designed to help them promote vanpooling in its three major approaches: employer sponsored, third party sponsored, and driver owned and operated. The first chapter is an overview of vanpooling and a second chapter, on vanpool marketing, is addressed to ridesharing coordinators and others whose responsibilities include the promotion of vanpooling. Some fact sheets on the three approaches provide convenient summaries of the needs and opportunities of each approach and suggest solutions to practical problems likely to be encountered in starting new vanpool programs.

  6. Majority rule on heterogeneous networks

    International Nuclear Information System (INIS)

    Lambiotte, R

    2008-01-01

    We focus on the majority rule (MR) applied on heterogeneous networks. When the underlying topology is homogeneous, the system is shown to exhibit a transition from an ordered regime to a disordered regime when the noise is increased. When the network exhibits modular structures, in contrast, the system may also exhibit an asymmetric regime, where the nodes in each community reach an opposite average opinion. Finally, the node degree heterogeneity is shown to play an important role by displacing the location of the order-disorder transition and by making the system exhibit non-equipartition of the average spin

  7. Societal risk and major disasters

    International Nuclear Information System (INIS)

    Clement, C.F.

    1989-01-01

    A disaster can be defined as an event, or a series of events, in which a large number of people is adversely affected by a single cause. This definition includes man-made accidents, like that at Chernobyl, as well as the natural disasters that insurance companies are sometimes pleased to describe as Acts of God. In 1986 alone, 12,000 people died and 2.2 million were made homeless by 215 major accidents or disasters. The nature of risk is examined in this paper. (author)

  8. Major Environmental Policy in 2000

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hong Jin [Ministry Of Environment, Kwachon (Korea)

    2000-04-01

    As a new millennium has started, there are active movements developing a basic paradigm of vision and policy over a nation-wide to prepare changes actively. For the environmental sector, it is possible to live in a pleasant environment if everyone prepare and work together like dealing with Y2K problem. With a goal of being an environmentally advanced country in the early new millennium, it is planned to improve a basic life environment such as water and air and to promote an advanced environmental management policy for showing results of its reform in 2000. Therefore, it examines environmental management circumstances and a direction of environmental policy first and it discusses more about major environmental policy related to petroleum industry. 7 tabs.

  9. Neuroticism in remitted major depression

    DEFF Research Database (Denmark)

    Gade, Anders; Kristoffersen, Marius; Kessing, Lars Vedel

    2015-01-01

    not been consistent. METHOD: We examined neuroticism, extraversion and perceived stress in 88 fully remitted depressed patients with a mean age of 60 years and with a history of hospitalization for major depressive disorder. Patients were divided into those with onset after and those with onset before 50......BACKGROUND: The personality trait of neuroticism is strongly related to depression, but depression is etiologically heterogeneous. Late-onset depression (LOD) may be more closely related to vascular factors, and previous studies of neuroticism in LOD versus early-onset depression (EOD) have...... age of onset and neuroticism was confirmed in analyses based on age of depression onset as a continuous variable. CONCLUSION: Neuroticism may be an etiological factor in EOD but not or less so in LOD. This finding contributes to the growing evidence for etiological differences between early- and late...

  10. Psychosocial implications of Thalassemia Major.

    Science.gov (United States)

    Aydinok, Yesim; Erermis, Serpil; Bukusoglu, Nagihan; Yilmaz, Deniz; Solak, Ufuk

    2005-02-01

    Many causes including the chronicity of disease, burden of treatment modalities, morbidities, and the expectation of early death resulting from the disease complications, may lead to psychosocial burden in Thalassemia Major (TM) patients. A total of 38 patients with TM and their mothers were recruited to evaluate the psychosocial burden as well as to disclose whether the psychological status of the patients contribute to the compliance with the therapy or to the contrary. Demographic and disease variables were obtained. Child Behavior Check-list (CBCL) was completed by the mothers of the patients. A detailed psychiatric interview based on the 4th edition of the Diagnostic and Statistical Manual diagnostic criteria was performed for each patient. Symptom Distress Checklist 90 (SCL-90) scale was given to all mothers for evaluating their psychopathology. Although CBCL scores remained between the normal ranges, desferrioxamine mesylate (DFO)-compliant patients and the patients with lower ferritin values had significantly higher scores. A total of 24% of the patients had a psychiatric diagnosis including major depression, anxiety disorder, tic disorder, and enuresis nocturnal. The psychiatric diagnosis was significantly higher in the patients who were compliant with desferrioxamine compared with the non-compliant group (P = 0.007). The SCL-90 scores indicated that the mothers who had a child with good adherence to DFO had higher scale scores than the mothers with a poor adherent child. The increase risk of psychosocial and behavioral problems in thalassemics and their parents indicated the importance of a lifelong psychosocial support for the prevention of mental health issues. The patients and their parents, who were more conscious of the illness, were more worried but more compliant with the therapy and need stronger psychiatric support.

  11. Thalassaemia major and the heart

    Directory of Open Access Journals (Sweden)

    J. Malcolm Walker

    2013-03-01

    Full Text Available Disorders of haemoglobin synthesis are the commonest monogenetic disorders worldwide. When first described, thalassaemia was universally fatal in childhood, but after the adoption of regular blood transfusion survival until early teenage and adulthood was to be expected. At that stage in the life of these affected individuals organ failure followed, due to accumulated iron, for which the human has no excretory capacity. Principal amongst the tissues affected by iron overload is the heart and even to the present day, heart disease accounts for the overwhelming majority of premature deaths in this population. Managing transfusion derived iron overload was the next hurdle for clinicians and the families of the patients. For nearly four decades the only available treatment was the demanding regime of parenteral chelation therapy, required on a daily basis, to achieve growth, development and survival with limited or no organ damage. Despite the adoption of these treatment strategies the outlook for thalassaemia patients remained poor, with a 30% to 40% mortality occurring between late teenage and 30 years of age, even in well organised health care systems, such as in the UK, where regular transfusion and desferioxamine treatment were readily available. This dreadful early mortality, largely as a consequence of myocardial iron overload, (1,2 is now improving so that in the UK and other developed nations, heart failure in thalassaemic patients has become uncommon and premature death a much rarer tragedy. This editorial reviews, from a personal viewpoint of a cardiologist involved in the care of these patients for the last 20 years, the progress in the management of the cardiovascular complications of thalassaemia major (TM, which has followed better techniques of identifying those thalassaemic individuals at greatest risk, improved chelation strategies making best use of the three chelating agents that are now available and improved co

  12. Aplicación de modelos estructurales marginales para estimar los efectos de la terapia antirretroviral en 5 cohortes de seroconvertores al virus de la inmunodeficiencia humana Marginal structural models application to estimate the effects of antiretroviral therapy in 5 cohorts of HIV seroconverters

    Directory of Open Access Journals (Sweden)

    Santiago Pérez-Hoyos

    2007-02-01

    Full Text Available Los métodos convencionales tienen limitaciones para ajustar por factores de confusión dependientes del tiempo para evaluar la efectividad poblacional de tratamientos en estudios observacionales. En este trabajo se muestra un nuevo tipo de metodología, los modelos estructurales marginales (MEM, y se estima la efectividad de la terapia antirretroviral de gran actividad (TARGA sobre la incidencia de sida o muerte. Sujetos y métodos: Se identificaron los sujetos sin TARGA seguidos a partir de 1997 en las cohortes de seroconvertores al virus de la inmunodeficiencia humana (VIH del proyecto GEMES (Grupo de Estudio Multicéntrico Español de Seroconvertores. Para estimar el efecto sobre la incidencia de sida o muerte, se obtuvieron los parámetros de un MEM mediante una regresión logística ponderada por probabilidad inversa. La estimación de los pesos se basó en el recuento de CD4, el tiempo desde la seroconversión, el sexo, la edad, la categoría de trasmisión y el tratamiento previo. Resultados: Los 917 sujetos elegibles se siguieron durante una media de 3,4 años, durante los cuales se observaron 139 desenlaces de interés. El 42,1% de los participantes recibió TARGA durante el estudio. La tasa relativa fue de 1,01 (intervalo de confianza &(IC& del 95%, 0,68-1,49 mediante un modelo de Cox convencional sin covariables, y de 0,90 (IC del 95%, 0,61-1,32 mediante un modelo de Cox convencional con covariables cambiantes en el tiempo. La tasa relativa causal estimada por un MEM fue de 0,74 (IC del 95%, 0,49-1,12. Conclusiones: El efecto beneficioso del TARGA encontrado por los MEM está bien establecido, pero los modelos convencionales no pudieron detectarlo. El uso de un MEM permitió ajustar apropiadamente por la variable CD4, que es a la vez una variable de confusión dependiente del tiempo y está afectada por el uso previo de tratamiento.Objectives: Standard methods to evaluate population effectiveness of treatments in observational

  13. Tilecal meets two major milestones

    CERN Multimedia

    Cavalli-Sforza, M.

    Over the last two months the Tile Calorimeter passed not one but two major milestones. In early May, the last of the 64 modules that make up one of the two Extended Barrels arrived at CERN from IFAE-Barcelona, equipped with optical components and tested. And during the Overview Week in Clermont-Ferrand, the last of the 64 Barrel modules, mechanically assembled, arrived from JINR-Dubna. Just a brief reminder: the ATLAS Tile Calorimeter is composed of 3 cylinders ("barrels") of steel, scintillating tiles and optical fibers, altogether about 12 m long, with an outer diameter of 8.4 m, and weighing about 2700 tons. The central cavity will contain the Liquid Argon cryostats, and the whole calorimetry system will measure the direction and energy of jets produced at the LHC, as well as the missing transverse energy, which as everyone knows is one of the telltale signals of new and exciting physics. Each of the three cylinders is divided azimuthally into 64 modules - much like the slices of an orange. The modules ar...

  14. [Oromaxillofacial changes in thalassemia major].

    Science.gov (United States)

    De Mattia, D; Pettini, P L; Sabato, V; Rubini, G; Laforgia, A; Schettini, F

    1996-01-01

    Sixty patients (31 male and 29 female) with thalassemia major, aged between 6 and 26 years, 18 of which were splenectomized, were observed in this study evaluating the oro-maxillo-facial alterations and correlating them to transfusion indexes, serum ferritin levels, splenectomy and age. For each patient a haematologic and odontostomatologic card was filed with a view to report the medical and clinical history regarding: the haematologic picture, the prevention of caries and parodontal disease, the facies characteristics, the odonto-stomatologic examination, the orthodontic diagnosis, the skull X-rays and the orthopantomography. Poor oral hygiene as well as misknowledge of prevention were generally observed. All the patients showed carious lesions but most of them had never seen a dentist for therapy. The disharmonious growth of splanchnocranium, with the enlargement of the jaw and of its alveolar process, induced by the bone marrow hyperplasia, produced various and serious malocclusion stages (Angle's II class, deep bite, open bite), gnathologic alterations, hypodiaphanous paranasal sinuses and orbital hypertelorism, with a typical oriental-like facies. Malocclusion and the poor oral hygienic conditions determined the occurrence of marginal gingivitis, mainly localized at the level of the lower frontal teeth. In only 3 patients the oral mucous membrane was pale and atrophic. During this investigation agenesia and dental retention were reported in 30% and in 26% of the examined cases respectively, while no patients had supernumerary teeth. Tooth volume, position and shape abnormalities rarely occurred. Only in two patients was enamel hypoplasia described. The caries frequency greatly varied in number and in degree. Only five patients did not show any carious lesions. The caries index (DMF) for the permanent teeth calculated in all the 60 subjects was 5, 12 +/- 4.76. By utilizing Spearman's rank test the number of teeth with caries in the permanent dentition (DFM

  15. First confirmed report of outbreak of theileriosis/anaplasmosis in a cattle farm in Henan, China.

    Science.gov (United States)

    Cui, Yanyan; Wang, Xiaoxing; Zhang, Yan; Yan, Yaqun; Dong, Haiju; Jian, Fuchun; Shi, Ke; Zhang, Longxian; Wang, Rongjun; Ning, Changshen

    2018-01-01

    Tick-borne diseases (TBDs) impose a significant constraint to livestock production world widely. In this paper, we presented a case of TBD in a cattle farm in Henan, China. 35 blood samples (7 samples sent by veterinarian, 28 samples gathered by our colleagues) were collected from ill, surviving and asymptomatic cattle and microscopic observation and PCR assays were conducted to characterize the pathogens. Genus Ixodes feeding on these cattle were collected and identified. Theileria annulata-like and Anaplasma marginale-like pathogens were observed in the blood smears stained with Giemsa staining under microscope. Furthermore, 5 out of 7 cattle blood samples were found to be positive for T. annulata by PCR. In the 28 blood specimens, three were positive for T. annulata, while A. marginale DNA was detected in nine blood DNA samples. Besides, 56 ticks feeding on cattle were collected from this farm and were all identified as Rhipisephalus microplus, meanwhile, 10 of them were found to be positive for A. marginale. In addition, phylogenetic analysis of the msp4 gene sequences of A. marginale obtained in this study showed that the isolate from cattle (KX840009) fell in the same clade with that of R. microplus (KX904527), sharing 100% similarity. To the best of our knowledge, this is the first confirmed report of outbreak of theileriosis/anaplasmosis in cattle farms in Henan, China. Copyright © 2017. Published by Elsevier B.V.

  16. [Natural infection by hemoparasites in calves submitted to chemoprophylaxis at 30 days of age].

    Science.gov (United States)

    da Silva, Rosângela A; Corrêa, Fabíola do N; Botteon, Rita de Cássia C M; Botteon, Paulo de Tarso L

    2007-01-01

    The tick-borne disease (TBD) brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%), B. bovis (11.1%) and A. marginale (13.9%). Six animals had clinical symptoms (16.7%) and one dead (2.8%). The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

  17. Diagnosis of hemoparasitosis trough the spread-smear technique using a drop of blood clot

    Directory of Open Access Journals (Sweden)

    Neusa Saltiél Stobbe

    1992-12-01

    Full Text Available The spread-smear technique using a drop of blood clot and stained by diluted and undimitcd Giemsa stain was evaluated for the search of blood cell types and recognition of Babesia bovis, Babesia bigemina and Anaplasma marginale hemoparasites. The blood clot samples were taken from a 6 month-old calf experimentally inoculated with the blood from a Cattle Tick Fever carrier. The Technique was sumitable for the observation of different blood cells and for the recognition of the hemoparasites.

  18. Major Highway Lines, US, 2015, NAVTEQ

    Data.gov (United States)

    U.S. Environmental Protection Agency — NAVTEQ Major Highways for the United States. The Major Highways layer contains Road Network features based on the Functional Class attribute value on each link...

  19. HEMOPARASITOSIS EN GANADERÍA DOBLE PROPÓSITO VENEZOLANA, DIAGNÓSTICO Y CONTROL: UNA REVISIÓN

    Directory of Open Access Journals (Sweden)

    Rita Tamasaukas

    2010-01-01

    Full Text Available Este trabajo de revisión de tesis doctoral incluye resultados de investigaciones realizadas en el periodo 1971 a 2009 sobre cuatro hemoparasitosis causados por protozoarios y rickettsiales en Venezuela y otros países, con énfasis en la infección mixta en rebaños bovinos, y su diagnóstico y control. En Venezuela, las afecciones causadas por agentes hemotrópicos parasitarios están distribuidas en todos los estados del país con vocación ganadera, en especial, en rebaños bovinos y bufalinos. Entre aquellos encontramos a especies del género Anaplasma (Anaplasma marginale, Babesia (Babesia bigemina y B. bovis, y Trypanosoma (Trypanosoma vivax, con una frecuencia endémica y con variaciones estacionales.

  20. Why It Pays to Major in Economics

    Science.gov (United States)

    Carroll, Thomas; Assane, Djeto; Busker, Jared

    2014-01-01

    In this article, the authors use a large, recent, and accessible data set to examine the effect of economics major on individual earnings. They find a significant positive earnings gain for economics majors relative to other majors, and this advantage increases with the level of education. Their findings are consistent with Black, Sanders, and…

  1. 75 FR 31383 - Major Capital Investment Projects

    Science.gov (United States)

    2010-06-03

    ...-0009] RIN 2132-AB02 Major Capital Investment Projects AGENCIES: Federal Transit Administration (FTA... current approach to evaluating and rating major capital investment projects (``New Starts'' and ``Small...'' to address identified transportation needs in the corridor without a major capital investment in new...

  2. The Prototypical Majority Effect Under Social Influence.

    Science.gov (United States)

    Koriat, Asher; Adiv-Mashinsky, Shiri; Undorf, Monika; Schwarz, Norbert

    2018-05-01

    Majority views are reported with greater confidence and fluency than minority views, with the difference increasing with majority size. This Prototypical Majority Effect (PME) was attributed generally to conformity pressure, but Koriat et al. showed that it can arise from the processes underlying decision and confidence independent of social influence. Here we examined the PME under conditions that differ in social influence. In Experiment 1, a robust PME emerged in the absence of information about the majority views, but the provision sof that information increased the choice of the majority view and magnified the PME. In Experiment 2, a PME emerged in a minority-biased condition that misled participants to believe that the majority view was the minority view, but the PME was stronger in a majority-biased condition. The results were discussed in terms of a dual-process view: The PME observed under social influence may contain externally driven and internally driven components.

  3. Majorization arrow in quantum-algorithm design

    International Nuclear Information System (INIS)

    Latorre, J.I.; Martin-Delgado, M.A.

    2002-01-01

    We apply majorization theory to study the quantum algorithms known so far and find that there is a majorization principle underlying the way they operate. Grover's algorithm is a neat instance of this principle where majorization works step by step until the optimal target state is found. Extensions of this situation are also found in algorithms based in quantum adiabatic evolution and the family of quantum phase-estimation algorithms, including Shor's algorithm. We state that in quantum algorithms the time arrow is a majorization arrow

  4. Performance profiles of major energy producers 1989

    Energy Technology Data Exchange (ETDEWEB)

    1991-01-23

    Performance Profiles of Major Energy Producers 1989 is the thirteenth annual report of the Energy Information Administration's (EIA) Financial Reporting System (FRS). The report examines financial and operating developments, with particular reference to the 23 major energy companies (the FRS companies'') required to report annually on Form EIA-28. Financial information is reported by major lines of business including oil and gas production, petroleum refining and marketing, and other energy operations. Domestic and international operations are examined separately in this report. It also traces key developments affecting the financial performance of major energy companies in 1989, as well as review of important trends.

  5. Performance profiles of major energy producers, 1991

    International Nuclear Information System (INIS)

    1992-01-01

    Performance Profiles of Major Energy Producers 1991 is the fifteenth annual report of the Energy Information Administration's (EIA) Financial Reporting System (FRS). The report examines financial and operating developments, with particular reference to the 23 major energy companies (the FRS companies) required to report annually on Form EIA-28. It also traces key developments affecting the financial performance of major energy companies in 1991, as well as reviews important trends. Financial information is reported by major lines of business including oil and gas production, petroleum refining and marketing, and other energy operations. Domestic and international operations are examined separately in this report

  6. Personal and interpersonal risk factors in the consumption of illicit drugs by marginal adolescents and young people from juvenile gangs Factores de riesgo personales e interpersonales en el consumo drogas ilícitas en adolescentes y jóvenes marginales de bandas juveniles Fatores de risco pessoais e interpessoais no consumo de drogas ilícitas em adolescentes e jovens marginais de bandos juvenis

    Directory of Open Access Journals (Sweden)

    Francisco Rafael Guzmán Facundo

    2008-06-01

    Full Text Available Marginal populations are groups which are known to present higher risks of drug consumption. It is possible to identify adolescents and young people from juvenile gangs that constitute this group. The purpose of this study was to analyze the effect of personal and interpersonal risk factors of drug consumption in 175 marginal adolescents and young people who belong to juvenile gangs in Mexico. Results showed a significant effect of personal factors on drug use, with an estimated variation of 26.1%. The factors that presented the highest rates were: gender, age and mental problems. The interpersonal factors (relationships with friends who have maladaptive behaviors and inappropriate relationships with parents showed an effect with an estimated variation of 15%. These results will allow for reflection and, in the future, the elaboration of adequate preventive programs aimed at this group of young people.Grupos reconocidos con mayor riesgo para consumir drogas, son los marginales, dentro de estos podemos localizar a los adolescentes y jóvenes de bandas juveniles. El objetivo del estudio fue analizar el efecto de los factores de riesgo personales e interpersonales sobre el consumo de drogas, en 175 adolescentes y jóvenes margínales de bandas juveniles de México. Los resultados mostraron efecto significativo de los factores personales sobre el consumo de drogas, con una varianza explicada del 26.1%, los factores que mostraron una mayor contribución fueron; el sexo, edad y problemas de salud mental. Los factores interpersonales (relación con amigos con conductas mal adaptadas y relación inapropiada con padres mostraron un efecto sobre el consumo de drogas, con una varianza explicada del 15%. Estos resultados posibilitarán la reflexión y en un futuro diseñar programas adecuados dirigidos a la prevención en este grupo de jóvenes.Grupos reconhecidos com maior risco para o consumo de drogas, são os de populações marginais, e, dentro destas

  7. Imaging of the major salivary glands

    DEFF Research Database (Denmark)

    Afzelius, Pia; Nielsen, Ming-Yuan; Ewertsen, Caroline

    2016-01-01

    The major salivary glands, submandibular, parotid and sublingual glands play an important role in preserving the oral cavity and dental health. Patients with problems of the major salivary glands may present with symptoms such as dry mouth, dysphagia and obstruction of duct, inflammation, severe...

  8. Work Values and College Major Choice

    Science.gov (United States)

    Balsamo, Michela; Lauriola, Marco; Saggino, Aristide

    2013-01-01

    Our study sought to clarify the nature of the known individual differences in work values associated with academic college major choice, specifically the question whether these precede or follow the choice of an academic major. To rule out environmental influences during academic study, group differences in five value orientations were evaluated…

  9. Test for English Majors (TEM) in China

    Science.gov (United States)

    Jin, Yan; Fan, Jinsong

    2011-01-01

    The purpose of the Test for English Majors (TEM) is to measure the English proficiency of Chinese university undergraduates majoring in English Language and Literature and to examine whether these students meet the required levels of English language abilities as specified in the National College English Teaching Syllabus for English Majors…

  10. 14 CFR Appendix B to Part 43 - Recording of Major Repairs and Major Alterations

    Science.gov (United States)

    2010-01-01

    ... inspected. (d) For extended-range fuel tanks installed within the passenger compartment or a baggage... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Recording of Major Repairs and Major... to Part 43—Recording of Major Repairs and Major Alterations (a) Except as provided in paragraphs (b...

  11. Performance profiles of major energy producers 1992

    International Nuclear Information System (INIS)

    1994-01-01

    Performance Profiles of Major Energy Producers 1992 is the sixteenth annual report of the Energy Information Administration's (EIA) Financial Reporting System (FRS). The report examines financial and operating developments, with particular reference to the 25 major energy companies (the FRS companies) required to report annually on Form EIA-28. Financial information is reported by major lines of business, including oil and gas production, petroleum refining and marketing, and other energy operations. Domestic and international operations are examined separately in this report. The data are presented in the context of key energy market developments with a view toward identifying changing strategies of corporate development and measuring the apparent success of current ongoing operations

  12. Inequalities theory of majorization and its applications

    CERN Document Server

    Olkin, Ingram

    1980-01-01

    Although they play a fundamental role in nearly all branches of mathematics, inequalities are usually obtained by ad hoc methods rather than as consequences of some underlying ""theory of inequalities."" For certain kinds of inequalities, the notion of majorization leads to such a theory that is sometimes extremely useful and powerful for deriving inequalities. Moreover, the derivation of an inequality by methods of majorization is often very helpful both for providing a deeper understanding and for suggesting natural generalizations.Anyone wishing to employ majorization as a tool in applicati

  13. Performance profiles of major energy producers 1994

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-02-01

    Performance Profiles of Major Energy Producers 1994 is the eighteenth annual report of the Energy Information Administration`s (EIA) Financial Reporting System (FRS). The report examines financial and operating developments in energy markets, with particular reference to the 24 major U.S. energy companies required to report annually on Form EIA-28. Financial information is reported by major lines of business, including oil and gas production, petroleum refining and marketing, other energy operations, and nonenergy businesses. Financial and operating results are presented in the context of energy market developments with a view toward identifying changing corporate strategies and measuring the performance of ongoing operations both in the United States and abroad.

  14. Performance profiles of major energy producers 1979

    International Nuclear Information System (INIS)

    1981-07-01

    The purpose of this report is to examine year-to-year developments in the operations of 26 major US energy companies on a corporate level and also by major line of energy business and by major functions within each line of business. The period covered is 1977 to 1979. Comparisons of income and investment flow are featured and related to functionally allocated net investment in place. The presentation seeks to identify similarities and dissimilarities in results across lines-of-business activity or by firm size

  15. Performance profiles of major energy producers 1993

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-01-01

    Performance Profiles of Major Energy Producers 1993 is the seventeenth annual report of the Energy Information Administration`s (EIA) Financial Reporting System (FRS). The report examines financial and operating developments in energy markets, with particular reference to the 25 major US energy companies required to report annually on Form EIA-28. Financial information is reported by major liens of business, including oil and gas production, petroleum refining and marketing, other energy operations, and nonenergy businesses. Financial and operating results are presented in the context of energy market developments with a view toward identifying changing corporate strategies and measuring the performance of ongoing operations both in the US and abroad. This year`s report analyzes financial and operating developments for 1993 (Part 1: Developments in 1993) and also reviews key developments during the 20 years following the Arab Oil Embargo of 1973--1974 (Part 2: Major Energy Company Strategies Since the Arab Oil Embargo). 49 figs., 104 tabs.

  16. Major Development Communication Paradigms and Practices ...

    African Journals Online (AJOL)

    info

    major paradigms of development and communication practices on graphic ... mobilize, educate and persuade target audience to support human development ... facilitates the understanding of the themes, issues and facts of a campaign.

  17. Data Sets from Major NCI Initiaves

    Science.gov (United States)

    The NCI Data Catalog includes links to data collections produced by major NCI initiatives and other widely used data sets, including animal models, human tumor cell lines, epidemiology data sets, genomics data sets from TCGA, TARGET, COSMIC, GSK, NCI60.

  18. Performance profiles of major energy producers 1996

    International Nuclear Information System (INIS)

    1998-01-01

    This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs

  19. Performance profiles of major energy producers 1996

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1998-01-01

    This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs.

  20. April 2006. 32 Major Orthopaedic Procedures

    African Journals Online (AJOL)

    user

    2006-04-01

    Apr 1, 2006 ... Major Orthopaedic Procedures: 17 Year Trends. Biruk Lambisso Wamisho1 ... financial and logistic constraints with poor compliance of ... Modern orthopaedic surgery is very expensive. A highly ..... Case management. Tribury.

  1. Dynamics of Major Cereals Productivity in Nepal

    Directory of Open Access Journals (Sweden)

    Samaya Gairhe

    2018-05-01

    Full Text Available Cereal crops have played major roles in addressing food security issues in Nepal. In recent years there have been fluctuations in crop production and demands situations due to various reasons. Thus, the present study aims to analyze the dynamics of major cereals productivity in Nepal from 1995 to 2014. Focus group discussions were done in mid-hills and tarai of Nepal in 2015. Percentage change, compound growth rate, annual rate of change, coefficient of variation, instability index were calculated to analyze results. The result shows that the area, production and productivity of major cereals had an increasing trend over the study period. The major factors contributing on productivity increase in cereal crops were irrigation facilities, use of improved and hybrid seeds, chemical fertilizer and better technical knowhow among the farmers. For effective adoption of research outputs to improve the productivity emphasis should also be given on promotion of public private partnership (PPP in research and development.

  2. Major Benno Leesiku mälestuseks

    Index Scriptorium Estoniae

    2010-01-01

    Järelehüüe 2006. aastal surnud Kaitseliidu juhile, Eesti Laskurliidu asepresidendile ja võimlemistreenerite klubi Kartek presidendile major Benno Leesikule, kes oleks 17. jaanuaril 2010. aastal saanud 50-aastaseks

  3. Characterizing the epistemological development of physics majors

    Directory of Open Access Journals (Sweden)

    Elizabeth Gire

    2009-02-01

    Full Text Available Students in introductory physics courses are likely to have views about physics that differ from those of experts. However, students who continue to study physics eventually become experts themselves. Presumably these students either possess or develop more expertlike views. To investigate this process, the views of introductory physics students majoring in physics are compared with the views of introductory physics students majoring in engineering. In addition, the views of physics majors are assessed at various stages of degree progress. The Colorado learning attitudes about science survey is used to evaluate students’ views about physics, and students’ overall survey scores and responses to individual survey items are analyzed. Beginning physics majors are significantly more expertlike than nonmajors in introductory physics courses, and this high level of sophistication is consistent for most of undergraduate study.

  4. Coherence for vectorial waves and majorization

    OpenAIRE

    Luis, Alfredo

    2016-01-01

    We show that majorization provides a powerful approach to the coherence conveyed by partially polarized transversal electromagnetic waves. Here we present the formalism, provide some examples and compare with standard measures of polarization and coherence of vectorial waves.

  5. Researchers Realize Major Breakthrough in Understanding Endometriosis

    Science.gov (United States)

    ... 16, 2014 Researchers Realize Major Breakthrough in Understanding Endometriosis For a disease that affects an estimated 6 ... 10% of women, surprisingly little is known about endometriosis — a disorder that causes uterine tissue to grow ...

  6. Disturbances in equilibrium function after major earthquake.

    Science.gov (United States)

    Honma, Motoyasu; Endo, Nobutaka; Osada, Yoshihisa; Kim, Yoshiharu; Kuriyama, Kenichi

    2012-01-01

    Major earthquakes were followed by a large number of aftershocks and significant outbreaks of dizziness occurred over a large area. However it is unclear why major earthquake causes dizziness. We conducted an intergroup trial on equilibrium dysfunction and psychological states associated with equilibrium dysfunction in individuals exposed to repetitive aftershocks versus those who were rarely exposed. Greater equilibrium dysfunction was observed in the aftershock-exposed group under conditions without visual compensation. Equilibrium dysfunction in the aftershock-exposed group appears to have arisen from disturbance of the inner ear, as well as individual vulnerability to state anxiety enhanced by repetitive exposure to aftershocks. We indicate potential effects of autonomic stress on equilibrium function after major earthquake. Our findings may contribute to risk management of psychological and physical health after major earthquakes with aftershocks, and allow development of a new empirical approach to disaster care after such events.

  7. Major dealers' expert power in distribution channels

    OpenAIRE

    Richard Chinomona; Marius Pretorius

    2011-01-01

    The importance of major dealers' expertise in distribution channels and effects on exchange relations is widely acknowledged by many SMEs in Africa and yet there seem to be a paucity of research on this matter. To address this dearth, the current study attempts to examine the relationship between major dealers' expert power and SME manufacturers' channel cooperation and the mediating influence of their trust, relationship commitment and satisfaction. The conceptualized model and five hypothes...

  8. The pectoralis major footprint: An anatomical study

    Directory of Open Access Journals (Sweden)

    Eduardo Antonio de Figueired

    2013-12-01

    Full Text Available Objective: To study the insertion of the pectoralis major tendon to the humerus, through knowledge of its dimensions in the coronal and sagittal planes. Methods: Twenty shoulders from 10 cadavers were dissected and the pectoralis major tendon insertion on the humerus was identified and isolated. The dimensions of its "footprint" (proximal to distal and medial to lateral borders and the distance from the top edge of the pectoralis major tendon to apex of the humeral head structures were measured. Results: The average proximal to distal border length was 80.8 mm (range: 70 -90 and the medial-to-lateral border length was 6.1 mm (5 -7. The average distance (and range from the apex of the pectoralis major tendon to the humeral head was 59.3 mm. Conclusions: We demonstrate that the insertion of the pectoralis major tendon is laminar, and the pectoralis major tendon has an average footprint height and width of 80.8 mm and 6.1 mm, respectively.

  9. A Major in Science? Initial Beliefs and Final Outcomes for College Major and Dropout

    OpenAIRE

    Ralph Stinebrickner; Todd R. Stinebrickner

    2014-01-01

    Taking advantage of unique longitudinal data, we provide the first characterization of what college students believe at the time of entrance about their final major, relate these beliefs to actual major outcomes, and provide an understanding of why students hold the initial beliefs about majors that they do. The data collection and analysis are based directly on a conceptual model in which a student's final major is best viewed as the end result of a learning process. We find that students en...

  10. Psychology Degree Beliefs and Stereotypes: Differences in the Perceptions of Majors and Non-Majors

    Science.gov (United States)

    Brinthaupt, Thomas M.; Hurst, Jennifer R.; Johnson, Quinn R.

    2016-01-01

    Very little research examines the beliefs and stereotypes students have about the discipline and major of psychology. Previous research has found that psychology majors report hearing a variety of such beliefs and stereotypes more often from their fellow students than from their family members. In the current study, psychology majors/minors and…

  11. Bipolar disorder: Evidence for a major locus

    Energy Technology Data Exchange (ETDEWEB)

    Spence, M.A.; Flodman, P.L. [Univ. of California, Irvine, CA (United States); Sadovnick, A.D.; Ameli, H. [Univ. of British Columbia, Vancouver (Canada)] [and others

    1995-10-09

    Complex segregation analyses were conducted on families of bipolar I and bipolar II probands to delineate the mode of inheritance. The probands were ascertained from consecutive referrals to the Mood Disorder Service, University Hospital, University of British Columbia and diagnosed by DSM-III-R and Research Diagnostic Criteria. Data were available on over 1,500 first-degree relatives of the 186 Caucasian probands. The purpose of the analyses was to determine if, after correcting for age and birth cohort, there was evidence for a single major locus. Five models were fit to the data using the statistical package SAGE: (1) dominant, (2) recessive, (3) arbitrary mendelian inheritance, (4) environmental, and (5) no major effects. A single dominant, mendelian major locus was the best fitting of these models for the sample of bipolar I and II probands when only bipolar relatives were defined as affected (polygenic inheritance could not be tested). Adding recurrent major depression to the diagnosis {open_quotes}affected{close_quotes} for relatives reduced the evidence for a major locus effect. Our findings support the undertaking of linkage studies and are consistent with the analyses of the National Institutes of Mental Health (NIMH) Collaborative Study data by Rice et al. and Blangero and Elston. 39 refs., 4 tabs.

  12. The major tokamak distruption in cylindrical plasma

    International Nuclear Information System (INIS)

    Choi, Jeong Sik; Choi, Eun Ha; Choi, Duk In

    1986-01-01

    The mechanism of the major disruption in tokamak plasma which involves the nonlinear interaction of tearing models is numerically studied in two and three dimensional formulations. In this study, it is found that in the two dimensional case with a flattened current density profile the magnetic islands of the m=2; n=1 mode do not saturate nonlinearly and but strongly interact with the limiter. Thus it is suggested that the helical perturbation of the m=2;n=1 mode plays the dominant role in the major disruption. We also show that the m=2;n=1 mode nonlinearly destablizes other tearing modes, especially the m=3;n=2 mode, from the nonlinear coupling of different helicities as also shown in other studies. The plasma extends across the plasma cross section, and the plasma core shifts inward along the major radius during the major disruption. The numerical result for the major disruption time measured using the nonlinear 3-D procedure for the initial value problem with PLT parameters is about 450 μsec which agrees reasonably well with the experimental value of 500 μsec. (Author)

  13. Performance profiles of major energy producers 1992

    Energy Technology Data Exchange (ETDEWEB)

    1994-01-13

    Performance Profiles of Major Energy Producers 1992 is the sixteenth annual report of the Energy Information Administration`s (EIA) Financial Reporting System (FRS). The report examines financial and operating developments, with particular reference to the 25 major energy companies (the FRS companies) required to report annually on Form EIA-28. Financial information is reported by major lines of business, including oil and gas production, petroleum refining and marketing, and other energy operations. Domestic and international operations are examined separately in this report. The data are presented in the context of key energy market developments with a view toward identifying changing strategies of corporate development and measuring the apparent success of current ongoing operations.

  14. Major dealers' expert power in distribution channels

    Directory of Open Access Journals (Sweden)

    Richard Chinomona

    2011-06-01

    Full Text Available The importance of major dealers’ expertise in distribution channels and effects on exchange relations is widely acknowledged by many SMEs in Africa and yet there seem to be a paucity of research on this matter. To address this dearth, the current study attempts to examine the impact of major dealers’ expert power on SME manufacturers’ channel cooperation and the mediating influence of their trust, relationship commitment and satisfaction. The conceptualized model and five hypotheses are empirically validated using a sample of 452 manufacturing SMEs in Zimbabwe. The findings indicate that major dealers’ expert power may influence SME manufacturers’ trust, relationship commitment, relationship satisfaction and channel cooperation in a significant way. Managerial implications of the research findings are provided.

  15. Exercise for patients with major depression

    DEFF Research Database (Denmark)

    Krogh, Jesper; Speyer, Helene; Gluud, Christian

    2015-01-01

    is to investigate the beneficial and harmful effects of exercise, in terms of severity of depression, lack of remission, suicide, and so on, compared with treatment as usual with or without co-interventions in randomized clinical trials involving adults with a clinical diagnosis of major depression. A meta......BACKGROUND: The lifetime prevalence of major depression is estimated to affect 17% of the population and is considered the second largest health-care problem globally in terms of the number of years lived with disability. The effects of most antidepressant treatments are poor; therefore, exercise...... has been assessed in a number of randomized clinical trials. A number of reviews have previously analyzed these trials; however, none of these reviews have addresses the effect of exercise for adults diagnosed with major depression. METHODS/DESIGN: The objective of this systematic review...

  16. [Major breakthroughs in the medical treatment

    DEFF Research Database (Denmark)

    Kirk, O.; Gerstoft, J.; Lundgren, J.D.

    2009-01-01

    The introduction of antiretroviral combination therapy for patients with HIV infection is described as an example of a breakthrough within the field of medical treatment. The background for the breakthrough and the phases thereof are described and for comparison, the circumstances of major breakt...... breakthroughs within other medical specialities are mentioned Udgivelsesdato: 2009/3/2......The introduction of antiretroviral combination therapy for patients with HIV infection is described as an example of a breakthrough within the field of medical treatment. The background for the breakthrough and the phases thereof are described and for comparison, the circumstances of major...

  17. Major economies Forum on energy and climate

    International Nuclear Information System (INIS)

    2009-01-01

    The Major Economies Forum is intended to facilitate an open dialogue among major developed and developing economies, help generate the political leadership necessary to achieve a successful outcome at the United Nations climatic change conference in Copenhagen, and advance the exploration of concrete initiatives and joint ventures that increase the supply of clean energy while cutting greenhouse gas emissions. The Forum's second preparatory meeting was held in Paris in May 2009, mainly focused on greenhouse gas emissions reduction actions and objectives, the diffusion of clean technologies, the financing of activities for climate protection and adaptation to climatic change impacts

  18. Rank reduction of correlation matrices by majorization

    NARCIS (Netherlands)

    R. Pietersz (Raoul); P.J.F. Groenen (Patrick)

    2004-01-01

    textabstractIn this paper a novel method is developed for the problem of finding a low-rank correlation matrix nearest to a given correlation matrix. The method is based on majorization and therefore it is globally convergent. The method is computationally efficient, is straightforward to implement,

  19. Predicting Undergraduate Music Education Majors' Collegiate Achievement

    Science.gov (United States)

    Rohwer, Debbie

    2012-01-01

    In order for teachers to guide students in their preparation to be music majors, it would be useful to know those musical components that best predict overall collegiate success. The purpose of this study was to measure the relationship of predictor variables (Lessons, Music History, Music Theory, and Piano) to collegiate grade point average (GPA)…

  20. China English and ELT for English Majors

    Science.gov (United States)

    Zhang, Mingjuan

    2008-01-01

    This paper is a general study of one of varieties of English--China English and its influence on English Language Teaching (ELT) for English majors. The status of English as an International language breaks the situation in which British English or American English is the sole standard. English becomes World Englishes, taking on a plural form,…

  1. Quality planning for major plant design modifications

    International Nuclear Information System (INIS)

    Dulee, R.J.

    1988-01-01

    This paper reviews the approach and activities undertaken by Public Service Electric and Gas Company's (PSE and G's) nuclear quality assurance (QA) department to support major plant design modifications conducted during refueling outages at Salem Generating Station. It includes the planning and implementation of quality plans developed to provide both QA and quality control (QC) coverage of modification performed by contracted service organizations

  2. Core Requirements for the Economics Major

    Science.gov (United States)

    Petkus, Marie; Perry, John J.; Johnson, Bruce K.

    2014-01-01

    In this article, the authors are the first to describe the core economics curriculum requirements for economics majors at all American colleges and universities, as opposed to a sample of institutions. Not surprisingly, principles of economics is nearly universally required and implemented as a two-semester course in 85 percent of economics major…

  3. Minerals in thalassaemia major patients: An overview.

    Science.gov (United States)

    Ozturk, Zeynep; Genc, Gizem Esra; Gumuslu, Saadet

    2017-05-01

    Thalassaemia major (TM) is a hereditary blood disease characterised by reduced or absent production of beta globin chains. Erythrocyte transfusions are given to raise the haemoglobin level in patients with thalassaemia major. However, transfusions have been related to increased risk of iron overload and tissue damage related to excess iron. Both elevated oxidative stress due to iron overload and increased hemolysis lead to over utilisation of minerals required for antioxidant enzymes activities. Iron chelators have been used to prevent iron overload in thalassaemia major patients, but these chelators have the possibility of removing minerals from the body. Thalassaemia patients are more at risk for mineral deficiency because of increased oxidative stress and iron chelation therapies. Growth and maturational delay, cardiomyopathy, endocrinopathies and osteoporosis are the complications of thalassaemia. Minerals may play a particular role to prevent these complications. In the current review, we provide an overview of minerals including zinc (Zn), copper (Cu), selenium (Se), magnesium (Mg) and calcium (Ca) in thalassaemia major patients. We, also, underline that some complications of thalassaemia can be caused by an increased need for minerals or lack of the minerals. Copyright © 2017 Elsevier GmbH. All rights reserved.

  4. Exploring Pair Programming Benefits for MIS Majors

    Science.gov (United States)

    Dongo, Tendai; Reed, April H.; O'Hara, Margaret

    2016-01-01

    Pair programming is a collaborative programming practice that places participants in dyads, working in tandem at one computer to complete programming assignments. Pair programming studies with Computer Science (CS) and Software Engineering (SE) majors have identified benefits such as technical productivity, program/design quality, academic…

  5. Major and minor form of hereditary hyperekplexia

    NARCIS (Netherlands)

    Tijssen, MAJ; Vergouwe, MN; van Dijk, JG; Rees, M; Frants, RR; Brown, P

    Hyperekplexia is a hereditary neurological disorder characterized by excessive startle responses. Within the disorder two clinical forms can be distinguished. The major form is characterized by continuous generalized stiffness in the first year of life and an exaggerated startle reflex, accompanied

  6. Peru: Affirmative Action for the Majority.

    Science.gov (United States)

    Bourque, Susan C.

    This paper discusses affirmative action in Peru and considers what the government must do to solve the inferior status of the Indian majority. Ethnically and geographically diverse, Peru's population is said to be marked by inequities in wealth, education, and employment. The policies developed by Peruvian governments over the past 20 years to…

  7. Major commercial products from micro- and macroalgae

    CSIR Research Space (South Africa)

    Griffiths, M

    2016-03-01

    Full Text Available Macro- and microalgae are used in a variety of commercial products with many more in development. This chapter outlines the major products, species used, methods of production, extraction, and processing as well as market sizes and trends. Foods...

  8. Acoustics for Music Majors-- A Laboratory Course

    Science.gov (United States)

    McDonald, Perry F.

    1972-01-01

    Brief descriptions of several of the laboratory experiments which have been incorporated into an acoustics course for music majors. Includes vibratory motion and sound generation, nature, speed, and pitch of sound, spectrum analysis and electronic synthesis of musical sound and some conventional sound experiments. (Author/TS)

  9. Simulation of a major tokamak disruption

    International Nuclear Information System (INIS)

    White, R.B.; Monticello, D.A.; Rosenbluth, M.N.

    1977-08-01

    It is known that the internal tokamak disruption leads to a current profile which is flattened inside the surface where the safety factor equals unity. It is shown that such a profile can lead to m = 2 magnetic islands which grow to fill a substantial part of the tokamak cross section in a time consistent with the observations of the major disruption

  10. Exercise Attenuates the Major Hallmarks of Aging

    Science.gov (United States)

    Garatachea, Nuria; Pareja-Galeano, Helios; Santos-Lozano, Alejandro; Fiuza-Luces, Carmen; Morán, María; Emanuele, Enzo; Joyner, Michael J.; Lucia, Alejandro

    2015-01-01

    Abstract Regular exercise has multi-system anti-aging effects. Here we summarize how exercise impacts the major hallmarks of aging. We propose that, besides searching for novel pharmaceutical targets of the aging process, more research efforts should be devoted to gaining insights into the molecular mediators of the benefits of exercise and to implement effective exercise interventions for elderly people. PMID:25431878

  11. Major and chronic diseases, report 2007.

    NARCIS (Netherlands)

    Giampaoli, S.; Oyen, H. van; Devillé, W.; Verschuuren, M.

    2008-01-01

    Blind spots in European health information On June 6th 2008 the European Commission has published the Major and Chronic Diseases Report 2007. This report describes the state of the art of health information in Europe on 13 prevalent chronic conditions. Large differences between the Member States of

  12. Identification of major sources controlling groundwater chemistry ...

    Indian Academy of Sciences (India)

    The study area Mettur forms an important industrial town situated NW of Salem district. The geology of the area is mainly composed of Archean crystalline metamorphic complexes. To iden- tify the major process activated for controlling the groundwater chemistry an attempt has been made by collecting a total of 46 ...

  13. Four New Course Competencies for Majors.

    Science.gov (United States)

    Van Leuven, Jim

    1999-01-01

    Notes changes in the past decade in the field of public relations. Proposes four new required core competencies for all undergraduate public-relations majors in programs housed in journalism/mass-communication units. Articulates these regarding appropriate outcomes, pedagogies, and assessment methods. Notes special considerations for small,…

  14. Identification and Characterisation of Major Hydrocarbons in ...

    African Journals Online (AJOL)

    Identification and Characterisation of Major Hydrocarbons in Thermally Degraded Low Density Polyethylene Films. ... There were alkanes, alkenes, halogenated alkanes, and very few aromatics in the liquid product and, the hydrocarbons were observed to range between C10 - C27. The FTIR and GC-MS results show the ...

  15. Exploring Pair Programming Benefits for MIS Majors

    Directory of Open Access Journals (Sweden)

    April H. Reed

    2016-12-01

    Full Text Available Pair programming is a collaborative programming practice that places participants in dyads, working in tandem at one computer to complete programming assignments. Pair programming studies with Computer Science (CS and Software Engineering (SE majors have identified benefits such as technical productivity, program/design quality, academic performance, and increased satisfaction for their participants. In this paper, pair programming is studied with Management Information Systems (MIS majors, who (unlike CS and SE majors taking several programming courses typically take only one programming course and often struggle to develop advanced programming skills within that single course. The researchers conducted two pair programming experiments in an introductory software development course for MIS majors over three semesters to determine if pair programming could enhance learning for MIS students. The program results, researchers’ direct observations, and participants’ responses to a survey questionnaire were analyzed after each experiment. The results indicate that pair programming appears to be beneficial to MIS students’ technical productivity and program design quality, specifically the ability to create programs using high-level concepts. Additionally, results confirmed increased student satisfaction and reduced frustration, as the pairs worked collaboratively to produce a program while actively communicating and enjoying the process.

  16. Atmospheric pollution from the major mobile telecommunication ...

    African Journals Online (AJOL)

    The extent of pollution from five major mobile telephone companies in Tanzania was investigated. These companies are Airtel, tIGO, Zantel, Sasatel and Vodacom. The parameters measured were the noise levels, NOx concentrations, and Particulate matter. The noise levels and exhaust gases were determined at 10 ...

  17. Reduced collagen accumulation after major surgery

    DEFF Research Database (Denmark)

    Jorgensen, L N; Kallehave, F; Karlsmark, T

    1996-01-01

    .01)). This decline was significantly higher in the six patients who had a postoperative infection (median 3.02 (range -0.06 to 6.14) versus 0.36 (range -1.56 to 12.60) micrograms/cm, P = 0.02). This study shows that major surgery is associated with impairment of subcutaneous collagen accumulation in a test wound...

  18. Combining two major ATLAS inner detector components

    CERN Multimedia

    Maximilien Brice

    2006-01-01

    The semiconductor tracker is inserted into the transition radiation tracker for the ATLAS experiment at the LHC. These make up two of the three major components of the inner detector. They will work together to measure the trajectories produced in the proton-proton collisions at the centre of the detector when the LHC is switched on in 2008.

  19. Students Facing Poverty: The New Majority

    Science.gov (United States)

    Suitts, Steve

    2016-01-01

    Low-income students are now a majority in U.S. public schools. Steve Suitts, formerly of the Southern Education Foundation, reviews statistics showing that the percentage of students in K-12 schools coming from low-income families has increased to 52 percent. Meanwhile, state funding for K-12 schools has increased much more modestly, so that…

  20. Migraine symptomatology and major depressive disorder

    NARCIS (Netherlands)

    Ligthart, Lannie; Penninx, Brenda; Nyholt, Dale R.; Distel, Marijn A.; de Geus, Eco J. C.; Willemsen, Gonneke; Smit, Johannes H.; Boomsma, Dorret I.

    Introduction and objective: Migraine and major depressive disorder (MDD) frequently co-occur, but it is unclear whether depression is associated with a specific subtype of migraine. The objective of this study was to investigate whether migraine is qualitatively different in MDD patients (N = 1816)

  1. Panthaleus major /Duges/ of cereals in Bulgaria

    Directory of Open Access Journals (Sweden)

    V. Maneva

    2016-12-01

    Full Text Available Abstract. Until recently, Penthaleus major (Dugès has not been recognized as an economically significant pest for the cereal crops. After climatic changes, its population began to grow and inflict damages around the world. The aim of this study was to investigate its distribution in Bulgaria and establish whether it presents a danger to the cereal crops. In the autumn of 2015 and the spring of 2016, a monitoring survey was conducted to establish Penthaleus major (Dugès with the cereal crops in Bulgaria. Over 60 sowed fields were investigated from all around the country. Samples were taken to identify the pest. It was established that Penthaleus major (Dugès inflicted harm to the wheat in north-eastern (12-14 mites per stem and south-eastern Bulgaria (6-8 mites per stem. Its density was under the threshold of economic harm. There was not found infestation of barley, rye, oat and triticale. On the field boundaries bordering the areas attacked by the mite were reported the following weeds: Capsella bursa pastoris (L. Medic, Descurania sophia (L. Welb. et Berth, Senecio spp., Sisymbrium orientale Torn., Taraxsacum officinale Weber, Anthemis spp., Bromus arvensis L., Eragrostis pilosa (L. P.B. Lolium temulentum L., which can be habitat for Penthaleus major (Dugès.

  2. Placebo and antidepressant treatment for major depression

    DEFF Research Database (Denmark)

    Hougaard, Esben

    2010-01-01

    Antidepressant medication is generally considered the primary treatment for major depressive disorders (MDD), but antidepressant treatment has recently approached a crisis with shrinking specific effects and growing placebo responses in current trials. The aim of the paper is to review the placebo...

  3. Recurrence in Major Depression: A Conceptual Analysis

    Science.gov (United States)

    Monroe, Scott M.; Harkness, Kate L.

    2011-01-01

    Theory and research on major depression have increasingly assumed a recurrent and chronic disease model. Yet not all people who become depressed suffer recurrences, suggesting that depression is also an acute, time-limited condition. However, few if any risk indicators are available to forecast which of the initially depressed will or will not…

  4. Major Abdominal Surgical Complications : Innovative Approaches

    NARCIS (Netherlands)

    G.S.A. ter Hoeve-Boersema (Simone)

    2017-01-01

    markdownabstractIn this thesis the focus was on three major complications after abdominal surgery: incisional hernia (IH), prolonged postoperative ileus (PPOI), and colorectal anastomotic leakage (CAL). The results were summarized in three parts: _Part 1_ focused on prediction and detection of

  5. The majority rule in a fuzzy environment.

    OpenAIRE

    Montero, Javier

    1986-01-01

    In this paper, an axiomatic approach to rational decision making in a fuzzy environment is studied. In particular, the majority rule is proposed as a rational way for aggregating fuzzy opinions in a group, when such agroup is defined as a fuzzy set.

  6. Involvement of Leishmania donovani major surface glycoprotein ...

    Indian Academy of Sciences (India)

    The major surface glycoprotein gp63 of the kinetoplastid protozoal parasite Leishmania is implicated as a ligand mediating uptake of the parasite into, and survival within, the host macrophage. By expressing gp63 antisense RNA from an episomal vector in L. donovani promastigotes, gp63-deficient transfectants were ...

  7. Major ions in spitsbergen snow samples

    International Nuclear Information System (INIS)

    Semb, A.; Braekkan, R.; Joranger, E.

    1984-01-01

    Chemical analysis of Spitsbergen snow cores sampled in spring 1983, reveals a spatial pattern consistent with orographic deposition of major anthropogenic pollutants with air movements from southeast towards northwest. The highest concentrations of pollutant species were found at an altitude of 700 metres above sea level, and are higher than for any other recorded snow samples from the Arctic

  8. Majorization in Euclidean Geometry and Beyond

    Czech Academy of Sciences Publication Activity Database

    Fiedler, Miroslav

    2015-01-01

    Roč. 466, 1 February (2015), s. 233-240 ISSN 0024-3795 Institutional support: RVO:67985807 Keywords : Majorization * Doubly stochastic matrix * Euclidean simplex * Star * Regular simplex * Volume of a simplex Subject RIV: BA - General Mathematics Impact factor: 0.965, year: 2015

  9. European Regulation on Major Shareholdings and Takeovers

    DEFF Research Database (Denmark)

    Sørensen, Karsten Engsig; Clausen, Nis Jul

    2002-01-01

    Even though the rules on disclosure of major shareholdings in listed companies has been partly harmonised in the EU large difference remains. This is documented in the article and it is further debated whether these difference are acceptable, especially in light of the ongoing efforts to harmonise...

  10. 75 FR 39492 - Major Capital Investment Projects

    Science.gov (United States)

    2010-07-09

    ... DEPARTMENT OF TRANSPORTATION Federal Transit Administration 49 CFR Part 611 [Docket No. FTA-2010-0009] RIN 2132-AB02 Major Capital Investment Projects AGENCY: Federal Transit Administration (FTA), DOT. ACTION: Public meetings on ANPRM. SUMMARY: This document announces the date, time, and location of an...

  11. 78 FR 1991 - Major Capital Investment Projects

    Science.gov (United States)

    2013-01-09

    ... Administration 49 CFR Part 611 Major Capital Investment Projects; Notice of Availability of Proposed New Starts... Capital Investment Projects AGENCY: Federal Transit Administration (FTA), DOT. ACTION: Final rule. SUMMARY... capital investments seeking funding under the discretionary ``New Starts'' and ``Small Starts'' programs...

  12. 75 FR 33757 - Major Capital Investment Projects

    Science.gov (United States)

    2010-06-15

    ... DEPARTMENT OF TRANSPORTATION Federal Transit Administration 49 CFR Part 611 [Docket No. FTA-2010-0009] RIN 2132-AB02 Major Capital Investment Projects AGENCY: Federal Transit Administration (FTA), DOT. ACTION: Public meetings on ANPRM. SUMMARY: This document announces the dates, times, and locations of...

  13. THE MAJOR COASTAL COMMUNITIES OF NORTH CAROLINA.

    Science.gov (United States)

    Marine Science Project, Beaufort, NC.

    IDENTIFIED IN THIS MARINE SCIENCE HANDBOOK ARE 5 MAJOR TYPES OF NATURAL HABITATS--(1) OPEN BEACH AND ANY OTHER SEAWARD-FACING, UNPROTECTED STRAND, (2) GROINS, JETTIES, PILINGS, AND ROCK BULKHEADS, (3) SAND AND/OR MUD FLAT, (4) SALT MARSH, AND (5) UPLAND COMMUNITIES. EACH HABITAT IS DESCRIBED IN TERMS OF TYPICAL PLANTS AND ANIMALS, ADAPTATIONS, AND…

  14. Preparing for major incidents in Kenya

    Directory of Open Access Journals (Sweden)

    B.W. Wachira*

    2013-12-01

    This report provides a review of some of the major incidents in Kenya for the period 2000–2012, with the hope of highlighting the importance of developing an integrated and well-trained Ambulance and Fire and Rescue service appropriate for the local health care system.

  15. Sex segregation in undergraduate engineering majors

    Science.gov (United States)

    Litzler, Elizabeth

    Gender inequality in engineering persists in spite of women reaching parity in college enrollments and degrees granted. To date, no analyses of educational sex segregation have comprehensively examined segregation within one discipline. To move beyond traditional methods of studying the long-standing stratification by field of study in higher education, I explore gender stratification within one field: engineering. This dissertation investigates why some engineering disciplines have a greater representation of women than other engineering disciplines. I assess the individual and institutional factors and conditions associated with women's representation in certain engineering departments and compare the mechanisms affecting women's and men's choice of majors. I use national data from the Engineering Workforce Commission, survey data from 21 schools in the Project to Assess Climate in Engineering study, and Carnegie Foundation classification information to study sex segregation in engineering majors from multiple perspectives: the individual, major, institution, and country. I utilize correlations, t-tests, cross-tabulations, log-linear modeling, multilevel logistic regression and weighted least squares regression to test the relative utility of alternative explanations for women's disproportionate representation across engineering majors. As a whole, the analyses illustrate the importance of context and environment for women's representation in engineering majors. Hypotheses regarding hostile climate and discrimination find wide support across different analyses, suggesting that women's under-representation in certain engineering majors is not a question of choice or ability. However, individual level factors such as having engineering coursework prior to college show an especially strong association with student choice of major. Overall, the analyses indicate that institutions matter, albeit less for women, and women's under-representation in engineering is not

  16. Molecular detection of tick-borne pathogens in cattle from Southwestern Ethiopia.

    Directory of Open Access Journals (Sweden)

    Zerihun Hailemariam

    Full Text Available Tick-borne diseases (TBDs cause significant losses among livestock and impact the livelihoods of resource-poor farming communities worldwide. In Ethiopia, detailed studies on the epidemiology of tick-borne pathogens (TBPs in cattle using sensitive molecular detection methods are scarce. The objective of this study was to determine the prevalence and species composition of bovine TBPs of veterinary significance in local cattle populations. A comprehensive cross-sectional epidemiological study was conducted in cattle populations of Illubabor zone in Southwestern Ethiopia from June to August 2013. For this purpose, blood samples were collected from 392 cattle. A combination of polymerase chain reaction (PCR and a Reverse Line Blot (RLB hybridization assay was employed for the detection of TBPs in these samples. The PCR/RLB results of the 392 blood samples indicated a high overall prevalence of 96.9% for TBPs, including Theileria mutans (66.1%, Theileria orientalis (51.8%, Anaplasma sp. Omatjenne (25.5%, Anaplasma marginale (14.5%, Babesia bigemina (14.0% and Theileria velifera (13.0% and minor occurrences of Ehrlichia ruminantium (0.5% and Ehrlichia minasensis (0.26%. Moreover, three novel Anaplasma genotypes were detected in bovine blood samples. A phylogenetic analysis revealed that they most likely represent three, but at least two, new species. The prevalence of the three novel Anaplasma species, preliminary designated as Anaplasma sp. Hadesa, Anaplasma sp. Saso and Anaplasma sp. Dedessa, was 12.5%, 14.3% and 5.6%, respectively. Overall, a total of 227 cattle (57.9% were found to be co-infected with two or more TBPs simultaneously and 86 different species combinations were observed. The findings show a very high burden of infection of cattle with TBPs in Ethiopia. The high frequency of co-infections suggests that clinical manifestations might be complex. Further research is required to determine the pathogenicity, host cell types and vector of

  17. Distortion product otoacoustic emissions in college music majors and nonmusic majors

    Directory of Open Access Journals (Sweden)

    Rebecca L. Warner Henning

    2016-01-01

    Full Text Available The presence and absence of distortion product otoacoustic emissions (DPOAEs as well as DPOAE amplitudes were compared between college music majors and a control group of nonmusic majors. Participants included 28 music majors and 35 nonmusic majors enrolled at a university with ages ranging from 18-25 years. DPOAEs and hearing thresholds were measured bilaterally on all the participants. DPOAE amplitudes were analyzed at the following f2 frequencies: 1,187 Hz, 1,500 Hz, 1,906 Hz, 2,531 Hz, 3,031 Hz, 3812 Hz, 4,812 Hz, and 6,031 Hz. Significantly more music majors (7/28 than nonmusic majors (0/35 exhibited absent DPOAEs for at least one frequency in at least one ear. Both groups of students reported similar histories of recreational and occupational noise exposures that were unrelated to studying music, and none of the students reported high levels of noise exposure within the previous 48 h. There were no differences in audiometric thresholds between the groups at any frequency. At DPOAE f2 frequencies from 3,031 Hz to 6,031 Hz, nonsignificantly lower amplitudes of 2-4 dB were seen in the right ears of music majors versus nonmajors, and in the right ears of music majors playing brass instruments compared to music majors playing nonbrass instruments. Given the greater prevalence of absent DPOAEs in university music majors compared to nonmusic majors, it appears that early stages of cochlear damage may be occurring in this population. Additional research, preferably longitudinal and across multiple colleges/universities, would be beneficial to more definitively determine when the music students begin to show signs of cochlear damage, and to identify whether any particular subgroups of music majors are at a greater risk of cochlear damage.

  18. Understanding Anaplasmataceae pathogenesis using ‘Omics’ approaches

    Directory of Open Access Journals (Sweden)

    Ludovic ePruneau

    2014-07-01

    Full Text Available This paper examines how Omics approaches improve our understanding of Anaplasmataceae pathogenesis, through a global and integrative strategy to identify genes and proteins involved in biochemical pathways key for pathogen-host-vector interactions.The Anaplasmataceae family comprises obligate intracellular bacteria mainly transmitted by arthropods. These bacteria are responsible for major human and animal endemic and emerging infectious diseases with important economic and public health impacts. In order to improve disease control strategies, it is essential to better understand their pathogenesis. Our work focused on four Anaplasmataceae, which cause important animal, human and zoonotic diseases: Anaplasma marginale, A. phagocytophilum, Ehrlichia chaffeensis and E. ruminantium. Wolbachia spp. an endosymbiont of arthropods was also included in this review as a model of a non-pathogenic Anaplasmataceae.A gap analysis on Omics approaches on Anaplasmataceae was performed, which highlighted a lack of studies on the genes and proteins involved in the infection of hosts and vectors. Furthermore, most of the studies have been done on the pathogen itself, mainly on infectious free-living forms and rarely on intracellular forms. In order to perform a transcriptomic analysis of the intracellular stage of development, researchers developed methods to enrich bacterial transcripts from infected cells. These methods are described in this paper. Bacterial genes encoding outer membrane proteins, post-translational modifications, eukaryotic repeated motif proteins, proteins involved in osmotic and oxidative stress and hypothetical proteins have been identified to play a key role in Anaplasmataceae pathogenesis. Further investigations on the function of these outer membrane proteins and hypothetical proteins will be essential to confirm their role in the pathogenesis. Our work underlines the need for further studies in this domain and on host and vector responses

  19. Review of major plutonium pyrochemical technology

    International Nuclear Information System (INIS)

    Moser, W.S.; Navratil, J.D.

    1983-01-01

    The past twenty years have seen significant growth in the development and application of pyrochemical technology for processing of plutonium. For particular feedstocks and specific applications, non-aqueous high-temperature processes offer key advantages over conventional hydrometallurgical systems. Major processes in use today include: (1) direct oxide reduction for conversion of PuO 2 to metal, (2) molten salt extraction for americium removal from plutonium, (3) molten salt electrorefining for Pu purification, and (4) hydriding to remove plutonium from host substrates. This paper reviews current major pyrochemical processes from the classical calcination-hydrofluorination-bomb reduction sequence through new techniques under development. Each process is presented and brief descriptions of production equipment are given. 47 references, 5 figures

  20. A student's guide to Einstein's major papers

    CERN Document Server

    Kennedy, Robert E

    2012-01-01

    Our understanding of the physical universe underwent a revolution in the early twentieth century - evolving from the classical physics of Newton, Galileo, and Maxwell to the modern physics of relativity and quantum mechanics. The dominant figure in this revolutionary change was Albert Einstein. In a single year, 1905, Einstein produced breakthrough works in three areas of physics: on the size and the effects of atoms; on the quantization of the electromagnetic field; and on the special theory of relativity. In 1916 he produced a fourth breakthrough work, the general theory of relativity. A Student's Guide to Einstein's Major Papers focuses on Einstein's contributions, setting his major works into their historical context, and then takes the reader through the details of each paper, including the mathematics. This book helps the reader appreciate the simplicity and insightfulness of Einstein's ideas and how revolutionary his work was, and locate it in the evolution of scientific thought begun by the ancient...

  1. Major gene mutations and domestication of plants

    International Nuclear Information System (INIS)

    Ashri, A.

    1989-01-01

    From the approximately 200,000 species of flowering plants known, only about 200 have been domesticated. The process has taken place in many regions over long periods. At present there is great interest in domesticating new species and developing new uses for existing ones in order to supply needed food, industrial raw materials, etc. It is proposed that major gene mutations were important in domestication; many key characters distinguishing cultivated from related wild species are controlled by one or very few major genes. The deliberate effort to domesticate new species requires at least the following: identification of needs and potential sources, establishment of suitable niches, choice of taxa to be domesticated, specification of the desired traits and key characters to be modified, as well as the potential role of induced mutations. (author). 14 refs

  2. Novel Augmentation Strategies in Major Depression

    DEFF Research Database (Denmark)

    Martiny, Klaus

    2017-01-01

    Hypothesis The hypotheses of all the four included studies share the common idea that it is possible to augment the effect of antidepressant drug treatment by applying different interventions and with each intervention attain a clinically meaningful better effect compared to a control condition......, and with minor side effects, thus improving the short- and medium-term outcome in major depression. Procedures Study design The basic study design has been the double blind randomised controlled trial (RCT). In the light therapy study, all patients were treated with sertraline for the whole of the study duration...... open psychiatric wards. Only a few patients were re-cruited through advertisements (in the PEMF and Chronos studies). Inclusion criteria Inclusion criteria were major depression according to the DSM-IV, including a depressive episode as part of a bipolar disorder. For the PEMF study, treatment...

  3. Anaplasma phagocytophilum in questing Ixodes ricinus ticks from Romania.

    Science.gov (United States)

    Matei, Ioana Adriana; Kalmár, Zsuzsa; Magdaş, Cristian; Magdaş, Virginia; Toriay, Hortenzia; Dumitrache, Mirabela Oana; Ionică, Angela Monica; D'Amico, Gianluca; Sándor, Attila D; Mărcuţan, Daniel Ioan; Domşa, Cristian; Gherman, Călin Mircea; Mihalca, Andrei Daniel

    2015-04-01

    Granulocytic anaplasmosis is a common vector-borne disease of humans and animals with natural transmission cycle that involves tick vectors, among which Ixodes ricinus is the most important. The present paper reports the prevalence and geographical distribution of A. phagocytophilum in 10,438 questing Ixodes ricinus ticks collected at 113 locations from 40 counties of Romania. The unfed ticks were examined for the presence of A. phagocytophilum by PCR targeting a portion of ankA gene. The overall prevalence of infection was 3.42%, with local prevalences ranging between 0.29% and 22.45%, with an average prevalence of 5.39% in the infected localities. The infection with A. phagocytophilum was detected in 72 out of 113 localities and in 34 out of 40 counties. The highest prevalence was recorded in females followed by males and nymphs. The results and the distribution model have shown a large distribution of A. phagocytophilum, covering Romania's entire territory. This study is the first large scale survey of the presence of A. phagocytophilum in questing I. ricinus ticks from Romania. Copyright © 2015 Elsevier GmbH. All rights reserved.

  4. New way on designing majorant coincidence circuits

    International Nuclear Information System (INIS)

    Gajdamaka, R.I.; Kalinnikov, V.A.; Nikityuk, N.M.; Shirikov, V.P.

    1982-01-01

    A new way of designing fast devices of combinatorial selection by the number of particles passing through a multichannel charged particle detector is decribed. The algorithm of their operation is based on modern algebraic coding theory. By application of analytical computational methods Boolean expressions can be obtianed for designing basic circuits for a large number of inputs. An example of computation of 15 inputs majorant coincidence circuit is considered

  5. Mechanical components: fabrication of major reactor structures

    International Nuclear Information System (INIS)

    Nicholson, S.

    1985-01-01

    The paper examines the validity of criticisms of quality assurance of mechanical plant and welded products within major reactor structures, taking into account experience gained on the AGR's. Various constructive recommendations are made aimed at furthering the objectives of quality assurance in the nuclear industry and making it more cost-effective. Current levels of quality related costs in the fabrication industry are provided as a basis for discussion. (U.K.)

  6. Information support for major public events

    International Nuclear Information System (INIS)

    2010-01-01

    The unique capabilities of the IAEA illicit trafficking database is used to provide information on and assesment of illicit trafficking and other unauthorized activities involving nuclear and other radioactive materials to national authorities in charge of nuclear security of major public events. The information communicated to state parties cooperating with IAEA is on incidences confirmed to the agency on illicit trafficking of nuclear and other radioactive materials and also incidences reported in open sources which have not been confirmed.

  7. Major Brazilian gold deposits - 1982 to 1999

    Science.gov (United States)

    Thorman, Charles H.; DeWitt, Ed; Maron, Marcos A.; Ladeira, Eduardo A.

    2001-07-01

    Brazil has been a major but intermittent producer of gold since its discovery in 1500. Brazil led the world in gold production during the 18th and early 19th centuries. From the late 19th century to the late 20th century, total mining company and garimpeiro production was small and relatively constant at about 5 to 8 t/year. The discovery of alluvial deposits in the Amazon by garimpeiros in the 1970s and the opening of eight mines by mining companies from 1983 to 1990 fueled a major boom in Brazil's gold production, exceeding 100 t/year in 1988 and 1989. However, garimpeiro alluvial production decreased rapidly in the 1990s, to about 10 t/year by 1999. Company production increased about tenfold from about 4 t/year in 1982 to 40 t in 1992. Production from 1992 to the present remained relatively stable, even though several mines were closed or were in the process of closing and no new major mines were put into production during that period. Based on their production history from 1982-1999, 17 gold mines are ranked as major (>20 t) and minor (3-8 t) mines. From 1982-1999, deposits hosted in Archean rocks produced 66% of the gold in Brazil, whereas deposits in Paleoproterozoic and Neoproterozoic rocks accounted for 19% and 15%, respectively. Deposits in metamorphosed sedimentary rocks, especially carbonate-rich rocks and carbonate iron-formation, yielded the great bulk of the gold. Deposits in igneous rocks were of much less importance. The Archean and Paleoproterozoic terranes of Brazil largely lack base-metal-rich volcanogenic massive sulfide deposits, porphyry deposits, and polymetallic veins and sedimentary exhalative deposits. An exception to this is in the Carajás Mineral Province.

  8. Major depressive disorder in Parkinson's disease

    DEFF Research Database (Denmark)

    Nilsson, Flemming M; Kessing, Lars V; Sørensen, Tine M

    2002-01-01

    OBJECTIVE: To investigate whether patients with Parkinson's disease (PD) were at an increased risk of developing major depression compared with patients having other medical illnesses with a comparable degree of disability. METHOD: Case register linkage study of Danish Psychiatric Central Register...... was compared with the control groups. CONCLUSION: The findings support the hypothesis that depression in patients with PD is a consequence of brain dysfunction....

  9. Statistical mechanics of the majority game

    International Nuclear Information System (INIS)

    Kozlowski, P; Marsili, M

    2003-01-01

    The majority game, modelling a system of heterogeneous agents trying to behave in a similar way, is introduced and studied using methods of statistical mechanics. The stationary states of the game are given by the (local) minima of a particular Hopfield-like Hamiltonian. On the basis of replica symmetric calculations, we draw the phase diagram, which contains the analogue of a retrieval phase. The number of metastable states is estimated using the annealed approximation. The results are confronted with extensive numerical simulations

  10. Consumer Demand for Major Foods in Egypt

    OpenAIRE

    Basem Fayaad; Stanley R. Johnson; Mohamed El-Khishin

    1995-01-01

    This study provides information on the structure of the consumer demand for major foods in Egypt. The information is in the form of key parameters for consumer demand systems. The modern theory of consumer behavior is the basis for estimating systems of demand equations. These systems yield estimates of own- and cross-price elasticities. The Linear Almost Ideal Demand System (LAIDS) model is applied in estimating a system of demand equations for food commodities. A full demand matrix results ...

  11. Frequent flyer business travelers: major exposure hazards.

    Science.gov (United States)

    Tompkins, Olga S; Randolph, Susan A; Ostendorf, Judith S

    2005-02-01

    Bagshaw (2004) notes "the modern commercial aircraft cabin is maintained with adequate environmental control for the comfort of most healthy individuals" (p. 417). Occupational health nurses frequently deal with a population that may include unhealthy individuals or those with pre-existing conditions. It is critical for occupational health nurses to stay current with major hazards faced by frequent flyer business travelers to assist in identifying and preventing adverse health effects associated with these exposures.

  12. Major brazilian gold deposits - 1982 to 1999

    Science.gov (United States)

    Thorman, C.H.; Dewitt, E.; Maron, M.A.; Ladeira, E.A.

    2001-01-01

    Brazil has been a major but intermittent producer of gold since its discovery in 1500. Brazil led the world in gold production during the 18th and early 19th centuries. From the late 19th century to the late 20th century, total mining company and garimpeiro production was small and relatively constant at about 5 to 8 t/year. The discovery of alluvial deposits in the Amazon by garimpeiros in the 1970s and the opening of eight mines by mining companies from 1983 to 1990 fueled a major boom in Brazil's gold production, exceeding 100 t/year in 1988 and 1989. However, garimpeiro alluvial production decreased 'rapidly in the 1990s, to about 10 t/year by 1999. Company production increased about tenfold from about 4 t/year in 1982 to 40 t in 1992. Production from 1992 to the present remained relatively stable, even though several mines were closed or were in the process of closing and no new major mines were put into production during that period. Based on their production history from 1982-1999, 17 gold mines are ranked as major (> 20 t) and minor (3-8 t) mines. From 1982-1999, deposits hosted in Archean rocks produced 66% of the gold in Brazil, whereas deposits in Paleoproterozoic and Neoproterozoic rocks accounted for 19% and 15%, respectively. Deposits in metamorphosed sedimentary rocks, especially carbonate-rich rocks and carbonate iron-formation, yielded the great bulk of the gold. Deposits in igneous rocks were of much less importance. The Archean and Paleoproterozoic terranes of Brazil largely lack base-metal-rich volcanogenic massive sulfide deposits, porphyry deposits, and polymetallic veins and sedimentary exhalative deposits. An exception to this is in the Caraja??s Mineral Province.

  13. Plasma fibronectin in patients undergoing major surgery

    International Nuclear Information System (INIS)

    Sallam, M.H.M.

    2003-01-01

    Plasma fibronectin in patients undergoing major surgery had been determined before and after operation. The study was done on 15 patients and 15 normal healthy individuals. The study revealed that patients subjected to major operation, their fibronectin level was normal before operation followed by reduction one day post-operation. After one week, fibronectin level raised again nearly to the pre-operations levels. The probable mechanisms of fibronectin in healing processes were discussed. Fibronectin (FN) is a family of structurally and immunologically related high molecular weight glycoproteins that are present in many cell surfaces, in extracellular fluids, in connective tissues and in most membranes. Interaction with certain discrete extracellular substances, such as a glucosaminoglycans (e.g. heparin), fibrin and collagen and with cell surface structure seem to account for many of its biological activities, among which are regulation of adhesion, spreading and locomotion (Mosesson and amrani, 1980). The concentration of Fn in human plasma decreases after extensive destruction such as that occurs in major surgery, burns or other trauma. This decrease has been generally though to be due to increased consumption of soluble plasma Fn in opsonization of particulate and soluble debris from circulation by the reticuloendothelial (RE) system. Fn rapidly appears in injury areas, in experimentally induced blisters, wounded and epithelium tissues (Petersen et al., 1985). Fn accumulates at times of increased vascular permeability and it is produced by cell of blood vessels in response to injury

  14. Performance profiles of major energy producers, 1997

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1999-01-01

    The energy industry generally and petroleum and natural gas operations in particular are frequently reacting to a variety of unsettling forces. Falling oil prices, economic upswings, currency devaluations, increasingly rigorous environmental quality standards, deregulation of electricity markets, and continued advances in exploration and production technology were among the challenges and opportunities to the industry in 1997. To analyze the extent to which these and other developments have affected energy industry financial and operating performance, strategies, and industry structure, the Energy Information Administration (EIA) maintains the Financial Reporting Systems (FRS). Through Form EIA-28, major US energy companies annually report to the FRS. Financial and operating information is reported by major lines of business, including oil and gas production (upstream), petroleum refining and marketing (downstream), other energy operations, and nonenergy business. Performance Profiles of Major Producers 1997 examines the interplays of energy markets, companies` strategies, and government policies (in 1997 and in historical context) that gave rise to the results given here. The report also analyzes other key aspects of energy company financial performance as seen through the multifaceted lens provided by the FRS data and complementary data for industry overall. 41 figs., 77 tabs.

  15. Genetic Diversity of Tick-Borne Rickettsial Pathogens; Insights Gained from Distant Strains

    Directory of Open Access Journals (Sweden)

    Sebastián Aguilar Pierlé

    2014-01-01

    Full Text Available The ability to capture genetic variation with unprecedented resolution improves our understanding of bacterial populations and their ability to cause disease. The goal of the pathogenomics era is to define genetic diversity that results in disease. Despite the economic losses caused by vector-borne bacteria in the Order Rickettsiales, little is known about the genetic variants responsible for observed phenotypes. The tick-transmitted rickettsial pathogen Anaplasma marginale infects cattle in tropical and subtropical regions worldwide, including Australia. Genomic analysis of North American A. marginale strains reveals a closed core genome defined by high levels of Single Nucleotide Polymorphisms (SNPs. Here we report the first genome sequences and comparative analysis for Australian strains that differ in virulence and transmissibility. A list of genetic differences that segregate with phenotype was evaluated for the ability to distinguish the attenuated strain from virulent field strains. Phylogenetic analyses of the Australian strains revealed a marked evolutionary distance from all previously sequenced strains. SNP analysis showed a strikingly reduced genetic diversity between these strains, with the smallest number of SNPs detected between any two A. marginale strains. The low diversity between these phenotypically distinct bacteria presents a unique opportunity to identify the genetic determinants of virulence and transmission.

  16. Biological characterization of venom peptides from the neotropical social waps Polistes major major (Dominican Republic)

    Czech Academy of Sciences Publication Activity Database

    Slaninová, Jiřina; Fučík, Vladimír; Borovičková, Lenka; Čeřovský, Václav

    2007-01-01

    Roč. 151, S1 (2007), s. 87-89 ISSN 1213-8118. [Pharmacological Days. Czech and Slovak Pharmacological Meeting /57./. Olomouc, 12.09.2007-14.09.2007] Institutional research plan: CEZ:AV0Z40550506 Keywords : venom peptides * Polistes major major Subject RIV: CE - Biochemistry

  17. Age at Menarche and Choice of College Major: Implications for STEM Majors

    Science.gov (United States)

    Brenner-Shuman, Anna; Waren, Warren

    2013-01-01

    Even though boys and girls in childhood perform similarly in math and spatial thinking, after puberty fewer young women pursue majors that emphasize abilities such as science, technology, engineering, and math (STEM) in college. If postpubertal feminization contributes to a lower likelihood of choosing STEM majors, then young women who enter…

  18. Student Perceptions of the First Course in Accounting: Majors versus Non-Majors

    Science.gov (United States)

    Tickell, Geoffrey; Lim, Tiong Kiong; Balachandran, Balasinghan

    2012-01-01

    This paper contributes to the continuing debate regarding the curriculum for the first undergraduate course in accounting by examining student perceptions from studying such a course. Participants are divided into two cohorts--Accounting & Finance Majors (AFM) and Other Business Majors (OBM). Results reported in this paper indicate that…

  19. Major life events and development of major depression in Parkinson's disease patients

    DEFF Research Database (Denmark)

    Rod, Naja Hulvej; Bordelon, Y; Thompson, A

    2012-01-01

    BACKGROUND AND PURPOSE: Non-motor symptoms including depression are important features of Parkinson's disease (PD). We aim to address the relationship between major life events and depression amongst PD patients free of depressive symptoms at baseline. METHODS: New-onset PD patients from California...... were recruited in 2001-2007 and followed up for 3-4 years. The participants (n = 221) were examined by neurologists and responded to comprehensive interviews that included major life events, social support, and coping measures from validated scales. Major depression was assessed using the Structured...... Clinical Interview for the DSM-IV depression module (SCID). RESULTS: More than half of all patients had experienced major life events since diagnosed with PD, and 22 patients developed a major depression. The number of life events was associated with risk of depression in an exposure-dependent manner...

  20. Franjas marginales de Brassica campestris L. (nabo) en cultivo de repollo. Efecto sobre pulgones y sus parasitoides: Título abreviado: Franjas marginales de Brassica campestris L. ....

    OpenAIRE

    Curis, M. C; Saravia Steudtner, F; Favaro, J. C; Sánchez, D; Bertolaccini, I

    2014-01-01

    La diversidad vegetal en los agroecosistemas afecta la dinámica poblacional de las plagas y de sus enemigos naturales, siendo una alternativa de control el uso de franjas trampa en algunos cultivos. El objetivo del trabajo fue determinar como una franja marginal de Brassicas campestris L. (Brassicales, Brassicaceae), afecta a la población de los pulgones de B. oleracea var. capitata y de sus parasitoides. El estudio se llevó a cabo en Santa Fe, a partir de febrero de 2012. Se estableció en un...

  1. Major gene mutations in fruit tree domestication

    International Nuclear Information System (INIS)

    Spiegel-Roy, P.

    1989-01-01

    Though fruit gathering from the wild began long before domestication, fruit tree domestication started only after the establishment of grain agriculture. Banana, fig, date, grape and olive were among the first fruit trees domesticated. Most fruit trees are outbreeders, highly heterozygous and vegetatively propagated. Knowledge of genetics and economic traits controlled by major genes is limited. Ease of vegetative propagation has played a prominent part in domestication; advances in propagation technology will play a role in domestication of new crops. Changes toward domestication affected by major genes include self-fertility in peach, apricot and sour cherry, while the emergence of self-fertile almond populations is more recent and due probably to introgression from Amygdalus webbii. Self-compatibility in the sweet cherry has been attained only by pollen irradiation. A single gene controls sex in Vitis. Wild grapes are dioecious, with most domesticated cultivars hermaphrodite, and only a few females. In the papaya changes from dioecism to hermaphroditism have also occurred. Self-compatible systems have also been selected during domestication in Rubus. Changes towards parthenocarpy and seedlessness during domestication occurred in the banana, citrus, grape, fig and pineapple. In the banana, parthenocarpy is due to three complementary dominant genes; stenospermocarpy in the grape depends on two complementary recessive genes; parthenocarpy and sterility in citrus seems more complicated; however, it can be induced in genetic material of suitable background with ease by irradiation. Presence of persistent syconia in the fig is controlled by a mutant allele P dominant to wild +. Thornlessness in blackberry is recessive, while in the pineapple spineless forms are dominant. Changes affecting fruit composition owing to major genes include the disappearance of amygdalin present in bitter almonds (bitter kernel recessive to sweet), shell hardness in almond, and a recessive

  2. Parvalbumin--the major tropical fish allergen.

    Science.gov (United States)

    Lim, Dawn Li-Chern; Neo, Keng Hwee; Yi, Fong Cheng; Chua, Kaw Yan; Goh, Denise Li-Meng; Shek, Lynette Pei-Chi; Giam, Yoke Chin; Van Bever, Hugo P S; Lee, Bee Wah

    2008-08-01

    Fish allergy is common in countries where consumption is high. Asian nations are amongst the world's largest consumers of fish but the allergen profiles of tropical fish are unknown. This study sought to evaluate the allergenicity of four commonly consumed tropical fish, the threadfin (Polynemus indicus), Indian anchovy (Stolephorus indicus), pomfret (Pampus chinensis) and tengirri (Scomberomorus guttatus). Immunoglobulin E (IgE) cross-reactivity with parvalbumin of cod fish (Gad c 1), the major fish allergen, was also studied. Detection of tropical fish and cod specific-IgE was performed by UniCap assay, and skin prick tests were also carried out. The IgE-binding components of tropical fish were identified using IgE immunoblot techniques, and cross-reactivity with Gad c 1 was assessed by ELISA inhibition and IgE immunoblot inhibition. Clinically, nine of 10 patients studied were allergic to multiple fish. All patients exhibited detectable specific-IgE to cod fish (10 of 10 skin prick test positive, eight of 10 UniCap assay positive) despite lack of previous exposure. The major allergen of the four tropical fish was the 12-kDa parvalbumin. IgE cross-reactivity of these allergens to Gad c 1 was observed to be moderate to high in the tropical fish studied. Parvalbumins are the major allergens in commonly consumed tropical fish. They are cross-reactive with each other as well as with Gad c 1. Commercial tests for cod fish appear to be sufficient for the detection of tropical fish specific-IgE.

  3. Arthroscopy Journal Prizes Are Major Decisions.

    Science.gov (United States)

    Lubowitz, James H; Brand, Jefferson C; Provencher, Matthew T; Rossi, Michael J

    2016-01-01

    According to the Harvard Business Review, the optimal number of people in a decision-making group is no more than 8. Thus, it is no surprise that 18 Arthroscopy journal associate editors had difficulty making a major decision. In the end, 18 editors did successfully select the 2015 winner of the Best Comparative Study Prize. All studies have limitations, but from a statistical standpoint, the editors believe that the conclusions of the winning study are likely correct. Copyright © 2016 Arthroscopy Association of North America. Published by Elsevier Inc. All rights reserved.

  4. The Dark Triad across academic majors

    DEFF Research Database (Denmark)

    Vedel, Anna; Thomsen, Dorthe K.

    2017-01-01

    The Dark Triad traits (i.e., narcissism, psychopathy, and Machiavellianism) have been associated with the desire for power, status, and social dominance in the workplace, and these desires have been hypothesized to draw Dark Triad individuals towards occupations affording such outcomes. Following...... this reasoning, the Dark Triad may also influence educational choices. Research in other personality traits has shown that Big Five traits impact educational choices: Students in different academic majors differ on Big Five traits at enrollment. The aim of the present study was to explore whether there are also...

  5. Women's decision to major in STEM fields

    Science.gov (United States)

    Conklin, Stephanie

    This paper explores the lived experiences of high school female students who choose to enter into STEM fields, and describes the influencing factors which steered these women towards majors in computer science, engineering and biology. Utilizing phenomenological methodology, this study seeks to understand the essence of women's decisions to enter into STEM fields and further describe how the decision-making process varies for women in high female enrollment fields, like biology, as compared with low enrollment fields like, computer science and engineering. Using Bloom's 3-Stage Theory, this study analyzes how relationships, experiences and barriers influenced women towards, and possibly away, from STEM fields. An analysis of women's experiences highlight that support of family, sustained experience in a STEM program during high school as well as the presence of an influential teacher were all salient factors in steering women towards STEM fields. Participants explained that influential teacher worked individually with them, modified and extended assignments and also steered participants towards coursework and experiences. This study also identifies factors, like guidance counselors as well as personal challenges, which inhibited participant's path to STEM fields. Further, through analyzing all six participants' experiences, it is clear that a linear model, like Bloom's 3-Stage Model, with limited ability to include potential barriers inhibited the ability to capture the essence of each participant's decision-making process. Therefore, a revised model with no linear progression which allows for emerging factors, like personal challenges, has been proposed; this model focuses on how interest in STEM fields begins to develop and is honed and then mastered. This study also sought to identify key differences in the paths of female students pursuing different majors. The findings of this study suggest that the path to computer science and engineering is limited. Computer

  6. Enhancing the Accounting Major with Online Learning

    Directory of Open Access Journals (Sweden)

    Hershey Friedman Ph.D

    2013-07-01

    Full Text Available Accounting majors who wish to be successful in life must learn to acquire knowledge using all kinds of platforms. The belief that the only way people can learn is by classroom instruction is not supported by research. The authors show how online learning is an important tool for achieving the various goals of accounting education that should include creativity, collaboration, communication, critical thinking and problem solving. The authors conclude that the optimal method to teach accounting is by combining face-to-face learning with on-line learning.

  7. Access to major overseas research facilities

    International Nuclear Information System (INIS)

    Bolderman, J. W.

    1997-01-01

    This paper will describe four schemes which have been established to permit Australian researchers access to some of the most advanced overseas research facilities. These include, access to Major Research Facilities Program, the Australian National Beamline Facility at the Photon Factory, the Australian Synchrotron Research Program and the ISIS Agreement. The details of each of these programs is discussed and the statistics on the scientific output provided. All programs are managed on behalf of the Department of Industry, Science and Tourism by the Australian Nuclear Science and Technology Organisation. One hundred and thirteen senior scientists plus forty, one postgraduate, students were supported through these schemes during the 1996-1997 financial year

  8. Acute Pectoralis Major Rupture Captured on Video

    Directory of Open Access Journals (Sweden)

    Alejandro Ordas Bayon

    2016-01-01

    Full Text Available Pectoralis major (PM ruptures are uncommon injuries, although they are becoming more frequent. We report a case of a PM rupture in a young male who presented with axillar pain and absence of the anterior axillary fold after he perceived a snap while lifting 200 kg in the bench press. Diagnosis of PM rupture was suspected clinically and confirmed with imaging studies. The patient was treated surgically, reinserting the tendon to the humerus with suture anchors. One-year follow-up showed excellent results. The patient was recording his training on video, so we can observe in detail the most common mechanism of injury of PM rupture.

  9. Majorization uncertainty relations for mixed quantum states

    Science.gov (United States)

    Puchała, Zbigniew; Rudnicki, Łukasz; Krawiec, Aleksandra; Życzkowski, Karol

    2018-04-01

    Majorization uncertainty relations are generalized for an arbitrary mixed quantum state ρ of a finite size N. In particular, a lower bound for the sum of two entropies characterizing the probability distributions corresponding to measurements with respect to two arbitrary orthogonal bases is derived in terms of the spectrum of ρ and the entries of a unitary matrix U relating both bases. The results obtained can also be formulated for two measurements performed on a single subsystem of a bipartite system described by a pure state, and consequently expressed as an uncertainty relation for the sum of conditional entropies.

  10. Major congenital anomalies in a Danish region

    DEFF Research Database (Denmark)

    Garne, Ester; Hansen, Anne Vinkel; Birkelund, Anne Sofie

    2014-01-01

    INTRODUCTION: This study describes the prevalence of congenital anomalies and changes over time in birth outcome, mortality and chronic maternal diseases. MATERIAL AND METHODS: This study was based on population data from the EUROCAT registry covering the Funen County, Denmark, 1995...... mortality decreased significantly over time for cases with major congenital anomalies (p congenital anomaly cases, 8% had a registration of one of these chronic maternal diseases......: diabetes, epilepsy, mental disorder, thyroid disease, asthma, or inflammatory bowel disease. Medication for these conditions accounted for 46% of maternal drug use. CONCLUSION: Maternal morbidity and use of potentially teratogenic medication have increased among congenital anomaly cases. Foetal and infant...

  11. Indirect Climatic Effects of Major Volcanic Eruptions

    Science.gov (United States)

    Hofmann, D. J.

    2007-05-01

    The direct effects on climate, related to atmospheric emissions to the atmosphere following major volcanic eruptions, are well-known although the sparseness of such eruptions make detailed study on the range of such variations difficult. In general terms, infrared absorption by volcanic emissions to the stratosphere result in local heating early in the event when gaseous sulfur compounds exist. This early period is followed by gas to particle conversion, on a time scale of 1-2 months, promoting the formation of sulfuric acid-water droplets. Coagulation and droplet growth result in the "volcanic stratospheric aerosol layer" which is related to the predominant direct climatic effect of large eruptions, the cooling of the troposphere by backscattering of solar visible radiation to space with a recovery time scale of 1-2 years. In this paper we will discuss some of the less-known "indirect" effects of the volcanic stratospheric aerosol on climate. We label them indirect as they act on climate through intermediary atmospheric constituents. The intermediaries in the volcanic indirect climatic effect are generally atmospheric greenhouse gases or other atmospheric gases and conditions which affect greenhouse gases. For example, cooling of the troposphere following major eruptions reduces the growth rate of atmospheric carbon dioxide related to respiration by the terrestrial biosphere. In addition, redirection of part of the direct solar beam into diffuse radiation by the volcanic stratospheric aerosol stimulates plant photosynthesis, further reducing the carbon dioxide growth rate. The growth rate of the second-most important atmospheric greenhouse gas, methane, is also affected by volcanic emissions. Volcanic stratospheric aerosol particles provide surface area which catalyzes heterogeneous chemical reactions thus stimulating removal of stratospheric ozone, also a greenhouse gas. Although major droughts usually related to ENSO events have opposite effects on carbon

  12. Bovine anaplasmosis with emphasis on immune responses and protection

    International Nuclear Information System (INIS)

    Ristic, M.

    1980-01-01

    Anaplasmosis is an infectious and transmissible disease manifested by progressive anaemia and the appearance of other characteristic disease symptoms. It is a world-wide tick-borne disease of cattle and some wild ruminants caused by the rickettsia Anaplasma marginale. By drawing on information obtained from studies of plasmodial cell cultures, a method has recently been developed for short-term in vitro cultivation of A. marginale. An attenuated Anaplasma organism capable of growth in both ovine and bovine erythrocytes was used to demonstrate that the in vitro system provided the necessary requirements for active transfer of the organism from cell to cell. Organismal antigens are found in the erythrocytes of infected animals, whereas soluble antigens are derived from their erythrocytes and serum. Serums from convalescing animals interact with these antigens in agglutination, complement fixation, fluorescent antibody and precipitation tests. Passive transfer of sera from immune to susceptible cattle, however, does not seem to confer protection against the infection and development of the disease. Studies that employed various tests for measuring cell-mediated immune (CMI) responses (leukocyte migration inhibition, blast transformation and cytotoxicity), in association with information collected simultaneously on antibody activity, have shown that both humoral and cellular immune responses are needed for the development of protective immunity in anaplasmosis. It was further shown that an active replication of Anaplasma is essential for induction of these two types of immune responses. Consequently, live virulent and attenuated immunogens fulfil requirements for induction of protective immunity. With the virulent agent, however, development of protective immunity is preceded by induction of auto-immune responses apparently associated with pathogenesis of anaemia in anaplasmosis. Inactivated immunogens derived from blood of infected cattle and used in combination with

  13. Into the millennium: farewell to majors

    International Nuclear Information System (INIS)

    Polczer, S.

    1999-01-01

    Conventional oil discoveries in Alberta peaked in the mid-1960s, marking a shift in the exploration strategies of the oil company majors that established Canada as a player in the world petroleum scene. Increasingly, they are shifting capital out of the country or look to unconventional sources for their new finds. Since they cannot find reserves needed to replace production, major oil companies have began to wind down their exploration programs, or shift to gas or oil sands, or exit altogether. According to the best expert opinion, future traditional exploration and production in Canada will be dominated by technically focused, entrepreneurial niche players using the latest technology to exploit lower quality reservoirs. The same expert source believes that Canada's contribution to the world's petroleum industry after 2000 will be primarily technological development, such as better drilling and well completion techniques. Past evidence suggest that Canada, while not a big player on the world petroleum scene, can and will continue to provide useful contribution to the industry by developing and exporting useful technology

  14. An animated depiction of major depression epidemiology

    Directory of Open Access Journals (Sweden)

    Patten Scott B

    2007-06-01

    Full Text Available Abstract Background Epidemiologic estimates are now available for a variety of parameters related to major depression epidemiology (incidence, prevalence, etc.. These estimates are potentially useful for policy and planning purposes, but it is first necessary that they be synthesized into a coherent picture of the epidemiology of the condition. Several attempts to do so have been made using mathematical modeling procedures. However, this information is not easy to communicate to users of epidemiological data (clinicians, administrators, policy makers. Methods In this study, up-to-date data on major depression epidemiology were integrated using a discrete event simulation model. The mathematical model was animated in Virtual Reality Modeling Language (VRML to create a visual, rather than mathematical, depiction of the epidemiology. Results Consistent with existing literature, the model highlights potential advantages of population health strategies that emphasize access to effective long-term treatment. The paper contains a web-link to the animation. Conclusion Visual animation of epidemiological results may be an effective knowledge translation tool. In clinical practice, such animations could potentially assist with patient education and enhanced long-term compliance.

  15. SITO, Environmental Impact of Major Industrial Activities

    International Nuclear Information System (INIS)

    Mazzini, M.; Oriolo, F.

    1982-01-01

    1 - Description of problem or function: SITO evaluates the impact of major industrial activities on the environment. The method applied accounts for the alterations of ecological, physico-chemical, aesthetical and social values caused by the development of the considered activity. Such values are usually considered as not quantifiable but very important for the quality of the environment. 2 - Method of solution: The territory affected by the industrial project is described in a one-dimensional (for example a coast development) or two-dimensional representation as a lattice of square meshes of equal size. A major feature of the model is that the impact factors are considered with reference to each single mesh. The following vectors and matrices are evaluated: a) Matrix of environmental quality characteristics. It is the product of the environmental quality index matrix and the vector of weighting factors. b) Vector of the initial environmental values. It is the sum of the columns of matrix (a). c) Matrix obtained when the environmental quality characteristics matrix is multiplied by the vector of project action factors, taking into account distance effects. d) Vector of the final environmental values. This is the sum of columns of matrix (c)

  16. [Cognition - the core of major depressive disorder].

    Science.gov (United States)

    Polosan, M; Lemogne, C; Jardri, R; Fossati, P

    2016-02-01

    Cognitive deficits have been only recently recognized as a major phenotype determinant of major depressive disorder, although they are an integral part of the definition of the depressive state. Congruent evidence suggest that these cognitive deficits persist beyond the acute phase and may be identified at all ages. The aim of the current study was to review the main meta-analyses on cognition and depression, which encompasses a large range of cognitive domains. Therefore, we discuss the "cold" (attention, memory, executive functions) and "hot" (emotional bias) cognitive impairments in MDD, as well as those of social cognition domains (empathy, theory of mind). Several factors interfere with cognition in MDD such as clinical (melancholic, psychotic...) features, age, age of onset, illness severity, medication and comorbid condition. As still debated in the literature, the type of relationship between the severity of cognitive symptoms and functioning in depression is detailed, thus highlighting their predictive value of functional outcome, independently of the affective symptoms. A better identification of the cognitive deficits in MDD and a monitoring of the effects of different treatments require appropriate instruments, which may be developed by taking advantage of the increasing success of computing tools. Overall, current data suggest a core role for different cognitive deficits in MDD, therefore opening new perspectives for optimizing the treatment of depression. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Inequalities Theory of Majorization and Its Applications

    CERN Document Server

    Marshall, Albert W; Arnold, Barry

    2011-01-01

    This book’s first edition has been widely cited by researchers in diverse fields. The following are excerpts from reviews. “Inequalities: Theory of Majorization and its Applications” merits strong praise. It is innovative, coherent, well written and, most importantly, a pleasure to read. … This work is a valuable resource!” (Mathematical Reviews). “The authors … present an extremely rich collection of inequalities in a remarkably coherent and unified approach. The book is a major work on inequalities, rich in content and original in organization.” (Siam Review). “The appearance of … Inequalities in 1979 had a great impact on the mathematical sciences. By showing how a single concept unified a staggering amount of material from widely diverse disciplines–probability, geometry, statistics, operations research, etc.–this work was a revelation to those of us who had been trying to make sense of his own corner of this material.” (Linear Algebra and its Applications). This greatly expanded...

  18. Interpersonal psychotherapy (IPT) in major depressive disorder.

    Science.gov (United States)

    Brakemeier, Eva-Lotta; Frase, Lukas

    2012-11-01

    In this article, we will introduce interpersonal psychotherapy as an effective short-term treatment strategy in major depression. In IPT, a reciprocal relationship between interpersonal problems and depressive symptoms is regarded as important in the onset and as a maintaining factor of depressive disorders. Therefore, interpersonal problems are the main therapeutic targets of this approach. Four interpersonal problem areas are defined, which include interpersonal role disputes, role transitions, complicated bereavement, and interpersonal deficits. Patients are helped to break the interactions between depressive symptoms and their individual interpersonal difficulties. The goals are to achieve a reduction in depressive symptoms and an improvement in interpersonal functioning through improved communication, expression of affect, and proactive engagement with the current interpersonal network. The efficacy of this focused and structured psychotherapy in the treatment of acute unipolar major depressive disorder is summarized. This article outlines the background of interpersonal psychotherapy, the process of therapy, efficacy, and the expansion of the evidence base to different subgroups of depressed patients.

  19. Major Peripheral Nerve Injuries After Elbow Arthroscopy.

    Science.gov (United States)

    Desai, Mihir J; Mithani, Suhail K; Lodha, Sameer J; Richard, Marc J; Leversedge, Fraser J; Ruch, David S

    2016-06-01

    To survey the American Society for Surgery of the Hand membership to determine the nature and distribution of nerve injuries treated after elbow arthroscopy. An online survey was sent to all members of the American Society for Surgery of the Hand under an institutional review board-approved protocol. Collected data included the number of nerve injuries observed over a 5-year period, the nature of treatment required for the injuries, and the outcomes observed after any intervention. Responses were anonymous, and results were securely compiled. We obtained 372 responses. A total of 222 nerve injuries were reported. The most injured nerves reported were ulnar, radial, and posterior interosseous (38%, 22%, and 19%, respectively). Nearly half of all patients with injuries required operative intervention, including nerve graft, tendon transfer, nerve repair, or nerve transfer. Of the patients who sustained major injuries, those requiring intervention, 77% had partial or no motor recovery. All minor injuries resolved completely. Our results suggest that major nerve injuries after elbow arthroscopy are not rare occurrences and the risk of these injuries is likely under-reported in the literature. Furthermore, patients should be counseled on this risk because most nerve injuries show only partial or no functional recovery. With the more widespread practice of elbow arthroscopy, understanding the nature and sequelae of significant complications is critically important in ensuring patient safety and improving outcomes. Copyright © 2016 Arthroscopy Association of North America. Published by Elsevier Inc. All rights reserved.

  20. An animated depiction of major depression epidemiology.

    Science.gov (United States)

    Patten, Scott B

    2007-06-08

    Epidemiologic estimates are now available for a variety of parameters related to major depression epidemiology (incidence, prevalence, etc.). These estimates are potentially useful for policy and planning purposes, but it is first necessary that they be synthesized into a coherent picture of the epidemiology of the condition. Several attempts to do so have been made using mathematical modeling procedures. However, this information is not easy to communicate to users of epidemiological data (clinicians, administrators, policy makers). In this study, up-to-date data on major depression epidemiology were integrated using a discrete event simulation model. The mathematical model was animated in Virtual Reality Modeling Language (VRML) to create a visual, rather than mathematical, depiction of the epidemiology. Consistent with existing literature, the model highlights potential advantages of population health strategies that emphasize access to effective long-term treatment. The paper contains a web-link to the animation. Visual animation of epidemiological results may be an effective knowledge translation tool. In clinical practice, such animations could potentially assist with patient education and enhanced long-term compliance.

  1. Subcortical brain alterations in major depressive disorder : findings from the ENIGMA Major Depressive Disorder working group

    NARCIS (Netherlands)

    Schmaal, L.; Veltman, D. J.; van Erp, T. G. M.; Saemann, P. G.; Frodl, T.; Jahanshad, N.; Loehrer, E.; Tiemeier, H.; Hofman, A.; Niessen, W. J.; Vernooij, M. W.; Ikram, M. A.; Wittfeld, K.; Grabe, H. J.; Block, A.; Hegenscheid, K.; Voelzke, H.; Hoehn, D.; Czisch, M.; Lagopoulos, J.; Hatton, S. N.; Hickie, I. B.; Goya-Maldonado, R.; Kraemer, B.; Gruber, O.; Couvy-Duchesne, B.; Renteria, M. E.; Strike, L. T.; Mills, N. T.; de Zubicaray, G. I.; McMahon, K. L.; Medland, S. E.; Martin, N. G.; Gillespie, N. A.; Wright, M. J.; Hall, G.B.; MacQueen, G. M.; Frey, E. M.; Carballedo, A.; van Velzen, L. S.; van Tol, M. J.; van der Wee, N. J.; Veer, I. M.; Walter, H.; Schnell, K.; Schramm, E.; Normann, C.; Schoepf, D.; Konrad, C.; Penninx, B. W. J. H.

    The pattern of structural brain alterations associated with major depressive disorder (MDD) remains unresolved. This is in part due to small sample sizes of neuroimaging studies resulting in limited statistical power, disease heterogeneity and the complex interactions between clinical

  2. Some mechanistic requirements for major transitions.

    Science.gov (United States)

    Schuster, Peter

    2016-08-19

    Major transitions in nature and human society are accompanied by a substantial change towards higher complexity in the core of the evolving system. New features are established, novel hierarchies emerge, new regulatory mechanisms are required and so on. An obvious way to achieve higher complexity is integration of autonomous elements into new organized systems whereby the previously independent units give up their autonomy at least in part. In this contribution, we reconsider the more than 40 years old hypercycle model and analyse it by the tools of stochastic chemical kinetics. An open system is implemented in the form of a flow reactor. The formation of new dynamically organized units through integration of competitors is identified with transcritical bifurcations. In the stochastic model, the fully organized state is quasi-stationary whereas the unorganized state corresponds to a population with natural selection. The stability of the organized state depends strongly on the number of individual subspecies, n, that have to be integrated: two and three classes of individuals, [Formula: see text] and [Formula: see text], readily form quasi-stationary states. The four-membered deterministic dynamical system, [Formula: see text], is stable but in the stochastic approach self-enhancing fluctuations drive it into extinction. In systems with five and more classes of individuals, [Formula: see text], the state of cooperation is unstable and the solutions of the deterministic ODEs exhibit large amplitude oscillations. In the stochastic system self-enhancing fluctuations lead to extinction as observed with [Formula: see text] Interestingly, cooperative systems in nature are commonly two-membered as shown by numerous examples of binary symbiosis. A few cases of symbiosis of three partners, called three-way symbiosis, have been found and were analysed within the past decade. Four-way symbiosis is rather rare but was reported to occur in fungus-growing ants. The model

  3. MAJOR OIL PLAYS IN UTAH AND VICINITY

    International Nuclear Information System (INIS)

    Chidsey, Thomas C. Jr.; Morgan, Craig D.; Bon, Roger L.

    2003-01-01

    Utah oil fields have produced over 1.2 billion barrels (191 million m 3 ). However, the 13.7 million barrels (2.2 million m 3 ) of production in 2002 was the lowest level in over 40 years and continued the steady decline that began in the mid-1980s. The Utah Geological Survey believes this trend can be reversed by providing play portfolios for the major oil producing provinces (Paradox Basin, Uinta Basin, and thrust belt) in Utah and adjacent areas in Colorado and Wyoming. Oil plays are geographic areas with petroleum potential caused by favorable combinations of source rock, migration paths, reservoir rock characteristics, and other factors. The play portfolios will include: descriptions and maps of the major oil plays by reservoir; production and reservoir data; case-study field evaluations; summaries of the state-of-the-art drilling, completion, and secondary/tertiary techniques for each play; locations of major oil pipelines; descriptions of reservoir outcrop analogs; and identification and discussion of land use constraints. All play maps, reports, databases, and so forth, produced for the project will be published in interactive, menu-driven digital (web-based and compact disc) and hard-copy formats. This report covers research activities for the third quarter of the first project year (January 1 through March 31, 2003). This work included gathering field data and analyzing best practices in the eastern Uinta Basin, Utah, and the Colorado portion of the Paradox Basin. Best practices used in oil fields of the eastern Uinta Basin consist of conversion of all geophysical well logs into digital form, running small fracture treatments, fingerprinting oil samples from each producing zone, running spinner surveys biannually, mapping each producing zone, and drilling on 80-acre (32 ha) spacing. These practices ensure that induced fractures do not extend vertically out of the intended zone, determine the percentage each zone contributes to the overall production of

  4. Establishing a legal service for major trauma patients at a major trauma centre in the UK.

    Science.gov (United States)

    Seligman, William H; Thompson, Julian; Thould, Hannah E; Tan, Charlotte; Dinsmore, Andrew; Lockey, David J

    2017-09-01

    Major trauma causes unanticipated critical illness and patients have often made few arrangements for what are sudden and life-changing circumstances. This can lead to financial, housing, insurance, legal and employment issues for patients and their families.A UK law firm worked with the major trauma services to develop a free and comprehensive legal service for major trauma patients and their families at a major trauma centre (MTC) in the UK. In 2013, a legal service was established at North Bristol NHS Trust. Referrals are made by trauma nurse practitioners and it operates within a strict ethical framework. A retrospective analysis of the activity of this legal service between September 2013 and October 2015 was undertaken. 66 major trauma patients were seen by the legal teams at the MTC. 535 hours of free legal advice were provided on non-compensation issues-an average of 8 hours per patient. This initiative confirms a demand for the early availability of legal advice for major trauma patients to address a range of non-compensation issues as well as for identification of potential compensation claims. The availability of advice at the MTC is convenient for relatives who may be spending the majority of their time with injured relatives in hospital. More data are needed to establish the rehabilitation and health effects of receiving non-compensation advice after major injury; however, the utilisation of this service suggests that it should be considered at the UK MTCs. © Article author(s) (or their employer(s) unless otherwise stated in the text of the article) 2017. All rights reserved. No commercial use is permitted unless otherwise expressly granted.

  5. The Major Histocompatibility Complex in Transplantation

    Directory of Open Access Journals (Sweden)

    Marco Antonio Ayala García

    2012-01-01

    Full Text Available The transplant of organs is one of the greatest therapeutic achievements of the twentieth century. In organ transplantation, the adaptive immunity is considered the main response exerted to the transplanted tissue, since the principal target of the immune response is the MHC (major histocompatibility complex molecules expressed on the surface of donor cells. However, we should not forget that the innate and adaptive immunities are closely interrelated and should be viewed as complementary and cooperating. When a human transplant is performed, HLA (human leukocyte antigens molecules from a donor are recognized by the recipient's immune system triggering an alloimmune response Matching of donor and recipient for MHC antigens has been shown to have a significant positive effect on graft acceptance. This paper will present MHC, the innate and adaptive immunities, and clinical HLA testing.

  6. BROOKHAVEN: Major detectors for RHIC under construction

    International Nuclear Information System (INIS)

    Ludlam, Thomas W.

    1994-01-01

    On March 9-10, a cost and schedule review at Brookhaven verified construction readiness for the PHENIX detector (May 1993, page 10). PHENIX thus joins STAR (Solenoidal Tracking at RHIC - November 1991, page 17), whose construction plan was ratified in January 1993, as a major detector to take data when the RHIC heavy ion collider is completed in mid-1999. The goal of both detectors is to search for the transition from ordinary nuclear matter to a new state of matter consisting of (momentarily) unconfined quarks and gluons. This transition to a ''quark-gluon plasma'' (QGP) is predicted to occur under extreme conditions of temperature and energy density, as is likely to be the case in the collision of heavy ions of sufficient energy. RHIC is expected to produce the highest energy densities ever observed on the nuclear scale

  7. MAJOR PROJECTS THAT INFLUENCE WORLD TRADE

    Directory of Open Access Journals (Sweden)

    GEORGE CORNEL DUMITRESCU

    2014-11-01

    Full Text Available In 1869, with the opening of the Suez Canal, world trade entered a new era of development. The commercial routes linking the Far East to the western countries were shortened considerably as compared to the maritime corridor around the Cape of Good Hope. In 1914, the opening of the Panama Canal sealed the new deal in world trade, opening for business the shortest commercial routes around the world. After 145 years from the inauguration of the Suez Canal, world trade is on the eve of a new expansion. Two major projects: the expansion of both the Suez and Panama canals, planned to be completed in the next two years, will double their transit capacity. This paper does a comparative analysis of these two strategic projects, underlining the main benefits for Egypt, Panama and world trade, based on the available statistical data, reports and literature in the field.

  8. Environment and safety: major goals for MARS

    International Nuclear Information System (INIS)

    Maninger, R.C.

    1983-01-01

    The Mirror Advanced Reactor Study (MARS) is a conceptual design study for a commercial fusion power reactor. One of the major goals of MARS is to develop design guidance so that fusion reactors can meet reasonable expectations for environmental health and safety. One of the first steps in the assessment of health and safety requirements was to examine what the guidelines might be for health and safety in disposal of radioactive wastes from fusion reactors. Then, using these quidelines as criteria, the impact of materials selection upon generation of radioactive wastes through neutron activation of structural materials was investigated. A conclusion of this work is that fusion power systems may need substantial engineering effort in new materials development and selection to meet the probable publicly acceptable levels of radioactivity for waste disposal in the future

  9. Novel Augmentation Strategies in Major Depression

    DEFF Research Database (Denmark)

    Martiny, Klaus

    2017-01-01

    open psychiatric wards. Only a few patients were re-cruited through advertisements (in the PEMF and Chronos studies). Inclusion criteria Inclusion criteria were major depression according to the DSM-IV, including a depressive episode as part of a bipolar disorder. For the PEMF study, treatment...... The results from the Pindolol study showed that pindolol did not augment the effect of venlafaxine for the whole sample. However, for those patients classified as slow metabolizers, based on their O-desmethylvenlafaxine/venlafaxine ratio (ODV/V), pindolol did augment the antidepressant effect. For patients...... classified as fast metabolizers, pindolol worsened the outcome. This interaction between ODV/V ratio and treatment group was statistically significant (p = 0.01). Results from the PEMF study The results from the PEMF Study showed that treatment with active versus sham PEMF augmented the effect of the ongoing...

  10. Coping with ecological catastrophe: crossing major thresholds

    Directory of Open Access Journals (Sweden)

    John Cairns, Jr.

    2004-08-01

    Full Text Available The combination of human population growth and resource depletion makes catastrophes highly probable. No long-term solutions to the problems of humankind will be discovered unless sustainable use of the planet is achieved. The essential first step toward this goal is avoiding or coping with global catastrophes that result from crossing major ecological thresholds. Decreasing the number of global catastrophes will reduce the risks associated with destabilizing ecological systems, which could, in turn, destabilize societal systems. Many catastrophes will be local, regional, or national, but even these upheavals will have global consequences. Catastrophes will be the result of unsustainable practices and the misuse of technology. However, avoiding ecological catastrophes will depend on the development of eco-ethics, which is subject to progressive maturation, comments, and criticism. Some illustrative catastrophes have been selected to display some preliminary issues of eco-ethics.

  11. MAJOR OIL PLAYS IN UTAH AND VICINITY

    International Nuclear Information System (INIS)

    Chidsey, Thomas C.; Morgan, Craig D.; McClure, Kevin; Willis, Grant C.

    2003-01-01

    Utah oil fields have produced over 1.2 billion barrels (191 million m 3 ). However, the 13.7 million barrels (2.2 million m 3 ) of production in 2002 was the lowest level in over 40 years and continued the steady decline that began in the mid-1980s. The Utah Geological Survey believes this trend can be reversed by providing play portfolios for the major oil-producing provinces (Paradox Basin, Uinta Basin, and thrust belt) in Utah and adjacent areas in Colorado and Wyoming. Oil plays are geographic areas with petroleum potential caused by favorable combinations of source rock, migration paths, reservoir rock characteristics, and other factors. The play portfolios will include: descriptions and maps of the major oil plays by reservoir; production and reservoir data; case-study field evaluations; summaries of the state-of-the-art drilling, completion, and secondary/tertiary techniques for each play; locations of major oil pipelines; descriptions of reservoir outcrop analogs; and identification and discussion of land use constraints. All play maps, reports, databases, and so forth, produced for the project will be published in interactive, menu-driven digital (web-based and compact disc) and hard-copy formats. This report covers research activities for the fourth quarter of the first project year (April 1 through June 30, 2003). This work included describing outcrop analogs to the Jurassic Nugget Sandstone and Pennsylvanian Paradox Formation, the major oil producers in the thrust belt and Paradox Basin, respectively. Production-scale outcrop analogs provide an excellent view, often in three dimensions, of reservoir-facies characteristics and boundaries contributing to the overall heterogeneity of reservoir rocks. They can be used as a ''template'' for evaluation of data from conventional core, geophysical and petrophysical logs, and seismic surveys. The Nugget Sandstone was deposited in an extensive dune field that extended from Wyoming to Arizona. Outcrop analogs are

  12. Some Major Issues Influencing Nuclear Energy Prospective

    International Nuclear Information System (INIS)

    Feretic, D.

    2012-01-01

    The presentation analyses some issues which are of particular importance for future nuclear power application. These include duration of uranium reserves and high level radioactive waste decay period in function of uranium reserves (determined, assumed and speculative) and type of fuel cycle used. Public acceptance during essential historical milestones of nuclear power use, influence of safety and compatibility evaluations, quantified risk, externalities and nuclear accidents. Short review of major accidents, causes, consequences, impact of LNT and hormesis hypothesis. Particular problem for future of nuclear power is potential shortage of experienced personnel due to long period without plants construction. To address some of problems which may face future investors a brief review of specific events experienced during construction of NPP Krsko is presented. Such events could be of interest to countries planning to construct nuclear power plant.(author).

  13. 'Hot' cognition in major depressive disorder

    DEFF Research Database (Denmark)

    Miskowiak, Kamilla W; Carvalho, Andre F

    2014-01-01

    Major depressive disorder (MDD) is associated with significant cognitive dysfunction in both 'hot' (i.e. emotion-laden) and 'cold' (non-emotional) domains. Here we review evidence pertaining to 'hot' cognitive changes in MDD. This systematic review searched the PubMed and PsycInfo computerized......-limbic network with hyper-activity in limbic and ventral prefrontal regions paired with hypo-activity of dorsal prefrontal regions subserve these abnormalities. A cross-talk of 'hot' and 'cold' cognition disturbances in MDD occurs. Disturbances in 'hot cognition' may also contribute to the perpetuation......' cognition deficits in healthy relatives of patients with MDD. Taken together, these findings suggest that abnormalities in 'hot' cognition may constitute a candidate neurocognitive endophenotype for depression....

  14. Plasma osmotic changes during major abdominal surgery.

    Science.gov (United States)

    Malone, R A; McLeavey, C A; Arens, J F

    1977-12-01

    Fluid balance across the capillary membrane is maintained normally by a balance of hydrostatic and colloid osmotic pressures (COP). In 12 patients having major intra-abdominal procedures, the COP was followed during the operative and immediate postoperative periods. The patients' intraoperative fluid management consisted of replacing shed blood with blood and following Shires' concept of crystalloid replacement. Significant decreases in COP to approximately two thirds of the initial value occurred in patients having intra-abdominal procedures versus only a 10 percent decrease in those having peripheral procedures (greater than .001). As a result of this decrease in COP, the balance between hydrostatic and colloid osmotic pressures is lost and risk of pulmonary intersitial edema is increased.

  15. Progress on resolution of major surety issues

    International Nuclear Information System (INIS)

    Bell, C.R.; Boudreau, J.M.

    1985-01-01

    This paper presents a summary of the major surety issues (safety, environmental protection, sageguards, reliability, quality assurance) that have been identified during Phase I of the SP-100 Program and the progress that has been made in analyzing the most important of these issues in the context of the conceptual design effort. These issues have been identified as inadvertent criticality, toxic material release and dispersion, radiation exposure following end-of-life reentry, potential diversion of special nuclear material, failure to achieve end-of-life neutronic shutdown, and structural predictability for end-of-life re-entry or boost. Because of the complexity of these issues, a simplified conservative approach was taken during Phase I. Progress on these issues has been mainly in the area of increased understanding of the issues, identification of design features to resolve the issues, and quantitative evaluations of the surety characteristics of the various design concepts

  16. Strategic issues for the oil majors - 1992

    Energy Technology Data Exchange (ETDEWEB)

    Oppenheimer, P M [Oxford Univ. (United Kingdom)

    1992-01-01

    Strategic issues facing major oil producers in the 1990s are very diffuse - in contrast with both the 1970s (when strategy meant the response to high oil prices) and the 1980s (when it meant anticipating and exploiting a drop in prices). Mainly upstream issues include the future of price management by OPEC or a successor, the speed of development of new markets for natural gas in power generation and the role of Russia in world energy markets. Other issues include the impact of environmental regulations and taxes on the product mix and on marketing. Human-resource management will continue to face the task of reconciling career opportunities with static or declining manpower requirements; and corporate cash mountains may periodically recur. (Author).

  17. Strategic issues for the oil majors - 1992

    International Nuclear Information System (INIS)

    Oppenheimer, P.M.

    1992-01-01

    Strategic issues facing major oil producers in the 1990s are very diffuse - in contrast with both the 1970s (when strategy meant the response to high oil prices) and the 1980s (when it meant anticipating and exploiting a drop in prices). Mainly upstream issues include the future of price management by OPEC or a successor, the speed of development of new markets for natural gas in power generation and the role of Russia in world energy markets. Other issues include the impact of environmental regulations and taxes on the product mix and on marketing. Human-resource management will continue to face the task of reconciling career opportunities with static or declining manpower requirements; and corporate cash mountains may periodically recur. (Author)

  18. Major Intrinsic Proteins in Biomimetic Membranes

    DEFF Research Database (Denmark)

    Helix Nielsen, Claus

    2010-01-01

    or as sensor devices based on e.g., the selective permeation of metalloids. In principle a MIP based membrane sensor/separation device requires the supporting biomimetic matrix to be virtually impermeable to anything but water or the solute in question. In practice, however, a biomimetic support matrix....../separation technology, a unique class of membrane transport proteins is especially interesting the major intrinsic proteins (MIPs). Generally, MIPs conduct water molecules and selected solutes in and out of the cell while preventing the passage of other solutes, a property critical for the conservation of the cells...... internal pH and salt concentration. Also known as water channels or aquaporins they are highly efficient membrane pore proteins some of which are capable of transporting water at very high rates up to 109 molecules per second. Some MIPs transport other small, uncharged solutes, such as glycerol and other...

  19. Cognitive hypnotherapy for major depressive disorder.

    Science.gov (United States)

    Alladin, Assen

    2012-04-01

    Since the publication of the special issue on cognitive hypnotherapy in the Journal of Cognitive Psychotherapy: An International Quarterly (1994), there have been major developments in the application of hypnosis to the treatment of depression. However, there is no "one-size-fits-all" treatment for depressive disorders as the conditions represent a complex set of heterogeneous symptoms, involving multiple etiologies. It is thus important for therapists to promote a multimodal approach to treating depressive disorders. This article describes cognitive hypnotherapy (CH), an evidence-based multimodal psychological treatment that can be applied to a wide range of depressed patients. CH combines hypnosis with cognitive behavior therapy as the latter provides the best integrative lodestone for assimilating empirically supported treatment techniques derived from various psychotherapies.

  20. Epigenetic Modifications of Major Depressive Disorder

    Directory of Open Access Journals (Sweden)

    Kathleen Saavedra

    2016-08-01

    Full Text Available Major depressive disorder (MDD is a chronic disease whose neurological basis and pathophysiology remain poorly understood. Initially, it was proposed that genetic variations were responsible for the development of this disease. Nevertheless, several studies within the last decade have provided evidence suggesting that environmental factors play an important role in MDD pathophysiology. Alterations in epigenetics mechanism, such as DNA methylation, histone modification and microRNA expression could favor MDD advance in response to stressful experiences and environmental factors. The aim of this review is to describe genetic alterations, and particularly altered epigenetic mechanisms, that could be determinants for MDD progress, and how these alterations may arise as useful screening, diagnosis and treatment monitoring biomarkers of depressive disorders.

  1. Cognitive functioning in major depression - a summary

    Directory of Open Access Journals (Sweden)

    Åsa Hammar

    2009-09-01

    Full Text Available The aim of the present paper is to summarize the research during the past decade regarding cognitive functioning in Major Depressive Disorder (MDD. Cognitive impairment in the acute phase of illness has been frequently reported. The findings are shown in different cognitive domains, such as executive functions (EF, attention, memory and psychomotor speed. Fewer reports have investigated cognitive functioning in MDD in longitudinal studies. Some longitudinal reports show that the impairment observed in the acute phase of illness may be long lasting despite symptom reduction and recovery. However, findings regarding cognitive functioning in depression are divergent. Factors that might contribute to the divergent findings, such as depression subtype, severity and comorbidity are discussed. Clinical implications and focus of future research directions is highlighted. .In conclusion, depression is associated with cognitive impairment in the acute phase of illness, and some reports indicate that this impairment might be long lasting despite symptom reduction and recovery.

  2. Access to major overseas research facilities

    Energy Technology Data Exchange (ETDEWEB)

    Bolderman, J. W. [Australian Nuclear Science and Technology Organisation, Lucas Heights, NSW (Australia)

    1997-12-31

    This paper will describe four schemes which have been established to permit Australian researchers access to some of the most advanced overseas research facilities. These include, access to Major Research Facilities Program, the Australian National Beamline Facility at the Photon Factory, the Australian Synchrotron Research Program and the ISIS Agreement. The details of each of these programs is discussed and the statistics on the scientific output provided. All programs are managed on behalf of the Department of Industry, Science and Tourism by the Australian Nuclear Science and Technology Organisation. One hundred and thirteen senior scientists plus forty, one postgraduate, students were supported through these schemes during the 1996-1997 financial year. 1 fig.

  3. Prediction of Major Vascular Events after Stroke

    DEFF Research Database (Denmark)

    Ovbiagele, Bruce; Goldstein, Larry B.; Amarenco, Pierre

    2014-01-01

    BACKGROUND: Identifying patients with recent stroke or transient ischemic attack (TIA) at high risk of major vascular events (MVEs; stroke, myocardial infarction, or vascular death) may help optimize the intensity of secondary preventive interventions. We evaluated the relationships between...... the baseline Framingham Coronary Risk Score (FCRS) and a novel risk prediction model and with the occurrence of MVEs after stroke or TIA in subjects enrolled in the Stroke Prevention by Aggressive Reduction in Cholesterol Level (SPARCL) trial. METHODS: Data from the 4731 subjects enrolled in the SPARCL study...... were analyzed. Hazard ratios (HRs) from Cox regression models were used to determine the risk of subsequent MVEs based on the FCRS predicting 20% or more 10-year coronary heart disease risk. The novel risk model was derived based on multivariable modeling with backward selection. Model discrimination...

  4. International gas trade: Potential major projects

    International Nuclear Information System (INIS)

    Haamsoe, B.; Mashayekhi, A.; Razavi, H.

    1994-01-01

    The present paper reviews some key factors affecting continued expansion of the use and trade of natural gas, with a particular focus on a group of major gas trade and transport projects now in various stages of consideration. The paper begins by outlining the distribution of potential gas supplies, it also sketches the sectorial and regional structures of potential demand for natural gas. It continues by considering current and emerging trends in the international trade of natural gas by pipeline and as liquefied natural gas (LNG). Within the context thus provided, the paper then details a number of significant potential gas trade and transportation projects individually. Finally, the paper comments on the challenges in financing and implementing gas projects, especially with regard to economic, political, and institutional issues in the producing, transit, and consuming countries

  5. Poverty – a major economical problem

    Directory of Open Access Journals (Sweden)

    Assistent Professor Somogyi János

    2008-05-01

    Full Text Available Poverty is the state for the majority of the world’s people and nations. Yet there is plenty offood in the world for everyone. The problem is that hungry people are trapped in severe poverty. They lackthe money to buy enough food to nourish them. Being constantly malnourished, they become weaker and oftensick. This makes them increasingly less able to work, which then makes them even poorer and hungrier.This downward spiral often continues until death for them and their families.Why is this? How is to blame? Poor people for their own predicament? Have they been lazy, madepoor decisions, and been solely responsible for their plight? What about their governments? Have theypursued policies that actually harm successful development? Such causes of poverty and inequality are nodoubt real. But deeper and more global causes of poverty are often less discussed. This article explores variouspoverty problems in more depth.

  6. [Sickness absence associated with major life events].

    Science.gov (United States)

    Markussen, Simen; Røgeberg, Ole

    2012-05-29

    Sickness absence in the Norwegian workplace doubled in the period 1993-2003. However, the extent to which the driving factors were medical or non-medical remains unclear, as does the extent to which the cause may be found in the composition of the workforce. A differences-in-differences regression model was used to estimate the added sickness absence associated with major life events such as separation, death of spouse and pregnancy in the period 1993-2005. The data were obtained from administrative registers covering the entire Norwegian population, and include all absence periods of 16 days' duration or more reported by a doctor's medical certificate. The primary outcome measures were incidence (the proportion of absentees in a given time window) and absence (the proportion of sick days in a given time window). The level of absence among employees exposed to the specified life events was compared to control groups matched for gender, age, education and income. In 1993, people in each of the three groups exposed to major life events had more frequent and longer periods of absence than people in the control groups. This added sickness absence increased between 1993 and 2005. The changes in added sickness absence were at times significant, particularly for pregnant women. While sickness absence among pregnant women in 1993 was 15.4 percentage points higher than in the control group, the difference had increased to 24.8 percentage points in 2005. We find it improbable for the increase in added sickness absence to be caused by changes in the medical impact of life events or alterations in the workforce composition. We believe the increase is caused by changing attitudes among the working population and in the medical profession towards sickness absence on grounds that are not strictly medical, combined with improved social acceptance and diagnosis of mental health issues, and/or a medicalisation of natural health variations (pregnancy) and emotional distress (grief).

  7. Major Oil Plays in Utah and Vicinity

    Energy Technology Data Exchange (ETDEWEB)

    Thomas C. Chidsey; Craig D. Morgan; Kevin McClure; Douglas A. Sprinkel; Roger L. Bon; Hellmut H. Doelling

    2003-12-31

    Utah oil fields have produced over 1.2 billion barrels (191 million m{sup 3}). However, the 13.7 million barrels (2.2 million m{sup 3}) of production in 2002 was the lowest level in over 40 years and continued the steady decline that began in the mid-1980s. The Utah Geological Survey believes this trend can be reversed by providing play portfolios for the major oil-producing provinces (Paradox Basin, Uinta Basin, and thrust belt) in Utah and adjacent areas in Colorado and Wyoming. Oil plays are geographic areas with petroleum potential caused by favorable combinations of source rock, migration paths, reservoir rock characteristics, and other factors. The play portfolios will include: descriptions and maps of the major oil plays by reservoir; production and reservoir data; case-study field evaluations; locations of major oil pipelines; identification and discussion of land-use constraints; descriptions of reservoir outcrop analogs; and summaries of the state-of-the-art drilling, completion, and secondary/tertiary techniques for each play. This report covers research activities for the sixth quarter of the project (October 1 through December 31, 2003). This work included describing outcrop analogs for the Jurassic Twin Creek Limestone and Mississippian Leadville Limestone, major oil producers in the thrust belt and Paradox Basin, respectively, and analyzing best practices used in the southern Green River Formation play of the Uinta Basin. Production-scale outcrop analogs provide an excellent view of reservoir petrophysics, facies characteristics, and boundaries contributing to the overall heterogeneity of reservoir rocks. They can be used as a ''template'' for evaluation of data from conventional core, geophysical and petrophysical logs, and seismic surveys. In the Utah/Wyoming thrust belt province, the Jurassic Twin Creek Limestone produces from subsidiary closures along major ramp anticlines where the low-porosity limestone beds are extensively

  8. Major Oil Plays In Utah And Vicinity

    Energy Technology Data Exchange (ETDEWEB)

    Thomas Chidsey

    2007-12-31

    Utah oil fields have produced over 1.33 billion barrels (211 million m{sup 3}) of oil and hold 256 million barrels (40.7 million m{sup 3}) of proved reserves. The 13.7 million barrels (2.2 million m3) of production in 2002 was the lowest level in over 40 years and continued the steady decline that began in the mid-1980s. However, in late 2005 oil production increased, due, in part, to the discovery of Covenant field in the central Utah Navajo Sandstone thrust belt ('Hingeline') play, and to increased development drilling in the central Uinta Basin, reversing the decline that began in the mid-1980s. The Utah Geological Survey believes providing play portfolios for the major oil-producing provinces (Paradox Basin, Uinta Basin, and thrust belt) in Utah and adjacent areas in Colorado and Wyoming can continue this new upward production trend. Oil plays are geographic areas with petroleum potential caused by favorable combinations of source rock, migration paths, reservoir rock characteristics, and other factors. The play portfolios include descriptions and maps of the major oil plays by reservoir; production and reservoir data; case-study field evaluations; locations of major oil pipelines; identification and discussion of land-use constraints; descriptions of reservoir outcrop analogs; and summaries of the state-of-the-art drilling, completion, and secondary/tertiary recovery techniques for each play. The most prolific oil reservoir in the Utah/Wyoming thrust belt province is the eolian, Jurassic Nugget Sandstone, having produced over 288 million barrels (46 million m{sup 3}) of oil and 5.1 trillion cubic feet (145 billion m{sup 3}) of gas. Traps form on discrete subsidiary closures along major ramp anticlines where the depositionally heterogeneous Nugget is also extensively fractured. Hydrocarbons in Nugget reservoirs were generated from subthrust Cretaceous source rocks. The seals for the producing horizons are overlying argillaceous and gypsiferous beds in

  9. Cyclic nucleotide specific phosphodiesterases of Leishmania major

    Directory of Open Access Journals (Sweden)

    Linder Markus

    2006-03-01

    Full Text Available Abstract Background Leishmania represent a complex of important human pathogens that belong to the systematic order of the kinetoplastida. They are transmitted between their human and mammalian hosts by different bloodsucking sandfly vectors. In their hosts, the Leishmania undergo several differentiation steps, and their coordination and optimization crucially depend on numerous interactions between the parasites and the physiological environment presented by the fly and human hosts. Little is still known about the signalling networks involved in these functions. In an attempt to better understand the role of cyclic nucleotide signalling in Leishmania differentiation and host-parasite interaction, we here present an initial study on the cyclic nucleotide-specific phosphodiesterases of Leishmania major. Results This paper presents the identification of three class I cyclic-nucleotide-specific phosphodiesterases (PDEs from L. major, PDEs whose catalytic domains exhibit considerable sequence conservation with, among other, all eleven human PDE families. In contrast to other protozoa such as Dictyostelium, or fungi such as Saccharomyces cerevisiae, Candida ssp or Neurospora, no genes for class II PDEs were found in the Leishmania genomes. LmjPDEA contains a class I catalytic domain at the C-terminus of the polypeptide, with no other discernible functional domains elsewhere. LmjPDEB1 and LmjPDEB2 are coded for by closely related, tandemly linked genes on chromosome 15. Both PDEs contain two GAF domains in their N-terminal region, and their almost identical catalytic domains are located at the C-terminus of the polypeptide. LmjPDEA, LmjPDEB1 and LmjPDEB2 were further characterized by functional complementation in a PDE-deficient S. cerevisiae strain. All three enzymes conferred complementation, demonstrating that all three can hydrolyze cAMP. Recombinant LmjPDEB1 and LmjPDEB2 were shown to be cAMP-specific, with Km values in the low micromolar range

  10. Teaching methods in the healthcare management major.

    Science.gov (United States)

    Petrova, Gergana G; Popov, Teodor N

    2009-01-01

    Organisation and management are factors of paramount importance in higher education for achieving higher quality of training, better professional adaptation, and more effective career pursuance of the students. The present study analyses the use of various teaching methods for the students in the major of Healthcare Management as they are employed in two medical universities. We conducted a detailed questionnaire survey which included the students in the Healthcare Management major in the Faculty of Public Health (FPH) at Sofia Medical University (SMU) and the Medical Faculty of Plovdiv Medical University (PMU). The students were surveyed for two consecutive academic years (2004/2005 and 2005/2006). The logical units of study were 198 students completing their baccalaureate programs in Healthcare Management: 145 (73.23+/-3.15%) in the FPH, SMU and 53 (26.77+/-3.15%) in the PMU (the greater number of students from the SMU was due to the greater number of students admitted into the Sofia Medical University). The technical units of study were the Faculty of Public Health in the Medical University in Sofia and the Medical faculty in the Medical University in Plovdiv. The survey was carried out using our own questionnaire form comprising 51 questions (open and closed), some of them allowing more than one answer. The collected sociological data were analysed using SPSS v. 13.0, and the diagrams were made using Microsoft Excel' 97. We used the alternative, non-parametric and graphic analyses to illustrate the processes and events at a level of significance P PMU and 26.32+/-1.91% for SMU). This format of teaching is also considered to be the easiest with regard to learning the study material by 22.75+/-3.25% of the PMU graduates and 27.56+/-2.38% of the SMU graduates. The PMU students regard seminars, individual work and discussions as the format that afford the easiest way to acquire knowledge (22.16+/-3.21%, 21.56+/-3.18%, (18.56+/-3.01%, respectively). The most

  11. Successful Control of Major Project Budgets

    Directory of Open Access Journals (Sweden)

    Steen Lichtenberg

    2016-07-01

    Full Text Available This paper differs from scientific papers describing current research. In line with the theme of this special issue, it challenges conventional risk management practice against the background of former research results successfully finished decades ago. It is well-known that conventional practice frequently results in budget overruns of large projects. International reviews document that. Severe delays of schedules are also well-known. This paper describes successful research results from almost three decades ago, which successfully challenges this severe problem and has led to new practices. The research involved is an unusual mix: Scandinavian researchers from psychology, statistical theory and engineering economy. The resulting procedure has been widely used since around 1990 and challenges conventional procedures. The procedure is documented to be able to yield statistically correct prognoses, when the “rules of the game” have been correctly followed. After a short summary of the basic situation, this paper summarizes the research, followed by some resulting experiences, focusing on two recent studies each of 40 infrastructures and other major projects. In both sets, the actual final cost largely equaled the expected project cost. This result is a marked change from international past and present experience. Finally, the need for further research and progress is discussed.

  12. Osteoporosis Syndrome in Thalassaemia Major: An Overview

    Directory of Open Access Journals (Sweden)

    Meropi Toumba

    2010-01-01

    Full Text Available Osteoporosis in thalassaemia major (TM represents a prominent cause of morbidity. The mechanism of pathogenesis of bone disease (BD in TM is multifactorial and complicated. Peak bone mass is achieved shortly after completion of puberty and normally remains stable until the third decade of life when age-related bone mass begins. Growth hormone (GH and sex steroids play a crucial role in bone remodeling and in the maintenance of skeletal architecture during adult life. GH and insulin growth factors (IGFs have anabolic effect in bone formation. Sex steroids act probably by increasing the expression of RANKL by osteoblastic cells and alterations in the RANK/RANKL/OPG system in favor of osteoclasts. Impaired GH secretion and lack of sex steroids in thalassemic patients due to pituitary damage, contribute to failure of achieving optimal peak bone mass. Other endocrine complications such as hypoparathyroidism and vitamin D deficiency have also a detrimental role on bones in TM. It is still questionable whether the international criteria for defining osteopenia and osteoporosis are relevant to patients with TM; also a question arises for the diagnostic methods such as DEXA scan and management of osteoporosis with known treatment protocols, in the thalassaemic patient.

  13. Thermal Radiation Anomalies Associated with Major Earthquakes

    Science.gov (United States)

    Ouzounov, Dimitar; Pulinets, Sergey; Kafatos, Menas C.; Taylor, Patrick

    2017-01-01

    Recent developments of remote sensing methods for Earth satellite data analysis contribute to our understanding of earthquake related thermal anomalies. It was realized that the thermal heat fluxes over areas of earthquake preparation is a result of air ionization by radon (and other gases) and consequent water vapor condensation on newly formed ions. Latent heat (LH) is released as a result of this process and leads to the formation of local thermal radiation anomalies (TRA) known as OLR (outgoing Longwave radiation, Ouzounov et al, 2007). We compare the LH energy, obtained by integrating surface latent heat flux (SLHF) over the area and time with released energies associated with these events. Extended studies of the TRA using the data from the most recent major earthquakes allowed establishing the main morphological features. It was also established that the TRA are the part of more complex chain of the short-term pre-earthquake generation, which is explained within the framework of a lithosphere-atmosphere coupling processes.

  14. Environmental influences on major waterfowl diseases

    Science.gov (United States)

    Friend, M.

    1992-01-01

    The decline of North American waterfowl resources since the 1960s is well-known to this audience and need not be detailed to establish that population numbers for several key waterfowl species are at or near their lowest levels since records have been kept. Loss of habitat is an accepted major cause for the decline of waterfowl numbers and the wildlife conservation community is responding with initiatives to prevent further loss of existing wetland acreage, restoration for degraded wetlands and creation of new wetlands. Numerous joint ventures focusing on key waterfowl habitat requirements are being developed under the North American Waterfowl Plan. The importance of habitat loss also is reflected in many of the presentations at this conference on wetland conservation, including one special session devoted solely to that topic. A basic premise of the focus on wetlands is that restoration of waterfowl populations is habitat dependent. This is a tenable thesis if other factors suppressing waterfowl numbers are dealt with and the habitat base being enhanced sustains waterfowl rather than contributes to their death. My presentation addresses disease as a factor suppressing waterfowl numbers and the relation of habitat quantity and quality with waterfowl disease.

  15. Resource Demand Scenarios for the Major Metals.

    Science.gov (United States)

    Elshkaki, Ayman; Graedel, T E; Ciacci, Luca; Reck, Barbara K

    2018-03-06

    The growth in metal use in the past few decades raises concern that supplies may be insufficient to meet demands in the future. From the perspective of historical and current use data for seven major metals-iron, manganese, aluminum, copper, nickel, zinc, and lead-we have generated several scenarios of potential metal demand from 2010 to 2050 under alternative patterns of global development. We have also compared those demands with various assessments of potential supply to midcentury. Five conclusions emerge: (1) The calculated demand for each of the seven metals doubles or triples relative to 2010 levels by midcentury; (2) The largest demand increases relate to a scenario in which increasingly equitable values and institutions prevail throughout the world; (3) The metal recycling flows in the scenarios meet only a modest fraction of future metals demand for the next few decades; (4) In the case of copper, zinc, and perhaps lead, supply may be unlikely to meet demand by about midcentury under the current use patterns of the respective metals; (5) Increased rates of demand for metals imply substantial new energy provisioning, leading to increases in overall global energy demand of 21-37%. These results imply that extensive technological transformations and governmental initiatives could be needed over the next several decades in order that regional and global development and associated metal demand are not to be constrained by limited metal supply.

  16. Contraction of online response to major events.

    Science.gov (United States)

    Szell, Michael; Grauwin, Sébastian; Ratti, Carlo

    2014-01-01

    Quantifying regularities in behavioral dynamics is of crucial interest for understanding collective social events such as panics or political revolutions. With the widespread use of digital communication media it has become possible to study massive data streams of user-created content in which individuals express their sentiments, often towards a specific topic. Here we investigate messages from various online media created in response to major, collectively followed events such as sport tournaments, presidential elections, or a large snow storm. We relate content length and message rate, and find a systematic correlation during events which can be described by a power law relation--the higher the excitation, the shorter the messages. We show that on the one hand this effect can be observed in the behavior of most regular users, and on the other hand is accentuated by the engagement of additional user demographics who only post during phases of high collective activity. Further, we identify the distributions of content lengths as lognormals in line with statistical linguistics, and suggest a phenomenological law for the systematic dependence of the message rate to the lognormal mean parameter. Our measurements have practical implications for the design of micro-blogging and messaging services. In the case of the existing service Twitter, we show that the imposed limit of 140 characters per message currently leads to a substantial fraction of possibly dissatisfying to compose tweets that need to be truncated by their users.

  17. The Chernobyl Forum: major findings and recommendations

    International Nuclear Information System (INIS)

    Balonov, M.I.

    2007-01-01

    The accident at the Chernobyl NPP in 1986 was the most severe in the history of the nuclear industry, causing a huge release of radionuclides over large areas of Europe. The recently completed Chernobyl Forum concluded that after a number of years, along with reduction of radiation levels and accumulation of humanitarian consequences, severe social and economic depression of the affected regions and associated psychological problems of the general public and the workers had become the most significant problem to be addressed by the authorities. The majority of the affected land is now safe for life and economic activities. However, in the Chernobyl Exclusion Zone and in some limited areas of Belarus, Russia and Ukraine some restrictions on land-use should be retained for decades to come. Most of the 600,000 emergency and recovery operation workers and five million residents of the contaminated areas in Belarus, Russia and Ukraine received relatively minor radiation doses which are comparable with the natural background levels. Apart from the dramatic increase in thyroid cancer incidence among those exposed at a young age and some increase of leukaemia and solid cancer in most exposed workers, there is no clearly demonstrated increase in the somatic diseases due to radiation

  18. Major savings promised by new dipper technology

    Energy Technology Data Exchange (ETDEWEB)

    Ednie, H.

    2005-10-01

    A Canadian rope shovel dipper prototype was tested at the Suncor oil sands operations in May 2005. The 3 cubic yard JPi 2005 series dipper was designed by JPi, a geo-industry engineering consultant firm. The new design minimizes shovel dipper wear and resistance while digging at a rock face. This simple concept could offer major savings for mine operators. The main feature of the shovel dipper is its shape. Rather than having a straight-lined profile, the lip to latch keeper is curved to match the range of motions of the machine itself. This provides optimum penetration angles with minimum resistance when digging, thereby increasing productivity while eliminating heel wear. The dipper was originally designed to dig softer materials, but can actually be used to dig or scoop any material from blasted hard rock to the softest oil sand. The dipper is also more open at the door than at the lip allowing the oil sand to naturally flow out of the dipper upon release. The prototype was demonstrated to an industry-wide audience in May 2005 on a recently rebuilt 1949 Dominion 500 shovel. Preliminary results indicate that the design is meeting the expectations of the designer. However, more tests are scheduled and JPi will continue to seek collaborations and partnerships with mining operations to produce and test a 75 cubic yard version of the dipper for use with modern shovels. 2 figs.

  19. Potentialities of robots in major accident situations

    International Nuclear Information System (INIS)

    Chevallier, M.

    2013-01-01

    The INTRA group was founded in 1988, 2 years after the Chernobyl accident with the purpose of a cooperation between EDF, Cogema and CEA in order to develop and operate a fleet of robots able to intervene and replace man in a nuclear facility in case of major accident. Now INTRA disposes of 5 types of equipment: first, robots for the inside of buildings (they can overcome 40 cm high obstacles, open doors, go upstairs) they are wire-guided and enjoy a battery life of 6 to 8 hours. Secondly, robots for the open air that are able to move in very degraded grounds, they are remote controlled through radio-waves and their autonomy range nears 5 km. Thirdly, public works vehicles, INTRA has developed an excavator and a dump truck, both are remote controlled, they allow the making of any earth work. Fourthly, INTRA has developed 2 systems of contamination measurement: Skylink and Helinuc. Skylink is a system of 20 radiation monitors that can be dispatched on the contaminated zone, their data is collected through radio waves. Helinuc is a kind of gamma spectrometer that is helicopter-borne and can draw a map of the contamination around the installation. Fifthly, 2 drones are being tested, they will be fitted with radiation monitors. (A.C.)

  20. Perceptive biases in major depressive episode.

    Directory of Open Access Journals (Sweden)

    Marine Naudin

    Full Text Available INTRODUCTION: Alterations in emotional processing occur during a major depressive episode (MDE, and olfaction and facial expressions have implications in emotional and social interactions. To gain a better understanding of these processes, we characterized the perceptive sensorial biases, potential links, and potential remission after antidepressant treatment of MDE. METHODS: We recruited 22 patients with acute MDE, both before and after three months of antidepressant treatment, and 41 healthy volunteers matched by age and smoking status. The participants underwent a clinical assessment (Mini International Neuropsychiatry Interview, Montgomery-Åsberg Depression Rating Scale, State-Trait Anxiety Inventory, Physical and Social Anhedonia scales, Pleasure-Displeasure Scale, an olfactory evaluation (hedonic aspect, familiarity and emotional impact of odors, and a computerized Facial Affect Recognition task. RESULTS: MDE was associated with an olfactory bias concerning hedonic and emotional aspects, including negative olfactory alliesthesia (unpleasant odorants perceived as more unpleasant, facial emotion expression recognition (happy facial expressions, and in part olfactory anhedonia (pleasant odorants perceived as less pleasant. In addition, the results revealed that these impairments represent state markers of MDE, suggesting that the patients recovered the same sensory processing as healthy subjects after antidepressant treatment. DISCUSSION: This study demonstrated that MDE is associated with negative biases toward olfactory perception and the recognition of facial emotional expressions. The link between these two sensory parameters suggests common underlying processes.

  1. Biomass Burning: Major Uncertainties, Advances, and Opportunities

    Science.gov (United States)

    Yokelson, R. J.; Stockwell, C.; Veres, P. R.; Hatch, L. E.; Barsanti, K. C.; Liu, X.; Huey, L. G.; Ryerson, T. B.; Dibb, J. E.; Wisthaler, A.; Müller, M.; Alvarado, M. J.; Kreidenweis, S. M.; Robinson, A. L.; Toon, O. B.; Peischl, J.; Pollack, I. B.

    2014-12-01

    Domestic and open biomass burning are poorly-understood, major influences on Earth's atmosphere composed of countless individual fires that (along with their products) are difficult to quantify spatially and temporally. Each fire is a minimally-controlled complex phenomenon producing a diverse suite of gases and aerosols that experience many different atmospheric processing scenarios. New lab, airborne, and space-based observations along with model and algorithm development are significantly improving our knowledge of biomass burning. Several campaigns provided new detailed emissions profiles for previously undersampled fire types; including wildfires, cooking fires, peat fires, and agricultural burning; which may increase in importance with climate change and rising population. Multiple campaigns have better characterized black and brown carbon and used new instruments such as high resolution PTR-TOF-MS and 2D-GC/TOF-MS to improve quantification of semi-volatile precursors to aerosol and ozone. The aerosol evolution and formation of PAN and ozone, within hours after emission, have now been measured extensively. The NASA DC-8 sampled smoke before and after cloud-processing in two campaigns. The DC-8 performed continuous intensive sampling of a wildfire plume from the source in California to Canada probing multi-day aerosol and trace gas aging. Night-time plume chemistry has now been measured in detail. Fire inventories are being compared and improved, as is modeling of mass transfer between phases and sub-grid photochemistry for global models.

  2. Trochleoplasty in major trochlear dysplasia: current concepts

    Directory of Open Access Journals (Sweden)

    Beaufils Philippe

    2012-02-01

    Full Text Available Abstract Trochleoplasty is the theoretical solution to persistent symptoms (pain and/or instability related to trochlear dysplasia where there is not only a trochlear flatness but also a trochlear prominence. The threshold of prominence indicating surgical intervention has as yet not been determined. A bump of 5 mm is generally accepted as the inferior limit. Given the interventional nature of this demanding procedure, it should be proposed in selected cases after considerable discussion with the patient. Trochleoplasty is indicated as a primary procedure for major trochlear dysplasia with a prominence > 5 mm. Stabilization is obtained in most of the cases with the risk of residual mild anterior knee pain. It is also indicated as a salvage procedure when a previous surgery failed. Despite the reputation of the procedure, the published results are encouraging in terms of prevention of re-dislocation, satisfaction index, and radiological outcomes. Post-operative stiffness is the main complication, which may require manipulation under anaesthesia or arthroscopic arthrolysis. There are few other complications reported and to date secondary necrosis of the trochlea has not been reported. Technically speaking, the deepening trochleoplasty is a difficult procedure without reliable landmarks. We propose a recession wedge trochleoplasty which is an easier procedure. It is never undertaken as an isolated procedure, but always in conjunction with other realignment procedures of the extensor apparatus according to the "a la carte" surgery concept.

  3. Affective Priming in Major Depressive Disorder

    Directory of Open Access Journals (Sweden)

    Joelle eLeMoult

    2012-10-01

    Full Text Available Research on cognitive biases in depression has provided considerable evidence for the impact of emotion on cognition. Individuals with depression tend to preferentially process mood-congruent material and to show deficits in the processing of positive material leading to biases in attention, memory, and judgments. More research is needed, however, to fully understand which cognitive processes are affected. The current study further examines the impact of emotion on cognition using a priming design with facial expressions of emotion. Specifically, this study tested whether the presentation of facial expressions of emotion affects subsequent processing of affective material in participants with major depressive disorder (MDD and healthy controls (CTL. Facial expressions displaying happy, sad, angry, disgusted, or neutral expressions were presented as primes for 500ms, and participants’ speed to identify a subsequent target’s emotional expression was assessed. All participants displayed greater interference from emotional versus neutral primes, marked by slower response times to judge the emotion of the target face when it was preceded by an emotional prime. Importantly, the CTL group showed the strongest interference when happy emotional expressions served as primes whereas the MDD group failed to show this bias. These results add to a growing literature that shows that depression is associated with difficulties in the processing of positive material.

  4. Mice lacking major brain gangliosides develop parkinsonism.

    Science.gov (United States)

    Wu, Gusheng; Lu, Zi-Hua; Kulkarni, Neil; Amin, Ruchi; Ledeen, Robert W

    2011-09-01

    Parkinson's disease (PD) is the second most prevalent late-onset neurodegenerative disorder that affects nearly 1% of the global population aged 65 and older. Whereas palliative treatments are in use, the goal of blocking progression of motor and cognitive disability remains unfulfilled. A better understanding of the basic pathophysiological mechanisms underlying PD would help to advance that goal. The present study provides evidence that brain ganglioside abnormality, in particular GM1, may be involved. This is based on use of the genetically altered mice with disrupted gene Galgt1 for GM2/GD2 synthase which depletes GM2/GD2 and all the gangliotetraose gangliosides that constitute the major molecular species of brain. These knockout mice show overt motor disability on aging and clear indications of motor impairment with appropriate testing at an earlier age. This disability was rectified by L-dopa administration. These mice show other characteristic symptoms of PD, including depletion of striatal dopamine (DA), loss of DA neurons of the substantia nigra pars compacta, and aggregation of alpha synuclein. These manifestations of parkinsonism were largely attenuated by administration of LIGA-20, a membrane permeable analog of GM1 that penetrates the blood brain barrier and enters living neurons. These results suggest that perturbation of intracellular mechanisms mediated by intracellular GM1 may be a contributing factor to PD.

  5. Contraction of online response to major events.

    Directory of Open Access Journals (Sweden)

    Michael Szell

    Full Text Available Quantifying regularities in behavioral dynamics is of crucial interest for understanding collective social events such as panics or political revolutions. With the widespread use of digital communication media it has become possible to study massive data streams of user-created content in which individuals express their sentiments, often towards a specific topic. Here we investigate messages from various online media created in response to major, collectively followed events such as sport tournaments, presidential elections, or a large snow storm. We relate content length and message rate, and find a systematic correlation during events which can be described by a power law relation--the higher the excitation, the shorter the messages. We show that on the one hand this effect can be observed in the behavior of most regular users, and on the other hand is accentuated by the engagement of additional user demographics who only post during phases of high collective activity. Further, we identify the distributions of content lengths as lognormals in line with statistical linguistics, and suggest a phenomenological law for the systematic dependence of the message rate to the lognormal mean parameter. Our measurements have practical implications for the design of micro-blogging and messaging services. In the case of the existing service Twitter, we show that the imposed limit of 140 characters per message currently leads to a substantial fraction of possibly dissatisfying to compose tweets that need to be truncated by their users.

  6. Burkholderia glumae: next major pathogen of rice?

    Science.gov (United States)

    Ham, Jong Hyun; Melanson, Rebecca A; Rush, Milton C

    2011-05-01

    Burkholderia glumae causes bacterial panicle blight of rice, which is an increasingly important disease problem in global rice production. Toxoflavin and lipase are known to be major virulence factors of this pathogen, and their production is dependent on the TofI/TofR quorum-sensing system, which is mediated by N-octanoyl homoserine lactone. Flagellar biogenesis and a type III secretion system are also required for full virulence of B. glumae. Bacterial panicle blight is thought to be caused by seed-borne B. glumae; however, its disease cycle is not fully understood. In spite of its economic importance, neither effective control measures for bacterial panicle blight nor rice varieties showing complete resistance to the disease are currently available. A better understanding of the molecular mechanisms underlying B. glumae virulence and of the rice defence mechanisms against the pathogen would lead to the development of better methods of disease control for bacterial panicle blight. Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales; Burkholderiaceae; Burkholderia. Gram-negative, capsulated, motile, lophotrichous flagella, pectolytic. Aborted seed, empty grains as a result of failure of grain filling, brown spots on panicles, seedling rot. Seed sterilization, planting partially resistant lines (no completely resistant line is available). KNOWN VIRULENCE FACTORS: Toxoflavin, lipase, type III effectors. © 2010 LSU AGCENTER. MOLECULAR PLANT PATHOLOGY © 2010 BSPP AND BLACKWELL PUBLISHING LTD.

  7. Major new sources of biological ice nuclei

    Science.gov (United States)

    Moffett, B. F.; Hill, T.; Henderson-Begg, S. K.

    2009-12-01

    Almost all research on biological ice nucleation has focussed on a limited number of bacteria. Here we characterise several major new sources of biogenic ice nuclei. These include mosses, hornworts, liverworts and cyanobacteria. Ice nucleation in the eukaryotic bryophytes appears to be ubiquitous. The temperature at which these organisms nucleate is that at which the difference in vapour pressure over ice and water is at or close to its maximum. At these temperatures (-8 to -18 degrees C) ice will grow at the expense of supercooled water. These organisms are dependent for their water on occult precipitation - fog, dew and cloudwater which by its nature is not collected in conventional rain gauges. Therefore we suggest that these organism produce ice nuclei as a water harvesting mechanism. Since the same mechanism would also drive the Bergeron-Findeisen process, and as moss is known to become airborne, these nuclei may have a role in the initiation of precipitation. The properties of these ice nuclei are very different from the well characterised bacterial nuclei. We will also present DNA sequence data showing that, although related, the proteins responsible are only very distantly related to the classical bacterial ice nuclei.

  8. Detrended fluctuation analysis for major depressive disorder.

    Science.gov (United States)

    Mumtaz, Wajid; Malik, Aamir Saeed; Ali, Syed Saad Azhar; Yasin, Mohd Azhar Mohd; Amin, Hafeezullah

    2015-01-01

    Clinical utility of Electroencephalography (EEG) based diagnostic studies is less clear for major depressive disorder (MDD). In this paper, a novel machine learning (ML) scheme was presented to discriminate the MDD patients and healthy controls. The proposed method inherently involved feature extraction, selection, classification and validation. The EEG data acquisition involved eyes closed (EC) and eyes open (EO) conditions. At feature extraction stage, the de-trended fluctuation analysis (DFA) was performed, based on the EEG data, to achieve scaling exponents. The DFA was performed to analyzes the presence or absence of long-range temporal correlations (LRTC) in the recorded EEG data. The scaling exponents were used as input features to our proposed system. At feature selection stage, 3 different techniques were used for comparison purposes. Logistic regression (LR) classifier was employed. The method was validated by a 10-fold cross-validation. As results, we have observed that the effect of 3 different reference montages on the computed features. The proposed method employed 3 different types of feature selection techniques for comparison purposes as well. The results show that the DFA analysis performed better in LE data compared with the IR and AR data. In addition, during Wilcoxon ranking, the AR performed better than LE and IR. Based on the results, it was concluded that the DFA provided useful information to discriminate the MDD patients and with further validation can be employed in clinics for diagnosis of MDD.

  9. The impact of major trauma network triage systems on patients with major burns.

    Science.gov (United States)

    Nizamoglu, Metin; O'Connor, Edmund Fitzgerald; Bache, Sarah; Theodorakopoulou, Evgenia; Sen, Sankhya; Sherren, Peter; Barnes, David; Dziewulski, Peter

    2016-12-01

    Trauma is a leading cause of death and disability worldwide. Patients presenting with severe trauma and burns benefit from specifically trained multidisciplinary teams. Regional trauma systems have shown improved outcomes for trauma patients. The aim of this study is to determine whether the development of major trauma systems have improved the management of patients with major burns. A retrospective study was performed over a four-year period reviewing all major burns in adults and children received at a regional burns centre in the UK before and after the implementation of the regional trauma systems and major trauma centres (MTC). Comparisons were drawn between three areas: (1) Patients presenting before the introduction of MTC and after the introduction of MTC. (2) Patients referred from MTC and non-MTC within the region, following the introduction of MTC. (3) Patients referred using the urban trauma protocol and the rural trauma protocol. Following the introduction of regional trauma systems and major trauma centres (MTC), isolated burn patients seen at our regional burns centre did not show any significant improvement in transfer times, admission resuscitation parameters, organ dysfunction or survival when referred from a MTC compared to a non-MTC emergency department. There was also no significant difference in survival when comparing referrals from all hospitals pre and post establishment of the major trauma network. No significant outcome benefit was demonstrated for burns patients referred via MTCs compared to non-MTCs. We suggest further research is needed to ascertain whether burns patients benefit from prolonged transfer times to a MTC compared to those seen at their local hospitals prior to transfer to a regional burns unit for further specialist care. Copyright © 2016 Elsevier Ltd and ISBI. All rights reserved.

  10. Comparative genomics and transcriptomics of trait-gene association

    Directory of Open Access Journals (Sweden)

    Pierlé Sebastián

    2012-11-01

    Full Text Available Abstract Background The Order Rickettsiales includes important tick-borne pathogens, from Rickettsia rickettsii, which causes Rocky Mountain spotted fever, to Anaplasma marginale, the most prevalent vector-borne pathogen of cattle. Although most pathogens in this Order are transmitted by arthropod vectors, little is known about the microbial determinants of transmission. A. marginale provides unique tools for studying the determinants of transmission, with multiple strain sequences available that display distinct and reproducible transmission phenotypes. The closed core A. marginale genome suggests that any phenotypic differences are due to single nucleotide polymorphisms (SNPs. We combined DNA/RNA comparative genomic approaches using strains with different tick transmission phenotypes and identified genes that segregate with transmissibility. Results Comparison of seven strains with different transmission phenotypes generated a list of SNPs affecting 18 genes and nine promoters. Transcriptional analysis found two candidate genes downstream from promoter SNPs that were differentially transcribed. To corroborate the comparative genomics approach we used three RNA-seq platforms to analyze the transcriptomes from two A. marginale strains with different transmission phenotypes. RNA-seq analysis confirmed the comparative genomics data and found 10 additional genes whose transcription between strains with distinct transmission efficiencies was significantly different. Six regions of the genome that contained no annotation were found to be transcriptionally active, and two of these newly identified transcripts were differentially transcribed. Conclusions This approach identified 30 genes and two novel transcripts potentially involved in tick transmission. We describe the transcriptome of an obligate intracellular bacterium in depth, while employing massive parallel sequencing to dissect an important trait in bacterial pathogenesis.

  11. A major genetic component of BSE susceptibility

    Science.gov (United States)

    Juling, Katrin; Schwarzenbacher, Hermann; Williams, John L; Fries, Ruedi

    2006-01-01

    Background Coding variants of the prion protein gene (PRNP) have been shown to be major determinants for the susceptibility to transmitted prion diseases in humans, mice and sheep. However, to date, the effects of polymorphisms in the coding and regulatory regions of bovine PRNP on bovine spongiform encephalopathy (BSE) susceptibility have been considered marginal or non-existent. Here we analysed two insertion/deletion (indel) polymorphisms in the regulatory region of bovine PRNP in BSE affected animals and controls of four independent cattle populations from UK and Germany. Results In the present report, we show that two previously reported 23- and 12-bp insertion/deletion (indel) polymorphisms in the regulatory region of bovine PRNP are strongly associated with BSE incidence in cattle. Genotyping of BSE-affected and control animals of UK Holstein, German Holstein, German Brown and German Fleckvieh breeds revealed a significant overrepresentation of the deletion alleles at both polymorphic sites in diseased animals (P = 2.01 × 10-3 and P = 8.66 × 10-5, respectively). The main effect on susceptibility is associated with the 12-bp indel polymorphism. Compared with non-carriers, heterozygous and homozygous carriers of the 12-bp deletion allele possess relatively higher risks of having BSE, ranging from 1.32 to 4.01 and 1.74 to 3.65 in the different breeds. These values correspond to population attributable risks ranging from 35% to 53%. Conclusion Our results demonstrate a substantial genetic PRNP associated component for BSE susceptibility in cattle. Although the BSE risk conferred by the deletion allele of the 12-bp indel in the regulatory region of PRNP is substantial, the main risk factor for BSE in cattle is environmental, i.e. exposure to feedstuffs contaminated with the infectious agent. PMID:17014722

  12. A major genetic component of BSE susceptibility

    Directory of Open Access Journals (Sweden)

    Williams John L

    2006-10-01

    Full Text Available Abstract Background Coding variants of the prion protein gene (PRNP have been shown to be major determinants for the susceptibility to transmitted prion diseases in humans, mice and sheep. However, to date, the effects of polymorphisms in the coding and regulatory regions of bovine PRNP on bovine spongiform encephalopathy (BSE susceptibility have been considered marginal or non-existent. Here we analysed two insertion/deletion (indel polymorphisms in the regulatory region of bovine PRNP in BSE affected animals and controls of four independent cattle populations from UK and Germany. Results In the present report, we show that two previously reported 23- and 12-bp insertion/deletion (indel polymorphisms in the regulatory region of bovine PRNP are strongly associated with BSE incidence in cattle. Genotyping of BSE-affected and control animals of UK Holstein, German Holstein, German Brown and German Fleckvieh breeds revealed a significant overrepresentation of the deletion alleles at both polymorphic sites in diseased animals (P = 2.01 × 10-3 and P = 8.66 × 10-5, respectively. The main effect on susceptibility is associated with the 12-bp indel polymorphism. Compared with non-carriers, heterozygous and homozygous carriers of the 12-bp deletion allele possess relatively higher risks of having BSE, ranging from 1.32 to 4.01 and 1.74 to 3.65 in the different breeds. These values correspond to population attributable risks ranging from 35% to 53%. Conclusion Our results demonstrate a substantial genetic PRNP associated component for BSE susceptibility in cattle. Although the BSE risk conferred by the deletion allele of the 12-bp indel in the regulatory region of PRNP is substantial, the main risk factor for BSE in cattle is environmental, i.e. exposure to feedstuffs contaminated with the infectious agent.

  13. Dichotomy of major genes and polygenes

    International Nuclear Information System (INIS)

    Jain, S.

    1989-01-01

    In order to facilitate domestication and breeding of new or underexploited crop species, the genetic basis of many traits must be critically investigated, and both naturally occurring and induced mutations should be utilized. Classically, most breeding procedures have invoked the dichotomy of major genes versus polygenes (or discrete versus continuously varying traits) which is briefly reviewed here from several viewpoints. Clearly, the evidence for two distinct classes of genes (or gene effects on phenotype) and traits is largely a product of different forms of genetic analyses and their primary objectives as well as of researchers' expectations. Superimposed on the simplest Mendelian ratios and genome maps are numerous sources of molecular variation and gene expression at many levels of phenotypic description. Many attempts to delineate developmental pathways and to identify genes controlling discrete vs. quantitative phenotypic variation have resulted in emphasis on multigenic models with specific gene effects at mappable loci but nonetheless modified by small effects. Thus, quantitative genetic variation may arise from multi-genic and multi-allelic systems of both structural and regulatory gene action and gene interactions which, from an empirical breeding perspective, might be adequately described by the biometrical and evolutionary models. Polygenic analyses were conceptually based on genetic parameters in these models (as caricatures of reality) but efforts to modify or reject them by identifying and mapping sources of phenotypic variation through newer genetic methods are likely to enrich and not displace biometrical methods. Domestication programmes, in particular, should employ the entire array of genetic discoveries and methodologies. (author). 71 refs, 1 fig., 1 tab

  14. Major depression and secondhand smoke exposure.

    Science.gov (United States)

    Patten, Scott B; Williams, Jeanne V A; Lavorato, Dina H; Woolf, Benjamin; Wang, Jian Li; Bulloch, Andrew G M; Sajobi, Tolulope

    2018-01-01

    Epidemiological studies have consistently linked smoking to poor mental health. Among non-smokers, some studies have also reported associations between secondhand smoke exposure and psychological symptoms. However, an association between secondhand smoke exposure and depressive disorders has not been well established. This analysis used cross-sectional data from a series of 10 population surveys conducted in Canada between 2003 and 2013. The surveys targeted the Canadian household population, included a brief structured interview for past year major depressive episode (MDE) and included items assessing secondhand smoke exposure. We used two-stage individual-level random-effects meta-regression to synthesize results from these surveys. Over the study interval, about 20% of non-smokers reported substantial exposure to secondhand smoke. In this group, the pooled annual prevalence of MDE was 6.1% (95% CI 5.3-6.9) compared to 4.0% (95% CI 3.7-4.3) in non-smokers without secondhand smoke exposure. The crude odds ratio was 1.5 (95% CI 1.4-1.7). With adjustment for a set of potential confounding variables the odds ratio was unchanged, 1.4 (95% CI 1.2 - 1.6). These results provide additional support for public health measures aimed at reducing secondhand smoke exposure. A causal connection between secondhand smoke exposure and MDEs cannot be confirmed due to the cross-sectional nature of the data. Longitudinal studies are needed to establish temporal sequencing. Copyright © 2017 Elsevier B.V. All rights reserved.

  15. Major advances in fundamental dairy cattle nutrition.

    Science.gov (United States)

    Drackley, J K; Donkin, S S; Reynolds, C K

    2006-04-01

    Fundamental nutrition seeks to describe the complex biochemical reactions involved in assimilation and processing of nutrients by various tissues and organs, and to quantify nutrient movement (flux) through those processes. Over the last 25 yr, considerable progress has been made in increasing our understanding of metabolism in dairy cattle. Major advances have been made at all levels of biological organization, including the whole animal, organ systems, tissues, cells, and molecules. At the whole-animal level, progress has been made in delineating metabolism during late pregnancy and the transition to lactation, as well as in whole-body use of energy-yielding substrates and amino acids for growth in young calves. An explosion of research using multicatheterization techniques has led to better quantitative descriptions of nutrient use by tissues of the portal-drained viscera (digestive tract, pancreas, and associated adipose tissues) and liver. Isolated tissue preparations have provided important information on the interrelationships among glucose, fatty acid, and amino acid metabolism in liver, adipose tissue, and mammary gland, as well as the regulation of these pathways during different physiological states. Finally, the last 25 yr has witnessed the birth of "molecular biology" approaches to understanding fundamental nutrition. Although measurements of mRNA abundance for proteins of interest already have provided new insights into regulation of metabolism, the next 25 yr will likely see remarkable advances as these techniques continue to be applied to problems of dairy cattle biology. Integration of the "omics" technologies (functional genomics, proteomics, and metabolomics) with measurements of tissue metabolism obtained by other methods is a particularly exciting prospect for the future. The result should be improved animal health and well being, more efficient dairy production, and better models to predict nutritional requirements and provide rations to meet

  16. Photoinactivation of major bacterial pathogens in aquaculture

    Directory of Open Access Journals (Sweden)

    Heyong Jin Roh

    2016-08-01

    Full Text Available Abstract Background Significant increases in the bacterial resistance to various antibiotics have been found in fish farms. Non-antibiotic therapies for infectious diseases in aquaculture are needed. In recent years, light-emitting diode technology has been applied to the inactivation of pathogens, especially those affecting humans. The purpose of this study was to assess the effect of blue light (wavelengths 405 and 465 nm on seven major bacterial pathogens that affect fish and shellfish important in aquaculture. Results We successfully demonstrate inactivation activity of a 405/465-nm LED on selected bacterial pathogens. Although some bacteria were not fully inactivated by the 465-nm light, the 405-nm light had a bactericidal effect against all seven pathogens, indicating that blue light can be effective without the addition of a photosensitizer. Photobacterium damselae, Vibrio anguillarum, and Edwardsiella tarda were the most susceptible to the 405-nm light (36.1, 41.2, and 68.4 J cm−2, respectively, produced one log reduction in the bacterial populations, whereas Streptococcus parauberis was the least susceptible (153.8 J cm−2 per one log reduction. In general, optical density (OD values indicated that higher bacterial densities were associated with lower inactivating efficacy, with the exception of P. damselae and Vibrio harveyi. In conclusion, growth of the bacterial fish and shellfish pathogens evaluated in this study was inactivated by exposure to either the 405- or 465-nm light. In addition, inactivation was dependent on exposure time. Conclusions This study presents that blue LED has potentially alternative therapy for treating fish and shellfish bacterial pathogens. It has great advantages in aspect of eco-friendly treating methods differed from antimicrobial methods.

  17. Generalized Anxiety and Major Depressive syndrome ...

    Science.gov (United States)

    Objective: Environmental exposure to manganese (Mn) may cause generalized anxiety (GA) and major depression (MD) in residents living in Mn-exposed areas. Marietta and East Liverpool are two Ohio towns identified as having elevated levels of Mn. The objective was to determine if levels of Mn exposure were associated with levels of GA and MD.Participants and methods: 186 participants (Mean age: 55.0 ± 10.80) were examined. Levels of air-Mn were assessed over a period of ten years using U.S. EPA’s AERMOD dispersion model. Average air-Mn exposure was 0.53 μg/m3 in the two towns. The GA syndrome was comprised of anxiety, obsessive-compulsive, and phobic scales from the Symptom Checklist (SCL-90-R). The MD syndrome was comprised of depression, anxiety, and psychoticism scales also from the SCL-90-R. Linear regression models were used to determine the relationship between Mn and GA, MD and the specific components of each.Results: Elevated air-Mn was associated with GA (β= 0.240, p=0.002), and MD (β= 0.202, p=0.011). Air-Mn was associated with specific components of GA anxiety (β= 0.255, p=0.001), phobic anxiety (β= 0.159, p=0.046), and obsessive-compulsive (β= 0.197, p=0.013). Similarly, components of MD syndrome suggested an association as well: depression (β= 0.180, p=0.023), anxiety (β= 0.255, p=0.001), and psychoticism (β= 0.188, p=0.018). Conclusions: The results suggest that residents with elevated exposure to environmental Mn have elevated levels of

  18. Performance profiles of major energy producers 1995, January 1997

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-02-01

    This publication examines developments in the operations of the major U.S. energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area.

  19. Performance profiles of major energy producers 1995, January 1997

    International Nuclear Information System (INIS)

    1997-01-01

    This publication examines developments in the operations of the major U.S. energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area

  20. A New Majority: Low Income Students Now a Majority in the Nation's Public Schools. Research Bulletin

    Science.gov (United States)

    Southern Education Foundation, 2015

    2015-01-01

    For the first time in recent history, a majority of the schoolchildren attending the nation's public schools come from low income families. The latest data collected from the states by the National Center for Education Statistics (NCES), evidence that 51 percent of the students across the nation's public schools were low income in 2013. The…

  1. Major Difference: An Examination of Student Writing Performance by Major and Its Implications for Business Communication

    Science.gov (United States)

    Sigmar, Lucia S.; Hynes, Geraldine E.

    2012-01-01

    This study analyzes the writing performance levels of 352 students to determine the extent to which business students are achieving written communication competency and whether differences exist among the business majors. Although most students met or exceeded expectations in format and content on a common writing task, students were weakest in…

  2. Majoring in Information Systems: Reasons Why Students Select (or Not) Information Systems as a Major

    Science.gov (United States)

    Snyder, Johnny; Slauson, Gayla Jo

    2014-01-01

    Filling the pipeline for information systems workers is critical in the information era. Projected growth rates for jobs requiring information systems expertise are significantly higher than the projected growth rates for other jobs. Why then do relatively few students choose to major in information systems? This paper reviews survey results from…

  3. Teleneonatology: a major tool for the future.

    Science.gov (United States)

    Minton, Stephen; Allan, Mark; Valdes, Wesley

    2014-02-01

    Hospitals have, for centuries, maintained a central position in the health care system, providing care for critically ill patients. Despite being a cornerstone of health care delivery, we are witnessing the beginning of a major transformation in their function. There are several forces driving this transformation, including health care costs, shortage of health care professionals, volume of people with chronic diseases, consumerism, health care reform, and hospital errors. The neonatal intensive care unit (NICU) at Utah Valley Regional Medical Center in Provo, Utah, began an aggressive redesign/quality improvement effort in 1990. It became obvious that our care processes were designed for health care deliverers and not for the families. An ongoing revamp of our care delivery processes was undertaken using significant input from a parent focus meeting, parental interviews, and development of a parent-to-parent support group. As a result of this work, it became obvious we needed a new model to truly empower parents. The idea of "NICU is Home" was born. We elected to make a mind shift, not to focus on what families think, but rather on how they think. Web cams and other video apparatus have been used in a number of NICUs across the country. We decided our equipment requirements would need to include high-resolution cameras, full high-definition video recording, autofocus, audio microphones, automatic noise reduction, and automatic low-light correction. Our conferencing software needed to accommodate multiple users and have multiple-picture capabilities, low band width, and inexpensive technology. It was recognized that a single video camera feed was insufficient to adequately capture the desired amount of information. Verbal communication between parents and their babies' principal care providers is critical. Parents loved the idea of expanding the remote NICU web cam of their baby to a two-way physician-parent communication bedside monitor. Doctors at Utah Valley

  4. 2016 Status Report on Major Equipment Procurement

    Directory of Open Access Journals (Sweden)

    David Perry

    2017-09-01

    Full Text Available The Department of National Defence made some progress in procurement in 2016 despite obstacles that included a continued drop in spending, the advent of a new federal Liberal government and uncertainty over the outcome of the Defence Policy Review. Four trends affected defence acquisitions in 2016. These include an ongoing slippage in recapitalizing the Canadian Armed Forces, some encouraging moves made on the shipbuilding and fighter jet files, mixed progress on implementing the 2014 Defence Procurement Strategy, and uncertainty over the Defence Policy Review. It is also too early to tell how the Trudeau government’s Policy on Results, known as the “deliverology” approach, will play out for defence procurement. However, Budget 2016’s major focus was not on defence, and it shifted some funding for capital equipment to a new endpoint of 2045. This suggests that delay in the overall defence procurement program continues. While the Liberals kept their pledge to make investment in the Royal Canadian Navy a priority, they also made good last year on a negative promise – not to purchase the F-35 stealth fighter bomber. However, further slowing things is the Liberals’ refusal to launch a competition to replace it until the Defence Policy Review is published. The government has made this situation more fraught with its intention to buy 18 Boeing Super Hornet fighter jets as interim aircraft, since Liberal policy requires the Royal Canadian Air Force to be capable of meeting both NORAD’s and NATO’s operational needs simultaneously. Prior to the release of the new defence policy, both the interim and permanent fighter aircraft projects lacked adequate funding. They were among several large projects that have been approved, but have not yet moved to the contract stage, and whose budgets were inadequate to move forward. Adding to this mix is the fact that a government-wide effort initiated in 2014 to streamline the defence procurement

  5. Major advances in applied dairy cattle nutrition.

    Science.gov (United States)

    Eastridge, M L

    2006-04-01

    Milk yield per cow continues to increase with a slower rate of increase in dry matter intake; thus, efficiency of ruminal fermentation and digestibility of the dietary components are key factors in improving the efficiency of feed use. Over the past 25 yr, at least 2,567 articles relating to ruminant or dairy nutrition have been published in the Journal of Dairy Science. These studies have provided important advancements in improving feed efficiency and animal health by improving quality of feeds, increasing feedstuff and overall diet digestibility, better defining interactions among feedstuffs in diets, identifying alternative feed ingredients, better defining nutrient requirements, and improving efficiency of ruminal fermentation. The publications are vital in continuing to make advancements in providing adequate nutrition to dairy cattle and for facilitating exchange of knowledge among scientists. Forages have been studied more extensively than any other type of feed. Cereal grains continue to be the primary contributors of starch to diets, and thus are very important in meeting the energy needs of dairy cattle. Processing of cereal grains has improved their use. Feeding by-products contributes valuable nutrients to diets and allows feedstuffs to be used that would otherwise be handled as wastes in landfills. Many of these by-products provide a considerable amount of protein, nonforage fiber, fat, and minerals (sometimes a detriment as in the case of P) to diets. The primary feeding system today is the total mixed ration, with still considerable use of the pasture system. Major improvements have occurred in the use of protein, carbohydrates, and fats in diets. Although advancements have been made in feeding practices to minimize the risk of metabolic diseases, the periparturient period continues to present some of the greatest challenges in animal health. Computers are a must today for diet formulation and evaluation, but fewer software programs are developed by

  6. Keynote on lessons from major radiation accidents

    International Nuclear Information System (INIS)

    Ortiz, P.; Oresegun, M.; Wheatley, J.

    2000-01-01

    Generic lessons have been learned from a relatively large number of accidents in the most relevant practices (a set of analysis have been made on about 90 radiotherapy events, 43 industrial radiography and nine from industrial irradiations); more specific lessons have been drawn from in-depth investigations of individual accidents. The body of knowledge is grouped as follows: a) radiotherapy is very unique in that humans (patients) are purposely given very high radiation doses (20-75 Gy) by placing them in the radiation beam or by placing radioactive sources in contact with tissues. Intended deterministic effects are the essence of the normal radiotherapy practice and relatively small deviation from the intended doses, i.e,, slightly higher or lower than intended may cause increased rate of severe complication or reduce probability of cure. Consequences of major accidents have been devastating, affecting tens, even hundreds of patients and causing death (directly or indirectly) to a large number of them; b) accidents involving industrial radiography are the most frequent cause of overexposure to workers (radiographers); c) accidents with industrial irradiators have lower probability of occurrence, however, they are deemed to be fatal, especially when whole body exposure to panoramic gamma irradiators occur; partial body irradiation from industrial or research accelerator beams has led to amputation of hands and legs; d) when control of sources was relinquished ('orphan' sources) this has resulted in severe injuries, in some cases death and widespread contamination of the environment. A tool for further dissemination of lessons will be an international reporting system of unusual radiation events (RADEV), being introduced world-wide. Accidents were rarely due to a single human error or isolated equipment failure. In most cases there was a combination of elements such as: a) unawareness of the potential for an accident, b) poor education, which usually did not

  7. Mammography screening: A major issue in medicine.

    Science.gov (United States)

    Autier, Philippe; Boniol, Mathieu

    2018-02-01

    Breast cancer mortality is declining in most high-income countries. The role of mammography screening in these declines is much debated. Screening impacts cancer mortality through decreasing the incidence of number of advanced cancers with poor prognosis, while therapies and patient management impact cancer mortality through decreasing the fatality of cancers. The effectiveness of cancer screening is the ability of a screening method to curb the incidence of advanced cancers in populations. Methods for evaluating cancer screening effectiveness are based on the monitoring of age-adjusted incidence rates of advanced cancers that should decrease after the introduction of screening. Likewise, cancer-specific mortality rates should decline more rapidly in areas with screening than in areas without or with lower levels of screening but where patient management is similar. These two criteria have provided evidence that screening for colorectal and cervical cancer contributes to decreasing the mortality associated with these two cancers. In contrast, screening for neuroblastoma in children was discontinued in the early 2000s because these two criteria were not met. In addition, overdiagnosis - i.e. the detection of non-progressing occult neuroblastoma that would not have been life-threatening during the subject's lifetime - is a major undesirable consequence of screening. Accumulating epidemiological data show that in populations where mammography screening has been widespread for a long time, there has been no or only a modest decline in the incidence of advanced cancers, including that of de novo metastatic (stage IV) cancers at diagnosis. Moreover, breast cancer mortality reductions are similar in areas with early introduction and high penetration of screening and in areas with late introduction and low penetration of screening. Overdiagnosis is commonplace, representing 20% or more of all breast cancers among women invited to screening and 30-50% of screen

  8. Major intrinsic proteins (MIPs) in plants: a complex gene family with major impacts on plant phenotype.

    Science.gov (United States)

    Forrest, Kerrie L; Bhave, Mrinal

    2007-10-01

    The ubiquitous cell membrane proteins called aquaporins are now firmly established as channel proteins that control the specific transport of water molecules across cell membranes in all living organisms. The aquaporins are thus likely to be of fundamental significance to all facets of plant growth and development affected by plant-water relations. A majority of plant aquaporins have been found to share essential structural features with the human aquaporin and exhibit water-transporting ability in various functional assays, and some have been shown experimentally to be of critical importance to plant survival. Furthermore, substantial evidence is now available from a number of plant species that shows differential gene expression of aquaporins in response to abiotic stresses such as salinity, drought, or cold and clearly establishes the aquaporins as major players in the response of plants to conditions that affect water availability. This review summarizes the function and regulation of these genes to develop a greater understanding of the response of plants to water insufficiency, and particularly, to identify tolerant genotypes of major crop species including wheat and rice and plants that are important in agroforestry.

  9. Absolutism versus Relativism: Philosophies of Education and Business Majors.

    Science.gov (United States)

    Deering, Thomas S.; And Others

    1994-01-01

    Results of the administration of Forsyth's Ethics Position Questionnaire to 20 student teachers, 20 experienced teachers, and 24 business majors were as follows: education majors and teachers were more idealistic and less relativistic than business majors; business majors showed significant disparity among themselves. Implications for the…

  10. Satisfaction with College Major: A Grounded Theory Study

    Science.gov (United States)

    Milsom, Amy; Coughlin, Julie

    2015-01-01

    All college students must eventually choose and complete a major. Many switch majors, and some change it multiple times. Despite extensive literature addressing factors that influence students' initial choice of major, few scholars have examined students' experiences after enrollment in a selected major. In this study, we used a grounded theory…

  11. A Student's Guide to Einstein's Major Papers

    International Nuclear Information System (INIS)

    Janssen, Michel

    2013-01-01

    The core of this volume is formed by four chapters (2–5) with detailed reconstructions of the arguments and derivations in four of Einstein's most important papers, the three main papers of his annus mirabilis 1905 (on the light quantum, Brownian motion, and special relativity) and his first systematic exposition of general relativity of 1916. The derivations are given in sufficient detail and in sufficiently modernized notation (without any serious distortion of the originals) for an undergraduate physics major to read and understand them with far less effort than it would take him or her to understand (English translations of) Einstein's original papers. Each of these four papers is accompanied by a detailed introduction, which covers the conceptual development of the relevant field prior to Einstein's contribution to it and corrects some of the myths surrounding these papers that still have not been fully eradicated among physicists. (One quibble: though Kennedy correctly points out that the goal of the light quantum paper was not to explain the photoelectric effect, it is also not quite right to say that 'it was written to explain the Wien region of blackbody radiation' (p. xv). Einstein used this explanatory feat as the central argument for his light quantum hypothesis.) These four chapters then are the most valuable part of the volume. They could be used, independently of one another, but preferably in conjunction with Einstein's original texts, in courses on quantum mechanics, statistical mechanics, electrodynamics, and general relativity, respectively, to add a historical component to such courses. As a historian of science embedded in a physics department who is regularly called upon to give guest lectures in such courses on the history of their subjects, I can highly recommend the volume for this purpose. However, I would not adopt this volume as (one of) the central text(s) for a course on the history of modern physics. For one thing, chapter 1, which

  12. Ursa Major: ot losya do medvedya %t Ursa Major: from elk to bear

    Science.gov (United States)

    Lushnikova, A. V.

    In the article material from various cultural and linguistic sources (Indo-European - Slavic, Indo-Iranian; Uralo-Altaic, Tungus, Ancient Egyptian, Babylonian) is used in order to trace up the chronology of the designation of Ursa Majopr, a constellation which has been playing an important role for people different regions since ancient times. It was used for observing of the visible yearly motion of the Sun, for working out seasonal changes; being a circumpolar and non-hiding behind the horizon it has been perceived as a symbol of immortality, its peculiar positional change during a year lay down in plot of the Uralo-Siberian myths about a cosmic hunt for the Elk, myths about deluge. Data from Uralo-Siberian mythology are analyzed. Designations of Ursa Major in the form of a horned hoofed animal such as elk, deer, cow (Uralo-Altaic, Tungus, Slavic, Indo-Iranian languages; Ancient Greece, Crete, Ancient Egypt) and connected with it (or derived from it) denominations and images of "enclosed space" - "vehicle for travelling and carrying goods" (a wagon, a boat) - "instrument for hunting-fishing, a ritual thing" - "household construction" are taken in consideration. The conclusion is made that the transition of the Ursa Major designation from elk to bear could follow the general tendency to shift from so-called matriarchy to patriarchy, to substitute female deities with male ones, which was reflected "in the rise" of the predatory animal cults (not earlier than II mil. B.C.). To prove this, lexical examples of resemblance and coincidences in designation of homed hoofed (elk, deer) and predatory (bear, wolf) animals should be analyzed. Such a goal-directed investigation of the chronology of Ursa Major designations has never been carried out.

  13. Major workplace related accidents in Singapore: A major trauma centre's experience.

    Science.gov (United States)

    Ng, Zhi Xu; Teo, Li Tserng; Go, Karen T S; Yeo, Yen Teng; Chiu, Ming Terk

    2010-12-01

    Major workplace related accidents pose a significant healthcare resource challenge in Singapore. Our study looks at the epidemiology of patients who were admitted for workplace related accidents, in a single institution, with an Injury Severity Score of >9. There were 196 cases of major workplace related accidents admitted between January 2006 and December 2007. The median age of patients admitted was 37 years with a large percentage being males (95.4%) and non-residents (57.1%). The most common ethnic group was Chinese (53.1%) followed by Indians (23.5%). The most common mechanism of injury was fall from height (66.3%) followed by injuries as a result of falling objects at work (21.9%). The percentage of patients who required surgical intervention was 69.9%. Patients admitted for major workplace related accidents had a median length of stay of 5 days in the hospital, a median length of 24 days of medical leave (ML), certifying them unfit for duty and the average cost of stay for each patient was S$11,000. We have a better understanding of the epidemiology and socio-economic impact of workplace related accidents through this study. Workplace related accidents result in significant number of man-days lost from work and monetary cost to employers, medical insurance and the hospital. With an improved understanding, we propose methods to prevent and reduce such accidents in future. A direct consequence of which will be the possible reduction of hospitalisation costs and better allocation of healthcare resources in the future.

  14. Domingo de Ramos, dalla violenza urbana alla solidarietà marginale

    Directory of Open Access Journals (Sweden)

    Riccardo Badini

    2016-12-01

    Full Text Available The article aims to analyze the poetry of Domingo de Ramos (Peru 1960 through themes like violence, urban decay and migration and presents the translation of an unpublished poem. A path is traced from the vanguards to the socio historical and political context of the  80s Peru, not to mention the innate inclination of the poet for marginal realities.

  15. TAMIZAJE CERVICOUTERINO USANDO PAPANICOLAOU EN MUJERES DE BARRIOS MARGINALES DE LA REGION LORETO

    Directory of Open Access Journals (Sweden)

    Carmen Nuñez-Rengifo

    2011-07-01

    Full Text Available La presente investigación, tiene como objetivo conocer la frecuencia de las mujeres portadoras de lesiones producidas por la infección con Papiloma Virus Humano en las zonas y lugares de difícil acceso geográfico en la región Loreto, donde escasean los recursos y las posibilidades de acceder al servicio de salud sexual y reproductiva son difíciles. Se usó para ello la prueba de Papanicolaou como tamizaje de dichas lesiones. Con ello se pretende reforzar la gestión para la obtención de vacunas contra el PVH, para la nueva generación de mujeres de Loreto; capacitación a los profesionales obstetras para reforzar el manejo en el tratamiento y reducción del cáncer de cuello uterino de la región Loreto. Este estudio tiene un Diseño descriptivo transversal. Se realizó teniendo como estratégica básica los Barridos de Papanicolaou entre los años 2008 y 2009. Se realizaron cientos de intervenciones, lográndose sensibilizar a 25,000 mujeres en Loreto, utilizando la estrategia de Promoción de la Salud, el perifoneo, volanteo, charlas educativas, 5,000 visitas domiciliarias, entre otras. De las 2000 mujeres estudiadas 348 tuvieron algún tipo de normalidad de las células epiteliales. En 45 casos se encontró lesiones intra epiteliales de alto grado ó carcinoma escamoso invasivo.

  16. EL CINE ESPAÑOL COMO FUENTE DOCUMENTAL PARA EL ESTUDIO DE LOS BARRIOS MARGINALES

    Directory of Open Access Journals (Sweden)

    Aramis López Juan

    2008-01-01

    Full Text Available El cine como arte nuevo y técnico se instala en una sociedad moderna que tiene una percepción del mundo basada en la imagen. El cine y la fotografía son los introductores de esta modalidad perceptiva de la modernidad. Esta experiencia sensorial sitúa al hombre en un universo más amplio. El hombre contemporáneo comprende los mecanismos representativos del cine, sus códigos, sus metáforas e iconos. El cine ha nacido al mismo tiempo que los abuelos de los espectadores actuales, ha crecido con sus padres, y es conocido y comprendido universalmente

  17. Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina

    Directory of Open Access Journals (Sweden)

    Alonso, R.

    1989-04-01

    Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en un momento dado de las aguas freáticas de los abanicos aluviales por aguas termales ricas en sílice, propiciaría junto con la evaporización la precipitación de la silíceo Los nódulos silíceos crecerían desplazando el sedimento terrígeno que constituye la roca caja o reemplazando nódulos previa de ulexita.

  18. Maras y barras : Pandillas y violencia juvenil en los barrios marginales de Centroamérica

    NARCIS (Netherlands)

    Savenije, W.

    2009-01-01

    Street gangs -especially ‘Mara Salvatrucha’ [MS] and 18th Street Gang [18]- and student gangs are feared throughout Central America. This study looks at the violent and criminal acts they engage in, the attraction they hold over other young people, the solidarity among their members, and the

  19. Optimization of fuel cycles: marginal loss values; Optimisation des cycles de combustibles: valeurs marginales des pertes

    Energy Technology Data Exchange (ETDEWEB)

    Gaussens, J [Commissariat a l' Energie Atomique, 75 - Paris (France); Lasteyrie, B de; Doumerc, J [Compagnie pour l' Etude et la Realisation de Combustibles Atomiques, 75 - Paris (France)

    1965-07-01

    Uranium processing from the pit to the fuel element rod entails metal losses at every step. These losses become more and more expensive with the elaboration of the metal. Some of the uranium must be accepted as definitely lost whilst the rest could be recovered and recycled. The high cost of these losses, whether they are recycled or not, and the fact that the higher the enrichment is the higher their costs are, make it necessary to take them into account when optimizing fuel cycles. It is therefore felt important to determine their most desirable level from an economic point of view at the various nuclear fuel processing stages. However, in France as in some other countries, fissile material production is a state concern, whilst fuel element fabrication is carried out by private enterprise. Optimization criteria and the economic value of losses are therefore different for each of the two links in the fabrication chain. One can try in spite of this to reach an optimum which would conform to public interest, without interfering with the firm's sales policy. This entails using the fact that for a given output marginal costs are equal at the optimum. One can therefore adjust the level of the losses to attain this equation of marginal costs, as these are easier to obtain from the firm than a justification of the actual prices. One notices moreover that, although mainly concerned with losses, this global analysis can bring both the state and the firm to a better use of other production factors. An account is given of the theory of this economic optimization method and practical applications in the field of natural uranium-graphite moderated and CO{sub 2} cooled reactor fuel element fabrication are offered. (authors) [French] L'elaboration de l'uranium, de la mine a la cartouche d'element combustible, s'accompagne, a tous les stades, de pertes, de plus en plus onereuses, a mesure que le metal devient plus elabore. Une certaine proportion de l'uranium doit etre consideree comme definitivement perdue, alors que le reste pourrait etre recupere et recycle. Le cout eleve des pertes, recyclees ou non, d'autant plus eleve que l'uranium est plus enrichi, exige qu'il en soit tenu compte dans l'optimisation generale des cycles de combustible. Il importe donc de determiner leur niveau le plus souhaitable economiquement, aux diverses etapes d'elaboration du combustible nucleaire. Mais en France et dans d'autres pays, la production de matieres fissiles est geree par l'Etat, tandis que la fabrication de l'element combustible est effectuee par l'industrie privee. Les criteres d'optimisation et l'interet economique accorde aux pertes sont donc differents pour les deux parties de la chaine de fabrication. Pour tenter neanmoins d'atteindre un optimum conforme a l'interet collectif sans intervenir dans la politique de prix de l'entreprise, on peut utiliser la propriete des couts marginaux d'etre egaux entre eux a l'optimum, pour un volume de production donne. On peut donc ajuster le niveau des pertes pour realiser cette egalite des couts marginaux dont le calcul est plus facile a obtenir de la firme que la justification des prix eux-memes. On s'apercoit d'ailleurs que, bien qu'axee essentiellement sur les pertes, cette analyse globale peut conduire a une meilleure utilisation d'autres facteurs de production. On donne un expose theorique et des exemples pratiques de cette methode d'optimisation economique dans le cadre de la fabrication d'elements combustibles destines a des reacteurs du type: uranium naturel, moderes au graphite et refroidis par le gaz carbonique. (auteurs)

  20. TAMIZAJE CERVICOUTERINO USANDO PAPANICOLAOU EN MUJERES DE BARRIOS MARGINALES DE LA REGION LORETO

    Directory of Open Access Journals (Sweden)

    Carmen Nuñez Rengifo

    2011-06-01

    Full Text Available La presente investigación, tiene como objetivo conocer la frecuencia de las mujeres portadoras de lesiones producidas por la infección con Papiloma Virus Humano en las zonas y lugares de difícil acceso geográfico en la región Loreto, donde escasean los recursos y las posibilidades de acceder al servicio de salud sexual y reproductiva son difíciles. Se usó para ello la prueba de Papanicolaou como tamizaje de dichas lesiones. Con ello se pretende reforzar la gestión para la obtención de vacunas contra el PVH, para la nueva generación de mujeres de Loreto; capacitación a los profesionales obstetras para reforzar el manejo en el tratamiento y reducción del cáncer de cuello uterino de la región Loreto. Este estudio tiene un Diseño descriptivo transversal. Se realizó teniendo como estratégica básica los Barridos de Papanicolaou entre los años 2008 y 2009. Se realizaron cientos de intervenciones, lográndose sensibilizar a 25,000 mujeres en Loreto, utilizando la estrategia de Promoción de la Salud, el perifoneo, volanteo, charlas educativas, 5,000 visitas domiciliarias, entre otras. De las 2000 mujeres estudiadas 348 tuvieron algún tipo de normalidad de las células epiteliales. En 45 casos se encontró lesiones intra epiteliales de alto grado ó carcinoma escamoso invasivo.

  1. Optimization of fuel cycles: marginal loss values; Optimisation des cycles de combustibles: valeurs marginales des pertes

    Energy Technology Data Exchange (ETDEWEB)

    Gaussens, J. [Commissariat a l' Energie Atomique, 75 - Paris (France); Lasteyrie, B. de; Doumerc, J. [Compagnie pour l' Etude et la Realisation de Combustibles Atomiques, 75 - Paris (France)

    1965-07-01

    Uranium processing from the pit to the fuel element rod entails metal losses at every step. These losses become more and more expensive with the elaboration of the metal. Some of the uranium must be accepted as definitely lost whilst the rest could be recovered and recycled. The high cost of these losses, whether they are recycled or not, and the fact that the higher the enrichment is the higher their costs are, make it necessary to take them into account when optimizing fuel cycles. It is therefore felt important to determine their most desirable level from an economic point of view at the various nuclear fuel processing stages. However, in France as in some other countries, fissile material production is a state concern, whilst fuel element fabrication is carried out by private enterprise. Optimization criteria and the economic value of losses are therefore different for each of the two links in the fabrication chain. One can try in spite of this to reach an optimum which would conform to public interest, without interfering with the firm's sales policy. This entails using the fact that for a given output marginal costs are equal at the optimum. One can therefore adjust the level of the losses to attain this equation of marginal costs, as these are easier to obtain from the firm than a justification of the actual prices. One notices moreover that, although mainly concerned with losses, this global analysis can bring both the state and the firm to a better use of other production factors. An account is given of the theory of this economic optimization method and practical applications in the field of natural uranium-graphite moderated and CO{sub 2} cooled reactor fuel element fabrication are offered. (authors) [French] L'elaboration de l'uranium, de la mine a la cartouche d'element combustible, s'accompagne, a tous les stades, de pertes, de plus en plus onereuses, a mesure que le metal devient plus elabore. Une certaine proportion de l'uranium doit etre consideree comme definitivement perdue, alors que le reste pourrait etre recupere et recycle. Le cout eleve des pertes, recyclees ou non, d'autant plus eleve que l'uranium est plus enrichi, exige qu'il en soit tenu compte dans l'optimisation generale des cycles de combustible. Il importe donc de determiner leur niveau le plus souhaitable economiquement, aux diverses etapes d'elaboration du combustible nucleaire. Mais en France et dans d'autres pays, la production de matieres fissiles est geree par l'Etat, tandis que la fabrication de l'element combustible est effectuee par l'industrie privee. Les criteres d'optimisation et l'interet economique accorde aux pertes sont donc differents pour les deux parties de la chaine de fabrication. Pour tenter neanmoins d'atteindre un optimum conforme a l'interet collectif sans intervenir dans la politique de prix de l'entreprise, on peut utiliser la propriete des couts marginaux d'etre egaux entre eux a l'optimum, pour un volume de production donne. On peut donc ajuster le niveau des pertes pour realiser cette egalite des couts marginaux dont le calcul est plus facile a obtenir de la firme que la justification des prix eux-memes. On s'apercoit d'ailleurs que, bien qu'axee essentiellement sur les pertes, cette analyse globale peut conduire a une meilleure utilisation d'autres facteurs de production. On donne un expose theorique et des exemples pratiques de cette methode d'optimisation economique dans le cadre de la fabrication d'elements combustibles destines a des reacteurs du type: uranium naturel, moderes au graphite et refroidis par le gaz carbonique. (auteurs)

  2. Infecção natural por hemoparasitos em bezerros submetidos à quimio-profilaxia aos 30 dias de idade Natural infection by hemoparasites in calves submitted to chemo -prophylaxis wonder 30 days of age

    Directory of Open Access Journals (Sweden)

    Rosângela A. Da Silva

    2007-09-01

    Full Text Available O complexo Tristeza Parasitária acarreta grandes prejuízos à pecuária bovina nacional. Os principais agentes etiológicos são Babesia bigemina, B. bovis e Anaplasma marginale, sendo o carrapato Boophilus microplus o principal vetor. Este trabalho relata a ocorrência de infecção natural por hemoparasitos da tristeza parasitária bovina em 36 bezerros com alta infestação natural por carrapatos e submetidos à quimioprofilaxia aos 30 dias de idade. Babesia bigemina (33,3%, B. bovis (11,1% e A. marginale (13,9% foram detectados em esfregaços sangüíneos de 16 animais (44,4% de diferentes idades. Seis bezerros apresentaram sintomas (16,7% e um morreu (2,8%. O número de casos clínicos foi decorrente de uma associação de fatores, destacando-se a alta infestação precoce por carrapatos e a baixa imunidade passiva em período em que os bezerros ainda não haviam desenvolvido imunidade ativa suficiente.The tick-borne disease (TBD brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%, B. bovis (11.1% and A. marginale (13.9%. Six animals had clinical symptoms (16.7% and one dead (2.8%. The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

  3. 75 FR 8099 - North Carolina; Major Disaster and Related Determinations

    Science.gov (United States)

    2010-02-23

    ... amended, Michael Bolch, of FEMA is appointed to act as the Federal Coordinating Officer for this major... this major disaster: Alleghany, Ashe, Avery, Buncombe, Burke, Caldwell, Haywood, Jackson, Madison...

  4. 14 CFR 313.4 - Major regulatory actions.

    Science.gov (United States)

    2010-01-01

    ...) PROCEDURAL REGULATIONS IMPLEMENTATION OF THE ENERGY POLICY AND CONSERVATION ACT § 313.4 Major regulatory... of actions shall not be deemed as major regulatory actions requiring an energy statement: (1) Tariff...

  5. 78 FR 45548 - South Dakota; Major Disaster and Related Determinations

    Science.gov (United States)

    2013-07-29

    ... President issued a major disaster declaration under the authority of the Robert T. Stafford Disaster Relief... warrant a major disaster declaration under the Robert T. Stafford Disaster Relief and Emergency Assistance...; 97.048, Disaster Housing Assistance to [[Page 45549

  6. 34 CFR 691.17 - Determination of eligible majors.

    Science.gov (United States)

    2010-07-01

    ... ACCESS TO RETAIN TALENT GRANT (NATIONAL SMART GRANT) PROGRAMS Application Procedures § 691.17... list of eligible majors identified by CIP code. (d) Designation of an additional eligible major. (1... include— (i) The CIP code and program title of the additional major; (ii) The reason or reasons the...

  7. The Viability of the English Major in the Current Economy

    Science.gov (United States)

    Hiner, Amanda

    2012-01-01

    In an April, 2012 Wall Street Journal article titled "Wealth or Waste? Rethinking the Value of a Business Major," national reporter Melissa Korn explores an intriguing fact: the business major, the most popular major on college campuses for over 30 years and the discipline believed to be most economically viable by prospective college…

  8. The "Discouraged-Business-Major" Hypothesis: Policy Implications

    Science.gov (United States)

    Marangos, John

    2012-01-01

    This paper uses a relatively large dataset of the stated academic major preferences of economics majors at a relatively large, not highly selective, public university in the USA to identify the "discouraged-business-majors" (DBMs). The DBM hypothesis addresses the phenomenon where students who are screened out of the business curriculum often…

  9. 7 CFR 987.104 - Major marketing promotion.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Major marketing promotion. 987.104 Section 987.104... IN RIVERSIDE COUNTY, CALIFORNIA Administrative Rules Definitions § 987.104 Major marketing promotion. A major marketing promotion program is one requiring the expenditure of more than $500 of Committee...

  10. Gamification for Non-Majors Mathematics: An Innovative Assignment Model

    Science.gov (United States)

    Leong, Siow Hoo; Tang, Howe Eng

    2017-01-01

    The most important ingredient of the pedagogy for teaching non-majors is getting their engagement. This paper proposes to use gamification to engage non-majors. An innovative game termed as Cover the Hungarian's Zeros is designed to tackle the common weakness of non-majors mathematics in solving the assignment problem using the Hungarian Method.…

  11. Gender, Empathy, and the Choice of the Psychology Major

    Science.gov (United States)

    Harton, Helen C.; Lyons, Patrick C.

    2003-01-01

    We compared male and female psychology majors to psychology minors and nonmajors to understand the trends in a growing major in which women outnumber men. A total of 451 psychology majors, minors, and nonmajors from 4 institutions completed a questionnaire measuring empathy, career goals, and perceptions of the importance of empathy for therapy.…

  12. Starting an Actuarial Science Major at a Liberal Arts College

    Science.gov (United States)

    Mills, Mark A.

    2014-01-01

    The article provides details of the process of starting an actuarial science major at a small, liberal arts college. Some critique of the major is included, as well as some challenges that may be faced by others wanting to start such a major at their institution.

  13. 78 FR 67381 - New Mexico; Major Disaster and Related Determinations

    Science.gov (United States)

    2013-11-12

    .... FEMA-4152-DR; Docket ID FEMA-2013-0001] New Mexico; Major Disaster and Related Determinations AGENCY... declaration of a major disaster for the State of New Mexico (FEMA-4152-DR), dated October 29, 2013, and... dated October 29, 2013, the President issued a major disaster declaration under the authority of the...

  14. 76 FR 76171 - New Mexico; Major Disaster and Related Determinations

    Science.gov (United States)

    2011-12-06

    .... FEMA-4047-DR; Docket ID FEMA-2011-0001] New Mexico; Major Disaster and Related Determinations AGENCY... declaration of a major disaster for the State of New Mexico (FEMA-4047-DR), dated November 23, 2011, and... dated November 23, 2011, the President issued a major disaster declaration under the authority of the...

  15. 78 FR 64522 - New Mexico; Major Disaster and Related Determinations

    Science.gov (United States)

    2013-10-29

    .... FEMA-4148-DR; Docket ID FEMA-2013-0001] New Mexico; Major Disaster and Related Determinations AGENCY... declaration of a major disaster for the State of New Mexico (FEMA-4148-DR), dated September 30, 2013, and... dated September 30, 2013, the President issued a major disaster declaration under the authority of the...

  16. Selecting a Business Major within the College of Business

    Science.gov (United States)

    Roach, David W.; McGaughey, Ronald E.; Downey, James P.

    2012-01-01

    This study employed a survey in examining the important influences that shape a student's selection of a major in the College of Business (COB). In particular, it compared these influences, by major, to assess which items were most (and least) important to the students majoring in accounting, general business, finance, management, marketing, and…

  17. 47 CFR 76.51 - Major television markets.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 4 2010-10-01 2010-10-01 false Major television markets. 76.51 Section 76.51... CABLE TELEVISION SERVICE Carriage of Television Broadcast Signals § 76.51 Major television markets. For purposes of the cable television rules, the following is a list of the major television markets and their...

  18. 49 CFR 542.2 - Procedures for selecting low theft light duty truck lines with a majority of major parts...

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 6 2010-10-01 2010-10-01 false Procedures for selecting low theft light duty... TRUCK LINES TO BE COVERED BY THE THEFT PREVENTION STANDARD § 542.2 Procedures for selecting low theft... a low theft rate have major parts interchangeable with a majority of the covered major parts of a...

  19. Female STEM majors wanted: The impact of certain factors on choice of a college major

    Science.gov (United States)

    Conrad, Walter Michael

    Although females have made significant strides in educational achievements and substantial inroads into academic majors, such as business and medicine, they have made considerably less progress in the science, technology, engineering, and math (STEM) fields. This translates into a smaller number of female graduates prepared to work in the science career fields and results in American industry looking to other countries for its educated workforce. A mixed-methods research design was used to explore and understand the lived experiences and perceptions of faculty members and working STEM professionals in Northern and Central Virginia. Results indicated that although females are attaining STEM degrees and entering STEM fields in record numbers, obstacles such as a challenging STEM curriculum, bias, feelings of insecurity, lack of female role models, and inadequate preparation for the STEM workforce could impede the progress females have made. This research makes recommendations to the academic community and industry which may be used as retention and recruitment strategies for females considering a career in STEM. The ultimate goal is to significantly increase the number of highly skilled female graduates entering STEM fields, leading the U.S. to regain its previous position atop the world in technological innovation and leadership.

  20. THE COMPATIBILITY STUDENT CHOICE OF UNIVERSITY MAJORING; A PRELIMINARY STUDIES

    Directory of Open Access Journals (Sweden)

    Daharnis Daharnis

    2016-06-01

    Full Text Available The continuous improvements in order to optimize the basic education to higher education are still running. Based on that purpose, there are many factors to supporting the students' learning activities success; one of the factors is suitability with majors in university. The purpose of this study is to reveal the condition of the compatibility of students majoring with their interest, then to describe the information when the student choose their majoring. Samples in this study were 122 peoples, taken by random sampling from the Padang State University. Data obtained by distributing questionnaires. The results showed that there are students that their major do not match with their interest (22.13%, only 3.28% of students who feel compatible with their major. This result should be a major concern, particularly for counselor in schools for design counseling services to solve these problems. The result of this study used as a grand tour or a preliminary study for further research.

  1. TYPES OF LANGUAGE LEARNING STRATEGIES USED BY TERTIARY ENGLISH MAJORS

    OpenAIRE

    TAN KHYE CHUIN; SARJIT KAUR

    2015-01-01

    This study investigated the types of language learning strategies used by 73 English majors from the School of Humanities in Universiti Sains Malaysia. Using questionnaires adopted from Oxford’s (1990) Strategy Inventory of Language Learning (SILL) and focus group interviews, the study also examined the English major students’ perceptions of using language learning strategies while learning English. The results revealed that the English majors were generally high users of all six types of lan...

  2. Majority and minority influence: A dual role interpretation

    OpenAIRE

    de Vries, N.K.; de Dreu, C.; Gordijn, E.; Schuurman, M.

    1996-01-01

    This chapter offers an analysis of majority vs. minority influence using the Heuristic-Systematic Model of persuasion (HSM). We evaluate evidence for and against leading perspectives such as Conversion Theory. Next, research and theory is reviewed suggesting that majority vs. minority influence differentially affect the processing of persuasive arguments. A dual-role interpretation of majority and minority influence is presented. First, numerical support for discrepant messages affects the de...

  3. Increased transmission potential of Leishmania major/Leishmania infantum hybrids

    OpenAIRE

    Volf, Petr; Benkova, Ivana; Myskova, Jitka; Sadlova, Jovana; Campino, Lenea; Ravel, Christophe

    2007-01-01

    Development of Leishmania infantum/Leishmania major hybrids was studied in two sand fly species. In Phlebotomus papatasi, which supported development of L. major but not L. infantum, the hybrids produced heavy late-stage infections with high numbers of metacyclic promastigotes. In the permissive vector Lutzomyia longipalpis, all Leishmania strains included in this study developed well. Hybrids were found to express L. major lipophosphoglycan, apparently enabling them to survive in P. papatasi...

  4. 77 FR 69647 - New Jersey; Major Disaster and Related Determinations

    Science.gov (United States)

    2012-11-20

    ... designated as adversely affected by this major disaster: Atlantic, Cape May, Essex, Hudson, Middlesex, Monmouth, Ocean, and Union Counties for Individual Assistance. Atlantic, Cape May, Essex, Hudson, Middlesex...

  5. Semuloparin for prevention of venous thromboembolism after major orthopedic surgery

    DEFF Research Database (Denmark)

    Lassen, M R; Fisher, W; Mouret, P

    2012-01-01

    BACKGROUND: Semuloparin is a novel ultra-low-molecular-weight heparin under development for venous thromboembolism (VTE) prevention in patients at increased risk, such as surgical and cancer patients. OBJECTIVES: Three Phase III studies compared semuloparin and enoxaparin after major orthopedic...... was to be performed between days 7 and 11. The primary efficacy endpoint was a composite of any deep vein thrombosis, non-fatal pulmonary embolism or all-cause death. Safety outcomes included major bleeding, clinically relevant non-major (CRNM) bleeding, and any clinically relevant bleeding (major bleeding plus CRNM...

  6. Anaplasmose bovina: parâmetros clínicos e de patologia clínica em bezerros infectados experimentalmente.: parâmetros clínicos e de patologia clínica em bezerros infectados experimentalmente.

    OpenAIRE

    Leonardo Costa Tavares Coelho

    2007-01-01

    Avaliou-se o comportamento dos parâmetros de patologia clínica em cinco bezerros HPB, com idade entre 90 e 120 dias, inoculados com Anaplasma marginale. O período médio de incubação foi de 13 dias, a duração do período patente, quando foram realizadas as análises, foi de 14 dias e o período convalescente durou 10 dias. Foram avaliadas as alterações no equilíbrio ácido-básico, perfil eletrolítico, parâmetros bioquímicos e hematológicos. Os animais apresentaram anemia, inicialmente normocítica ...

  7. Why Are Students Not Majoring in Information Systems?

    Science.gov (United States)

    Walstrom, Kent A.; Schambach, Thomas P.; Jones, Keith T.; Crampton, William J.

    2008-01-01

    The purpose of this study was to examine some of the factors that influence and impact business students when they select their major and, more particularly, to examine why students are not majoring in information systems. Students in an entry level business class responded that they were more knowledgeable about careers in management, marketing,…

  8. The Opinions of Economics Majors before and after Learning Economics

    Science.gov (United States)

    Hammock, Michael R.; Routon, P. Wesley; Walker, Jay K.

    2016-01-01

    Using longitudinal data on undergraduates from 463 American colleges and universities from 1994-99, the authors examine how majoring in economics affects student opinions on 13 social, political, and economic issues. Economics majors were found to begin and end their college tenure with differing opinions on several issues when compared to other…

  9. Geographic Differences in the Earnings of Economics Majors

    Science.gov (United States)

    Winters, John V.; Xu, Weineng

    2014-01-01

    Economics has been shown to be a relatively high-earning college major, but geographic differences in earnings have been largely overlooked. The authors of this article use the American Community Survey to examine geographic differences in both absolute earnings and relative earnings for economics majors. They find that there are substantial…

  10. Proximity of US schools to major roadways: a nationwide assessment.

    Science.gov (United States)

    Kingsley, Samantha L; Eliot, Melissa N; Carlson, Lynn; Finn, Jennifer; MacIntosh, David L; Suh, Helen H; Wellenius, Gregory A

    2014-01-01

    Long-term exposure to traffic pollution has been associated with adverse health outcomes in children and adolescents. A significant number of schools may be located near major roadways, potentially exposing millions of children to high levels of traffic pollution, but this hypothesis has not been evaluated nationally. We obtained data on the location and characteristics of 114,644 US public and private schools, grades prekindergarten through 12, and calculated their distance to the nearest major roadway. In 2005-2006, 3.2 million students (6.2%) attended 8,424 schools (7.3%) located within 100 m of a major roadway, and an additional 3.2 million (6.3%) students attended 8,555 (7.5%) schools located 100-250 m from a major roadway. Schools serving predominantly Black students were 18% (95% CI, 13-23%) more likely to be located within 250 m of a major roadway. Public schools eligible for Title I programs and those with a majority of students eligible for free/reduced price meals were also more likely to be near major roadways. In conclusion, 6.4 million US children attended schools within 250 m of a major roadway and were likely exposed to high levels of traffic pollution. Minority and underprivileged children were disproportionately affected, although some results varied regionally.

  11. Academic search in response to major scientific events

    NARCIS (Netherlands)

    Li, X.; de Rijke, M.

    2017-01-01

    In this paper, we look at the search behavior of users of an academic search engine and in particular, their query patterns following the occurrence of major scientific events. We select Nobel Prize announcements as major scientific events and observe how academic searchers behave in response to

  12. Freshman Biology Majors' Misconceptions about Diffusion and Osmosis.

    Science.gov (United States)

    Odom, A. Louis; Barrow, Lloyd H.

    The data for this study were obtained from a sample of 117 biology majors enrolled in an introductory biology course. The Diffusion and Osmosis Diagnostic Test, composed of 12 two-tier items, was administered to the students. Among the major findings are: (1) there was no significant difference in scores of male and female students; (2) math…

  13. Assessment of major nuclear technologies with decision and risk analysis

    International Nuclear Information System (INIS)

    Winterfeldt, D. von

    1995-01-01

    Selecting technologies for major nuclear programs involves several complexities, including multiple stakeholders, multiple conflicting objectives, uncertainties, and risk. In addition, the programmatic risks related to the schedule, cost, and performance of these technologies often become major issues in the selection process. This paper describes a decision analysis approach for addressing these complexities in a logical manner

  14. Reconstruction of major bile duct injuries after laparoscopic cholecystectomy

    DEFF Research Database (Denmark)

    Holte, Kathrine; Bardram, Linda; Wettergren, André

    2010-01-01

    Bile duct injury (BDI) after cholecystectomy remains a serious complication with major implications for patient outcome. For most major BDIs, the recommended method of repair is a hepaticojejunostomy (HJ). We conducted a retrospective review aiming to examine the perioperative and the long...

  15. 76 FR 44029 - North Dakota; Major Disaster and Related Determinations

    Science.gov (United States)

    2011-07-22

    .... FEMA-1986-DR; Docket ID FEMA-2011-0001] North Dakota; Major Disaster and Related Determinations AGENCY... declaration of a major disaster for the State of North Dakota (FEMA-1986-DR), dated May 20, 2011, and related... determined that the damage in certain areas of the State of North Dakota resulting from a severe winter storm...

  16. 75 FR 62135 - South Dakota; Major Disaster and Related Determinations

    Science.gov (United States)

    2010-10-07

    .... FEMA-1938-DR; Docket ID FEMA-2010-0002] South Dakota; Major Disaster and Related Determinations AGENCY... Presidential declaration of a major disaster for the State of South Dakota (FEMA-1938-DR), dated September 23... South Dakota resulting from severe storms and flooding during the period of July 21-30, 2010, is of...

  17. 75 FR 30418 - South Dakota; Major Disaster and Related Determinations

    Science.gov (United States)

    2010-06-01

    .... FEMA-1914-DR; Docket ID FEMA-2010-0002] South Dakota; Major Disaster and Related Determinations AGENCY... declaration of a major disaster for the State of South Dakota (FEMA-1914-DR), dated May 13, 2010, and related... in certain areas of the State of South Dakota resulting from a severe winter storm on April 2, 2010...

  18. 76 FR 34089 - North Dakota; Major Disaster and Related Determinations

    Science.gov (United States)

    2011-06-10

    .... FEMA-1981-DR; Docket ID FEMA-2011-0001] North Dakota; Major Disaster and Related Determinations AGENCY... Presidential declaration of a major disaster for the State of North Dakota (FEMA-1981-DR), dated May 10, 2011...''), as follows: I have determined that the damage in certain areas of the State of North Dakota resulting...

  19. 78 FR 67381 - North Dakota; Major Disaster and Related Determinations

    Science.gov (United States)

    2013-11-12

    .... FEMA-4154-DR; Docket ID FEMA-2013-0001] North Dakota; Major Disaster and Related Determinations AGENCY... declaration of a major disaster for the State of North Dakota (FEMA-4154-DR), dated October 31, 2013, and... Act''), as follows: I have determined that the damage in certain areas of the State of North Dakota...

  20. 75 FR 30420 - South Dakota; Major Disaster and Related Determinations

    Science.gov (United States)

    2010-06-01

    .... FEMA-1915-DR;Docket ID FEMA-2010-0002] South Dakota; Major Disaster and Related Determinations AGENCY... declaration of a major disaster for the State of South Dakota (FEMA-1915-DR), dated May 13, 2010, and related... in certain areas of the State of South Dakota resulting from flooding beginning on March 10, 2010...