WorldWideScience

Sample records for anaplasma marginale identification

  1. Identification of Anaplasma marginale type IV secretion system effector proteins.

    Directory of Open Access Journals (Sweden)

    Svetlana Lockwood

    Full Text Available Anaplasma marginale, an obligate intracellular alphaproteobacterium in the order Rickettsiales, is a tick-borne pathogen and the leading cause of anaplasmosis in cattle worldwide. Complete genome sequencing of A. marginale revealed that it has a type IV secretion system (T4SS. The T4SS is one of seven known types of secretion systems utilized by bacteria, with the type III and IV secretion systems particularly prevalent among pathogenic Gram-negative bacteria. The T4SS is predicted to play an important role in the invasion and pathogenesis of A. marginale by translocating effector proteins across its membrane into eukaryotic target cells. However, T4SS effector proteins have not been identified and tested in the laboratory until now.By combining computational methods with phylogenetic analysis and sequence identity searches, we identified a subset of potential T4SS effectors in A. marginale strain St. Maries and chose six for laboratory testing. Four (AM185, AM470, AM705 [AnkA], and AM1141 of these six proteins were translocated in a T4SS-dependent manner using Legionella pneumophila as a reporter system.The algorithm employed to find T4SS effector proteins in A. marginale identified four such proteins that were verified by laboratory testing. L. pneumophila was shown to work as a model system for A. marginale and thus can be used as a screening tool for A. marginale effector proteins. The first T4SS effector proteins for A. marginale have been identified in this work.

  2. Identification of a vertically transmitted strain from Anaplasma marginale (UFMG3): Molecular and phylogenetic characterization, and evaluation of virulence.

    Science.gov (United States)

    Silvestre, Bruna T; Silveira, Júlia A G; Meneses, Rodrigo M; Facury-Filho, Elias J; Carvalho, Antônio U; Ribeiro, Múcio F B

    2016-02-01

    Bovine anaplasmosis is a disease caused by the intraerythrocytic rickettsia species Anaplasma marginale and results in great economic losses in tropical and subtropical regions. Vertical transmission is an important phenomenon that contributes to the persistence of different strains of the agent within the same herd. The identification of new strains and genetic characterization studies are essential to understanding their epidemiology and virulence and for vaccine development. The aim of this study was to perform molecular and phylogenetic characterizations of a new vertically transmitted strain from A. marginale and to evaluate its virulence by experimental inoculation of rickettsia-free calves. Thirty newborn Holstein calves were subjected to molecular tests for the detection of A. marginale, Babesia bovis and Babesia bigemina. Calves positive for A. marginale (n=3) were splenectomized and monitored for the clinical manifestations of anaplasmosis. Blood samples from one of the calves that presented rickettsemia of 42.8% and spontaneous recovery of clinical parameters were used for molecular and phylogenetic characterization (msp1a gene), and inoculum production was used for the evaluation of virulence. This strain was identified as UFMG3. Three tandem repeat forms (13 and MGI19) were identified from the analysis of the msp1a gene, in which the form MGI19 appeared twice. Analysis of these repeats revealed the presence of the sequences QASTSS and SSASGQQQESS and of aspartic acid (D) at position 20 of both repeats. Phylogenetic analysis showed a close relationship among the UFMG3, MGI19 and UFMG2 strains. For virulence evaluation, six Holstein calves were inoculated intravenously with 2×10(7)A. marginale UFMG3-infected erythrocytes. The calves showed maximum rickettsemia of 5.1%, a moderate decrease in packed cell volume and spontaneous recovery of clinical parameters without the need for treatment. The results of experimental inoculation suggest that the strain A

  3. Molecular identification of Anaplasma marginale in two autochthonous South American wild species revealed an identical new genotype and its phylogenetic relationship with those of bovines.

    Science.gov (United States)

    Guillemi, Eliana C; de la Fourniere, Sofía; Orozco, Marcela; Peña Martinez, Jorge; Correa, Elena; Fernandez, Javier; Lopez Arias, Ludmila; Paoletta, Martina; Corona, Belkis; Pinarello, Valérie; Wilkowsky, Silvina E; Farber, Marisa D

    2016-05-26

    Anaplasma marginale is a well-known cattle pathogen of tropical and subtropical world regions. Even though, this obligate intracellular bacterium has been reported in other host species different than bovine, it has never been documented in Myrmecophaga tridactyla (giant anteater) or Hippocamelus antisense (taruca), which are two native endangered species. Samples from two sick wild animals: a Myrmecophaga tridactyla (blood) and a Hippocamelus antisense (blood and serum) were studied for the presence of A. marginale DNA through msp5 gene fragment amplification. Further characterization was done through MSP1a tandem repeats analysis and MLST scheme and the genetic relationship among previously characterized A. marginale sequences were studied by applying, eBURST algorithm and AMOVA analysis. Anaplasma marginale DNA was identified in the Myrmecophaga tridactyla and Hippocamelus antisense samples. Through molecular markers, we identified an identical genotype in both animals that was not previously reported in bovine host. The analysis through eBURST and AMOVA revealed no differentiation between the taruca/anteater isolate and the bovine group. In the present publication we report the identification of A. marginale DNA in a novel ruminant (Hippocamelus antisense) and non-ruminant (Myrmecophaga tridactyla) host species. Genotyping analysis of isolates demonstrated the close relatedness of the new isolate with the circulation population of A. marginale in livestock. Further analysis is needed to understand whether these two hosts contribute to the anaplasmosis epidemiology.

  4. Seroprevalence of Bovine Anaplasmosis Caused by Anaplasma Marginale in Malaysia

    OpenAIRE

    Pong, Samantha; Nik-Him, Nik-Ahmad I. I

    2012-01-01

    Anaplasmosis, also known as yellow fever, is an infectious parasitic disease of cattle caused by the protozoan Anaplasma marginale. Anaplasma marginale infects the erythrocytes and causes severe anaemia, weakness, loss of appetite, fever, depression, abortion, decreased milk production, constipation, jaundice and sometimes death. In Malaysia, data on A. marginale infection is still behind compared to other parasites such as nematodes. Anaplasmosis in livestock has received little attention in...

  5. Anaplasma marginale and Anaplasma phagocytophilum: Rickettsiales pathogens of veterinary and public health significance.

    Science.gov (United States)

    Atif, Farhan Ahmad

    2015-11-01

    Anaplasma marginale and Anaplasma phagocytophilum are the most important tick-borne bacteria of veterinary and public health significance in the family Anaplasmataceae. The objective of current review is to provide knowledge on ecology and epidemiology of A. phagocytophilum and compare major similarities and differences of A. marginale and A. phagocytophilum. Bovine anaplasmosis is globally distributed tick-borne disease of livestock with great economic importance in cattle industry. A. phagocytophilum, a cosmopolitan zoonotic tick transmitted pathogen of wide mammalian hosts. The infection in domestic animals is generally referred as tick-borne fever. Concurrent infections exist in ticks, domestic and wild animals in same geographic area. All age groups are susceptible, but the prevalence increases with age. Movement of susceptible domestic animals from tick free non-endemic regions to disease endemic regions is the major risk factor of bovine anaplasmosis and tick-borne fever. Recreational activities or any other high-risk tick exposure habits as well as blood transfusion are important risk factors of human granulocytic anaplasmosis. After infection, individuals remain life-long carriers. Clinical anaplasmosis is usually diagnosed upon examination of stained blood smears. Generally, detection of serum antibodies followed by molecular diagnosis is usually recommended. There are problems of sensitivity and cross-reactivity with both the Anaplasma species during serological tests. Tetracyclines are the drugs of choice for treatment and elimination of anaplasmosis in animals and humans. Universal vaccine is not available for either A. marginale or A. phagocytophilum, effective against geographically diverse strains. Major control measures for bovine anaplasmosis and tick-borne fever include rearing of tick-resistant breeds, endemic stability, breeding Anaplasma-free herds, identification of regional vectors, domestic/wild reservoirs and control, habitat modification

  6. Detection and Characterisation of Anaplasma marginale and A. centrale in South Africa

    Directory of Open Access Journals (Sweden)

    Paidashe Hove

    2018-03-01

    Full Text Available Bovine anaplasmosis is endemic in South Africa and it has a negative economic impact on cattle farming. An improved understanding of Anaplasma marginale and Anaplasma marginale variety centrale (A. centrale transmission, together with improved tools for pathogen detection and characterisation, are required to inform best management practices. Direct detection methods currently in use for A. marginale and A. centrale in South Africa are light microscopic examination of tissue and organ smears, conventional, nested, and quantitative real-time polymerase chain reaction (qPCR assays, and a reverse line blot hybridisation assay. Of these, qPCR is the most sensitive for detection of A. marginale and A. centrale in South Africa. Serological assays also feature in routine diagnostics, but cross-reactions prevent accurate species identification. Recently, genetic characterisation has confirmed that A. marginale and A. centrale are separate species. Diversity studies targeting Msp1a repeats for A. marginale and Msp1aS repeats for A. centrale have revealed high genetic variation and point to correspondingly high levels of variation in A. marginale outer membrane proteins (OMPs, which have been shown to be potential vaccine candidates in North American studies. Information on these OMPs is lacking for South African A. marginale strains and should be considered in future recombinant vaccine development studies, ultimately informing the development of regional or global vaccines.

  7. Anaplasma phagocytophilum and Anaplasma marginale Elicit Different Gene Expression Responses in Cultured Tick Cells

    Directory of Open Access Journals (Sweden)

    Zorica Zivkovic

    2009-01-01

    Full Text Available The genus Anaplasma (Rickettsiales: Anaplasmataceae includes obligate tick-transmitted intracellular organisms, Anaplasma phagocytophilum and Anaplasma marginale that multiply in both vertebrate and tick host cells. Recently, we showed that A. marginale affects the expression of tick genes that are involved in tick survival and pathogen infection and multiplication. However, the gene expression profile in A. phagocytophilum-infected tick cells is currently poorly characterized. The objectives of this study were to characterize tick gene expression profile in Ixodes scapularis ticks and cultured ISE6 cells in response to infection with A. phagocypthilum and to compare tick gene expression responses in A. phagocytophilum- and A. marginale-infected tick cells by microarray and real-time RT-PCR analyses. The results of these studies demonstrated modulation of tick gene expression by A. phagocytophilum and provided evidence of different gene expression responses in tick cells infected with A. phagocytophilum and A. marginale. These differences in Anaplasma-tick interactions may reflect differences in pathogen life cycle in the tick cells.

  8. Antigenic variation of Anaplasma marginale msp2 occurs by combinatorial gene conversion.

    Science.gov (United States)

    Brayton, Kelly A; Palmer, Guy H; Lundgren, Anna; Yi, Jooyoung; Barbet, Anthony F

    2002-03-01

    The rickettsial pathogen Anaplasma marginale establishes lifelong persistent infection in the mammalian reservoir host, during which time immune escape variants continually arise in part because of variation in the expressed copy of the immunodominant outer membrane protein MSP2. A key question is how the small 1.2 Mb A. marginale genome generates sufficient variants to allow long-term persistence in an immunocompetent reservoir host. The recombination of whole pseudogenes into the single msp2 expression site has been previously identified as one method of generating variants, but is inadequate to generate the number of variants required for persistent infection. In the present study, we demonstrate that recombination of a whole pseudogene is followed by a second level of variation in which small segments of pseudogenes recombine into the expression site by gene conversion. Evidence for four short sequential changes in the hypervariable region of msp2 coupled with the identification of nine pseudogenes from a single strain of A. marginale provides for a combinatorial number of possible expressed MSP2 variants sufficient for lifelong persistence.

  9. Gamma irradiation attenuation of Anaplasma Marginale and its possible use as vaccine against bovine anaplasmosis

    International Nuclear Information System (INIS)

    Castro Z, J.; Pupiales T, N.

    1986-01-01

    Bovine Anaplasmosis is one of the limiting in the cattle development at Colombia and others tropical countries. Bovine Anaplasmosis is an infectious disease caused by a microorganism called Anaplasma Marginale, it with invades the red globules producing erythrofagocitosis. In this job, were irradiated with different gamma beam intensity; microorganisms of Anaplasma Marginale, those which were used as innocuous. Animals of the groups (I,II,III) presented good protection against the disease; animals of the Group IV presented mild symptoms with subsequent recovery and strong symptoms

  10. Transmisión de Anaplasma marginale por garrapatas

    Directory of Open Access Journals (Sweden)

    Kelly A. Brayton

    2012-01-01

    Full Text Available Anaplasma marginale, patógeno de distribución mundial, es transmitido por garrapatas Ixódidas. Comprender su complejo desarrollo dentro de la garrapata vector, permitirá la predicción de brotes y ofrecerá oportunidades para controlar su transmisión. En este trabajo se revisa su ciclo básico de desarrollo junto con los estudios recientes acerca de las diferencias de transmisión entre cepas, que delinean aspectos de la interacción patógeno - vector. Bacterias, virus o protozoarios transmitidos por artrópodos causan enfermedades severas, tanto en humanos como en animales. Las enfermedades infecciosas transmitidas por garrapatas, entre las que incluimos a la Anaplasmosis (A. marginale, babesiosis (Babesia bigemina, B. bovis, B. divergens y Theileriosis (Theileria annulata, T. parva, se encuentran entre las más importantes en el ámbito mundial, con pérdidas cercanas a los siete mil millones de dólares anualmente; y, a pesar de su impacto, permanecen escasamente bajo control, basado primordialmente en la aplicación de acaricidas, para interrumpir su transmisión. La aparición de garrapatas resistentes a múltiples sustancias acaricidas, representa una amenaza en este tipo de control y, como resultado, hay un resurgimiento de la investigación para el desarrollo de nuevas estrategias para su control. Nuevas opciones para prevenir la transmisión de patógenos de animales por garrapatas, será el resultado de entender las interacciones garrapata patógeno; proceso que culmina con el desarrollo de la infección y transmisión exitosa. En todos los casos de patógenos transmitidos por garrapatas, el desarrollo de la infección se realiza coordinamente a los momentos de adhesión y alimentación del vector sobre el animal. Esto sucede por la interdependencia en la señalización entre el patógeno y el vector al alimentarse y, por ello, será susceptible de intervención.

  11. Knockout of an outer membrane protein operon of anaplasma marginale by transposon mutagenesis

    Science.gov (United States)

    Large amounts of data generated by genomics, transcriptomics and proteomics technologies have increased our understanding of the biology of Anaplasma marginale. However, these data have also led to new assumptions that require testing, ideally through classic genetic mutation. One example is the def...

  12. Detection of genetic diversity of Anaplasma marginale isolates in Minas Gerais, Brazil

    Czech Academy of Sciences Publication Activity Database

    Pohl, A.E.; Cabezas Cruz, Alejandro; Ribeiro, M.F.B.; Goncalves da Silvera, J.; Silaghi, C.; Pfister, K.; Friche Passos, L.M.

    2013-01-01

    Roč. 22, č. 1 (2013), s. 129-135 ISSN 1984-2961 Institutional support: RVO:60077344 Keywords : Anaplasma marginale * MSP1a * DNA sequencing * microsatellites * tandem repeats * Brazil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.961, year: 2013

  13. Prevalence of Anaplasma marginale in different tick species from Ngorongoro Crater, Tanzania.

    Science.gov (United States)

    Fyumagwa, Robert D; Simmler, Pascale; Meli, Marina L; Hoare, Richard; Hofmann-Lehmann, Regina; Lutz, Hans

    2009-04-06

    In 2001, Ngorongoro Crater was infested with high density of ticks on grassland, livestock and wildlife which was also associated with high mortality. Adult ticks were collected, identified, processed for nucleic acids extraction and a molecular analysis was performed to determine the range of tick species harboring Anaplasma marginale. The real-time PCR was used in the amplification of rickettsia DNA in tick pools (n=527) from 11 identified tick species. Six tick species were detected with A. marginale DNA including Amblyomma gemma, Rhipicephalus appendiculatus, R. compositus, R.decoloratus, R. praetextatus and R. pulchellus. The detection rate in each tick species was 3%, 0.7%, 2%, 13%, 1.8%, and 6.2%, respectively. Five of the positive tick species excluding R.decoloratus have previously not been described to transmit A. marginale. High diversity of tick species detected with A. marginale in Ngorongoro Crater is likely to increase a risk to susceptible animals of contracting the infection.

  14. Immune responses in cattle vaccinated with gamma-irradiated Anaplasma marginale

    International Nuclear Information System (INIS)

    Sharma, S.P.; Bansal, G.C.

    1986-01-01

    The infectivity and immunogenecity of gamma-irradiated Anaplasma marginale organisms were studied in bovine calves. The severity of Anaplasma infection based on per cent infected red blood cells, haematological values and mortality was more in animals immunized with blood exposed to 60 kR in comparison to those inoculated with blood irradiated at 70, 80 and 90 kR. The immunizing controls demonstrated a significantly high parasitaemia, marked anaemia and more deaths. Marked and prolonged cell-mediated and humoral immune responses detectable in the first 3 weeks of post-immunization may be responsible for conferring of protective immunity. (author)

  15. Anaplasma Marginale isolation from infected bovine erythrocytes or from its floating culture

    International Nuclear Information System (INIS)

    Canon Q, Y.

    1986-01-01

    Isolation of Anaplasma Marginale is of great importance because this is the cause of anaplasmosis in cattle. Anaplasmosis is a mortal disease and spreads easily. To isolate the anaplasm, four different experiments were developed; in the first experiment, the parasite was isolated from parasitic blood, by means of three methods; osmotic shock, sonic vibration and treatment with hemolisine. In the second experiment, the parasite source was the top of the bacteriologic culture of anaplasma marginale obtained by means of slow centrifugation. In the third experiment, it was used parasitic blood diluted in PBS and liquid nitrogen criopreserved. In the fourth experiment.it was used parasitic blood which was separated by means of sonic oscillation. This method was more adequate to free the parasite from the host cell. Differential centrifugation was the best method to separate parasite of the stroma and ghost cells

  16. Transplacental transmission of Anaplasma marginale in beef cattle chronically infected in southern Brazil

    Directory of Open Access Journals (Sweden)

    Hermann Eduardo Gonzalez Grau

    Full Text Available In this study, we have investigated the incidence of transplacental transmission of Anaplasma marginale in chronically infected cows with no history of acute anaplasmosis during gestation. In addition, we evaluated various techniques for detection of transplacental transmission ofA. marginale. Blood samples were collected from 30 cows at three different periods: at the time of artificial insemination, at gestational diagnosis, and after calving. Also, blood was collected from the newborn calves, including one sample before colostrum intake, and another three days after birth. A. marginale-specific antibodies were detected in 100% of the cows with an indirect fluorescent antibody test (IFAT, and in 97% of them, using an indirect enzyme-linked immunosorbent assay (ELISA. Also, we observed that all of the three-day-old newborn calves were seropositive by IFAT. According to polymerase chain reaction, 63.3% of the cows were carriers of A. marginale, as well as 6.7% of the newborn calves. This represented a transplacental transmission rate of 10.5%. Furthermore, a correlation of 93.3% was observed between the two serodiagnostic techniques, demonstrating that both ELISA and IFAT can be used in epidemiological surveys of A. marginale. These results confirm the occurrence of transplacental transmission of A. marginale in chronically infected cows and suggest the importance of this transmission route in areas of enzootic instability.

  17. Effect of gamma irradiation on anaplasma marginale in bovines

    International Nuclear Information System (INIS)

    Romero, H.Q.; Fernandez, M.V.G. de; Meza, B.R.; Rodriguez, E.

    1981-01-01

    Because the costs of treatment of anaplasmosis are very high, it was considered of great usefulness to obtain the modification of the pathogenecity and the antigenecity of A. marginale by means of gamma radiation ( 60 Co) to obtain a vaccine. This would be reflected favorably in saving lives as well as to obviate losses of meat and dairy production and the elimination of the risks derived from the introduction of selected cattle into the tropics. The main purpose of this study was to determine the optimal modification of the pathogenecity of A. marginale in splenectomized calves and adult cows, among 4 different radiation doses. (author)

  18. Anaplasma marginale infection in cattle from south-western Amazonia Infecção por Anaplasma marginale em bovinos na Amazônia Sul Ocidental, Brasil

    Directory of Open Access Journals (Sweden)

    Luciana Gatto Brito

    2010-03-01

    Full Text Available The present study provides the first epidemiological data regarding infection by Anaplasma marginale in cattle reared in south-western Brazilian Amazonia. One simple procedure was adapted for the extraction of DNA from blood clots collected in seven microregions of Rondônia State and two mesoregions of Acre State. PCR method was used to asses the frequency of A. marginale infections in 4 to12-month-old cattle. The cattle infection was investigated by polymerase chain reaction (PCR using the specific primer "msp5" for A. marginale. The DNA amplifications revealed that the mean frequency of A. marginale infection was 98.6% (1,627/1,650 in samples from Rondonia, and 92.87% (208/225 in samples from Acre. The high frequency of A. marginale infections in 4 to 12-month-old cattle indicate a situation of enzootic stability in the studied areas and are comparable to those detected by immunodiagnosis in different endemic regions in Brazil. The DNA extraction of clotted blood method described here can be used for epidemiological studies on anaplasmosis and other bovine hemoparasites.O presente estudo fornece os primeiros dados epidemiológicos relativos a infecção por Anaplasma marginale em bovinos criados na Amazônia Sul Ocidental brasileira. Foi adaptado um procedimento simples para a extração de DNA a partir de coágulos sanguíneos coletados em sete microrregiões do estado de Rondônia e duas mesoregiões do estado do Acre. A técnica da reação em cadeia da polimerase (PCR foi aplicada para avaliar a freqüência da infecção por A. marginale em bovinos com idade entre 4 e 12 meses. Após a extração do DNA de cada amostra, a infecção nos bovinos foi investigada pela amplificação do gene "msp5" de A. marginale. As técnicas de amplificação do DNA revelaram que a freqüência de infecção por A. marginale foi de 98,6% (1.627/1.650 nas amostras provenientes de Rondônia e de 92,87% (208/225 nas amostras do Acre. A alta freqüência da

  19. Prevalence of Babesia spp. and Anaplasma marginale in cattle in the municipality of Palma, MG

    Directory of Open Access Journals (Sweden)

    Marluce Aparecida Mattos Paula

    2015-12-01

    Full Text Available ABSTRACT. Paula M.A.M., Oliveira F.C.R., Melo Jr O.A. & Frazão-Teixeira E. [Prevalence of Babesia spp. and Anaplasma marginale in cattle in the municipality of Palma, MG.] Prevalência de Babesia spp. e Anaplasma marginale em bovinos no município de Palma, MG. Revista Brasileira de Medicina Veterinária, 37(4: 359-365, 2015. Laboratório de Biologia Estrutural, Instituto Oswaldo Cruz/ Fiocruz, Avenida Brasil, 4365, Manguinhos, Rio de Janeiro, RJ 21040-361, Brasil. E-mail: edwards.teixeira@ioc.fiocruz.br We verified the prevalence of hemoparasites in 40 cattle with ages varying from one month to 12 years old, in two farms of the Municipality of Palma, Minas Gerais state, Brazil. Two blood smear samples were collected from each animal: one from the tail tip and another from the ear tip. The smears were fixed, stained and observed under 100X lighted microscope magnifying glass. Twenty- -seven out of 40 animals studied (67.5% had at least one species of hemoparasite. Among these, 21 (52.5% were infected with Babesia spp., 10 (25% with Anaplasma marginale and four (10% parasitized with both hemoparasites. The studied region is potentially enzootic for the detected parasites and there is high risk for clinical cases of tick-borne disease. Both anatomic points, tail and ear tips, are good spots for blood collection and smear confection for hemoparasite investigation.

  20. Anaplasma marginale attenuated by irradiation, its potential use as vaccine

    International Nuclear Information System (INIS)

    Gil, A.; Pupiales, N.; Castro, J.; Higuera, B.; Orrego, J.

    1986-01-01

    Five groups of 5 calves each were inoculated: group 1 (control) with 5 x 10 8 non-irradiated parasites (day 0) and group 2 with the same dose of irradiated (900 Gy) parasites on day 0. Both groups showed clinical signs of the infection, although group 2 was less severely affected. On day 41 group 3 was inoculated with blood (1 x 10 9 parasites) from an animal in group 2. These parasites were irradiated again (900 Gy) prior to inoculation. On day 59 group 4 was inoculated with blood (1 x 10 9 parasites) from the same animal in group 2. This inoculum was irradiated a second time (900 Gy) and the cells were washed and culture ''IN VITRO'' for 4 days prior to inoculation. Parasitaemia increased abruptly in group 3 (peak = 25%) concomitant with a sudden drop in hematocrit. Two animals died, the others required treatment. Group 4 had a transient and low parasitaemia (peak = 2%) and normal hematocrit values. On day 201 all animals including a new control (group 5) of 5 animals, were inoculated with 2 x 10 9 heterologous parasites. All 5 control animals reached 20% parasitaemia and averaged a -40% hematocrit decrease when treated. In contrast, the remaining animals had from -20% to normal hematocrit values and from 5.6% to non-detectable parasitaemias. All inoculated calves showed high antibody titers which increased once the parasitaemia was overcome, and after challenge. It appears that two (900 Gy) irradiations effectively attenuated A. marginale, conferring an active and long lasting protection. However, inoculum cells had to be washed and cultured to prevent hemolitic shock

  1. Comparação entre diversos antígenos para o diagnóstico de Anaplasma marginale por ELISA Comparison between several antigens for diagnosis of Anaplasma marginale by ELISA

    Directory of Open Access Journals (Sweden)

    Carlos A.N. Ramos

    2010-01-01

    Full Text Available Anaplasmose bovina é uma doença com grande importância nas regiões tropicais e subtropicais do mundo por determinar perdas econômicas devido à mortalidade e redução da produtividade. É causada por Anaplasma marginale, uma riquétsia intraeritrocítica obrigatória cujo controle requer, além de uma vacina eficiente, uma acurada identificação de bovinos cronicamente infectados. Apesar de existirem atualmente diversos métodos de diagnóstico dessa riquétsia, os métodos sorológicos, em particular o ensaio de imunoadsorção enzimática-ELISAs, são os mais utilizados devido à sua versatilidade e praticidade. No entanto, devido ao grande número de antígenos disponíveis, atualmente torna-se necessária uma avaliação para definir quais antígenos apresentam um melhor desempenho no diagnóstico da anaplasmose. Soros de bovinos positivos e negativos para A. marginale por PCR, e soros de animais provenientes do Brasil e Costa Rica, foram testados em ELISAs baseados em MSP1a, MSP2 e MSP5 recombinantes, um pool das três proteínas recombinantes, e antígeno de lisado de corpúsculos iniciais da riquétsia (CI. Utilizando soro de bovinos positivos para A. marginale por PCR, uma maior sensibilidade foi observada no ELISA CI. No entanto, uma maior especificidade, com soro de bovinos negativos a PCR, foi observada com os ELISAs recombinantes. O porcentual de bovinos positivos do Brasil e Costa Rica foi maior com ELISA CI. Razões para essas diferenças são discutidas.Bovine anaplasmosis is a major disease in tropical and subtropical regions of the world by determine economical loss due mortality and productive reduction. The disease is caused by Anaplasma marginale, an intraerythrocytic rickettsia whose control requires, besides an efficient vaccine, the accurate identification of chronically infected cattle. Although the existence of diverse methods of diagnosis of this rickettsia, the serological methods, in particular the enzyme

  2. Insights into mechanisms of bacterial antigenic variation derived from the complete genome sequence of Anaplasma marginale.

    Science.gov (United States)

    Palmer, Guy H; Futse, James E; Knowles, Donald P; Brayton, Kelly A

    2006-10-01

    Persistence of Anaplasma spp. in the animal reservoir host is required for efficient tick-borne transmission of these pathogens to animals and humans. Using A. marginale infection of its natural reservoir host as a model, persistent infection has been shown to reflect sequential cycles in which antigenic variants emerge, replicate, and are controlled by the immune system. Variation in the immunodominant outer-membrane protein MSP2 is generated by a process of gene conversion, in which unique hypervariable region sequences (HVRs) located in pseudogenes are recombined into a single operon-linked msp2 expression site. Although organisms expressing whole HVRs derived from pseudogenes emerge early in infection, long-term persistent infection is dependent on the generation of complex mosaics in which segments from different HVRs recombine into the expression site. The resulting combinatorial diversity generates the number of variants both predicted and shown to emerge during persistence.

  3. Anaplasma marginale major surface protein 1a: a marker of strain diversity with implications for control of bovine anaplasmosis.

    Science.gov (United States)

    Cabezas-Cruz, Alejandro; de la Fuente, José

    2015-04-01

    Classification of bacteria is challenging due to the lack of a theory-based framework. In addition, the adaptation of bacteria to ecological niches often results in selection of strains with diverse virulence, pathogenicity and transmission characteristics. Bacterial strain diversity presents challenges for taxonomic classification, which in turn impacts the ability to develop accurate diagnostics and effective vaccines. Over the past decade, the worldwide diversity of Anaplasma marginale, an economically important tick-borne pathogen of cattle, has become apparent. The extent of A. marginale strain diversity, formerly underappreciated, has contributed to the challenges of classification which, in turn, likely impacts the design and development of improved vaccines. Notably, the A. marginale surface protein 1a (MSP1a) is a model molecule for these studies because it serves as a marker for strain identity, is both an adhesin necessary for infection of cells and an immuno-reactive protein and is also an indicator of the evolution of strain diversity. Herein, we discuss a molecular taxonomic approach for classification of A. marginale strain diversity. Taxonomic analysis of this important molecule provides the opportunity to understand A. marginale strain diversity as it relates geographic and ecological factors and to the development of effective vaccines for control of bovine anaplasmosis worldwide. Copyright © 2015 Elsevier GmbH. All rights reserved.

  4. Subdominant Outer Membrane Antigens in Anaplasma marginale: Conservation, Antigenicity, and Protective Capacity Using Recombinant Protein.

    Directory of Open Access Journals (Sweden)

    Deirdre R Ducken

    Full Text Available Anaplasma marginale is a tick-borne rickettsial pathogen of cattle with a worldwide distribution. Currently a safe and efficacious vaccine is unavailable. Outer membrane protein (OMP extracts or a defined surface protein complex reproducibly induce protective immunity. However, there are several knowledge gaps limiting progress in vaccine development. First, are these OMPs conserved among the diversity of A. marginale strains circulating in endemic regions? Second, are the most highly conserved outer membrane proteins in the immunogens recognized by immunized and protected animals? Lastly, can this subset of OMPs recognized by antibody from protected vaccinates and conserved among strains recapitulate the protection of outer membrane vaccines? To address the first goal, genes encoding OMPs AM202, AM368, AM854, AM936, AM1041, and AM1096, major subdominant components of the outer membrane, were cloned and sequenced from geographically diverse strains and isolates. AM202, AM936, AM854, and AM1096 share 99.9 to 100% amino acid identity. AM1041 has 97.1 to 100% and AM368 has 98.3 to 99.9% amino acid identity. While all four of the most highly conserved OMPs were recognized by IgG from animals immunized with outer membranes, linked surface protein complexes, or unlinked surface protein complexes and shown to be protected from challenge, the highest titers and consistent recognition among vaccinates were to AM854 and AM936. Consequently, animals were immunized with recombinant AM854 and AM936 and challenged. Recombinant vaccinates and purified outer membrane vaccinates had similar IgG and IgG2 responses to both proteins. However, the recombinant vaccinates developed higher bacteremia after challenge as compared to adjuvant-only controls and outer membrane vaccinates. These results provide the first evidence that vaccination with specific antigens may exacerbate disease. Progressing from the protective capacity of outer membrane formulations to

  5. Immune response of calves inoculated with proteins ofAnaplasma marginale bound to an immunostimulant complex

    Directory of Open Access Journals (Sweden)

    Marcela Ribeiro Gasparini

    Full Text Available Despite our current knowledge of the immunology, pathology, and genetics of Anaplasma marginale, prevention in cattle is currently based on old standbys, including live attenuated vaccines, antibiotic treatment, and maintaining enzootic stability in cattle herds. In the present study, we evaluated the use of an immunostimulant complex (ISCOMATRIX adjuvant, associated with a pool of recombinant major surface proteins (rMSP1a, rMSP1b, rMSP4 and rMSP5 to improve the humoral immune response triggered in calves mainly by IgG2. Ten calves were divided in three groups: 4 calves were inoculated with the ISCOMATRIX/rMSPs (G1; 2 calves were inoculated with ISCOMATRIX adjuvant (G2; and 4 calves received saline (G3. Three inoculations were administered at 21-day intervals. In G1, the calves showed significant increases in total IgG, IgG1 and IgG2 levels 21 days after the second inoculation, compared to the control group (p < 0.05, and G1 calves remained above the cut-off value 28 days after the third inoculation (p < 0.05. The post-immunized sera from calves in G1 reacted specifically for each of the rMSPs used. In conclusion, the ISCOMATRIX/rMSPs induced antigen-specific seroconversion in calves. Therefore, additional testing to explore the protection induced by rMSPs, both alone and in conjunction with proteins previously identified as subdominant epitopes, is warranted.

  6. Molecular detection and characterization of Babesia bovis, Babesia bigemina, Theileria species and Anaplasma marginale isolated from cattle in Kenya.

    Science.gov (United States)

    Adjou Moumouni, Paul Franck; Aboge, Gabriel Oluga; Terkawi, Mohamad Alaa; Masatani, Tatsunori; Cao, Shinuo; Kamyingkird, Ketsarin; Jirapattharasate, Charoonluk; Zhou, Mo; Wang, Guanbo; Liu, Mingming; Iguchi, Aiko; Vudriko, Patrick; Ybanez, Adrian Patalinghug; Inokuma, Hisashi; Shirafuji-Umemiya, Rika; Suzuki, Hiroshi; Xuan, Xuenan

    2015-09-30

    Infections with Babesia bovis, Babesia bigemina, Theileria species and Anaplasma marginale are endemic in Kenya yet there is a lack of adequate information on their genotypes. This study established the genetic diversities of the above tick-borne hemoparasites infecting cattle in Kenya. Nested PCR and sequencing were used to determine the prevalence and genetic diversity of the above parasites in 192 cattle blood samples collected from Ngong and Machakos farms. B. bovis spherical body protein 4, B. bigemina rhoptry-associated protein 1a, A. marginale major surface protein 5, Theileria spp. 18S rRNA, T. parva p104 and T. orientalis major piroplasm surface protein were used as the marker genes. B. bovis, B. bigemina, T. parva, T. velifera, T. taurotragi, T. mutans and A. marginale were prevalent in both farms, whereas T. ovis, Theileria sp. (buffalo) and T. orientalis were found only in Ngong farm. Co-infections were observed in more than 50 % of positive samples in both farms. Babesia parasites and A. marginale sequences were highly conserved while T. parva and T. orientalis were polymorphic. Cattle-derived T. parva was detected in Machakos farm. However, cattle and buffalo-derived Theileria were detected in Ngong farm suggesting interactions between cattle and wild buffaloes. Generally, the pathogens detected in Kenya were genetically related to the other African isolates but different from the isolates in other continents. The current findings reaffirm the endemicity and co-infection of cattle with tick-borne hemoparasites, and the role of wildlife in pathogens transmission and population genetics in Kenya.

  7. Molecular detection and genetic diversity of bovine Babesia spp., Theileria orientalis, and Anaplasma marginale in beef cattle in Thailand.

    Science.gov (United States)

    Jirapattharasate, Charoonluk; Adjou Moumouni, Paul Franck; Cao, Shinuo; Iguchi, Aiko; Liu, Mingming; Wang, Guanbo; Zhou, Mo; Vudriko, Patrick; Efstratiou, Artemis; Changbunjong, Tanasak; Sungpradit, Sivapong; Ratanakorn, Parntep; Moonarmart, Walasinee; Sedwisai, Poonyapat; Weluwanarak, Thekhawet; Wongsawang, Witsanu; Suzuki, Hiroshi; Xuan, Xuenan

    2017-02-01

    Babesia spp., Theileria orientalis, and Anaplasma marginale are significant tick-borne pathogens that affect the health and productivity of cattle in tropical and subtropical areas. In this study, we used PCR to detect the presence of Babesia bovis, Babesia bigemina, and T. orientalis in 279 beef cattle from Western Thailand and A. marginale in 608 beef cattle from the north, northeastern, and western regions. The PCRs were performed using species-specific primers based on the B. bovis spherical body protein 2 (BboSBP2), B. bigemina rhoptry-associated protein 1a (BbiRAP-1a), T. orientalis major piroplasm surface protein (ToMPSP), and A. marginale major surface protein 4 (AmMSP4) genes. To determine the genetic diversity of the above parasites, amplicons of B. bovis and B. bigemina ITS1-5.8s rRNA gene-ITS2 regions (B. bovis ITS, B. bigemina ITS), ToMPSP, and AmMSP4 genes were sequenced for phylogenetic analysis. PCR results revealed that the prevalence of B. bovis, B. bigemina, T. orientalis, and A. marginale in the Western region was 11.1, 12.5, 7.8, and 39.1 %, respectively. Coinfections of two or three parasites were observed in 17.9 % of the animals sampled. The study revealed that the prevalence of A. marginale in the western region was higher than in the north and northeastern regions (7 %). Sequence analysis showed the BboSBP2 gene to be more conserved than B. bovis ITS in the different isolates and, similarly, the BbiRAP-1a was more conserved than B. bigemina ITS. In the phylogenetic analysis, T. orientalis MPSP sequences were classified into types 3, 5, and 7 as previously reported. A. marginale MSP4 gene sequences shared high identity and similarity with each other and clustered with isolates from other countries. This study provides information on the prevalence and genetic diversity of tick-borne pathogens in beef cattle and highlights the need for effective strategies to control these pathogens in Thailand.

  8. Uso de inóculo padronizado de Anaplasma marginale e da quimioprofilaxia no controle da anaplasmose bovina

    Directory of Open Access Journals (Sweden)

    Ribeiro M.F.B.

    2003-01-01

    Full Text Available O uso de inóculo homólogo padronizado de Anaplasma marginale foi comparado à prática de quimioprofilaxia com diidrato de oxitetraciclina na redução da riquetsemia e do volume globular (VG causada pela anaplasmose bovina. Os animais que receberam o inóculo (10(7 hemácias com Anaplasma marginaleapresentaram, ao serem desafiados em campo, riquetsemia média de 1,2% e redução média de VG de 23,0%, significativamente inferiores às do grupo-controle (P<0,05. No experimento de quimioprofilaxia os animais que receberam três doses de diidrato de oxitetraciclina (20mg/kg, com intervalos de 25 dias, apresentaram riquetsemia de 2,7% e redução de 36,3% no VG, significativamente inferiores às do grupo-controle (P<0,05. Ambas as medidas preventivas testadas foram eficientes na redução da intensidade da riquetsemia e na queda do VG.

  9. Genetic characterization of Anaplasma marginale strains from Tunisia using single and multiple gene typing reveals novel variants with an extensive genetic diversity.

    Science.gov (United States)

    Ben Said, Mourad; Ben Asker, Alaa; Belkahia, Hanène; Ghribi, Raoua; Selmi, Rachid; Messadi, Lilia

    2018-05-12

    Anaplasma marginale, which is responsible for bovine anaplasmosis in tropical and subtropical regions, is a tick-borne obligatory intraerythrocytic bacterium of cattle and wild ruminants. In Tunisia, information about the genetic diversity and the phylogeny of A. marginale strains are limited to the msp4 gene analysis. The purpose of this study is to investigate A. marginale isolates infecting 16 cattle located in different bioclimatic areas of northern Tunisia with single gene analysis and multilocus sequence typing methods on the basis of seven partial genes (dnaA, ftsZ, groEL, lipA, secY, recA and sucB). The single gene analysis confirmed the presence of different and novel heterogenic A. marginale strains infecting cattle from the north of Tunisia. The concatenated sequence analysis showed a phylogeographical resolution at the global level and that most of the Tunisian sequence types (STs) formed a separate cluster from a South African isolate and from all New World isolates and strains. By combining the characteristics of each single locus with those of the multi-loci scheme, these results provide a more detailed understanding on the diversity and the evolution of Tunisian A. marginale strains. Copyright © 2018 Elsevier GmbH. All rights reserved.

  10. Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System.

    Science.gov (United States)

    Zhang, Bing; Cavallaro, Antonio S; Mody, Karishma T; Zhang, Jun; Deringer, James R; Brown, Wendy C; Mahony, Timothy J; Yu, Chengzhong; Mitter, Neena

    2016-11-05

    Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale . Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris . When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm), 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

  11. Eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos naturalmente infectados por Anaplasma marginale

    Directory of Open Access Journals (Sweden)

    L.R. Alberton

    2015-08-01

    Full Text Available O agente de maior importância, em relação à anaplasmose bovina, é o Anaplasma marginale. Os principais sinais clínicos dessa enfermidade são anemia hemolítica, icterícia, dispneia, taquicardia, febre, fadiga, lacrimejamento, sialorreia, micção frequente, anorexia, perda de peso, aborto e morte. A terapia antimicrobiana é o principal protocolo terapêutico. O objetivo do presente trabalho foi avaliar a eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos leiteiros naturalmente infectados por Anaplasma marginale. Para isso, foram avaliados 48 zebuínos mestiços que apresentavam os sinais clínicos sugestivos da doença. Os animais foram submetidos à coleta de sangue para a realização de hemograma e à extração de DNA para a confirmação da presença de A. marginale, por meio da reação em cadeia pela polimerase (PCR. Os animais foram divididos em três grupos experimentais, para realização dos protocolos terapêuticos, utilizando-se dipropionato de imidocarb, oxitetraciclina e enrofloxacina. Trinta e seis animais (75% apresentaram reação positiva ao PCR. Os animais positivos não apresentaram diferenças significativas quanto ao hemograma e ao leucograma quando comparados com os negativos, no entanto os níveis de proteínas séricas foram inferiores nos animais positivos (P<0,05. Os três protocolos terapêuticos foram capazes de reduzir a infecção ao longo do tratamento (P<0,01, porém, após cinco dias de tratamento, a enrofloxacina apresentou maior efetividade em relação aos demais (P<0,01. Após o final do tratamento, nenhum protocolo foi capaz de eliminar totalmente a infecção pelo A. marginale em bovinos naturalmente infectados e manejados a campo.

  12. Prevalencia y detección por PCR anidada de Anaplasma marginale en bovinos y garrapatas en la zona central del Litoral ecuatoriano

    Directory of Open Access Journals (Sweden)

    Ariel Escobar Troya

    2015-09-01

    Full Text Available La bacteria que provoca la anaplasmosis en bovinos se conoce como Anaplasma marginale, es potencialmente transmitida de forma biológica por garrapatas, moscas y fómites o mediante sangre infectada como consecuencia del uso incorrecto de herramientas quirúrgicas. Hasta la fecha, Ecuador carece de estudios actualizados sobre procedimientos eficientes para el diagnóstico específico y, erradicación de A. marginale a través del control de estos insectos, por lo que resulta de gran importancia desarrollar e implementar trabajos relacionados con el uso de esta herramienta molecular, para la detección de la bacteria en vectores de transmisión que provocan la enfermedad en bovinos. En este trabajo, se extrajo ADN eficazmente con el método de Salting Out. Un total de 255 muestras fueron analizadas por PCR anidada, distribuidas del siguiente modo|108| Riphicephalus (Boophilus microplus, |85| bovinos, de estos el 13.46% y 85.48% dieron positivas para la rickettsia, las muestras de Amblyomma spp. |62| todas fueron negativas. El índice de concordancia Kappa |total de bovinos infestados frente a Riphicephalus (Boophilus microplus|, no fue significativo (0.28. Subsiguientemente, se determinó por χ2 (p=0.66 que la presencia o ausencia de la enfermedad es independiente del lugar de donde proviene el bovino.

  13. Nanoparticle-Based Delivery of Anaplasma marginale Membrane Proteins; VirB9-1 and VirB10 Produced in the Pichia pastoris Expression System

    Directory of Open Access Journals (Sweden)

    Bing Zhang

    2016-11-01

    Full Text Available Bovine anaplasmosis or cattle-tick fever is a tick-borne haemolytic disease caused by the rickettsial haemoparasite Anaplasma marginale in tropical and subtropical areas of the world. While difficult to express, the proteins VirB9-1 and VirB10 are immunogenic components of the outer membrane type IV secretion system that have been identified as candidate antigens for vaccines targeting of A. marginale. Soluble VirB9-1 and VirB10 were successfully expressed using Pichia pastoris. When formulated with the self-adjuvanting silica vesicles, SV-100 (diameter: 50 nm, and pore entrance size: 6 nm, 200 µg of VirB9-1 and VirB10 were adsorbed per milligram of nanoparticle. The VirB9-1 and VirB10, SV-100 formulations were shown to induce higher antibody responses in mice compared to the QuilA formulations. Moreover, intracellular staining of selected cytokines demonstrated that both VirB9-1 and VirB10 formulations induced cell-mediated immune responses in mice. Importantly, the SV-100 VirB9-1 and VirB10 complexes were shown to specifically stimulate bovine T-cell linages derived from calves immunised with A. marginale outer membrane fractions, suggesting formulations will be useful for bovine immunisation and protection studies. Overall this study demonstrates the potential of self-adjuvanting silica vesicle formulations to address current deficiencies in vaccine delivery applications.

  14. Epitope-based vaccines with the Anaplasma marginale MSP1a functional motif induce a balanced humoral and cellular immune response in mice.

    Directory of Open Access Journals (Sweden)

    Paula S Santos

    Full Text Available Bovine anaplasmosis is a hemoparasitic disease that causes considerable economic loss to the dairy and beef industries. Cattle immunized with the Anaplasma marginale MSP1 outer membrane protein complex presents a protective humoral immune response; however, its efficacy is variable. Immunodominant epitopes seem to be a key-limiting factor for the adaptive immunity. We have successfully demonstrated that critical motifs of the MSP1a functional epitope are essential for antibody recognition of infected animal sera, but its protective immunity is yet to be tested. We have evaluated two synthetic vaccine formulations against A. marginale, using epitope-based approach in mice. Mice infection with bovine anaplasmosis was demonstrated by qPCR analysis of erythrocytes after 15-day exposure. A proof-of-concept was obtained in this murine model, in which peptides conjugated to bovine serum albumin were used for immunization in three 15-day intervals by intraperitoneal injections before challenging with live bacteria. Blood samples were analyzed for the presence of specific IgG2a and IgG1 antibodies, as well as for the rickettsemia analysis. A panel containing the cytokines' transcriptional profile for innate and adaptive immune responses was carried out through qPCR. Immunized BALB/c mice challenged with A. marginale presented stable body weight, reduced number of infected erythrocytes, and no mortality; and among control groups mortality rates ranged from 15% to 29%. Additionally, vaccines have significantly induced higher IgG2a than IgG1 response, followed by increased expression of pro-inflammatory cytokines. This is a successful demonstration of epitope-based vaccines, and protection against anaplasmosis may be associated with elicitation of effector functions of humoral and cellular immune responses in murine model.

  15. Immune response and biochemistry of calves immunized with rMSP1a ( Anaplasma marginale using carbon nanotubes as carrier molecules

    Directory of Open Access Journals (Sweden)

    Bruna Torres Silvestre

    2018-05-01

    Full Text Available Abstract Vaccination against Anaplasma marginale has been considered an important control strategy for bovine anaplasmosis. Recently, mice immunized with rMSP1 a linked to carbon nanotubes (MWNT showed significant immune responses, generating a new possibility for use of an inactivated vaccine. The objective of this study was to investigate the cellular and humoral responses in calves immunized with MWNT+rMSP1a , associated with inactivated vaccine of A. marginale produced in vitro, and evaluate the toxic effects of the MWNT on renal and hepatic function. rMSP1a was covalently linked to MWNT. Inactivated vaccine (AmUFMG2 was produced by cultivating A. marginale in IDE8 cells. Twenty-four Holstein calves were divided (four groups and immunized subcutaneously with PBS and non-carboxylated MWNT (control, G1, AmUFMG2 (G2, MWNT+rMSP1a (G3, and AmUFMG2 with MWNT+rMSP1a (G4. Blood samples were collected for total leukocyte counts, biochemical profiling and evaluation of the cellular and humoral response. Immunization with MWNT+rMSP1a induced increase in the total number of leukocytes, NK cells, in the lymphocyte populations and higher levels of antibodies compared to calves immunized only with AmUFMG2. Furthermore, MWNT did not induce changes in the biochemical profile. These data indicate that MWNT+rMSP1a were able to induce the immune responses more efficiently than AmUFMG2 alone, without generating toxicity.

  16. Induced immune response of Escherichia coli BL21 expressing recombinant MSP1a and MSP1b proteins of Anaplasma marginale

    Directory of Open Access Journals (Sweden)

    Katia Tamekuni

    2009-11-01

    Full Text Available This work aims to evaluate the potential of immunization with E. coli BL21 expressing the recombinant rMSP1a and rMSP1b proteins of Anaplasma marginale. E. coli BL21 was transformed with recombinant plasmids pET102/msp1α and pET101/msp1β, and rMSP1a and rMSP1b were expressed after induction by IPTG. BALB/c mice were vaccinated with formolized BL21/rMSP1a and BL21/rMSP1b, and the production in mice sera of whole IgG was determined by ELISA. The mice immunized with BL21/rMSP1a showed a better humoral response for whole IgG when compared to the mice immunized with BL21/rMSP1b; these mice exhibited a small response after the second vaccination. Sera of mice immunized with BL21/rMSP1a reacted via western blot with BL21 and rMSP1a, with molecular masses varying from 70 to 105 kDa. Sera of mice immunized with BL21/rMSP1b reacted with BL21 and rMSP1b with a molecular mass of 100 kDa. These results demonstrate that BL21 containing rMSP1a and rMSP1b in the outer membrane were able to produce an immune response in mice, reinforcing its use in vaccine models against bovine anaplasmosis.Esse trabalho avaliou o potencial de imunização de Escherichia coli BL21 expressando as proteínas recombinantes rMSP1a e rMSP1b de Anaplasma marginale. A E. coli BL21 foi transformada com os plasmídios recombinantes pET102/msp1α e pET101/msp1β e as proteínas rMSP1a e rMSP1b foram expressas após indução com IPTG. Camundongos BALB/c foram vacinados com BL21/rMSP1a e BL21/rMSP1b formolisadas, e a produção de IgG total foi determinada pelo teste de ELISA nos soros dos camundongos imunizados. Os camundongos imunizados com a BL21/rMSP1a mostraram uma melhor resposta humoral para IgG total, comparada à resposta apresentada pelos camundongos imunizados com BL21/rMSP1b; estes camundongos exibiram uma menor resposta após a segunda vacinação. Soros de camundongos imunizados BL21/rMSP1a reagiram pelo western blot com BL21 e rMSP1a, com massa molecular variando de 70 a

  17. Frequency of antibodies to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burdgorferi in cattle from the northeastern region of the state of Pará, Brazil Freqüência de anticorpos para Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax e Borrelia burgdorferi em bovinos do nordeste do Estado do Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Daniel S. Guedes Junior

    2008-06-01

    Full Text Available Babesiosis, anaplasmosis, and trypanosomosis are relevant diseases, potentially causing morbidity in cattle, leading to economic losses. Borreliosis is import as a potential zoonosis. The objective of this study was to determine, by indirect enzyme-linked immunosorbent assay (ELISA, the frequency of seropositive cattle to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burgdorferi in cattle from the Northeastern region of Pará, Brazil. Sera samples from 246 female adult cattle from municipalities of Castanhal and São Miguel do Guamá were used. Crude antigens ELISAs were used to detect antibodies to all agents, except to A. marginale, to which an indirect ELISA with recombinant major surface 1a protein (MSP1a antigen was used. Overall frequencies of seropositive animals were: B. bigemina - 99.2%; B. bovis - 98.8%; A. marginale - 68.3%; T. vivax - 93.1% and B. burgdorferi - 54.9%. The frequencies of seropositive cattle to B. bovis and B. bigemina suggest a high rate of transmission of these organisms by tick in the studied region, which can be classified as enzootically stable to these hemoprotozoans. The low frequency of seropositive cattle to A. marginale may be attributed to a lower sensitivity of the recombinant antigen ELISA utilized or a distinct rate of inoculation of this rickettsia by ticks, as compared with Babesia sp. transmission. The high frequency of seropositive cattle to T. vivax indicates that this hemoprotozoan is prevalent in herds from the Northeastern region of Pará. The rate of animal that showed homologues antibodies to B. burgdorferi indicates the presence of the tickborne spirochaetal agent in the cattle population in the studied region.A babesiose, a anaplasmose e a tripanossomose são enfermidades relevantes, potencialmente causadoras de morbidade em bovinos, levando a perdas econômicas. A borreliose assume importância como zoonose potencial. O objetivo desse estudo foi determinar

  18. Anaplasma marginale major surface protein 2 CD4+-T-cell epitopes are evenly distributed in conserved and hypervariable regions (HVR), whereas linear B-cell epitopes are predominantly located in the HVR.

    Science.gov (United States)

    Abbott, Jeffrey R; Palmer, Guy H; Howard, Chris J; Hope, Jayne C; Brown, Wendy C

    2004-12-01

    Organisms in the genus Anaplasma express an immunodominant major surface protein 2 (MSP2), composed of a central hypervariable region (HVR) flanked by highly conserved regions. Throughout Anaplasma marginale infection, recombination results in the sequential appearance of novel MSP2 variants and subsequent control of rickettsemia by the immune response, leading to persistent infection. To determine whether immune evasion and selection for variant organisms is associated with a predominant response against HVR epitopes, T-cell and linear B-cell epitopes were localized by measuring peripheral blood gamma interferon-secreting cells, proliferation, and antibody binding to 27 overlapping peptides spanning MSP2 in 16 cattle. Similar numbers of MSP2-specific CD4(+) T-cell epitopes eliciting responses of similar magnitude were found in conserved and hypervariable regions. T-cell epitope clusters recognized by the majority of animals were identified in the HVR (amino acids [aa] 171 to 229) and conserved regions (aa 101 to 170 and 272 to 361). In contrast, linear B-cell epitopes were concentrated in the HVR, residing within hydrophilic sequences. The pattern of recognition of epitope clusters by T cells and of HVR epitopes by B cells is consistent with the influence of protein structure on epitope recognition.

  19. Caracterização da imunogenicidade das proteínas recombinantes Virb9, Virb10 e fator termo instável de Elongação de Peptídeos de Anaplasma marginale em camundongos

    Directory of Open Access Journals (Sweden)

    Ana Beatriz Canevari Castelão

    2012-10-01

    Full Text Available Considerando as limitações dos atuais métodos de controle contra a anaplasmose bovina, o desenvolvimento de uma vacina efetiva se faz necessário. A partir do advento da análise genômica e proteômica, novas proteínas de membrana de Anaplasma marginale foram identificadas como possíveis candidatas a componentes de uma vacina, tais como, VirB9,VirB10 e Fator Termo Instavél de Elongação de Peptídeos (EF-Tu. Embora estas proteínas ainda não estejam bem caracterizadas na membrana de A. marginale, a produção destas na forma recombinante (rVirB 9, rVirB10 e rEF-Tutem sido realizada, mas as mesmas ainda não foram exploradas em formulações vacinais. Neste trabalho, avaliou-se ouso de rVirB9, rVirB10 e rEF-Tu emulsionadas em adjuvante Montanide em camundongos. Nas condições testadas, verificou-se a indução de forte resposta imune humoral com a produção de IgG1 e IgG2a, sendo que as proporções dos níveis de produção destas subclasses indicam predomínio de IgG1. Entretanto, esplenócitos de animais, que foram injetados com rVirB9 ou rVirB10, produziram interferon-gama acima do limite de detecção do ensaio após estimulação in vitro, sinalizando assim resposta celular específica. Assim, novas avaliações serão realizadas com a finalidade de modular o perfil de resposta imune obtido em bovinos e avaliar a proteção contra A. marginale.

  20. Frequency of Anaplasma marginale (Theiler 1910 and Babesia sp in mestizo bovine Zebu, in the Municipality of Ixiamas county Abel Iturralde Department of The La Paz, Bolivia

    Directory of Open Access Journals (Sweden)

    Mercado Alvaro

    2011-08-01

    Full Text Available The present work one carries out in the Municipality of Ixiamas County Abel Iturralde of the department of Peace-Bolivia, between May and August of 2010. The objective was to determine the presence of Anaplama sp and Babesia sp, through sanguine smear, they took 160 samples of blood, 40 bovine of the four areas they have been evaluated. The results indicate the presence of Anaplasma sp 6,90%, 6,20% in females and 9,70% in males, this represents 2,50% for the area TO, 5,00% area B, 17,50% area C and 2,50% area D. According to the category 12,50% in calves, 0,00% in torillos, 4,80% in bulls, 6,20% in cows and 14,30% in heifers. The presence of Babesia sp 3,13%, with relationship to the sex 3,10% in females and 3,22% in males, being observed 2,50% in the area TO, 5,00% in the area B, 5,00% in the area C and 0,00% in the area D, according to the category 0,00% in calves, torillos 4,80% bulls, 2,73% vacates and 7,14% in heifers.

  1. Molecular biological identification of Babesia, Theileria, and Anaplasma species in cattle in Egypt using PCR assays, gene sequence analysis and a novel DNA microarray.

    Science.gov (United States)

    El-Ashker, Maged; Hotzel, Helmut; Gwida, Mayada; El-Beskawy, Mohamed; Silaghi, Cornelia; Tomaso, Herbert

    2015-01-30

    In this preliminary study, a novel DNA microarray system was tested for the diagnosis of bovine piroplasmosis and anaplasmosis in comparison with microscopy and PCR assay results. In the Dakahlia Governorate, Egypt, 164 cattle were investigated for the presence of piroplasms and Anaplasma species. All investigated cattle were clinically examined. Blood samples were screened for the presence of blood parasites using microscopy and PCR assays. Seventy-one animals were acutely ill, whereas 93 were apparently healthy. In acutely ill cattle, Babesia/Theileria species (n=11) and Anaplasma marginale (n=10) were detected. Mixed infections with Babesia/Theileria spp. and A. marginale were present in two further cases. A. marginale infections were also detected in apparently healthy subjects (n=23). The results of PCR assays were confirmed by DNA sequencing. All samples that were positive by PCR for Babesia/Theileria spp. gave also positive results in the microarray analysis. The microarray chips identified Babesia bovis (n=12) and Babesia bigemina (n=2). Cattle with babesiosis were likely to have hemoglobinuria and nervous signs when compared to those with anaplasmosis that frequently had bloody feces. We conclude that clinical examination in combination with microscopy are still very useful in diagnosing acute cases of babesiosis and anaplasmosis, but a combination of molecular biological diagnostic assays will detect even asymptomatic carriers. In perspective, parallel detection of Babesia/Theileria spp. and A. marginale infections using a single microarray system will be a valuable improvement. Copyright © 2015 The Authors. Published by Elsevier B.V. All rights reserved.

  2. Effect of milk production system on the enzootic stability to Anaplasma marginale and Babesia bovis in calves in the Campo das Vertentes region of Minas Gerais state, BrazilEfeito do sistema de produção de leite sobre a estabilidade enzoótica para Anaplasma marginale e Babesia bovis em bezerras na região do Campo das Vertentes de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães Rocha

    2012-04-01

    Full Text Available We conducted a cross-sectional observational study, in order to determine the frequency of anti-A. marginale and anti-B. bovis antibodies in calves from four to 12 months of age from ten farms that producing B type milk and an equal number that produce raw milk refrigerated, located in the Campo das Vertentes region of Minas Gerais state, in the period September 2008 to August 2009. Blood smears were performed, serologic testing by indirect immunofluorescence technique (IFAT, given the packed cell volume, rickettsemia, and the clinical scores of animals infected by A. marginale. In the farms that produce B type milk, the overall average frequency of seropositive calves was 94.47% (166/176 and 89.20% (157/176 for A. marginale and B. bovis, respectively. Already on the farms that produce raw milk refrigerated, the overall average frequency of A. marginale was 92.59% (149/161 and for B. bovis from 86.30% (139/161, and there was no significant difference (p > 0.05 in the frequency of calves infected for both hemoparasitic between the two systems of milk production. Statistically significant (p 0.05 among calves from properties that produce B type milk and raw milk refrigerated. The results of this study indicate that, in the Campos das Vertentes region of Minas Gerais, the production system does not interfere with the enzootic stability for A. marginale and B. bovis in calves from dairy farms B milk or raw milk refrigerated, with low probability of anaplasmosis and/or babesiosis in adults animals.Foi realizado um estudo observacional do tipo transversal, com o objetivo de determinar a frequência de anticorpos anti-A. marginale e B. bovis em 337 bezerras com idade entre quatro a 12 meses, oriundas de dez propriedades produtoras de leite B e igual número de fazendas de leite cru refrigerado (leite C, na região do Campo das Vertentes de Minas Gerais, no período de setembro de 2008 a agosto de 2009. Foram realizados esfregaços sangu

  3. Validation of an improved anaplasma antibody cELISA kit for detection of anaplasma ovis antibody in domestic sheep at the U.S. Sheep Experiment Station in Dubois, ID

    Science.gov (United States)

    An accurate and simple-to-perform new version of a competitive ELISA (cELISA) kit that became commercially available in 2015 for testing of cattle for antibody to Anaplasma marginale was validated for detection of Anaplasma ovis antibody in domestic sheep. True positives and negatives were identifie...

  4. Detection and identification of Anaplasma phagocytophilum, Borrelia burgdorferi, and Rickettsia helvetica in Danish Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Skarphédinsson, Sigurdur; Lyholm, Birgitte Fjendbo; Ljungberg, Marianne

    2007-01-01

    % of adult ticks. The difference in prevalence between Anaplasma and Borrelia in adult ticks supports the idea that their maintenance cycles in nature may be different. Ticks were also infected with Rickettsia helvetica. Our study indicates that A. phagocytophilum prevalence in ticks in Denmark is as high...

  5. Diversidad genética de la región variable de los genes msp1a y msp4 en cepas de Anaplasma marginale de México

    Directory of Open Access Journals (Sweden)

    Rafael Jiménez Ocampo

    2012-01-01

    Full Text Available La anaplasmosis es de difícil control debido a la diversidad genética de la rickettsia. La proteína Msp1a, compuesta de repetidos variables de entre 23 y 31 aminoácidos en su región variable y la proteína Msp4, son dos de las proteínas de superficie más estudiadas en A. marginale y han sido ampliamente usadas como marcadores genéticos en la caracterización de cepas de A. marginale de diferentes orígenes geográficos. En este trabajo se analizaron, la región variable de la proteína Msp1a y la proteína Msp4 de 10 cepas mexicanas. En el caso de Msp1a, se observó un patrón de segregación que contiene los repetidos (alpha, beta, beta, gama en diferentes modalidades a lo largo de aislamientos del Golfo de México, principalmente en zonas de estabilidad enzoótica, mientras que la máxima variabilidad se presentó en Tamaulipas, en aislamientos de un brote de la enfermedad, es decir en zonas de inestabilidad. La diversidad observada no es tan extensa como se esperaba y, misma que se puede explicar por la presión que el sistema inmune del hospedero ejerce contra la rickettsia y los mecanismos de esta última para evadirla. En el caso de la proteína Msp4, la secuencia fue altamente conservada tanto en nucleótidos como en aminoácidos para los aislados en estudio, aunque, se observan diferencias con lo previamente reportado en México para este marcador.

  6. Vaccinomics Approach to the Identification of Candidate Protective Antigens for the Control of Tick Vector Infestations and Anaplasma phagocytophilum Infection

    Directory of Open Access Journals (Sweden)

    Marinela Contreras

    2017-08-01

    Full Text Available Anaplasma phagocytophilum is an emerging tick-borne pathogen causing human granulocytic anaplasmosis (HGA, tick-borne fever (TBF in small ruminants, and other forms of anaplasmosis in different domestic and wild animals. The main vectors of this pathogen are Ixodes tick species, particularly I. scapularis in the United States and I. ricinus in Europe. One of the main limitations for the development of effective vaccines for the prevention and control of A. phagocytophilum infection and transmission is the identification of effective tick protective antigens. The objective of this study was to apply a vaccinomics approach to I. scapularis-A. phagocytophilum interactions for the identification and characterization of candidate tick protective antigens for the control of vector infestations and A. phagocytophilum infection. The vaccinomics pipeline included the use of quantitative transcriptomics and proteomics data from uninfected and A. phagocytophilum-infected I. scapularis ticks for the selection of candidate protective antigens based on the variation in tick mRNA and protein levels in response to infection, their putative biological function, and the effect of antibodies against these proteins on tick cell apoptosis and pathogen infection. The characterization of selected candidate tick protective antigens included the identification and characterization of I. ricinus homologs, functional characterization by different methodologies including RNA interference, immunofluorescence, gene expression profiling, and artificial tick feeding on rabbit antibodies against the recombinant antigens to select the candidates for vaccination trials. The vaccinomics pipeline developed in this study resulted in the identification of two candidate tick protective antigens that could be selected for future vaccination trials. The results showed that I. scapularis lipocalin (ISCW005600 and lectin pathway inhibitor (AAY66632 and I. ricinus homologs constitute

  7. Epidemiology of Babesia, Anaplasma and Trypanosoma species using a new expanded reverse line blot hybridization assay.

    Science.gov (United States)

    Paoletta, Martina Soledad; López Arias, Ludmila; de la Fournière, Sofía; Guillemi, Eliana Carolina; Luciani, Carlos; Sarmiento, Néstor Fabián; Mosqueda, Juan; Farber, Marisa Diana; Wilkowsky, Silvina Elizabeth

    2018-02-01

    Vector-borne hemoparasitic infections are a major problem that affects livestock industries worldwide, particularly in tropical and subtropical regions. In this work, a reverse line blot (RLB) hybridization assay was developed for the simultaneous detection and identification of Anaplasma, Babesia and bovine trypanosomes, encompassing in this way the most relevant hemoparasites that affect cattle. A total of 186 bovine blood samples collected from two different ecoepidemiological regions of northeast Argentina, with and without tick control, were analyzed with this new RLB. High diversity of parasites, such as Babesia bovis, B. bigemina, Anaplasma marginale and three different Trypanosoma species, was found. High rates of coinfections were also detected, and significant differences were observed not only in the prevalence of parasites but also in the level of coinfections between the two analyzed areas. Regarding the Trypanosoma genus, we provide molecular evidence of the presence of T. vivax and T. theileri for the first time in Argentina. Besides, since the RLB is a prospective tool, it allowed the identification of a yet unknown bovine trypanosome which could not be assigned to any of the bovine species known so far. In the present study we provide new insights on the prevalence of several pathogens that directly impact on livestock production in Argentina. The RLB assay developed here allows to identify simultaneously numerous pathogenic species which can also be easily expanded to detect other blood borne pathogens. These characteristics make the RLB hybridization assay an essential tool for epidemiological survey of all vector-borne pathogens. Copyright © 2017 Elsevier GmbH. All rights reserved.

  8. Spatio-temporal variations and genetic diversity of Anaplasma spp. in cattle from the North of Tunisia.

    Science.gov (United States)

    Belkahia, Hanène; Ben Said, Mourad; El Mabrouk, Narjesse; Saidani, Mariem; Cherni, Chayma; Ben Hassen, Mariem; Bouattour, Ali; Messadi, Lilia

    2017-09-01

    In cattle, anaplasmosis is a tick-borne rickettsial disease caused by Anaplasma marginale, A. centrale, A. phagocytophilum, and A. bovis. To date, no information concerning the seasonal dynamics of single and/or mixed infections by different Anaplasma species in bovines are available in Tunisia. In this work, a total of 1035 blood bovine samples were collected in spring (n=367), summer (n=248), autumn (n=244) and winter (n=176) from five different governorates belonging to three bioclimatic zones from the North of Tunisia. Molecular survey of A. marginale, A. centrale and A. bovis in cattle showed that average prevalence rates were 4.7% (minimum 4.1% in autumn and maximum 5.6% in summer), 7% (minimum 3.9% in winter and maximum 10.7% in autumn) and 4.9% (minimum 2.7% in spring and maximum 7.3% in summer), respectively. A. phagocytophilum was not detected in all investigated cattle. Seasonal variations of Anaplasma spp. infection and co-infection rates in overall and/or according to each bioclimatic area were recorded. Molecular characterization of A. marginale msp4 gene indicated a high sequence homology of revealed strains with A. marginale sequences from African countries. Alignment of 16S rRNA A. centrale sequences showed that Tunisian strains were identical to the vaccine strain from several sub-Saharan African and European countries. The comparison of the 16S rRNA sequences of A. bovis variants showed a perfect homology between Tunisian variants isolated from cattle, goats and sheep. These present data are essential to estimate the risk of bovine anaplasmosis in order to develop integrated control policies against multi-species pathogen communities, infecting humans and different animal species, in the country. Copyright © 2017 Elsevier B.V. All rights reserved.

  9. Functional and Immunological Relevance of Anaplasma marginale Major Surface Protein 1a Sequence and Structural Analysis

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Passos, L.M.F.; Lis, K.; Kenneil, R.; Valdés, James J.; Ferrolho, J.; Tonk, Miray; Pohl, A.E.; Grubhoffer, Libor; Zweygarth, E.; Shkap, V.; Ribeiro, M.F.B.; Estrada-Pena, A.; Kocan, K.M.; de la Fuente, J.

    2013-01-01

    Roč. 8, č. 6 (2013), e65243 E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 238511 - POSTICK Institutional support: RVO:60077344 Keywords : CD4(+) T-lymphocytes * B-cell epitopes * salivary glands Subject RIV: EC - Immunology Impact factor: 3.534, year: 2013

  10. Molecular detection of Rickettsia, Anaplasma, Coxiella and Francisella bacteria in ticks collected from Artiodactyla in Thailand.

    Science.gov (United States)

    Sumrandee, Chalao; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2016-07-01

    A total of 79 ticks collected from Sambar deer (Cervus unicolor), Barking deer (Muntiacus muntjak) and Wild boar (Sus scrofa) were examined by PCR for the presence of Rickettsia, Anaplasma, Coxiella, and Francisella bacteria. Of the 79 ticks, 13% tested positive for Rickettsia, 15% tested positive for Anaplasma, 4% tested positive for Coxiella, and 3% tested positive for Francisella. Interestingly, triple infection with Anaplasma, Rickettsia and Francisella was determined in a Dermacentor auratus tick. Moreover, another triple infection with Rickettsia, Anaplasma, and Coxiella was found in a Haemaphysalis lagrangei tick. Double infection of Rickettsia with Coxiella was also detected in another H. lagrangei tick. From the phylogenetic analyses, we found a Rickettsia sp. with a close evolutionary relationship to Rickettsia bellii in the H. lagrangei tick. We also found the first evidence of a Rickettsia sp. that is closely related to Rickettsia tamurae in Rhipicephalus (Boophilus) microplus ticks from Thailand. H. lagrangei and Haemaphysalis obesa ticks collected from Sambar deer tested positive for Anaplasma species form the same clade with Anaplasma bovis. In contrast, other H. lagrangei ticks collected from Sambar deer and D. auratus ticks collected from Wild boar were also reported for the first time to be infected with an Anaplasma species that is closely related to Anaplasma platys. The phylogenetic analysis of the 16S rRNA gene of Coxiella bacteria revealed that Coxiella symbionts from H. lagrangei formed a distinctly different lineage from Coxiella burnetii (a human pathogen). Additionally, Francisella bacteria identified in D. auratus ticks were found to be distantly related to a group of pathogenic Francisella species. The identification of these bacteria in several feeding ticks suggests the risk of various emerging tick-borne diseases and endosymbionts in humans, wildlife, and domestic animals in Thailand. Copyright © 2016 Elsevier GmbH. All rights

  11. Molecular Epidemiological Survey and Genetic Characterization of Anaplasma Species in Mongolian Livestock.

    Science.gov (United States)

    Ochirkhuu, Nyamsuren; Konnai, Satoru; Odbileg, Raadan; Murata, Shiro; Ohashi, Kazuhiko

    2017-08-01

    Anaplasma species are obligate intracellular rickettsial pathogens that cause great economic loss to the animal industry. Few studies on Anaplasma infections in Mongolian livestock have been conducted. This study examined the prevalence of Anaplasma marginale, Anaplasma ovis, Anaplasma phagocytophilum, and Anaplasma bovis by polymerase chain reaction assay in 928 blood samples collected from native cattle and dairy cattle (Bos taurus), yaks (Bos grunniens), sheep (Ovis aries), and goats (Capra aegagrus hircus) in four provinces of Ulaanbaatar city in Mongolia. We genetically characterized positive samples through sequencing analysis based on the heat-shock protein groEL, major surface protein 4 (msp4), and 16S rRNA genes. Only A. ovis was detected in Mongolian livestock (cattle, yaks, sheep, and goats), with 413 animals (44.5%) positive for groEL and 308 animals (33.2%) positive for msp4 genes. In the phylogenetic tree, we separated A. ovis sequences into two distinct clusters based on the groEL gene. One cluster comprised sequences derived mainly from sheep and goats, which was similar to that in A. ovis isolates from other countries. The other divergent cluster comprised sequences derived from cattle and yaks and appeared to be newly branched from that in previously published single isolates in Mongolian cattle. In addition, the msp4 gene of A. ovis using same and different samples with groEL gene of the pathogen demonstrated that all sequences derived from all animal species, except for three sequences derived from cattle and yak, were clustered together, and were identical or similar to those in isolates from other countries. We used 16S rRNA gene sequences to investigate the genetically divergent A. ovis and identified high homology of 99.3-100%. However, the sequences derived from cattle did not match those derived from sheep and goats. The results of this study on the prevalence and molecular characterization of A. ovis in Mongolian livestock can facilitate

  12. Detection and phylogenetic characterisation of novel Anaplasma and Ehrlichia species in Amblyomma triguttatum subsp. from four allopatric populations in Australia.

    Science.gov (United States)

    Gofton, Alexander W; Waudby, Helen P; Petit, Sophie; Greay, Telleasha L; Ryan, Una M; Irwin, Peter J

    2017-08-01

    Anaplasma and Ehrlichia spp. are tick-borne pathogens that can cause severe disease in domestic animals, and several species are responsible for emerging zoonoses in the northern hemisphere. Until recently, the only members of these genera reported in Australia (A. marginale, A. centrale, and A. platys) were introduced from other continents, through the importation of domestic animals and their associated ticks. However, unique Anaplasma and Ehrlichia 16S rRNA gene sequences were recently detected for the first time in native Australian ticks, particularly in Amblyomma triguttatum subsp. ticks from southwest Western Australia (WA). We used molecular techniques to survey Am. triguttatum subsp. ticks from four allopatric populations in southern and western Australia for Anaplasma and Ehrlichia species, and described here the phylogeny of these novel organisms. An A. bovis variant (genotype Y11) was detected in ticks from two study sites; Yanchep National Park (12/280, 4.3%) and Barrow Island (1/69, 1.4%). Phylogenetic analysis of 16S rRNA and groEL gene sequences concluded that A. bovis genotype Y11 is a unique genetic variant, distinct from other A. bovis isolates worldwide. Additionally, a novel Ehrlichia species was detected in Am. triguttatum subsp. from three of the four study sites; Yanchep National Park (18/280, 6.4%), Bungendore Park (8/46, 17.4%), and Innes National Park (9/214, 4.2%), but not from Barrow Island. Phylogenetic analysis of 16S, groEL, gltA, and map1 gene sequences revealed that this Ehrlichia sp. is most closely related to, but clearly distinct from, E. ruminantium and Ehrlichia sp. Panola Mountain. We propose to designate this new species 'Candidatus Ehrlichia occidentalis'. Anaplasma bovis genotype Y11 and 'Candidatus E. occidentalis' are the first Anaplasma and Ehrlichia species to be recorded in native Australian ticks. Copyright © 2017 Elsevier GmbH. All rights reserved.

  13. Alpha proteobacteria of genus Anaplasma (Rickettsiales: Anaplasmataceae): Epidemiology and characteristics of Anaplasma species related to veterinary and public health importance.

    Science.gov (United States)

    Atif, Farhan Ahmad

    2016-05-01

    The Anaplasma species are important globally distributed tick-transmitted bacteria of veterinary and public health importance. These pathogens, cause anaplasmosis in domestic and wild animal species including humans. Rhipicephalus, Ixodes, Dermacentor and Amblyomma genera of ticks are the important vectors of Anaplasma. Acute anaplasmosis is usually diagnosed upon blood smear examination followed by antibodies and nucleic acid detection. All age groups are susceptible but prevalence increases with age. Serological cross-reactivity is one of the important issues among Anaplasma species. They co-exist and concurrent infections occur in animals and ticks in same geographic area. These are closely related bacteria and share various common attributes which should be considered while developing vaccines and diagnostic assays. Movement of susceptible animals from non-endemic to endemic regions is the major risk factor of bovine/ovine anaplasmosis and tick-borne fever. Tetracyclines are currently available drugs for clearance of infection and treatment in humans and animals. Worldwide vaccine is not yet available. Identification, elimination of reservoirs, vector control (chemical and biological), endemic stability, habitat modification, rearing of tick resistant breeds, chemotherapy and tick vaccination are major control measures of animal anaplasmosis. Identification of reservoirs and minimizing the high-risk tick exposure activities are important control strategies for human granulocytic anaplasmosis.

  14. The Life and Death of Anaplasma

    Centers for Disease Control (CDC) Podcasts

    Dr. Setu Vora, medical director of critical care and physician director of performance improvement at Backus Hospital in Norwich, Connecticut, reads his poem The Life and Death of Anaplasma and discusses the poem’s origins.

  15. The Life and Death of Anaplasma

    Centers for Disease Control (CDC) Podcasts

    2012-03-30

    Dr. Setu Vora, medical director of critical care and physician director of performance improvement at Backus Hospital in Norwich, Connecticut, reads his poem The Life and Death of Anaplasma and discusses the poem’s origins.  Created: 3/30/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 4/2/2012.

  16. Anaplasma, Ehrlichia and Rickettsia species infections in cats

    NARCIS (Netherlands)

    Pennisi, Maria Grazia; Hofmann-Lehmann, Regina; Radford, Alan D; Tasker, Séverine; Belák, Sándor; Addie, Diane D; Boucraut-Baralon, Corine; Egberink, Herman; Frymus, Tadeusz; Gruffydd-Jones, Tim; Hartmann, Katrin; Horzinek, Marian C; Hosie, Margaret J; Lloret, Albert; Lutz, Hans; Marsilio, Fulvio; Thiry, Etienne; Truyen, Uwe; Möstl, Karin

    2017-01-01

    OVERVIEW: Anaplasma species, Ehrlichia species and Rickettsia species are vector-borne pathogens infecting a wide variety of mammals, but causing disease in very few of them. Infection in cats: Anaplasma phagocytophilum is the most important feline pathogen among these rickettsial organisms, and

  17. Arnaldo Saraiva y las literaturas marginales y marginalizadas

    Directory of Open Access Journals (Sweden)

    Carlos Nogueira

    2014-04-01

    Full Text Available This article focuses on Arnaldo Saraiva’s studies and teaching in the area of the socalled marginal or marginalized literatures of Portugal and Brazil, and on the unusually significant impact they have had on successive generations of teachers, cultural agents and literary scholars. RESUMEN: El presente trabajo versa sobre los estudios y la actividad docente de Arnaldo Saraiva en el área de las llamadas literaturas marginales o marginalizadas de Portugal y de Brasil, así como el impacto extrañamente significativo que aquellos han tenido en sucesivas generaciones de profesores, agentes culturales o estudiosos de la literatura.

  18. High Prevalence of Anaplasma spp. in Small Ruminants in Morocco.

    Science.gov (United States)

    Ait Lbacha, H; Alali, S; Zouagui, Z; El Mamoun, L; Rhalem, A; Petit, E; Haddad, N; Gandoin, C; Boulouis, H-J; Maillard, R

    2017-02-01

    The prevalence of infection by Anaplasma spp. (including Anaplasma phagocytophilum) was determined using blood smear microscopy and PCR through screening of small ruminant blood samples collected from seven regions of Morocco. Co-infections of Anaplasma spp., Babesia spp, Theileria spp. and Mycoplasma spp. were investigated and risk factors for Anaplasma spp. infection assessed. A total of 422 small ruminant blood samples were randomly collected from 70 flocks. Individual animal (breed, age, tick burden and previous treatment) and flock data (GPS coordinate of farm, size of flock and livestock production system) were collected. Upon examination of blood smears, 375 blood samples (88.9%) were found to contain Anaplasma-like erythrocytic inclusion bodies. Upon screening with a large spectrum PCR targeting the Anaplasma 16S rRNA region, 303 (71%) samples were found to be positive. All 303 samples screened with the A. phagocytophilum-specific PCR, which targets the msp2 region, were found to be negative. Differences in prevalence were found to be statistically significant with regard to region, altitude, flock size, livestock production system, grazing system, presence of clinical cases and application of tick and tick-borne diseases prophylactic measures. Kappa analysis revealed a poor concordance between microscopy and PCR (k = 0.14). Agreement with PCR is improved by considering microscopy and packed cell volume (PCV) in parallel. The prevalence of double infections was found to be 1.7, 2.5 and 24% for Anaplasma-Babesia, Anaplasma-Mycoplasma and Anaplasma-Theileria, respectively. Co-infection with three or more haemoparasites was found in 1.6% of animals examined. In conclusion, we demonstrate the high burden of anaplasmosis in small ruminants in Morocco and the high prevalence of co-infections of tick-borne diseases. There is an urgent need to improve the control of this neglected group of diseases. © 2015 Blackwell Verlag GmbH.

  19. EL MISTICISMO de los espíritus marginales

    Directory of Open Access Journals (Sweden)

    JOSÉ JORGE DE CARVALHO

    2001-01-01

    Full Text Available EL ARTÍCULO OFRECE UNA VISIÓN PANORÁMICA DE LAS MANIFESTACIONES RELIGIOSAS brasileñas marginales con relación al cristianismo dominante, entre las cuales se destacan el espiritismo kardecista y las varias formas de religiones de origen africano, todas de tradición oral. Un punto común a esas expresiones religiosas es la experiencia del trance y la posesión, que busco teorizar con la idea de la apófasis radical. En la segunda mitad del ensayo presento una antología de textos sagrados afrobrasileños, los cuales comento en una perspectiva de simbología comparada. Ellos señalan la presencia de un misticismo análogo al de los místicos de las llamadas "grandes religiones" o "religiones del libro". Propongo, entonces, incluir esas tradiciones marginales como parte constitutiva de la experiencia religiosa de la humanidad como un todo.

  20. Detection of Rickettsia and Anaplasma from hard ticks in Thailand.

    Science.gov (United States)

    Malaisri, Premnika; Hirunkanokpun, Supanee; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2015-12-01

    We collected a total of 169 adult hard ticks and 120 nymphs from under the leaves of plants located along tourist nature trails in ten localities. The results present data examining the vector competence of ticks of different genera and the presence of Rickettsia and Anaplasma species. The ticks belonged to three genera, Amblyomma, Dermacentor, and Haemaphysalis, comprising 11 species. Rickettsia bacteria were detected at three collection sites, while Anaplasma bacteria were detected at only one site. Phylogenetic analysis revealed new rickettsia genotypes from Thailand that were closely related to Rickettsia tamurae, Rickettsia monacensis, and Rickettsia montana. This study was also the first to show that Anaplasma bacteria are found in Haemaphysalis shimoga ticks and are closely related evolutionarily to Anaplasma bovis. These results provide additional information for the geographical distribution of tick species and tick-borne bacteria in Thailand and can therefore be applied for ecotourism management. © 2015 The Society for Vector Ecology.

  1. Molecular detection of Anaplasma platys, Anaplasma phagocytophilum and Wolbachia sp. but not Ehrlichia canis in Croatian dogs.

    Science.gov (United States)

    Huber, Doroteja; Reil, Irena; Duvnjak, Sanja; Jurković, Daria; Lukačević, Damir; Pilat, Miroslav; Beck, Ana; Mihaljević, Željko; Vojta, Lea; Polkinghorne, Adam; Beck, Relja

    2017-11-01

    The bacteria Anaplasma platys, Anaplasma phagocytophilum and Ehrlichia canis are tick-borne agents that cause canine vector-borne disease. The prevalence of these pathogens in South Eastern Europe is unknown with the exception of an isolated case of A. platys detected in a dog imported into Germany from Croatia. To gain a better insight into their presence and prevalence, PCR-based screening for these bacterial pathogens was performed on domesticated dogs from different regions of Croatia. Blood samples from 1080 apparently healthy dogs from coastal and continental parts of Croatia as well as tissue samples collected from 63 deceased dogs with a history of anaemia and thrombocytopenia were collected for molecular screening by an Anaplasmataceae-specific 16S rRNA conventional PCR. Positive samples were confirmed using a second Anaplasmataceae-specific PCR assay with the PCR product sequenced for the purpose of bacterial species identification. All sequenced isolates were georeferenced and a kernel intensity estimator was used to identify clusters of greater case intensity. 42/1080 (3.8%; CI 2.7-5.0) of the healthy dogs were PCR positive for bacteria in the Anaplasmataceae. Sequencing of the 16S rRNA gene amplified from these positive samples revealed the presence of A. platys in 2.5% (CI 1.6-3.4%, 27 dogs), A. phagocytophilum in 0.3% (CI 0-0.6%, 3 dogs) and a Wolbachia endosymbiont in 1.1% (CI 0.4-1.6%, 12 dogs) of dogs screened in this study. Necropsied dogs were free from infection. Notably, no evidence of E. canis infection was found in any animal. This survey represents a rare molecular study of Anaplasmataceae in dogs in South Eastern Europe, confirming the presence of A. platys and A. phagocytophilum but not E. canis. The absence of E. canis was surprising given it has been described in all other Mediterranean countries surveyed and raises questions over the regional vector capacity of the Rhipicephalus sanguineus tick.

  2. Ticks circulate Anaplasma, Ehrlichia, Babesia and Theileria parasites in North of Iran.

    Science.gov (United States)

    Bekloo, Ahmad Jafar; Bakhshi, Hasan; Soufizadeh, Ayoub; Sedaghat, Mohammad Mehdi; Bekloo, Romina Jafar; Ramzgouyan, Maryam Roya; Chegeni, Asadollah Hosseini; Faghihi, Faezeh; Telmadarraiy, Zakkyeh

    2017-12-15

    Ticks serve as important vectors of some pathogens of medical importance all over the world and identification of their rate of infection plays an important role for further control of diseases. In the current study, we investigated on ticks collected from north of Iran where raising and caring livestock are the main task of the people in order to find evidences of infection of Babesia, Theileria, Anaplasma and Ehrlichia microbial agents. Totally, 609 hard tick species from two genera Hyalomma and Rhipicephalus including; Hy. scupense, Hy. dromedarii, Hy. rufipes, Hy. marginatum, Hy. asiaticum, Hy. anatolicum, R. bursa, R. sanguineus and R. turanicus were identified. Molecular analysis revealed the presence of Anaplasma, Ehrlichia, Babesia and Theileria microorganism agents in all collected tick species except Hy. asiaticum and R. turanicus. To the best of our knowledge, this is the first report on identification of B. occultans in Hyalomma anatolicum and B. ovis in Hyalomma sp in Iran. Copyright © 2017 Elsevier B.V. All rights reserved.

  3. Prevalence of Anaplasma phagocytophilum in North Carolina Eastern Black Bears ( Ursus americanus ).

    Science.gov (United States)

    Westmoreland, Lori S H; Stoskopf, Michael K; Maggi, Ricardo G

    2016-10-01

    We detected Anaplasma phagocytophilum by DNA amplification in whole blood from free-ranging, hunter-killed American black bears ( Ursus americanus ) from the east coast of North Carolina, US. Molecular prevalence for Anaplasma phagocytophilum was 3% from 68 black bears. No DNA of other Anaplasma or Ehrlichia spp. was identified.

  4. Violencia basada en género en zonas urbanas y urbano-marginales de Lima y Callao, 2007 - 2010

    Directory of Open Access Journals (Sweden)

    Pedro Mascaro-Sánchez

    2012-04-01

    Full Text Available Objetivos: Determinar y comparar las características de la violencia en pobladores de zonas urbanas y urbano-marginales. Diseño: Estudio epidemiológico descriptivo. Institución: Escuela de Obstetricia, Facultad de Medicina, Universidad Nacional Mayor de San Marcos, Lima, Perú. Participantes: Mujeres de Lima y Callao. Intervenciones: Entre los años 2007 y 2010, se aplicó una entrevista estructurada a 3 971 mujeres de zonas urbanas y urbano-marginales de Lima y Callao. Se incluyó mujeres residentes de la zona, excluyéndose aquellas con problemas psicológicos evidentes y problemas del habla. Los datos fueron analizados con estadísticas descriptivas y con el estadístico chi cuadrado, significativo a un nivel p<0,05. Principales medidas de resultados: Violencia física. Resultados: De las entrevistadas, 39% tenía entre 20 y 24 años de edad. El 47% identificó violencia física, siendo similar en zonas urbanas y urbano-marginales. Los empujones y bofetadas fueron la forma más frecuente de violencia en ambas áreas. Con respecto al estudio de la violencia psicológica, fueron más frecuentes la utilización de gritos y celos por posesividad, también en ambas áreas. El gasto de la pareja sin la consulta fue ligeramente mayor para el área urbano marginal (49% que para el área urbana (42%. El intento de tener relaciones sexuales contra su voluntad fue el tipo de violencia más frecuente (37%, más en el área urbana (41% que en el área urbano marginal (34%. Conclusiones: Se evidenció episodios de violencia física, psicológica, económica y sexual similares para el área urbana y el área urbano-marginal, siendo la violencia sexual más frecuente en el área urbana.

  5. Molecular detection of Anaplasma bovis, Ehrlichia canis and Hepatozoon felis in cats from Luanda, Angola.

    Science.gov (United States)

    Oliveira, Ana Cristina; Luz, Maria Francisca; Granada, Sara; Vilhena, Hugo; Nachum-Biala, Yaarit; Lopes, Ana Patrícia; Cardoso, Luís; Baneth, Gad

    2018-03-20

    Molecular identification of tick-borne pathogen infection in cats from Africa is scarce. The presence of bacterial (Anaplasma and Ehrlichia) and protozoal (Babesia and Hepatozoon) agents was investigated in blood samples from 102 domestic cats from Luanda, Angola, by polymerase chain reaction and DNA sequencing. Three cats (2.9%) were found infected with Ehrlichia canis, three (2.9%) with Hepatozoon felis and one (1.0%) with Anaplasma bovis. The prevalence of infections with one single agent was 4.9%, and that of infection with two agents (i.e. E. canis and H. felis) was 1.0%. In total, six cats (5.9%) were found infected with at least one of the detected tick-borne agents. This is the first report of A. bovis, E. canis and H. felis in cats from Angola. To the best of our knowledge, A. bovis is also being reported for the first time in domestic cats outside of Japan. Cats are at a low to moderate risk of being infected with tick-borne agents in Luanda.

  6. Anaplasma phagocytophilum in ticks in Slovenia

    Directory of Open Access Journals (Sweden)

    Knap Nataša

    2010-11-01

    Full Text Available Abstract Ticks act as vectors of many pathogens of domestic animals and humans. Anaplasma phagocytophilum in Europe is transmitted by the ixodid tick vector Ixodes ricinus. A. phagocytophilum causes a disease with diverse clinical signs in various hosts. A great genetic diversity of the groESL operon of A. phagocytophilum has been found in ticks elsewhere. In Slovenia, the variety of the groESL operon was conducted only on deer samples. In this study, the prevalence of infected ticks was estimated and the diversity of A. phagocytophilum was evaluated. On 8 locations in Slovenia, 1924 and 5049 (6973 I. ricinus ticks were collected from vegetation in the years 2005 and 2006, respectively. All three feeding stages of the tick's life cycle were examined. The prevalence of ticks infected with A. phagocytophilum in the year 2005 and in the year 2006 was 0.31% and 0.63%, respectively, and it did not differ considerably between locations. The similarity among the sequences of groESL ranged from 95.6% to 99.8%. They clustered in two genetic lineages along with A. phagocytophilum from Slovenian deer. One sequence formed a separate cluster. According to our study, the prevalence of A. phagocytophilum in ticks is comparable to the findings in other studies in Europe, and it does not vary considerably between locations and tick stages. According to groESL operon analysis, two genetic lineages have been confirmed and one proposed. Further studies on other genes would be useful to obtain more information on genetic diversity of A. phagocytophilum in ticks in Slovenia.

  7. Construcción de Distribuciones Multivariadas con Marginales Dependientes Usando Cópulas en R

    OpenAIRE

    Jaramillo-Elorza, M. C; Lozano, J. A

    2014-01-01

    Las cópulas se han convertido en una herramienta popular para la construcción de modelos multivariados en campos donde la dependencia multivariada es de gran interés. El propósito de este trabajo es presentar las cópulas tanto en su concepto teórico, como en su implementación en el software estadístico R y profundizar en la construcción de distribuciones multivariadas con marginales dependientes, usando la clase mvdc del paquete copula, la cual permite utilizar varias y diferentes marginales ...

  8. Natural Anaplasma phagocytophilum infection in ticks from a forest area of Selenge province, Mongolia

    Directory of Open Access Journals (Sweden)

    G Javkhlan

    2014-03-01

    Full Text Available Anaplasma phagocytophilum is a zoonotic agent of public health importance, infecting both humans and animals. An investigation of the presence of Anaplasma phagocytophilum as well as Anaplasma platys was conducted in a forest area of Selenge province, Mongolia, where ticks are widely distributed and tick-borne diseases are highly endemic. Ticks were collected and tested using polymerase chain reaction based on groEL methodology. Anaplasma phagocytophilum was detected in 14 (6% of Ixodes persulcatus ticks and four (1% Dermacentor nuttalli ticks; infection of Anaplasma platys was detected in 1% of Ixodes persulcatus ticks and 10% of Dermacentor nuttalli ticks. The phylogenetic tree showed that the Anaplasma phagocytophilum clustered with the Russian group, most likely due to similar geographical locations. This finding is significant for both veterinary and public health officials given that these agents can cause both animal and human illness.

  9. Anaplasma spp. in dogs and owners in north-western Morocco.

    Science.gov (United States)

    Elhamiani Khatat, Sarah; Daminet, Sylvie; Kachani, Malika; Leutenegger, Christian M; Duchateau, Luc; El Amri, Hamid; Hing, Mony; Azrib, Rahma; Sahibi, Hamid

    2017-04-24

    Anaplasma phagocytophilum is an emerging tick-borne zoonotic pathogen of increased interest worldwide which has been detected in northern Africa. Anaplasma platys is also present in this region and could possibly have a zoonotic potential. However, only one recent article reports on the human esposure to A. phagocytophilum in Morocco and no data are available on canine exposure to both bacteria. Therefore, we conducted a cross-sectional epidemiological study aiming to assess both canine and human exposure to Anaplasma spp. in Morocco. A total of 425 dogs (95 urban, 160 rural and 175 working dogs) and 11 dog owners were sampled from four cities of Morocco. Canine blood samples were screened for Anaplasma spp. antibodies by an enzyme-linked immunosorbent assay (ELISA) and for A. phagocytophilum and A. platys DNA by a real-time polymerase chain reaction (RT-PCR) targeting the msp2 gene. Human sera were tested for specific A. phagocytophilum immunoglobulin G (IgG) using a commercial immunofluorescence assay (IFA) kit. Anaplasma spp. antibodies and A. platys DNA were detected in 21.9 and 7.5% of the dogs, respectively. Anaplasma phagocytophilum DNA was not amplified. Anaplasma platys DNA was significantly more frequently amplified for working dogs. No statistically significant differences in the prevalence of Anaplasma spp. antibodies or A. platys DNA detection were observed between sexes, age classes or in relation to exposure to ticks. A total of 348 Rhipicephalus sanguineus (sensu lato) ticks were removed from 35 urban and working dogs. The majority of dog owners (7/10) were seroreactive to A. phagoyctophilum IgG (one sample was excluded because of hemolysis). This study demonstrates the occurrence of Anaplasma spp. exposure and A. platys infection in dogs, and A. phagocytophilum exposure in humans in Morocco.

  10. NNDSS - Table II. Ehrlichiosis and Anaplasmosis, Anaplasma phagocytophilum infection to Ehrlichia chaffeensis infection

    Data.gov (United States)

    U.S. Department of Health & Human Services — NNDSS - Table II. Ehrlichiosis and Anaplasmosis, Anaplasma phagocytophilum infection to Ehrlichia chaffeensis infection - 2018. In this Table, provisional cases of...

  11. La sexualidad en los jóvenes de sectores marginales. Un informe de avance

    OpenAIRE

    Aigneren Aburto, José Miguel

    2004-01-01

    La sexualidad en los jovenes de sectores marginales. El problema es la sexualidad de los adolescentes en un mundo de pobreza e inequidad. Este estudio tiene como objetivo general describir los crudos productos sexuales de la miseria y los mitos que envenenan a la juventud marginal. Es un intento de retratar a aquellos adolescentes que conocen el sexo en la escuela del submundo que esconden los cordones de extrema pobreza del Medellín de hoy. Los resultados citados corresponden a realidades co...

  12. El impuesto al valor agregado en los contratos de campos marginales

    OpenAIRE

    Niquinga Salazar, Oscar Javier

    2007-01-01

    Esta investigación dirigida por los métodos de investigación sistemático, exegético, y teleológico, pretende analizar los contratos petroleros de Campos Marginales utilizados por la legislación ecuatoriana y específicamente, el papel de Impuesto al Valor Agregado en la producción de la Curva Base; ésta, se convierte en una figura contractual innovadora que ha producido una interesante discusión a nivel nacional; sin embargo, la propuesta de este trabajo va encaminado a encontra...

  13. Anaplasma phagocytophilum, Bartonella spp., haemoplasma species and Hepatozoon spp. in ticks infesting cats: a large-scale survey.

    Science.gov (United States)

    Duplan, Florent; Davies, Saran; Filler, Serina; Abdullah, Swaid; Keyte, Sophie; Newbury, Hannah; Helps, Chris R; Wall, Richard; Tasker, Séverine

    2018-03-20

    Ticks derived from cats have rarely been evaluated for the presence of pathogens. The aim of this study was to determine the prevalence of Anaplasma phagocytophilum, Bartonella spp., haemoplasma species and Hepatozoon spp. in ticks collected from cats in the UK. Five hundred and forty DNA samples extracted from 540 ticks collected from cats presenting to veterinarians in UK practices were used. Samples underwent a conventional generic PCR assay for detection of Hepatozoon spp. and real-time quantitative PCR assays for detection of Anaplasma phagocytophilum and three feline haemoplasma species and a generic qPCR for detection of Bartonella spp. Feline 28S rDNA served as an endogenous internal PCR control and was assessed within the haemoplasma qPCR assays. Samples positive on the conventional and quantitative generic PCRs were submitted for DNA sequencing for species identification. Feline 28S rDNA was amplified from 475 of the 540 (88.0%) ticks. No evidence of PCR inhibition was found using an internal amplification control. Of 540 ticks, 19 (3.5%) contained DNA from one of the tick-borne pathogens evaluated. Pathogens detected were: A. phagocytophilum (n = 5; 0.9%), Bartonella spp. (n = 7; 1.3%) [including Bartonella henselae (n = 3; 0.6%) and Bartonella clarridgeiae (n = 1; 0.2%)], haemoplasma species (n = 5; 0.9%), "Candidatus Mycoplasma haemominutum" (n = 3; 0.6%), Mycoplasma haemofelis (n = 1; 0.2%), "Candidatus Mycoplasma turicensis" (n = 1; 0.2%), Hepatozoon spp. (n = 2; 0.4%), Hepatozoon felis (n = 1; 0.2%) and Hepatozoon silvestris (n = 1; 0.2%). These data provide important information on the prevalence of tick-borne pathogens in ticks infesting cats, with the identification of haemoplasma species, A. phagocytophilum, H. felis and Bartonella spp. (including B. henselae and B. clarridgeiae). This study also documents the first report of H. silvestris in ticks collected from domestic cats.

  14. Prevalence of Anaplasma phagocytophilum infection in feral cats in Massachusetts.

    Science.gov (United States)

    Galemore, Erin R; Labato, Mary A; O'Neil, Elizabeth

    2018-01-01

    The primary objective of this study was to determine the prevalence of Anaplasma phagocytophilum infection and exposure in adult feral cats in Massachusetts, an endemic area for A phagocytophilum and its tick vector Ixodes scapularis . The secondary objective was to determine if there were correlations between A phagocytophilum infection and the presence of anemia and thrombocytopenia. Blood samples were collected between June and December 2015 from 175 apparently healthy adult feral cats that were presented to trap and release spay/neuter centers in Massachusetts. Complete blood count, blood smear evaluation, SNAP 4Dx Plus test (IDEXX) and A phagocytophilum PCR were performed on all samples to document acute infection (PCR-positive and/or inclusions observed on blood smear) and exposure to A phagocytophilum (SNAP 4Dx Plus-positive for A phagocytophilum antibodies). The prevalence of exposure to A phagocytophilum in feral cats in Massachusetts was 9.7%, whereas the prevalence of acute infection was 6.9%. All blood smears were negative for Anaplasma species inclusions; therefore, acute infection was defined as testing positive on PCR analysis. No statistically significant correlations were identified for cats that were positive for A phagocytophilum on PCR analysis or SNAP 4Dx Plus test and the presence of anemia or thrombocytopenia. The prevalence of A phagocytophilum exposure in feral cats approaches 10% and is higher than the previously reported national average prevalence of 4.3% in the USA. A phagocytophilum infection may be an emerging infectious disease in cats. Further research is needed to determine the prevalence of clinical illness associated with A phagocytophilum infection in cats living in endemic areas.

  15. Molecular and phylogenetic analysis of Anaplasma spp. in sheep and goats from six provinces of China.

    Science.gov (United States)

    Zhang, Yan; Lv, Yali; Zhang, Feifei; Zhang, Wenjing; Wang, Jinhong; Cui, Yanyan; Wang, Rongjun; Jian, Fuchun; Zhang, Longxian; Ning, Changshen

    2016-12-30

    Members of the genus Anaplasma are important emerging tick-borne pathogens in both humans and animals in tropical and subtropical areas. Here, we investigated the presence of Anaplasma spp. in 621 sheep and 710 goats from six provinces of China. Polymerase chain reaction (PCR) and DNA sequencing were conducted to determine the prevalence of Anaplasma (A.) phagocytophilum, A. ovis and A. bovis targeting the 16S ribosomal RNA or the major surface protein 4 gene. PCR revealed Anaplasma in 39.0% (240/621) of sheep and 45.5% (323/710) of goats. The most frequently detected species was A. ovis (88/621, 14.2% for sheep; 129/710, 18.2% for goats), followed by A. bovis (60/621, 9.7% for sheep; 74/710, 10.4% for goats) and A. phagocytophilum (33/621, 5.3% for sheep; 15/710, 2.1% for goats). Additionally, eight sheep and 20 goats were found to be infected with three pathogens simultaneously. DNA sequencing confirmed the presence of these three Anaplasma species in the investigated areas, and phylogenetic analysis indicated that there was geographic segregation to a certain extent, as well as a relationship between the host and cluster of A. ovis. The results of the present study provide valuable data that helps understand the epidemiology of anaplasmosis in ruminants from China.

  16. Anaplasma phagocytophilum in Danish sheep: confirmation by DNA sequencing

    Directory of Open Access Journals (Sweden)

    Thamsborg Stig M

    2009-12-01

    Full Text Available Abstract Background The presence of Anaplasma phagocytophilum, an Ixodes ricinus transmitted bacterium, was investigated in two flocks of Danish grazing lambs. Direct PCR detection was performed on DNA extracted from blood and serum with subsequent confirmation by DNA sequencing. Methods 31 samples obtained from clinically normal lambs in 2000 from Fussingø, Jutland and 12 samples from ten lambs and two ewes from a clinical outbreak at Feddet, Zealand in 2006 were included in the study. Some of the animals from Feddet had shown clinical signs of polyarthritis and general unthriftiness prior to sampling. DNA extraction was optimized from blood and serum and detection achieved by a 16S rRNA targeted PCR with verification of the product by DNA sequencing. Results Five DNA extracts were found positive by PCR, including two samples from 2000 and three from 2006. For both series of samples the product was verified as A. phagocytophilum by DNA sequencing. Conclusions A. phagocytophilum was detected by molecular methods for the first time in Danish grazing lambs during the two seasons investigated (2000 and 2006.

  17. Intrauterine Transmission of Anaplasma phagocytophilum in Persistently Infected Lambs

    Directory of Open Access Journals (Sweden)

    Snorre Stuen

    2018-02-01

    Full Text Available Anaplasma phagocytophilum, which causes the disease tick-borne fever (TBF, is the most important tick-borne pathogen in European animals. TBF may contribute to severe welfare challenges and economic losses in the Norwegian sheep industry. The bacterium causes a persistent infection in sheep and several other animal species. The objective of this study was to investigate whether intrauterine transmission occurs in persistently infected sheep. The study included thirteen 5–6-month-old unmated ewes, of which twelve were experimentally infected with A. phagocytophilum (GenBank acc. no. M73220. Four to six weeks later, all ewes were mated, and nine became pregnant. Blood samples were collected from these ewes and their offspring. If the lamb died, tissue samples were collected. The samples were analyzed with real-time PCR (qPCR targeting the msp2 gene. PCR-positive samples were further analyzed by semi-nested PCR and 16S rDNA sequencing. A total of 20 lambs were born, of which six died within two days. Six newborn lambs (30% were PCR-positive (qPCR, of which one was verified by 16S rDNA sequencing. The present study indicates that intrauterine transmission of A. phagocytophilum in persistently infected sheep may occur. The importance of these findings for the epidemiology of A. phagocytophilum needs to be further investigated.

  18. Prevalence of Anaplasma phagocytophilum infection and effect on lamb growth

    Directory of Open Access Journals (Sweden)

    Steinshamn Håvard

    2011-05-01

    Full Text Available Abstract Background A major challenge in sheep farming during the grazing season along the coast of south-western Norway is tick-borne fever (TBF caused by the bacteria Anaplasma phagocytophilum that is transmitted by the tick Ixodes ricinus. Methods A study was carried out in 2007 and 2008 to examine the prevalence of A. phagocytophilum infection and effect on weaning weight in lambs. The study included 1208 lambs from farms in Sunndal Ram Circle in Møre and Romsdal County in Mid-Norway, where ticks are frequently observed. All lambs were blood sampled and serum was analyzed by an indirect fluorescent antibody assay (IFA to determine an antibody status (positive or negative to A. phagocytophilum infection. Weight and weight gain and possible effect of infection were analyzed using ANOVA and the MIXED procedure in SAS. Results The overall prevalence of infection with A. phagocytophilum was 55%. A lower weaning weight of 3% (1.34 kg, p A. phagocytophilum infection compared to seronegative lambs at an average age of 137 days. Conclusions The results show that A. phagocytophilum infection has an effect on lamb weight gain. The study also support previous findings that A. phagocytophilum infection is widespread in areas where ticks are prevalent, even in flocks treated prophylactic with acaricides.

  19. A molecular epidemiological survey of Babesia, Hepatozoon, Ehrlichia and Anaplasma infections of dogs in Japan

    Science.gov (United States)

    KUBO, Shotaro; TATENO, Morihiro; ICHIKAWA, Yasuaki; ENDO, Yasuyuki

    2015-01-01

    Tick-borne diseases are often encountered in canine clinical practice. In the present study, a molecular epidemiological survey of dogs in Japan was conducted to understand the prevalence and geographical distribution of Babesia spp., Hepatozoon spp., Ehrlichia spp. and Anaplasma spp. Pathogen-derived DNA in blood samples obtained from 722 dogs with a history of exposure to ticks and/or fleas was examined by PCR. The prevalence of Babesia gibsoni, Babesia odocoilei-like species, Hepatozoon canis and Ehrlichia spp./Anaplasma spp. was 2.4% (16/722), 0.1% (1/722), 2.5% (18/722) and 1.5% (11/722), respectively. While B. gibsoni and Ehrlichia spp./Anaplasma spp. were detected in the western part of Japan, H. canis was detected in Tohoku area in addition to western and central parts of Japan. PMID:25947226

  20. Remodeling of tick cytoskeleton in response to infection with Anaplasma phagocytophilum

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Alberdi, P.; Valdés, James J.; Villar, M.; de la Fuente, J.

    2017-01-01

    Roč. 22, Jun 1 (2017), s. 1830-1844 ISSN 1093-4715 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : cytoskeleton * proteomics * transcriptomics * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology

  1. Anaplasma phagocytophilum Infection Subverts Carbohydrate Metabolic Pathways in the Tick Vector, Ixodes scapularis

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Alberdi, P.; Valdés, James J.; Villar, M.; de la Fuente, J.

    2017-01-01

    Roč. 7, 7 February (2017), č. článku 23. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : proteomics * transcriptomics * glucose metabolism * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016

  2. Ixodes scapularis Tick Cells Control Anaplasma phagocytophilum Infection by Increasing the Synthesis of Phosphoenolpyruvate from Tyrosine

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Espinosa, P. J.; Obregon, D. A.; Alberdi, P.; de la Fuente, J.

    2017-01-01

    Roč. 7, AUG 17 (2017), č. článku 375. ISSN 2235-2988 Institutional support: RVO:60077344 Keywords : proteomics * transcriptomics * phosphoenolpyruvate * glycerol-3-phosphate * Ixodes scapularis * Anaplasma phagocytophilum Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 4.300, year: 2016

  3. Ixodes scapularis saliva mitigates inflammatory cytokine secretion during Anaplasma phagocytophilum stimulation of immune cells

    Czech Academy of Sciences Publication Activity Database

    Chen, G.; Severo, M. S.; Sohail, M.; Sakhon, O. S.; Wikel, S. K.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2012-01-01

    Roč. 5, č. 1 (2012), s. 229 ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Tick * Ixodes scapularis * Saliva * Anaplasma phagocytophilum * Rickettsial agent Subject RIV: EC - Immunology Impact factor: 3.246, year: 2012 http://www.parasitesandvectors.com/content/5/1/229

  4. Neonatal Anaplasma platys infection in puppies: Further evidence for possible vertical transmission

    Czech Academy of Sciences Publication Activity Database

    Matei, I.A.; Stuen, S.; Modrý, David; Degan, A.; D'Amico, G.; Mihalca, A. D.

    2017-01-01

    Roč. 219, 1 January (2017), s. 40-41 ISSN 1090-0233 Institutional support: RVO:60077344 Keywords : Anaplasma platys * canine * vertical transmission Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine OBOR OECD: Veterinary science Impact factor: 1.802, year: 2016

  5. Molecular and serological prevalence of Toxoplasma gondii and Anaplasma spp. infection in goats from Chongqing Municipality, China

    Directory of Open Access Journals (Sweden)

    Zhou Zuoyong

    2018-01-01

    Full Text Available Toxoplasmosis and anaplasmosis are severe zoonotic diseases, the former caused by Toxoplasma gondii and the latter by Anaplasma spp. In the present study, 332 goat blood samples were randomly collected from Chongqing Municipality, China to screen for T. gondii and Anaplasma spp. We used a polymerase chain reaction (PCR to detect DNA, and enzyme-linked immunosorbent assay (ELISA to test for T. gondii antibodies. The prevalence of T. gondii and Anaplasma spp. was 38% and 35% respectively by PCR, and 42% for T. gondii antibodies by ELISA. The co-infection rate by T. gondii and Anaplasma was 13%, where the two predominant pathogens co-infecting were Anaplasma phagocytophilum + A. bovis (10%, followed by T. gondii + A. phagocytophilum (9.64%. While co-infection by three pathogens varied ranging from 1.81% to 5.72%, less than 1% of goats were found to be positive for four pathogens. This is the first investigation of T. gondii and Anaplasma spp. infection in goats from Chongqing.

  6. Incidencia de los Hábitos Alimenticios en los Niveles de Rendimiento Académico Escolar en las Instituciones Educativas Secundarias Urbano Marginales de Juliaca

    OpenAIRE

    Aguilar Roque, Gaylee Yemira

    2015-01-01

    El presente trabajo de investigación denominado “INCIDENCIA DE LOS HÁBITOS ALIMENTICIOS EN LOS NIVELES DE RENDIMIENTO ACADÉMICO ESCOLAR EN LAS INSTITUCIONES EDUCATIVAS SECUNDARIAS URBANO - MARGINALES DE JULIACA”, cuyo objetivo general es establecer la importancia del consumo de cereales andinos y productos procesados en los niveles de rendimiento académico de los estudiantes de las I.E.S. de las zonas urbano – marginales de la ciudad de Juliaca. Este estudio nos permite establec...

  7. REDES COMUNITARIAS: UN DESAFÍO PARA ESCUELAS URBANO-MARGINALES

    Directory of Open Access Journals (Sweden)

    Mirta Giacobbe Tovani

    2009-01-01

    Full Text Available Las ideas básicas de este trabajo son conocer y comprender el entramado de la red de relaciones entre los distintos actores de las instituciones: escuela y organismos de la comunidad y su incidencia en la calidad educativa / calidad de vida. Analizamos la visión de los distintos actores educativos acerca de la inserción de la escuela en la comunidad. Tomamos como punto de partida el análisis de las relaciones entre calidad educativa y calidad de vida, en poblaciones urbano-marginales. Realizamos en primer lugar una investigación exploratoria, para conocer las características generales de escuelas que reciben población marginal. En una segunda etapa seleccionamos cuatro escuelas, que tomamos como casos e indagamos sus problemáticas. En ellas observamos gran dificultad para la construcción de redes comunitarias desde la institución escolar. Si bien responden a los problemas puntuales, mediante cambios o innovaciones planificados dinámica y flexiblemente, no existen soluciones duraderas debido a la falta de una convocatoria que comprometa a todas las instituciones de la comunidad constituyendo una efectiva relación en red. Estos resultados alcanzados en la investigación son producto de la triangulación de los datos estadísticos, documentales e históricos así como de los procedentes de la observación participante y de la información de las entrevistas en profundidad.

  8. First case of Anaplasma platys infection in a dog from Croatia

    Directory of Open Access Journals (Sweden)

    Dyachenko Viktor

    2012-03-01

    Full Text Available Abstract Background It is known that Anaplasma (A. platys, the causative agent of infectious canine cyclic thrombocytopenia, is endemic in countries of the Mediterranean basin. However, few reports are available from the Balkans. This case report describes a dog, which was imported from Croatia to Germany in May 2010. One month later the dog was presented to a local veterinarian in Germany due to intermittent/recurrent diarrhoea. Diagnostic tests were performed to identify infections caused by Anaplasma spp., Ehrlichia spp., Hepatozoon canis, Babesia spp., Leishmania spp., Borrelia burgdorferi and/or Dirofilaria immitis. Findings Haematological examination of a blood smear revealed basophilic inclusions in thrombocytes, which were confirmed as A. platys with a species-specific real-time PCR. Additionally, an infection with Babesia (B. vogeli was also detected (PCR and serology. No specific antibodies against Anaplasma antigen were detectable. Although the dog showed no specific clinical signs, thrombocytopenia, anaemia and elevated C-reactive protein (CRP were observed. Sequencing of a 1,348-bp partial ribosomal RNA gene revealed highest homology to A. platys sequences from Thailand, Japan and France. Conclusions A. platys was detected for first time in a dog imported from Croatia. As the dog was also co-infected by B. vogeli, unique serological and haematological findings were recorded. Thrombocytopenia, anaemia and elevated values of C-reactive protein were the laboratory test abnormalities observed in this case. A. platys infections should be considered in dogs coming from Croatia and adjacent regions.

  9. ORF Alignment: NC_004842 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available [Anaplasma ... marginale str. St. Maries] ... Length = 114 ... Query: 16 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWL...DKASGARTEKTEWHSIVVFSEG 75 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWL...DKASGARTEKTEWHSIVVFSEG Sbjct: 1 ... GVNKVILIGHLGKDPDVRVMQNGKEMASFSLATSESWLDKASGARTEKTEWHSIVVFSEG 60 ...

  10. Development of duplex PCR for simultaneous detection of Theileria spp. and Anaplasma spp. in sheep and goats.

    Science.gov (United States)

    Cui, Yanyan; Zhang, Yan; Jian, Fuchun; Zhang, Longxian; Wang, Rongjun; Cao, Shuxuan; Wang, Xiaoxing; Yan, Yaqun; Ning, Changshen

    2017-05-01

    Theileria spp. and Anaplasma spp., which are important tick-borne pathogens (TBPs), impact the health of humans and animals in tropical and subtropical areas. Theileria and Anaplasma co-infections are common in sheep and goats. Following alignment of the relevant DNA sequences, two primer sets were designed to specifically target the Theileria spp. 18S rRNA and Anaplasma spp. 16S rRNA gene sequences. Genomic DNA from the two genera was serially diluted tenfold for testing the sensitivities of detection of the primer sets. The specificities of the primer sets were confirmed when DNA from Anaplasma and Theileria (positive controls), other related hematoparasites (negative controls) and ddH 2 O were used as templates. Fifty field samples were also used to evaluate the utility of single PCR and duplex PCR assays, and the detection results were compared with those of the PCR methods previously published. An optimized duplex PCR assay was established from the two primer sets based on the relevant genes from the two TBPs, and this assay generated products of 298-bp (Theileria spp.) and 139-bp (Anaplasma spp.). The detection limit of the assay was 29.4 × 10 -3  ng per μl, and there was no cross-reaction with the DNA from other hematoparasites. The results showed that the newly developed duplex PCR assay had an efficiency of detection (P > 0.05) similar to other published PCR methods. In this study, a duplex PCR assay was developed that can simultaneously identify Theileria spp. and Anaplasma spp. in sheep and goats. This duplex PCR is a potentially valuable assay for epidemiological studies of TBPs in that it can detect cases of mixed infections of the pathogens. Copyright © 2017 Elsevier Inc. All rights reserved.

  11. Spatial distribution of Anaplasma phagocytophilum and Hepatozoon canis in red foxes (Vulpes vulpes) in Hungary.

    Science.gov (United States)

    Tolnai, Z; Sréter-Lancz, Z; Sréter, T

    2015-07-01

    In recent years, Ehrlichia canis and Hepatozoon canis transmitted by Rhipicephalus sanguineus were reported from Hungary. The aim of the present study was to reveal the spatial distribution pattern of pathogens transmitted by R. sanguineus in a sentinel species, red fox (Vulpes vulpes) in Hungary and to analyse the relationship of these patterns with landscape and climate by geographical information systems. Fox carcasses, representing 0.5% of the total fox population were randomly selected out of all the foxes of Hungary. The spleen samples of the animals were tested by real-time PCR for Anaplasma platys, Babesia vogeli, E. canis and H. canis infection. Positive results were confirmed by conventional PCR followed by sequencing. The prevalence of H. canis infection was 22.2% (95% CI=18.4-26.4%), and this parasite was detected in all areas including the mountain regions of Hungary. These findings indicate that other tick species or other transmission routes (oral and transplacental) might be in the background of the countrywide distribution of H. canis. Anaplasma platys was not found; nevertheless, the prevalence of Anaplasma phagocytophilum infection transmitted by Ixodes ricinus was 12.5% (95% CI=9.7-16.1%) in foxes. B. vogeli and E. canis infection was not detected. There was no correlation between environmental parameter values in the home range of foxes and A. phagocytophilum or H. canis infection, which is in line with that observed in the case of tick species infesting foxes in Hungary. The results of this study indicate that R. sanguineus, if present, might be rare in Hungary. Our baseline study can be used for future evaluation of the effect of climate change on the spreading and emergence of R. sanguineus transmitted pathogens in Hungary. Copyright © 2015 Elsevier GmbH. All rights reserved.

  12. Molecular Detection of Anaplasma bovis in Cattle from Central Part of Iran

    Directory of Open Access Journals (Sweden)

    Vahid Noaman

    2010-09-01

    Full Text Available Anaplasma bovis is a leukocytotropic agent of bovine anaplasmosis and there is no available information about molecular study on this agent in cattle of Iran. In this study a total 150 cattle blood samples were collected from central part of Iran. The presence of A. bovis examined using light microscopic detection and species-specific nested polymerase chain reaction (nested-PCR based on 16S rRNA gene. Of the 150 cattle, 4 (2.66 % was positive for A. bovis by nested-PCR. These data is the first A. bovis DNA presence in cattle from central part of Iran.

  13. Test of the sheep ked Melophagus ovinus (L) as a vector of Anaplasma ovis Lestoquard.

    Science.gov (United States)

    Zaugg, J L; Coan, M E

    1986-05-01

    The sheep ked Melophagus ovinus was evaluated as a possible vector of Anaplasma ovis. In 4 tests, 45 to 293 keds were transferred from sheep with acute anaplasmosis, low level parasitemia, or carrier state of anaplasmosis to individual splenectomized ewes. Keds were confined in stockinette cages attached to the dorsal midline of the recipient hosts for 10 days. Throughout the 90-day observation periods after the keds were transferred, no clinical, serologic, or hematologic evidence of anaplasmosis was detected in any of the ked-recipient ewes. Results indicate that sheep keds probably are not mechanical or biological vectors of the ovine anaplasmosis organism.

  14. Detection of Ehrlichia spp., Anaplasma spp., Rickettsia spp., and Other Eubacteria in Ticks from the Thai-Myanmar Border and Vietnam

    OpenAIRE

    Parola, Philippe; Cornet, Jean-Paul; Sanogo, Yibayiri Osée; Miller, R. Scott; Thien, Huynh Van; Gonzalez, Jean-Paul; Raoult, Didier; Telford III, Sam R.; Wongsrichanalai, Chansuda

    2003-01-01

    A total of 650 ticks, including 13 species from five genera, were collected from animals, from people, or by flagging of the vegetation at sites on the Thai-Myanmar border and in Vietnam. They were tested by PCR to detect DNA of bacteria of the order Rickettsiales. Three Anaplasma spp. were detected in ticks collected in Thailand, including (i) Anaplasma sp. strain AnDa465, which was considered a genotype of Anaplasma platys (formerly Ehrlichia platys) and which was obtained from Dermacentor ...

  15. Identification and Characterization of Anaplasma phagocytophilum Proteins Involved in Infection of the Tick Vector, Ixodes scapularis

    Czech Academy of Sciences Publication Activity Database

    Villar, M.; Ayllón, N.; Kocan, K.M.; Bonzón-Kulichenko, E.; Alberdi, P.; Blouin, E.F.; Weisheit, S.; Mateos-Hernández, L.; Cabezas-Cruz, A.; Bell-Sakyi, L.; Vancová, Marie; Bílý, Tomáš; Meyer, D.F.; Štěrba, Ján; Contreras, M.; Rudenko, Natalia; Grubhoffer, Libor; Vázquez, J.; de la Fuente, J.

    2015-01-01

    Roč. 10, č. 9 (2015), e0137237 E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 238511; European Commission(XE) 278976 Institutional support: RVO:60077344 Keywords : secretion system * outer membrane vesicles * gene expression Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.057, year: 2015

  16. Coinfection of sheep with Anaplasma, Theileria and Babesia species in the Kurdistan Region, Iraq.

    Science.gov (United States)

    Renneker, S; Abdo, J; Bakheit, M A; Kullmann, B; Beyer, D; Ahmed, J; Seitzer, U

    2013-11-01

    Infections of small ruminants with Anaplasma, Theileria and Babesia species are widely distributed in the old world and are of great economic impact. In Iraq, data on disease occurrence in sheep caused by above-mentioned infectious agents are scarce. This study provides information on various haemoparasitic agents infecting sheep in the Kurdistan Region, Iraq, using molecular diagnostic tools. Altogether, 195 samples originating from three governorates in the Kurdistan Region, namely Duhok, Erbil and Sulaimaniya, were analysed. The following pathogens were identified: Anaplasma ovis (62.6%), Theileria ovis (14.35%), T. lestoquardi (7.7%), T. uilenbergi (5.6%) and Babesia ovis (1.5%). T. uilenbergi is detected for the first time in Iraq. Coinfection of sheep with different pathogens could be observed in this study, and it was found that 45 of 195 (23%) of the samples contained more than one pathogen. Even triple-positive samples were identified in 3% of the investigated animals. In conclusion, we confirm the coinfection of sheep with various haemoparasitic pathogen species in the Kurdistan Region of Iraq. Further investigations are needed to reveal the epidemiology of the diseases, the respective tick vectors, and, in the case of coinfection, pathogens' interaction and possible cross-protection. © 2013 Blackwell Verlag GmbH.

  17. One particular Anaplasma phagocytophilum ecotype infects cattle in the Camargue, France.

    Science.gov (United States)

    Dugat, Thibaud; Leblond, Agnès; Keck, Nicolas; Lagrée, Anne-Claire; Desjardins, Isabelle; Joulié, Aurélien; Pradier, Sophie; Durand, Benoit; Boulouis, Henri-Jean; Haddad, Nadia

    2017-08-02

    Anaplasma phagocytophilum is a zoonotic tick-borne pathogen responsible for granulocytic anaplasmosis, a mild to a severe febrile disease that affects man and several animal species, including cows and horses. In Europe, I. ricinus is the only proven vector for this pathogen, but studies suggest that other tick genera and species could be involved in its transmission. Our objective was to assess the presence and genetic diversity of A. phagocytophilum in domestic animals and different tick species from the Camargue region, located in the south of France. A total of 140 ticks and blood samples from 998 cattle and 337 horses were collected in Camargue and tested for the presence of A. phagocytophilum DNA by msp2 quantitative real-time PCR. Molecular typing with four markers was performed on positive samples. Anaplasma phagocytophilum DNA was detected in 6/993 (0.6%) cows, 1/20 (5%) Haemaphysalis punctata, 1/57 (1.75%) Rhipicephalus pusillus, and was absent in horses (0%). All cattle A. phagocytophilum presented a profile identical to an A. phagocytophilum variant previously detected in Dermacentor marginatus, Hyalomma marginatum, and Rhipicephalus spp. in Camargue. Our results demonstrate that one particular A. phagocytophilum variant infects cattle in Camargue, where I. ricinus is supposed to be rare or even absent. Dermacentor marginatus, Rhipicephalus spp. and Hyalomma spp., and possibly other tick species could be involved in the transmission of this variant in this region.

  18. Molecular detection of Anaplasma phagocytophilum DNA in the lesser horseshoe bat (Rhinolophus hipposideros) guano.

    Science.gov (United States)

    Afonso, E; Goydadin, A-C

    2018-05-30

    Although bats are increasingly recognised as potential reservoir hosts of human zoonotic pathogens, bacteria in bats are still poorly studied. To investigate the DNA faecal prevalence of the bacterium Anaplasma phagocytophilum, we sampled 23 lesser horseshoe bat (Rhinolophus hipposideros) maternity colonies located in buildings (churches, barns) in rural villages of eastern France. A total of 552 faecal samples were collected from 278 individuals. Anaplasma phagocytophilum DNA was detected in the faeces of 63 individuals (22.7%). Such high prevalence might suggest persistent infection in bats and/or a frequent consumption of insect preys carrying bacteria. Faecal DNA prevalence varied highly among colonies but was not related to the colony size. Faecal DNA prevalence was the highest in the Jura Department, where the density of ticks is known to be the highest across the study area. Because the sampled bats live in close proximity to humans, we discuss how concerning the presence of A. phagocytophilum DNA in bat guano is for humans frequenting places of worship that shelter bats. We also advocate future research to understand what a high faecal DNA prevalence in bat guano really implicates in terms of bacteria transmission.

  19. The Prostaglandin E2-EP3 Receptor Axis Regulates Anaplasma phagocytophilum-Mediated NLRC4 Inflammasome Activation

    Czech Academy of Sciences Publication Activity Database

    Wang, X.; Shaw, D.K.; Hammond, H.L.; Sutterwala, F.S.; Rayamajhi, M.; Shirey, K.A.; Perkins, D.J.; Bonventre, J.V.; Velayutham, T.S.; Evans, S.M.; Rodino, K.G.; VieBrock, L.; Scanlon, K.M.; Carbonetti, N.H.; Carlyon, J.A.; Miao, E.A.; McBride, J.W.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2016-01-01

    Roč. 12, č. 8 (2016), č. článku e1005803. E-ISSN 1553-7374 Institutional support: RVO:60077344 Keywords : Rickettsial agents * Anaplasma phagocytophilum * prostaglandin E2-EP3 Receptor Axis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 7.003, year: 2015

  20. High infection of Anaplasma and Ehrlichia spp. among tick species collected from different geographical locations of Iran

    Directory of Open Access Journals (Sweden)

    Leila Tajedin

    2016-10-01

    Full Text Available Objective: To ascertain the prevalence of the Anaplasma/Ehrlichia infections in tick population within four provinces of Iran. Methods: A total of 384 tick specimens were collected from domestic animals inhabiting in four provinces (East Azerbaijan, Gilan, South Khorasan and Yazd. Specimens were identified based on morphological analysis. The detection of Anaplasma spp./Ehrlichia spp. within tick samples was carried out by nested PCR amplification of the 16S ribosomal RNA gene accompanied by DNA sequencing and analysis for verification. Results: A total of 10 tick species were identified as follows: Ornithodoros lahorensis (O. lahorensis (44.8%, Hyalomma dromedarii (15.6%, Dermacentor marginatus (13.5%, Hyalomma anatolicum (11.2%, Hyalomma asiaticum (5.7%, Hyalomma marginatum (4.9%, Rhipicephalus sanguineus (2.3%, Hyalomma detritum (1.0%, Dermacentor niveus (0.5% and Argas persicus (0.3%. The percentage distribution of Anaplasma/Ehrlichia was 55.5% (213 across 384 studied ticks. Conclusions: To the best of our knowledge, this is the first report of Anaplasma ovis infection in O. lahorensis in Iran. We also conjecture the prevalence of Ehrlichia spp. in Yazd Province based on sequencing results; also, it is suggested that O. lahorensis is a potential vector in the studied area. This survey highlights the importance of Argasidae family to verify and correlate their threat in causing anaplasmosis and other diseases in animals.

  1. Anaplasma phagocytophilum MSP4 and HSP70 Proteins Are Involved in Interactions with Host Cells during Pathogen Infection

    Czech Academy of Sciences Publication Activity Database

    Contreras, M.; Alberdi, P.; Mateos-Hernández, L.; Fernández de Mera, I.G.; García-Pérez, A. L.; Vancová, Marie; Villar, M.; Ayllón, N.; Cabezas Cruz, Alejandro; Valdés, James J.; Stuen, S.; Gortazar, C.; de la Fuente, J.

    2017-01-01

    Roč. 7, JUL 5 (2017), č. článku 307. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : anaplasmosis * immunology * hl60 * tick * vaccine * sheep * Anaplasma phagocytophilum Subject RIV: EC - Immunology OBOR OECD: Immunology Impact factor: 4.300, year: 2016

  2. Molecular detection of Anaplasma platys infection in free-roaming dogs and ticks from Kenya and Ivory Coast

    Czech Academy of Sciences Publication Activity Database

    Matei, I.A.; D'Amico, G.; Yao, P.K.; Ionică, A.M.; Kanyari, P. W. N.; Daskalaki, A.A.; Dumitrache, M.O.; Sándor, A.D.; Gherman, C.M.; Qablan, M.; Modrý, David; Mihalca, A. D.

    2016-01-01

    Roč. 9, MAR 16 (2016), č. článku 157. ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Africa * Anaplasma platys * carnivores * Kenya * Ivory Coast Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.080, year: 2016

  3. Estimated seroprevalence of Anaplasma spp. and spotted fever group Rickettsia exposure among herders and livestock in Mongolia.

    Science.gov (United States)

    von Fricken, Michael E; Lkhagvatseren, Sukhbaatar; Boldbaatar, Bazartseren; Nymadawa, Pagbajab; Weppelmann, Thomas A; Baigalmaa, Bekh-Ochir; Anderson, Benjamin D; Reller, Megan E; Lantos, Paul M; Gray, Gregory C

    2018-01-01

    To better understand the epidemiology of tick-borne disease in Mongolia, a comprehensive seroprevalence study was conducted investigating exposure to Anaplasma spp. and spotted fever group (SFG) Rickettsia spp. in nomadic herders and their livestock across three provinces from 2014 to 2015. Blood was collected from 397 herders and 2370 livestock, including sheep, goats, cattle, horses and camels. Antibodies against Anaplasma spp. and SFG Rickettsia were determined by indirect immunofluorescence using commercially available slides coated with Anaplasma phagocytophilum and Rickettsia rickettsii antigens. Logistic regression was used to determine if the odds of previous exposure differed by gender, location, and species, with or without adjustment for age. To examine the association between seroprevalence and environmental variables we used ArcGIS to circumscribe the five major clusters where human and animal data were collected. Anaplasma spp. exposure was detected in 37.3% (136/365) of humans and 47.3% (1120/2370) of livestock; SFG Rickettsia exposure was detected in 19.5% (73/374) humans and 20.4% (478/2342) livestock. Compared to the southern province (aimag) of Dornogovi, located in the Gobi Desert, humans were significantly more likely to be exposed to Anaplasma spp. and SFG Rickettsia in the northern provinces of Tov (OR=7.3, 95% CI: 3.5, 15.1; OR=3.3, 95% CI: 1.7, 7.5), and Selenge (OR=6.9, 95% CI: 3.4, 14.0; OR=2.2, 95% CI: 1.1, 4.8). The high seroprevalence of Anaplasma spp. and SFG Rickettsia in humans and livestock suggests that exposure to tick-borne pathogens may be common in herders and livestock in Mongolia, particularly in the more northern regions of the country. Until more is known about these pathogens in Mongolia, physicians and veterinarians in the countryside should consider testing for Anaplasma and SFG Rickettsia infections and treating clinically compatible cases, while public health authorities should expand surveillance efforts for these

  4. Molecular detection of tick-borne bacteria and protozoa in cervids and wild boars from Portugal.

    Science.gov (United States)

    Pereira, André; Parreira, Ricardo; Nunes, Mónica; Casadinho, Afonso; Vieira, Maria Luísa; Campino, Lenea; Maia, Carla

    2016-05-10

    Wildlife can act as reservoir of different tick-borne pathogens, such as bacteria, parasites and viruses. The aim of the present study was to assess the presence of tick-borne bacteria and protozoa with veterinary and zoonotic importance in cervids and wild boars from the Centre and South of Portugal. One hundred and forty one blood samples from free-ranging ungulates including 73 red deer (Cervus elaphus), 65 wild boars (Sus scrofa) and three fallow deer (Dama dama) were tested for the presence of Anaplasma marginale/A. ovis, A. phagocytophilum, Anaplasma/Ehrlichia spp., Babesia/Theileria spp., Borrelia burgdorferi (sensu lato) (s.l.), and Rickettsia spp. DNA by PCR. Anaplasma spp. DNA was detected in 33 (43.4 %) cervids (31 red deer and two fallow deer) and in two (3.1 %) wild boars while Theileria spp. were found in 34 (44.7 %) cervids (32 red deer and two fallow deer) and in three (4.6 %) wild boar blood samples. Sequence analysis of msp4 sequences identified A. marginale, A. ovis, while the analysis of rDNA sequence data disclosed the presence of A. platys and A. phagocytophilum and T. capreoli and Theileria sp. OT3. Anaplasma spp./Theileria spp. mixed infections were found in 17 cervids (22.4 %) and in two wild boars (3.1 %). All samples were negative for Babesia sp., B. burgdorferi (s.l.), Ehrlichia sp. or Rickettsia sp. This is the first detection of Anaplasma marginale, A. ovis, A. phagocytophilum, A. platys, Theileria capreoli and Theileria sp. OT3 in cervids and wild boars from Portugal. Further studies concerning the potential pathogenicity of the different species of  Anaplasma and Theileria infecting wild ungulates, the identification of their vector range, and their putative infectivity to domestic livestock and humans should be undertaken.

  5. Análisis de la dinámica relacional generada por las websites de Internet en el desarrollo de los turismos marginales

    Directory of Open Access Journals (Sweden)

    José Mª Prat

    2012-01-01

    Full Text Available El conocimiento de los actores turísticos del territorio, y de sus relaciones, es un elemento básico para la gestión activa de cualquier destino turístico. Como que, gracias a las nuevas tecnologías de la información y a la popularizacióndel uso de Internet, se han creado una gran cantidad de relaciones sociales gracias a las websites, interrelacionadas, que han permitido una rápida y amplia difusión promocional de aquellos destinos que ofrecen unas alternativas turísticas más marginales, como respuesta a los nuevos planteamientos post-fordistas del turismo, generándose una dinámica relacional que se ha beneficiado del rápido desarrollo de las TIC's. En este trabajo se han analizado dichas relaciones entre websites, en el caso del desarrollo de dos turismos marginales, el naturista y el swinger, en Cap d'Agde, en el sur de Francia, comprobándose la existencia de una relación directa entre la dinámica relacional del territorio y elgrado de desarrollo de los turismos marginales.

  6. Usos marginales de los marcadores del discurso. Su efecto en la comprensión lectora en español como lengua extranjera

    Directory of Open Access Journals (Sweden)

    María Fernanda Pelayo

    2003-04-01

    Full Text Available En este trabajo abordamos lo que hemos denominado usos marginales de los marcadores del discurso y cómo afectan a la comprensión lectora en español como lengua extranjera. Tras un análisis y definición de estos usos no ortodoxos de los marcadores del discurso, realizamos una clasificación preliminar de los mismos. Finalmente, diseñamos y llevamos a cabo un estudio empírico acerca de la manera en que los usos marginales de los marcadores del discurso podrían afectar a la comprensión lectora de textos en español como lengua extranjera. Losresultados obtenidos en este estudio experimental muestran que existe una tendencia bastante generalizada que nos hace aventurarnos a concluir que efectivamente los lectores de español como lengua extranjera muestran tenerproblemas para comprender textos en los que se han empleado usos marginales de los marcadores del discurso. Por otra parte, el uso ortodoxo de los marcadores del discurso parece favorecer la comprensión adecuada del texto.

  7. Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago.

    Science.gov (United States)

    Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto

    2016-07-01

    Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island. Copyright © 2016

  8. NCBI nr-aa BLAST: CBRC-ACAR-01-1026 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-1026 ref|YP_153799.1| hypothetical protein AM518 [Anaplasma marginale ...str. St. Maries] gb|AAV86544.1| hypothetical protein AM518 [Anaplasma marginale str. St. Maries] YP_153799.1 3.7 24% ...

  9. NCBI nr-aa BLAST: CBRC-LAFR-01-0905 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-0905 ref|YP_153919.1| hypothetical protein AM688 [Anaplasma marginale ...str. St. Maries] gb|AAV86664.1| hypothetical protein AM688 [Anaplasma marginale str. St. Maries] YP_153919.1 5e-08 62% ...

  10. Babesia canis vogeli, Ehrlichia canis, and Anaplasma platys infection in a dog.

    Science.gov (United States)

    Al Izzi, Salah; Martin, Donald S; Chan, Roxanne Y Y; Leutenegger, Christian M

    2013-12-01

    A 12-month-old male neutered mixed breed dog was presented with a history of diarrhea, lethargy, emaciation, polydypsia, and sniffling. Physical examination findings included pale mucous membranes, increased heart and respiratory rates, and normal rectal temperature (38°C). Hematologic abnormalities included anemia and thrombocytopenia. Biochemical abnormalities included hypoalbuminemia, hyperbilirubinemia, and elevated ALP and ALT activities. A SNAP 4Dx test result was positive for Ehrlichia canis. Babesia canis vogeli organisms were found in the peripheral blood films, while morulae of E canis were not seen. Real-time polymerase chain reaction testing confirmed the presence of both B c vogeli and E canis organisms, and also was positive for Anaplasma platys infection. The dog recovered following treatment with doxycycline and imidocarb dipropionate, with normal hematology and biochemical profiles. © 2013 American Society for Veterinary Clinical Pathology.

  11. Citrate synthase gene sequence: a new tool for phylogenetic analysis and identification of Ehrlichia.

    Science.gov (United States)

    Inokuma, H; Brouqui, P; Drancourt, M; Raoult, D

    2001-09-01

    The sequence of the citrate synthase gene (gltA) of 13 ehrlichial species (Ehrlichia chaffeensis, Ehrlichia canis, Ehrlichia muris, an Ehrlichia species recently detected from Ixodes ovatus, Cowdria ruminantium, Ehrlichia phagocytophila, Ehrlichia equi, the human granulocytic ehrlichiosis [HGE] agent, Anaplasma marginale, Anaplasma centrale, Ehrlichia sennetsu, Ehrlichia risticii, and Neorickettsia helminthoeca) have been determined by degenerate PCR and the Genome Walker method. The ehrlichial gltA genes are 1,197 bp (E. sennetsu and E. risticii) to 1,254 bp (A. marginale and A. centrale) long, and GC contents of the gene vary from 30.5% (Ehrlichia sp. detected from I. ovatus) to 51.0% (A. centrale). The percent identities of the gltA nucleotide sequences among ehrlichial species were 49.7% (E. risticii versus A. centrale) to 99.8% (HGE agent versus E. equi). The percent identities of deduced amino acid sequences were 44.4% (E. sennetsu versus E. muris) to 99.5% (HGE agent versus E. equi), whereas the homology range of 16S rRNA genes was 83.5% (E. risticii versus the Ehrlichia sp. detected from I. ovatus) to 99.9% (HGE agent, E. equi, and E. phagocytophila). The architecture of the phylogenetic trees constructed by gltA nucleotide sequences or amino acid sequences was similar to that derived from the 16S rRNA gene sequences but showed more-significant bootstrap values. Based upon the alignment analysis of the ehrlichial gltA sequences, two sets of primers were designed to amplify tick-borne Ehrlichia and Neorickettsia genogroup Ehrlichia (N. helminthoeca, E. sennetsu, and E. risticii), respectively. Tick-borne Ehrlichia species were specifically identified by restriction fragment length polymorphism (RFLP) patterns of AcsI and XhoI with the exception of E. muris and the very closely related ehrlichia derived from I. ovatus for which sequence analysis of the PCR product is needed. Similarly, Neorickettsia genogroup Ehrlichia species were specifically identified by

  12. Molecular Characterization and Phylogenetic Analysis of Anaplasma spp. and Ehrlichia spp. Isolated from Various Ticks in Southeastern and Northwestern Regions of Iran.

    Science.gov (United States)

    Jafar Bekloo, Ahmad; Ramzgouyan, Maryam Roya; Shirian, Sadegh; Faghihi, Faezeh; Bakhshi, Hassan; Naseri, Fatemeh; Sedaghat, Mehdi; Telmadarraiy, Zakkyeh

    2018-05-01

    Anaplasma/Ehrlichia species are tick-transmitted pathogens that cause infections in humans and numerous domestic and wild animal species. There is no information available on the molecular characteristics and phylogenetic position of Anaplasma/Ehrlichia spp. isolated from tick species from different geographic locations in Iran. The aim of this study was to determine the prevalence, molecular characteristics, and phylogenetic relationship of both Anaplasma spp. and Ehrlichia spp. in tick species isolated from different domestic animals from two different geographical locations of Iran. A total of 930 ticks were collected from 93 cattle, 250 sheep, and 587 goats inhabiting the study areas. The collected ticks were then investigated for the presence of Anaplasma/Ehrlichia spp. using nested PCR based on the 16S rRNA gene, followed by sequencing. Sequence analysis was done based on the data published in the GenBank on Anaplasma/Ehrlichia spp. isolates using bioinformatic tools such as the standard nucleotide BLAST. Genome of Anaplasma or Ehrlichia spp. was detected in 14 ticks collected in Heris, including 5 Dermacentor marginatus, 1 Haemaphysalis erinacei, 3 Hyalomma anatolicum, and 4 Rhipicephalus sanguineus, also in 29 ticks collected in Chabahar, including 14 R. sanguineus, 8 D. marginatus, 3 Hyalomma Anatolicum, and 4 Hyalomma dromedarii. Partial analysis of the 16S rRNA gene sequence of positive samples collected from goats and sheep showed that they were infected with Anaplasma/Ehrlichia spp. that were 94-98% identical to ovine Anaplasma and 91-96% identical to Neoehrlichia and Ehrlichia spp. The various ticks identified in this study suggest the possible emergence of tick-borne diseases in animals and humans in these regions. R. sanguineus and D. marginatus seem to be predominant vectors responsible for anaplasmosis in these regions. Partial sequence analysis of the 16S rRNA gene showed that A. ovis is genetically polymorphic in these regions. Furthermore, an

  13. Molecular detection and identification of Rickettsiales pathogens in dog ticks from Costa Rica.

    Science.gov (United States)

    Campos-Calderón, Liliana; Ábrego-Sánchez, Leyda; Solórzano-Morales, Antony; Alberti, Alberto; Tore, Gessica; Zobba, Rosanna; Jiménez-Rocha, Ana E; Dolz, Gaby

    2016-10-01

    Although vector-borne diseases are globally widespread with considerable impact on animal production and on public health, few reports document their presence in Central America. This study focuses on the detection and molecular identification of species belonging to selected bacterial genera (Ehrlichia, Anaplasma and Rickettsia) in ticks sampled from dogs in Costa Rica by targeting several genes: 16S rRNA/dsb genes for Ehrlichia; 16S rRNA/groEL genes for Anaplasma, and ompA/gltA/groEL genes for Rickettsia. PCR and sequence analyses provides evidences of Ehrlichia canis, Anaplasma platys, and Anaplasma phagocytophilum infection in Rhipicephalus sanguineus s.l ticks, and allow establishing the presence of Rickettsia monacensis in Ixodes boliviensis. Furthermore, the presence of recently discovered Mediterranean A. platys-like strains is reported for the first time in Central America. Results provide new background on geographical distribution of selected tick-transmitted bacterial pathogens in Costa Rica and on their molecular epidemiology, and are pivotal to the development of effective and reliable diagnostic tools in Central America. Copyright © 2016 Elsevier GmbH. All rights reserved.

  14. Detection of Anaplasma phagocytophilum DNA in Ixodes Ticks (Acari: Ixodidae) from Madeira Island and Setúbal District, Mainland Portugal

    Science.gov (United States)

    Santos-Silva, Maria Margarida; Almeida, Victor Carlos; Bacellar, Fátima; Dumler, John Stephen

    2004-01-01

    A total of 278 Ixodes ticks, collected from Madeira Island and Setúbal District, mainland Portugal, were examined by polymerase chain reaction (PCR) for the presence of Anaplasma phagocytophilum. Six (4%) of 142 Ixodes ricinus nymphs collected in Madeira Island and 1 nymph and 1 male (2%) of 93 I. ventalloi collected in Setúbal District tested positive for A. phagocytophilum msp2 genes or rrs. Infection was not detected among 43 I. ricinus on mainland Portugal. All PCR products were confirmed by nucleotide sequencing to be identical or to be most closely related to A. phagocytophilum. To our knowledge, this is the first evidence of A. phagocytophilum in ticks from Setúbal District, mainland Portugal, and the first documentation of Anaplasma infection in I. ventalloi. Moreover, these findings confirm the persistence of A. phagocytophilum in Madeira Island's I. ricinus. PMID:15498168

  15. Detection of Anaplasma phagocytophilum DNA in Ixodes ticks (Acari: Ixodidae) from Madeira Island and Setubal District, mainland Portugal.

    Science.gov (United States)

    Santos, Ana Sofia; Santos-Silva, Maria Margarida; Almeida, Victor Carlos; Bacellar, Fátima; Dumler, John Stephen

    2004-09-01

    A total of 278 Ixodes ticks, collected from Madeira Island and Setubal District, mainland Portugal, were examined by polymerase chain reaction (PCR) for the presence of Anaplasma phagocytophilum. Six (4%) of 142 Ixodes ricinus nymphs collected in Madeira Island and 1 nymph and 1 male (2%) of 93 I. ventalloi collected in Setubal District tested positive for A. phagocytophilum msp2 genes or rrs. Infection was not detected among 43 I. ricinus on mainland Portugal. All PCR products were confirmed by nucleotide sequencing to be identical or to be most closely related to A. phagocytophilum. To our knowledge, this is the first evidence of A. phagocytophilum in ticks from Setubal District, mainland Portugal, and the first documentation of Anaplasma infection in I. ventalloi. Moreover, these findings confirm the persistence of A. phagocytophilum in Madeira Island's I. ricinus.

  16. Detection of Anaplasma sp. phylogenetically related to A. phagocytophilum in a free-living bird in Brazil

    Directory of Open Access Journals (Sweden)

    Anna Claudia Baumel Mongruel

    2017-08-01

    Full Text Available Abstract Wild animals play an important role in carrying vectors that may potentially transmit pathogens. Several reports highlighted the participation of wild animals on the Anaplasma phagocytophilum cycle, including as hosts of the agent. The aim of this study was to report the molecular detection of an agent phylogenetically related to A. phagocytophilum isolated from a wild bird in the Midwest of the state of Paraná, Brazil. Fifteen blood samples were collected from eleven different bird species in the Guarapuava region. One sample collected from a Penelope obscura bird was positive in nested PCR targeting the 16S rRNA gene of Anaplasma spp. The phylogenetic tree based on the Maximum Likelihood analysis showed that the sequence obtained was placed in the same clade with A. phagocytophilum isolated from domestic cats in Brazil. The present study reports the first molecular detection of a phylogenetically related A. phagocytophilum bacterium in a bird from Paraná State.

  17. First report of Anaplasma ovis in pupal and adult Melophagus ovinus (sheep ked) collected in South Xinjiang, China.

    Science.gov (United States)

    Zhao, Li; He, Bo; Li, Kai-Rui; Li, Fei; Zhang, Lu-Yao; Li, Xian-Qiang; Liu, Yong-Hong

    2018-04-19

    Melophagus ovinus (sheep ked) is a blood-feeding ectoparasite that belongs to the family Hippoboscidae (Diptera: Hippoboscoidea) and mainly parasitizes sheep. The life-cycle of M. ovinus consists of three stages: larva, pupa and adult. It has a worldwide distribution and has been found in four provinces of China, especially South Xinjiang. In addition to causing direct damage to animal hosts, M. ovinus serves as a vector for disease transmission. In this study, our aim was to investigate the presence of Anaplasma spp. in pupal and adult M. ovinus. A total of 93 specimens (including eight pupal specimens) of M. ovinus collected in South Xinjiang were selected for isolation of genomic DNA, followed by PCR amplification and sequencing of the msp4 gene of Anaplasma spp. The sequences were analyzed in MEGA 7.0 software and via online BLAST. PCR and sequencing results showed that all the specimens collected in 2013 were free of Anaplasma spp., whereas three and 25 specimens (including five pupal specimens) collected in 2016 and 2017, respectively, tested positive for Anaplasma spp. The analysis of 24 msp4 gene sequences (from four pupal specimens) confirmed the presence of A. ovis in M. ovinus specimens collected in South Xinjiang, China. The detected A. ovis isolates belong to Genotypes II and III. To the best of our knowledge, this is the first report of the detection of A. ovis DNA in pupal M. ovinus, confirming the vertical transmission of A. ovis in M. ovinus and the potential of M. ovinus to serve as a vector for A. ovis.

  18. Anaplasma ovis genetic diversity detected by major surface protein 1a and its prevalence in small ruminants.

    Science.gov (United States)

    Aktas, Munir; Özübek, Sezayi

    2018-04-01

    Anaplasma ovis is a widely distributed tick-borne rickettsial pathogen of sheep, goats, and wild ruminants. The aims of this study were to assess the prevalence, associations of Anaplasma ovis in sheep and goats, as well as its genetic diversity based on analysis of the msp1α gene. A total of 416 DNA samples from sheep (n = 236) and goats (n = 180) from four provinces in southeastern Turkey were analyzed by PCR. The overall A. ovis prevalence was 18% (CI 14.4-22.1). The infection rates of A. ovis varied from 15.9% to 21.8% in sampled provinces, and they were not significantly different. There was no difference between Anaplasma ovis infection in sheep (20.3%, CI 15.4-26.0) and goats (15.0%, CI 10.1-21.1) or in infection rate of animals 1 year (16.4%, CI 12.4-21.2). A significant association between A. ovis infection and the presence of Rhipicephalus bursa and Rhipicephalus turanicus was observed (P diversity of A. ovis were found in small ruminants in Turkey. Copyright © 2018 Elsevier B.V. All rights reserved.

  19. Seroprevalence and risk factors associated with Ehrlichia canis, Anaplasma spp., Borrelia burgdorferi sensu lato, and D. immitis in hunting dogs from southern Italy.

    Science.gov (United States)

    Piantedosi, Diego; Neola, Benedetto; D'Alessio, Nicola; Di Prisco, Francesca; Santoro, Mario; Pacifico, Laura; Sgroi, Giovanni; Auletta, Luigi; Buch, Jesse; Chandrashekar, Ramaswamy; Breitschwerdt, Edward B; Veneziano, Vincenzo

    2017-10-01

    Canine vector-borne diseases (CVBDs) are caused by a range of pathogens transmitted to dogs by arthropods. The present study investigates Ehrlichia canis, Anaplasma spp., Borrelia burgdorferi sensu lato, and Dirofilaria immitis seroprevalences in hunting dogs from southern Italy. Dogs (no. 1335) were tested using a commercial in-clinic enzyme-linked immunosorbent assay kit. Odds ratios (ORs) were calculated by logistic regression analysis to identify risk factors. Overall, 138/1335 dogs (10.3%) were seroreactive to at least one CVBD pathogen. E. canis, Anaplasma spp., B. burgdorferi s.l., and D. immitis seroprevalences were 7.6, 4.4, 0.3, and 0.2%, respectively. E. canis and Anaplasma spp. co-exposures were found in 30 dogs (2.2%), compared with Anaplasma spp. and B. burgdorferi s.l. co-exposures in 2 dogs (0.1%). Adult age was a risk factor for E. canis (OR 2.35) seroreactivity whereas hunting fur-bearing animals for E. canis (OR 4.75) and Anaplasma spp. (OR 1.87), respectively. The historical presence of tick infestation was identified as a risk factor for positivity to E. canis (OR 2.08) and Anaplasma spp. (OR 2.15). Finally, larger dog pack size was significantly associated with E. canis (OR 1.85) and Anaplasma spp. (OR 2.42) exposures. The results of the present survey indicated that hunting dog populations are at relative risk of CVBDs in southern Italy. Further studies are needed to evaluate the role of hunting dogs in the epidemiology of vector-borne organisms due to sharing common environments with wild, sympatric animal populations.

  20. Deficiencia de Vitamina A y Estado Nutricional Antropométrico en niños MarginalesUrbanos y Rurales en el Estado Zulia, Venezuela

    OpenAIRE

    Amaya-Castellanos, Daisy; Viloria-Castejón, Haydée; Ortega, Pablo; Gómez, Gisela; Urrieta, Jesús R; Lobo, Pablo; Estévez, Jesús

    2002-01-01

    El presente estudio transversal fue realizado para estimar la prevalencia de deficiencia de vitamina A (DVA) y desnutrición proteico-energética en una población infantil (24 a 85 meses) de tres barrios marginales urbanos de Maracaibo Estado Zulia, Venezuela (n=173) y de una zona rural (n=34), vecina a Maracaibo, por medio del análisis del retinol sérico y mediciones antropométricas, aplicando puntuación Z a los indicadores Talla//Edad (ZT//E); Peso//Edad (ZP//E) y Peso//Talla (ZP//T), compara...

  1. Human Exposure to Anaplasma phagocytophilum in Two Cities of Northwestern Morocco

    Science.gov (United States)

    Elhamiani Khatat, Sarah; Sahibi, Hamid; Hing, Mony; Alaoui Moustain, Ismail; El Amri, Hamid; Benajiba, Mohammed; Kachani, Malika; Duchateau, Luc; Daminet, Sylvie

    2016-01-01

    Anaplasma phagocytophilum is an emerging tick-borne zoonosis with extensive increased interest. Epidemiological data are available in several regions of the USA, Europe and Asia in contrast to other parts of the world such as North Africa. Blood samples of 261 healthy individuals divided in two groups i.e., dog handlers and blood donors were analysed. Indirect immunofluorescent assay using a commercial kit was performed to detect specific A. phagocytophilum IgG. Two dilutions were used to assess the prevalence of seroreactive samples. Demographic variables were assessed as potential risk factors using exact logistic regression. Seropositivity rates reached 37% and 27% in dog handlers and 36% and 22% in blood donors. No statistically significant differences were found in the prevalence rates between the two groups. Analysis of risk factors such as gender, age groups, outdoor activities, self-reported previous exposure to ticks, or contact with domestic animals (dogs, cats, ruminants and horses) did not shown any significant difference. A. phagocytophilum exposure was common in both high-risk population and blood donors in Morocco. PMID:27532208

  2. Mixed Ehrlichia canis, Hepatozoon canis, and presumptive Anaplasma phagocytophilum infection in a dog.

    Science.gov (United States)

    Mylonakis, Mathio E; Koutinas, Alex F; Baneth, Gad; Polizopoulou, Zoe; Fytianou, Anna

    2004-01-01

    A 5-month-old, female, mongrel dog was admitted to the Clinic of Companion Animal Medicine, Aristotle University of Thessaloniki, Greece, with depression, anorexia, fever, peripheral lymphadenopathy, splenomegaly, oculonasal discharge, nonregenerative anemia, and mild thrombocytopenia. Cytology of Giemsa-stained buffy coat, bone marrow, and lymph node aspiration smears revealed numerous morulae in mononuclear leukocytes and in neutrophils, and Hepatozoon canis gamonts in neutrophils. The dog was seropositive to Ehrlichia canis (immunofluorescence assay [IFA]) and Hepatozoon canis (ELISA) but not to Anaplasma phagocytophilum (IFA). A nested polymerase chain reaction performed on bone marrow aspirates was positive for E canis. This method was not applied for the detection of A phagocytophilum. Treatment with doxycycline and imidocarb dipropionate resulted in both clinical and parasitologic cure. This is the first reported case of a mixed infection with E canis, H canis, and presumptive A phagocytophilum. The findings emphasize the value of cytology in offering a quick and inexpensive diagnosis in mixed tick-borne infections of dogs.

  3. Anaplasma phagocytophilum-Related Defects in CD8, NKT, and NK Lymphocyte Cytotoxicity

    Directory of Open Access Journals (Sweden)

    Diana G. Scorpio

    2018-04-01

    Full Text Available Human granulocytic anaplasmosis, caused by the tick-transmitted Anaplasma phagocytophilum, is not controlled by innate immunity, and induces a proinflammatory disease state with innate immune cell activation. In A. phagocytophilum murine infection models, hepatic injury occurs with production of IFNγ thought to be derived from NK, NKT cells, and CD8 T lymphocytes. Specific A. phagocytophilum ligands that drive inflammation and disease are not known, but suggest a clinical and pathophysiologic basis strikingly like macrophage activation syndrome (MAS and hemophagocytic syndrome (HPS. We studied in vivo responses of NK, NKT, and CD8 T lymphocytes from infected animals for correlates of lymphocyte-mediated cytotoxicity and examined in vitro interactions with A. phagocytophilum-loaded antigen-presenting cells (APCs. Murine splenocytes were examined and found deficient in cytotoxicity as determined by CD107a expression in vitro for specific CTL effector subsets as determined by flow cytometry. Moreover, A. phagocytophilum-loaded APCs did not lead to IFNγ production among CTLs in vitro. These findings support the concept of impaired cytotoxicity with A. phagocytophilum presentation by APCs that express MHC class I and that interact with innate and adaptive immune cells with or after infection. The findings strengthen the concept of an enhanced proinflammatory phenotype, such as MAS and HPS disease states as the basis of disease and severity with A. phagocytophilum infection, and perhaps by other obligate intracellular bacteria.

  4. Anaplasma phagocytophilum Manipulates Host Cell Apoptosis by Different Mechanisms to Establish Infection

    Directory of Open Access Journals (Sweden)

    Pilar Alberdi

    2016-07-01

    Full Text Available Anaplasma phagocytophilum is an emerging zoonotic pathogen that causes human and animal granulocytic anaplasmosis and tick-borne fever of ruminants. This obligate intracellular bacterium evolved to use common strategies to establish infection in both vertebrate hosts and tick vectors. Herein, we discuss the different strategies used by the pathogen to modulate cell apoptosis and establish infection in host cells. In vertebrate neutrophils and human promyelocytic cells HL-60, both pro-apoptotic and anti-apoptotic factors have been reported. Tissue-specific differences in tick response to infection and differential regulation of apoptosis pathways have been observed in adult female midguts and salivary glands in response to infection with A. phagocytophilum. In tick midguts, pathogen inhibits apoptosis through the Janus kinase/signal transducers and activators of transcription (JAK/STAT pathway, while in salivary glands, the intrinsic apoptosis pathways is inhibited but tick cells respond with the activation of the extrinsic apoptosis pathway. In Ixodes scapularis ISE6 cells, bacterial infection down-regulates mitochondrial porin and manipulates protein processing in the endoplasmic reticulum and cell glucose metabolism to inhibit apoptosis and facilitate infection, whereas in IRE/CTVM20 tick cells, inhibition of apoptosis appears to be regulated by lower caspase levels. These results suggest that A. phagocytophilum uses different mechanisms to inhibit apoptosis for infection of both vertebrate and invertebrate hosts.

  5. The prevalence of Anaplasma phagocytophilum in questing Ixodes ricinus ticks in SW Poland.

    Science.gov (United States)

    Kiewra, Dorota; Zaleśny, Grzegorz; Czułowska, Aleksandra

    2014-01-01

    Ticks constitute important vectors of human and animal pathogens. Besides the Lyme borreliosis and tick-borne encephalitis, other pathogens such as Babesia spp., Rickettsia spp., and Anaplasma phagocytophilum, are of increasing public health interest. In Poland, as in other European countries, Ixodes ricinus, the most prevalent tick species responsible for the majority of tick bites in humans, is the main vector of A. phagocytophilum. The aim of the study was to estimate the infection level of I. ricinus with A. phagocytophilum in selected districts, not previously surveyed for the presence of this agent. Sampling of questing ticks was performed in 12 forested sites, located in four districts (Legnica, Milicz, Lubań, and Oława) in SW Poland. Altogether, 792 ticks (151 females, 101 males, and 540 nymphs) representing I. ricinus were checked for the presence of A. phagocytophilum. The average infection level was 4.3%, with higher rate reported for adult ticks. The highest percentage of infected adults was observed in Milicz (17.4%) and the lowest in Oława (6.8%). The abundance of questing I. ricinus in all examined sites as well as the infection with A. phagocytophilum indicate for the first time the risk for HGA transmission in SW Poland.

  6. Diversity of ankA and msp4 genes of Anaplasma phagocytophilum in Slovenia.

    Science.gov (United States)

    Strašek Smrdel, Katja; von Loewenich, Friederike D; Petrovec, Miroslav; Avšič Županc, Tatjana

    2015-03-01

    Granulocytic anaplasmosis is a tick transmitted emerging disease in Europe and worldwide. The agent, Anaplasma phagocytophilum is transmitted by ticks of the genus Ixodes and causes infections in humans and domestic animals. The analysis of different target genes showed that in nature several genetic variants of A. phagocytophilum were present. The purpose of our study was to genetically characterize A. phagocytophilum strains from eight humans, 16 dogs, 12 wild boars, one bear and 18 tick pools from Slovenia. Therefore, the ankA and msp4 genes of A. phagocytophilum were chosen. The same genetic ankA and msp4 variant of A. phagocytophilum was detected in humans, wild boar and a part of the pooled ticks indicating that it circulates in a zoonotic cycle between wild boar and ticks. In dogs, three ankA variants of A. phagocytophilum were detected. One of them was identical to the one that was found in humans. In contrast, all dogs harboured the same msp4 variant as humans and wild boar. In ticks, numerous ankA and msp4 variants were present. Copyright © 2014 Elsevier GmbH. All rights reserved.

  7. Epigenetic silencing of host cell defense genes enhances intracellular survival of the rickettsial pathogen Anaplasma phagocytophilum.

    Directory of Open Access Journals (Sweden)

    Jose C Garcia-Garcia

    2009-06-01

    Full Text Available Intracellular bacteria have evolved mechanisms that promote survival within hostile host environments, often resulting in functional dysregulation and disease. Using the Anaplasma phagocytophilum-infected granulocyte model, we establish a link between host chromatin modifications, defense gene transcription and intracellular bacterial infection. Infection of THP-1 cells with A. phagocytophilum led to silencing of host defense gene expression. Histone deacetylase 1 (HDAC1 expression, activity and binding to the defense gene promoters significantly increased during infection, which resulted in decreased histone H3 acetylation in infected cells. HDAC1 overexpression enhanced infection, whereas pharmacologic and siRNA HDAC1 inhibition significantly decreased bacterial load. HDAC2 does not seem to be involved, since HDAC2 silencing by siRNA had no effect on A. phagocytophilum intracellular propagation. These data indicate that HDAC up-regulation and epigenetic silencing of host cell defense genes is required for A. phagocytophilum infection. Bacterial epigenetic regulation of host cell gene transcription could be a general mechanism that enhances intracellular pathogen survival while altering cell function and promoting disease.

  8. Remodeling of tick cytoskeleton in response to infection with Anaplasma phagocytophilum.

    Science.gov (United States)

    Cabezas-Cruz, Alejandro; Alberdi, Pilar; Valdes, James J; Villar, Margarita; de la Fuente, Jose

    2017-06-01

    The obligate intracellular pathogen Anaplasma phagocytophilum infects vertebrate and tick hosts. In this study, a genome-wide search for cytoskeleton components was performed in the tick vector, Ixodes scapularis . The available transcriptomics and proteomics data was then used to characterize the mRNA and protein levels of I. scapularis cytoskeleton components in response to A. phagocytophilum infection. The results showed that cytoskeleton components described in other model organisms were present in the I. scapularis genome. One type of intermediate filaments (lamin), a family of septins that was recently implicated in the cellular response to intracellular pathogens, and several members of motor proteins (kinesins and dyneins) that could be implicated in the cytoplasmic movements of A. phagocytophilum were found. The results showed that levels of tubulin, actin, septin, actin-related proteins and motor proteins were affected by A. phagocytophilum , probably to facilitate infection in I. scapularis . Functional studies demonstrated a role for selected cytoskeleton components in pathogen infection. These results provided a more comprehensive view of the cytoskeletal components involved in the response to A. phagocytophilum infection in ticks.

  9. Superinfection occurs in Anaplasma phagocytophilum infected sheep irrespective of infection phase and protection status

    Directory of Open Access Journals (Sweden)

    Bergström Karin

    2009-10-01

    Full Text Available Abstract Background Anaplasma phagocytophilum infection in domestic ruminants is widespread in the coastal areas of southern Norway. The bacteria may persist in mammalian hosts. Several genetic variants of A. phagocytophilum exist. In the present study, we investigate whether superinfection occurs in the acute and persistent phase of the infection. Methods Five-month-old lambs of the Norwegian Dala breed were experimentally infected with two 16S rRNA gene variants of A. phagocytophilum, i.e. A. phagocytophilum variant 1 (GenBank accession number M73220 and variant 2 (GenBank acc. no. AF336220. Eighteen lambs were used, two lambs in each group. Eight groups were experimentally inoculated with either variant 1 or 2 on day 0. Six of these groups were then challenged with the other variant on either days 7, 42 or 84, respectively. One group was left uninfected. The occurrence of A. phagocytophilum in blood samples was determined using semi-nested PCR analysis and gene sequencing. Specific antibodies were measured by an indirect immunofluorescence antibody assay (IFA. Results A. phagocytophilum variant 1 and 2 differed significantly with regards to clinical reaction and cross-immunity in infected lambs. Both variants were found in the blood after challenge. However, variant 1 was detected most frequently. Conclusion The present experiment indicates that superinfection of different genotypes occurs during the acute as well as the persistent phase of an A. phagocytophilum infection, even in lambs protected against the challenged infection.

  10. Genome-wide Anaplasma phagocytophilum AnkA-DNA interactions are enriched in intergenic regions and gene promoters and correlate with infection-induced differential gene expression.

    Directory of Open Access Journals (Sweden)

    J Stephen Dumler

    2016-09-01

    Full Text Available Anaplasma phagocytophilum, an obligate intracellular prokaryote, infects neutrophils and alters cardinal functions via reprogrammed transcription. Large contiguous regions of neutrophil chromosomes are differentially expressed during infection. Secreted A. phagocytophilum effector AnkA transits into the neutrophil or granulocyte nucleus to complex with DNA in heterochromatin across all chromosomes. AnkA binds to gene promoters to dampen cis-transcription and also has features of matrix attachment region (MAR-binding proteins that regulate three-dimensional chromatin architecture and coordinate transcriptional programs encoded in topologically-associated chromatin domains. We hypothesize that identification of additional AnkA binding sites will better delineate how A. phagocytophilum infection results in reprogramming of the neutrophil genome. Using AnkA-binding ChIP-seq, we showed that AnkA binds broadly throughout all chromosomes in a reproducible pattern, especially at: i intergenic regions predicted to be matrix attachment regions (MARs; ii within predicted lamina-associated domains; and iii at promoters ≤3,000 bp upstream of transcriptional start sites. These findings provide genome-wide support for AnkA as a regulator of cis-gene transcription. Moreover, the dominant mark of AnkA in distal intergenic regions known to be AT-enriched, coupled with frequent enrichment in the nuclear lamina, provides strong support for its role as a MAR-binding protein and genome re-organizer. AnkA must be considered a prime candidate to promote neutrophil reprogramming and subsequent functional changes that belie improved microbial fitness and pathogenicity.

  11. Detection of Ehrlichia spp., Anaplasma spp., Rickettsia spp., and other eubacteria in ticks from the Thai-Myanmar border and Vietnam.

    Science.gov (United States)

    Parola, Philippe; Cornet, Jean-Paul; Sanogo, Yibayiri Osée; Miller, R Scott; Thien, Huynh Van; Gonzalez, Jean-Paul; Raoult, Didier; Telford III, Sam R; Wongsrichanalai, Chansuda

    2003-04-01

    A total of 650 ticks, including 13 species from five genera, were collected from animals, from people, or by flagging of the vegetation at sites on the Thai-Myanmar border and in Vietnam. They were tested by PCR to detect DNA of bacteria of the order RICKETTSIALES: Three Anaplasma spp. were detected in ticks collected in Thailand, including (i) Anaplasma sp. strain AnDa465, which was considered a genotype of Anaplasma platys (formerly Ehrlichia platys) and which was obtained from Dermacentor auratus ticks collected from dogs; (ii) Anaplasma sp. strain AnAj360, which was obtained from Amblyomma javanense ticks collected on a pangolin; and (iii) Anaplasma sp. strain AnHl446, which was closely related to Anaplasma bovis and which was detected in Haemaphysalis lagrangei ticks collected from a bear. Three Ehrlichia spp. were identified, including (i) Ehrlichia sp. strain EBm52, which was obtained from Boophilus microplus ticks collected from cattle from Thailand; (ii) Ehrlichia sp. strain EHh324, which was closely related to Ehrlichia chaffeensis and which was detected in Haemaphysalis hystricis ticks collected from wild pigs in Vietnam; and (iii) Ehrlichia sp. strain EHh317, which was closely related to Ehrlichia sp. strain EBm52 and which was also detected in H. hystricis ticks collected from wild pigs in Vietnam. Two Rickettsia spp. were detected in Thailand, including (i) Rickettsia sp. strain RDla420, which was detected in Dermacentor auratus ticks collected from a bear, and (ii) Rickettsia sp. strain RDla440, which was identified from two pools of Dermacentor larvae collected from a wild pig nest. Finally, two bacteria named Eubacterium sp. strain Hw124 and Eubacterium sp. strain Hw191 were identified in Haemaphysalis wellingtoni ticks collected from chicken in Thailand; these strains could belong to a new group of bacteria.

  12. A proline racemase based PCR for identification of Trypanosoma vivax in cattle blood.

    Directory of Open Access Journals (Sweden)

    Regassa Fikru

    Full Text Available A study was conducted to develop a Trypanosoma vivax (T. vivax specific PCR based on the T. vivax proline racemase (TvPRAC gene. Forward and reverse primers were designed that bind at 764-783 bp and 983-1002 bp of the gene. To assess its specificity, TvPRAC PCR was conducted on DNA extracted from different haemotropic pathogens: T. vivax from Nigeria, Ethiopia and Venezuela, T. congolense Savannah type, T. brucei brucei, T. evansi, T. equiperdum, T. theileri, Theileria parva, Anaplasma marginale, Babesia bovis and Babesia bigemina and from bovine, goat, mouse, camel and human blood. The analytical sensitivity of the TvPRAC PCR was compared with that of the ITS-1 PCR and the 18S PCR-RFLP on a dilution series of T. vivax DNA in water. The diagnostic performance of the three PCRs was compared on 411 Ethiopian bovine blood specimens collected in a former study. TvPRAC PCR proved to be fully specific for T. vivax, irrespective of its geographical origin. Its analytical sensitivity was lower than that of ITS-1 PCR. On these bovine specimens, TvPRAC PCR detected 8.3% T. vivax infections while ITS-1 PCR and 18S PCR-RFLP detected respectively 22.6 and 6.1% T. vivax infections. The study demonstrates that a proline racemase based PCR could be used, preferably in combination with ITS-1 PCR, as a species-specific diagnostic test for T. vivax infections worldwide.

  13. Intraoperative bleeding in dogs from Grenada seroreactive to Anaplasma platys and Ehrlichia canis.

    Science.gov (United States)

    Lanza-Perea, M; Zieger, U; Qurollo, B A; Hegarty, B C; Pultorak, E L; Kumthekar, S; Bruhl-Day, R; Breitschwerdt, E B

    2014-01-01

    Frequent exposure of Grenadian dogs to Rhipicephalus sanguineus results in Anaplasma platys, and Ehrlichia canis seroreactivity. During elective surgeries, substantial intraoperative hemorrhage occurs in some seroreactive dogs. To assess hemostatic parameters and bleeding tendencies as well as prevalence of PCR positivity in apparently healthy A. platys and E. canis seroreactive and seronegative free-roaming dogs from Grenada. Forty-seven elective surgery dogs allocated to 4 groups: Seronegative control (n = 12), A. platys (n = 10), E. canis (n = 14) and A. platys, and E. canis (n = 11) seroreactive. Preoperatively, hemostasis was assessed by platelet count, prothrombin time, activated partial thromboplastin time, and buccal mucosal bleeding time. Intra- and postoperative bleeding scores were subjectively assigned. Blood, spleen, bone marrow, and lymph node aspirates were tested by PCR. Bleeding scores in dogs coseroreactive for A. platys and E. canis were higher (P = .015) than those of seronegative dogs. A. platys DNA was amplified from 7/21 (33%) A. platys seroreactive dogs and from 1 E. canis seroreactive dog; E. canis DNA was amplified from 21/25 (84%) E. canis seroreactive dogs. E. canis DNA was amplified most often from blood, whereas A. platys DNA was amplified most often from bone marrow. Apparently healthy, free-roaming dogs coseropositive for A. platys and E. canis may have increased intraoperative bleeding tendencies despite normal hemostatic parameters. Future investigations should explore the potential for vascular injury as a cause for bleeding in these dogs. Improved tick control is needed for dogs in Grenada. Copyright © 2014 by the American College of Veterinary Internal Medicine.

  14. Canine infection with Borrelia burgdorferi, Dirofilaria immitis, Anaplasma spp. and Ehrlichia spp. in Canada, 2013-2014.

    Science.gov (United States)

    Herrin, Brian H; Peregrine, Andrew S; Goring, Jonas; Beall, Melissa J; Little, Susan E

    2017-05-19

    Canine test results generated by veterinarians throughout Canada from 2013-2014 were evaluated to assess the geographical distribution of canine infection with Borrelia burgdorferi, Dirofilaria immitis, Ehrlichia spp., and Anaplasma spp. The percent positive test results of 115,636 SNAP® 4Dx® Plus tests from dogs tested were collated by province and municipality to determine the distribution of these vector-borne infections in Canada. A total of 2,844/115,636 (2.5%) dogs tested positive for antibody to B. burgdorferi. In contrast, positive test results for D. immitis antigen and antibodies to Ehrlichia spp. and Anaplasma spp. were low, with less than 0.5% of dogs testing positive for any one of these three agents nationwide. Provincial seroprevalence for antibodies to B. burgdorferi ranged from 0.5% (Saskatchewan)-15.7% (Nova Scotia); the areas of highest percent positive test results were in proximity to regions in the USA considered endemic for Lyme borreliosis, including Nova Scotia (15.7%) and Eastern Ontario (5.1%). These high endemic foci, which had significantly higher percent positive test results than the rest of the nation (P Canada. Using dogs as sentinels for these pathogens can aid in recognition of the public and veterinary health threat that each pose.

  15. DETECTION OF ANTIBODIES TO ANAPLASMA, BARTONELLA AND COXIELLA IN RURAL INHABITANTS OF THE CARIBBEAN AREA OF COLOMBIA

    Directory of Open Access Journals (Sweden)

    Salim Máttar

    2006-12-01

    Full Text Available Objetivo. Establecer la seroprevalencia de Bartonella spp, Anaplasma phagocytophilum (antesErlichia y Coexiella burnetii. Materiales y métodos. Se analizaron sueros representativos de unsector de la población en el año 2003, recolectados de personas que trabajan en actividades delcampo en los departamentos de Córdoba y Sucre que sirvieron como población base de las muestrasque se obtuvieron. Los trabajadores rurales elegidos a participar tenían entra 16 – 65 años deedad. Los sueros fueron examinados por IFA para detección de anticuerpos contra IgG para Bartonellaspp, Erlichia Anaplasma phagocytophilum y Coexiella burnetii. Resultados. La seroprevalencia deanticuerpos de todos los microorganismos estudiados fue de 56.8%. De 81 muestras de sueroanalizadas el 26.6% fueron seropositivas contra C. burnetii, el 37.7% tuvieron anticuerpos contraBartonella y el 20% de los individuos evaluados fueron seropositivos para Anaplasmaphagocytophilum. Conclusiones. Nuestros datos indican que la prevalencia de anticuerpos contraBartonella, A. phagocytophilum y C. burnetii son altos en nuestra región. Los resultados indicanque estas enfermedades zoonoticas son muy comunes en las personas que residen en el área delcaribe colombiano. Este estudio demuestra por primera vez la presencia de estos microorganismosen Colombia.

  16. Anaplasma phagocytophilum increases the levels of histone modifying enzymes to inhibit cell apoptosis and facilitate pathogen infection in the tick vector Ixodes scapularis

    Czech Academy of Sciences Publication Activity Database

    Cabezas-Cruz, A.; Alberdi, P.; Ayllón, N.; Valdés, James J.; Pierce, R.; Villar, M.; de la Fuente, J.

    2016-01-01

    Roč. 11, č. 4 (2016), s. 303-319 ISSN 1559-2294 EU Projects: European Commission(XE) 278976 - ANTIGONE; European Commission(XE) 316304 - MODBIOLIN Institutional support: RVO:60077344 Keywords : Anaplasma * epigenetic s * histone modifying enzyme * histone * pathogen * tick Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.394, year: 2016

  17. Occurrence of Hepatozoon canis (Adeleorina: Hepatozoidae) and Anaplasma spp. (Rickettsiales: Anaplasmataceae) in black-backed jackals (Canis mesomelas) in South Africa.

    Science.gov (United States)

    Penzhorn, Barend L; Netherlands, Edward C; Cook, Courtney A; Smit, Nico J; Vorster, Ilse; Harrison-White, Robert F; Oosthuizen, Marinda C

    2018-03-20

    Domestic dogs are not native to sub-Saharan Africa, which may account for their susceptibility to Babesia rossi, of which endemic black-backed jackals (Canis mesomelas) are natural reservoirs. There is virtually no information on the occurrence of potentially pathogenic haemogregarines (e.g. Hepatozoon canis) or even rickettsial bacteria (e.g. Ehrlichia spp. and Anaplasma spp.) in indigenous canids in sub-Saharan Africa. Such organisms could pose a risk to domestic dogs, as well as to populations of endangered indigenous canid species. Genomic DNA extracted from blood samples taken from 126 free-ranging and 16 captive black-backed jackals was subjected to reverse line blot (RLB) hybridization assay; 82 (57.8%) specimens reacted only with the Ehrlichia/Anaplasma genera-specific probe. Full-length bacterial 16S rRNA gene of five of these specimens was cloned and the recombinants sequenced. The ten 16S rDNA sequences obtained were most closely related, with approximately 99% identity, to Anaplasma sp. South African Dog, various uncultured Anaplasma spp., as well as various Anaplasma phagocytophilum genotypes. Ninety-one specimens were screened for haemogregarines through PCR amplification using the 18S rRNA gene; 20 (21.9%) specimens reacted positively, of which 14 (15.4%) were confirmed positive for Hepatozoon genotypes from within H. canis. Two (2.2%) specimens were found positive for two different Hepatozoon genotypes. Sequence analyses confirmed the presence of 16S rDNA sequences closely related to A. phagocytophilum and Anaplasma sp. South African Dog as well as two H. canis genotypes in both free-ranging and captive black-backed jackals. Distinguishing between closely related lineages may provide insight into differences in pathogenicity and virulence of various Anaplasma and H. canis genotypes. By building up a more comprehensive understanding of the range and diversity of the bacteria and eukaryotic organisms (piroplasms and haemogregarines) in the blood of

  18. Influence des paramètres d'un laser ER: YAG sur l'adaptation marginale d'une restauration à faible contraction

    OpenAIRE

    Peeters, Frédéric

    2013-01-01

    Quarante molaires ont été réparties en cinq groupes. C'est avec un laser de type Er:YAG que des cavités occlusales ont été faites sur les dents des quatre premiers groupes et cela avec certains paramètres définis et spécifiques à chacun. Les dents du dernier groupe quant à elles, ont subi un traitement conventionnel de fraisage. L’obturation des cavités a été faite avec le même matériau, une résine composite à faible taux de contraction. L'adaptation marginale de chaque dent a ensuite été com...

  19. Prevalencia de caries de infancia temprana en niños menores de 6 años de edad, residentes en poblados urbano marginales de Lima Norte

    OpenAIRE

    Villena Sarmiento, Rita; Pachas Barrionuevo, Flor; Sánchez Huamán, Yhedina; Carrasco Loyola, Milagros

    2014-01-01

    La prevalencia de caries de infancia temprana es un problema de salud pública prevenible y que afecta a un gran número de niños. El propósito de este trabajo fue determinar la prevalencia yseveridad de la caries dental en niños de 6-71 meses de edad de comunidades urbano marginales de Lima. Se evaluaron a 332 niños con los criterios de caries dental de la OMS, con equipo noinvasivo, bajo luz natural, y con técnica de rodilla-rodilla para los más pequeños. Fueron calibrados 3 odontólogos en el...

  20. Redes comunitarias: un desafío para escuelas urbano-marginales (COMMUNITY NETWORKS: A CHALLENGE FOR URBAN MARGINAL SCHOOLS

    Directory of Open Access Journals (Sweden)

    Moscoloni Bicchi Nora

    2009-04-01

    Full Text Available Resumen: Las ideas básicas de este trabajo son conocer y comprender el entramado de la red de relaciones entre los distintos actores de las instituciones: escuela y organismos de la comunidad y su incidencia en la calidad educativa / calidad de vida. Analizamos la visión de los distintos actores educativos acerca de la inserción de la escuela en la comunidad. Tomamos como punto de partida el análisis de las relaciones entre calidad educativa y calidad de vida, en poblaciones urbano-marginales. Realizamos en primer lugar una investigación exploratoria, para conocer las características generales de escuelas que reciben población marginal. En una segunda etapa seleccionamos cuatro escuelas, que tomamos como casos e indagamos sus problemáticas. En ellas observamos gran dificultad para la construcción de redes comunitarias desde la institución escolar. Si bien responden a los problemas puntuales, mediante cambios o innovaciones planificados dinámica y flexiblemente, no existen soluciones duraderas debido a la falta de una convocatoria que comprometa a todas las instituciones de la comunidad constituyendo una efectiva relación en red. Estos resultados alcanzados en la investigación son producto de la triangulación de los datos estadísticos, documentales e históricos así como de los procedentes de la observación participante y de la información de las entrevistas en profundidad.Abstract:The basic ideas of this work are to know and understand the fabric of the network of relationships between the different institutions involved in school and community agencies and their impact on the quality of education / quality of life. The vision of the different actors of education about the insertion of the school in the community is analyzed from the point of view of the school. The analysis started studying how the quality of education is related to the quality of life in marginalized urban populations. At first an exploratory research was

  1. Investigating the Adult Ixodid Tick Populations and Their Associated Anaplasma, Ehrlichia, and Rickettsia Bacteria at a Rocky Mountain Spotted Fever Hotspot in Western Tennessee.

    Science.gov (United States)

    Trout Fryxell, Rebecca T; Hendricks, Brain M; Pompo, Kimberly; Mays, Sarah E; Paulsen, Dave J; Operario, Darwin J; Houston, Allan E

    2017-08-01

    Ehrlichiosis and rickettsiosis are two common bacterial tick-borne diseases in the southeastern United States. Ehrlichiosis is caused by ehrlichiae transmitted by Amblyomma americanum and rickettsiosis is caused by rickettsiae transmitted by Amblyomma maculatum and Dermacentor variabilis. These ticks are common and have overlapping distributions in the region. The objective of this study was to identify Anaplasma, Ehrlichia, and Rickettsia species associated with questing ticks in a Rocky Mountain spotted fever (RMSF) hotspot, and identify habitats, time periods, and collection methods for collecting questing-infected ticks. Using vegetation drags and CO 2 -baited traps, ticks were collected six times (May-September 2012) from 100 sites (upland deciduous, bottomland deciduous, grassland, and coniferous habitats) in western Tennessee. Adult collections were screened for Anaplasma and Ehrlichia (simultaneous polymerase chain reaction [PCR]) and Rickettsia using genus-specific PCRs, and resulting positive amplicons were sequenced. Anaplasma and Ehrlichia were only identified within A. americanum (Ehrlichia ewingii, Ehrlichia chaffeensis, Panola Mountain Ehrlichia, and Anaplasma odocoilei sp. nov.); more Ehrlichia-infected A. americanum were collected at the end of June regardless of habitat and collection method. Rickettsia was identified in three tick species; "Candidatus Rickettsia amblyommii" from A. americanum, R. parkeri and R. andeanae from A. maculatum, and R. montanensis ( = montana) from D. variabilis. Overall, significantly more Rickettsia-infected ticks were identified as A. americanum and A. maculatum compared to D. variabilis; more infected-ticks were collected from sites May-July and with dragging. In this study, we report in the Tennessee RMSF hotspot the following: (1) Anaplasma and Ehrlichia are only found in A. americanum, (2) each tick species has its own Rickettsia species, (3) a majority of questing-infected ticks are collected May-July, (4) A

  2. Molecular detection and identification of hemoparasites in pampas deer (Ozotoceros bezoarticus Linnaeus, 1758) from the Pantanal Brazil.

    Science.gov (United States)

    Silveira, Júlia A G; Rabelo, Elida M L; Lacerda, Ana C R; Borges, Paulo A L; Tomás, Walfrido M; Pellegrin, Aiesca O; Tomich, Renata G P; Ribeiro, Múcio F B

    2013-06-01

    Hemoparasites were surveyed in 60 free-living pampas deer Ozotoceros bezoarticus from the central area of the Pantanal, known as Nhecolândia, State of Mato Grosso do Sul, Brazil, through the analysis of nested PCR assays and nucleotide sequencing. Blood samples were tested for Babesia/Theileria, Anaplasma spp., and Trypanosoma spp. using nPCR assays and sequencing of the 18S rRNA, msp4, ITS, and cathepsin L genes. The identity of each sequence was confirmed by comparison with sequences from GenBank using BLAST software. Forty-six (77%) pampas deer were positive for at least one hemoparasite, according to PCR assays. Co-infection occurred in 13 (22%) animals. Based on the sequencing results, 29 (48%) tested positive for A. marginale. Babesia/Theileria were detected in 23 (38%) samples, and according to the sequencing results 52% (12/23) of the samples were similar to T. cervi, 13% (3/23) were similar to Babesia bovis, and 9% (2/23) were similar to B. bigemina. No samples were amplified with the primers for T. vivax, while 11 (18%) were amplified with the ITS primers for T. evansi. The results showed pampas deer to be co-infected with several hemoparasites, including species that may cause serious disease in cattle. Pampas deer is an endangered species in Brazil, and the consequences of these infections to their health are poorly understood. Copyright © 2013 Elsevier GmbH. All rights reserved.

  3. An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.

    Science.gov (United States)

    Oliva Chávez, Adela S; Fairman, James W; Felsheim, Roderick F; Nelson, Curtis M; Herron, Michael J; Higgins, LeeAnn; Burkhardt, Nicole Y; Oliver, Jonathan D; Markowski, Todd W; Kurtti, Timothy J; Edwards, Thomas E; Munderloh, Ulrike G

    2015-01-01

    Anaplasma phagocytophilum, the causative agent of Human Granulocytic Anaplasmosis (HGA), is an obligately intracellular α-proteobacterium that is transmitted by Ixodes spp ticks. However, the pathogen is not transovarially transmitted between tick generations and therefore needs to survive in both a mammalian host and the arthropod vector to complete its life cycle. To adapt to different environments, pathogens rely on differential gene expression as well as the modification of proteins and other molecules. Random transposon mutagenesis of A. phagocytophilum resulted in an insertion within the coding region of an o-methyltransferase (omt) family 3 gene. In wild-type bacteria, expression of omt was up-regulated during binding to tick cells (ISE6) at 2 hr post-inoculation, but nearly absent by 4 hr p.i. Gene disruption reduced bacterial binding to ISE6 cells, and the mutant bacteria that were able to enter the cells were arrested in their replication and development. Analyses of the proteomes of wild-type versus mutant bacteria during binding to ISE6 cells identified Major Surface Protein 4 (Msp4), but also hypothetical protein APH_0406, as the most differentially methylated. Importantly, two glutamic acid residues (the targets of the OMT) were methyl-modified in wild-type Msp4, whereas a single asparagine (not a target of the OMT) was methylated in APH_0406. In vitro methylation assays demonstrated that recombinant OMT specifically methylated Msp4. Towards a greater understanding of the overall structure and catalytic activity of the OMT, we solved the apo (PDB_ID:4OA8), the S-adenosine homocystein-bound (PDB_ID:4OA5), the SAH-Mn2+ bound (PDB_ID:4PCA), and SAM- Mn2+ bound (PDB_ID:4PCL) X-ray crystal structures of the enzyme. Here, we characterized a mutation in A. phagocytophilum that affected the ability of the bacteria to productively infect cells from its natural vector. Nevertheless, due to the lack of complementation, we cannot rule out secondary mutations.

  4. An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.

    Directory of Open Access Journals (Sweden)

    Adela S Oliva Chávez

    Full Text Available Anaplasma phagocytophilum, the causative agent of Human Granulocytic Anaplasmosis (HGA, is an obligately intracellular α-proteobacterium that is transmitted by Ixodes spp ticks. However, the pathogen is not transovarially transmitted between tick generations and therefore needs to survive in both a mammalian host and the arthropod vector to complete its life cycle. To adapt to different environments, pathogens rely on differential gene expression as well as the modification of proteins and other molecules. Random transposon mutagenesis of A. phagocytophilum resulted in an insertion within the coding region of an o-methyltransferase (omt family 3 gene. In wild-type bacteria, expression of omt was up-regulated during binding to tick cells (ISE6 at 2 hr post-inoculation, but nearly absent by 4 hr p.i. Gene disruption reduced bacterial binding to ISE6 cells, and the mutant bacteria that were able to enter the cells were arrested in their replication and development. Analyses of the proteomes of wild-type versus mutant bacteria during binding to ISE6 cells identified Major Surface Protein 4 (Msp4, but also hypothetical protein APH_0406, as the most differentially methylated. Importantly, two glutamic acid residues (the targets of the OMT were methyl-modified in wild-type Msp4, whereas a single asparagine (not a target of the OMT was methylated in APH_0406. In vitro methylation assays demonstrated that recombinant OMT specifically methylated Msp4. Towards a greater understanding of the overall structure and catalytic activity of the OMT, we solved the apo (PDB_ID:4OA8, the S-adenosine homocystein-bound (PDB_ID:4OA5, the SAH-Mn2+ bound (PDB_ID:4PCA, and SAM- Mn2+ bound (PDB_ID:4PCL X-ray crystal structures of the enzyme. Here, we characterized a mutation in A. phagocytophilum that affected the ability of the bacteria to productively infect cells from its natural vector. Nevertheless, due to the lack of complementation, we cannot rule out secondary

  5. Structure of the type IV secretion system in different strains of Anaplasma phagocytophilum

    Directory of Open Access Journals (Sweden)

    Al-Khedery Basima

    2012-11-01

    Full Text Available Abstract Background Anaplasma phagocytophilum is an intracellular organism in the Order Rickettsiales that infects diverse animal species and is causing an emerging disease in humans, dogs and horses. Different strains have very different cell tropisms and virulence. For example, in the U.S., strains have been described that infect ruminants but not dogs or rodents. An intriguing question is how the strains of A. phagocytophilum differ and what different genome loci are involved in cell tropisms and/or virulence. Type IV secretion systems (T4SS are responsible for translocation of substrates across the cell membrane by mechanisms that require contact with the recipient cell. They are especially important in organisms such as the Rickettsiales which require T4SS to aid colonization and survival within both mammalian and tick vector cells. We determined the structure of the T4SS in 7 strains from the U.S. and Europe and revised the sequence of the repetitive virB6 locus of the human HZ strain. Results Although in all strains the T4SS conforms to the previously described split loci for vir genes, there is great diversity within these loci among strains. This is particularly evident in the virB2 and virB6 which are postulated to encode the secretion channel and proteins exposed on the bacterial surface. VirB6-4 has an unusual highly repetitive structure and can have a molecular weight greater than 500,000. For many of the virs, phylogenetic trees position A. phagocytophilum strains infecting ruminants in the U.S. and Europe distant from strains infecting humans and dogs in the U.S. Conclusions Our study reveals evidence of gene duplication and considerable diversity of T4SS components in strains infecting different animals. The diversity in virB2 is in both the total number of copies, which varied from 8 to 15 in the herein characterized strains, and in the sequence of each copy. The diversity in virB6 is in the sequence of each of the 4 copies in

  6. Molecular detection and characterization of Anaplasma platys in dogs and ticks in Cuba.

    Science.gov (United States)

    Silva, Claudia Bezerra da; Santos, Huarrisson Azevedo; Navarrete, Maylín González; Ribeiro, Carla Carolina Dias Uzedo; Gonzalez, Belkis Corona; Zaldivar, Maykelin Fuentes; Pires, Marcus Sandes; Peckle, Maristela; Costa, Renata Lins da; Vitari, Gabriela Lopes Vivas; Massard, Carlos Luiz

    2016-07-01

    Canine cyclic thrombocytopenia, an infectious disease caused by Anaplasma platys is a worldwide dog health problem. This study aimed to detect and characterize A. platys deoxyribonucleic acid (DNA) in dogs and ticks from Cuba using molecular methods. The study was conducted in four cities of Cuba (Habana del Este, Boyeros, Cotorro and San José de las Lajas). Blood samples were collected from 100 dogs in these cities. The animals were inspected for the detection of tick infestation and specimens were collected. Genomic DNA was extracted from dog blood and ticks using a commercial kit. Genomic DNA samples from blood and ticks were tested by a nested polymerase chain reaction (nPCR) to amplify 678 base pairs (bp) from the 16S ribosomal DNA (rDNA) of A. platys. Positive samples in nPCR were also subjected to PCR to amplify a fragment of 580bp from the citrate synthase (gltA) gene and the products were sequenced. Only Rhipicephalus sanguineus sensu lato (s.l.) was found on dogs, and 10.20% (n=5/49) of these ticks plus sixteen percent (16.0%, n=16/100) of dogs were considered positive for A. platys by nPCR targeting the 16S rDNA gene. All analyzed gltA and 16S rDNA sequences showed a 99-100% identity with sequences of A. platys reported in around the world. Phylogenetic analysis showed two defined clusters for the 16S rDNA gene and three defined clusters for the gltA gene. Based on the gltA gene, the deduced amino acid sequence showed two mutations at positions 88 and 168 compared with the sequence DQ525687 (GenBank ID from Italian sample), used as a reference in the alignment. A preliminary study on the epidemiological aspects associated with infection by A. platys showed no statistical association with the variables studied (p>0.05). This is the first evidence of the presence of A. platys in dogs and ticks in Cuba. Further studies are needed to evaluate the epidemiological aspects of A. platys infection in Cuban dogs. Copyright © 2016 Elsevier GmbH. All rights

  7. First evidence of Anaplasma platys and Hepatozoon canis co-infection in a dog from Romania--a case report.

    Science.gov (United States)

    Andersson, Martin; Turcitu, Mihai A; Stefanache, Mircea; Tamba, Paula; Barbuceanu, Florica; Chitimia, Lidia

    2013-06-01

    Anaplasma platys was first identified and described in North America as a Rickettsia-like, platelet-specific organism in dogs with infectious canine cyclic thrombocytopenia. In Europe, A. platys has so far mainly been described for some Mediterranean countries. Here, we describe a case of A. platys infection in a dog from Romania, confirmed by PCR. Additionally, the dog had a co-infection with Hepatozoon canis. To the best of our knowledge, this is the first case of A. platys infection in Romania and the first case of a co-infection with A. platys and H. canis altogether. Both pathogens should be considered as possible disease agents in dogs suffering from disease associated with tick bite in south-eastern Europe. Copyright © 2013 Elsevier GmbH. All rights reserved.

  8. The infection of questing Dermacentor reticulatus ticks with Babesia canis and Anaplasma phagocytophilum in the Chernobyl exclusion zone.

    Science.gov (United States)

    Karbowiak, Grzegorz; Vichová, Bronislavá; Slivinska, Kateryna; Werszko, Joanna; Didyk, Julia; Peťko, Branislav; Stanko, Michal; Akimov, Igor

    2014-08-29

    Tick occurrence was studied in the Chernobyl exclusion zone (CEZ) during the August-October 2009-2012. Dermacentor reticulatus ticks were collected using the flagging method and then screened for infection with Anaplasma phagocytophilum and Babesia canis by a PCR method incorporating specific primers and sequence analysis. The prevalence of infection with B. canis canis and A. phagocytophilum was found to be 3.41% and 25.36%, respectively. The results present the first evidence of B. canis canis and A. phagocytophilum in questing D. reticulatus ticks from the Chernobyl exclusion zone. They also reveal the presence of tick-borne disease foci in areas with no human activity, and confirm that they can be maintained in areas after a nuclear disaster with radioactive contamination. Copyright © 2014 Elsevier B.V. All rights reserved.

  9. Clinical and molecular features of one case of human infection with Anaplasma phagocytophilum from Podlaskie Province in eastern Poland

    Directory of Open Access Journals (Sweden)

    Renata Welc-Falęciak

    2015-09-01

    Full Text Available The article focuses on the clinical and laboratory diagnosis of human granulocytic anaplasmosis (HGA caused by Anaplasma phagocytophilum infection in one of 28 patients (3.6%; n=1/28 tested samples with early Lyme borreliosis. The clinical and laboratory results of a 42-year-old patient fulfilled criteria of confirm anaplasmosis and suggest an acute stage of illness. The described case provides strong presumptive evidence that infection in this patient was acquired with a pathogenic strain of A. phagocytophilum through a tick bite. A positive DNA with PCR for A. phagocytophilum infection was sequenced and analyzed phylogenetically. Physicians should consider the possibility of anaplasmosis in patients with early Lyme borreliosis, and A. phagocytophilum should be considered as a differential diagnosis in all patients from an endemic region of potential high risk factors for tick-borne diseases.

  10. A putative marker for human pathogenic strains of Anaplasma phagocytophilum correlates with geography and host, but not human tropism.

    Science.gov (United States)

    Foley, Janet; Stephenson, Nicole; Cubilla, Michelle Pires; Qurollo, Barbara; Breitschwerdt, Edward B

    2016-03-01

    Anaplasma phagocytophilum is an Ixodes species tick-transmitted bacterium that is capable of infecting a variety of host species, although there is a diversity of bacterial strains with differing host tropism. Recent analysis of A. phagocytophilum strains suggested that "drhm", a gene locus designated "distantly related to human marker" (drhm), which was predicted to be an integral membrane protein with possible transporter functions was not present in available canine and human isolates. By assessing 117 strains from 14 host species from across the US, we extended this analysis. Phylogenetic clades were associated with geography, but not host species. Additionally, a virulent clade that lacks drhm and infects dogs, horses, and humans in northeastern US was identified. Copyright © 2015 Elsevier GmbH. All rights reserved.

  11. First molecular evidence of Anaplasma ovis and Rickettsia spp. in keds (Diptera: Hippoboscidae) of sheep and wild ruminants.

    Science.gov (United States)

    Hornok, Sándor; de la Fuente, José; Biró, Nóra; Fernández de Mera, Isabel G; Meli, Marina L; Elek, Vilmos; Gönczi, Eniko; Meili, Theres; Tánczos, Balázs; Farkas, Róbert; Lutz, Hans; Hofmann-Lehmann, Regina

    2011-10-01

    To evaluate the presence of rickettsial agents in hippoboscid flies with molecular methods, 81 sheep keds (Melophagus ovinus) were collected from 23 sheep, 144 deer keds (Lipoptena cervi) were caught in the environment, and a further 463 and 59 individuals of the latter species were obtained from fresh carcasses of 29 red deer and 17 roe deer, respectively. DNA was extracted individually or in pools. Anaplasma ovis was demonstrated in all examined sheep keds, and from one pool of free-living deer keds. Rickettsia helvetica or other, unidentified rickettsiae were also present in one pool of sheep keds, and in four pools of deer keds from both red deer and roe deer. This is the first account of polymerase chain reaction positivity of hippoboscid flies for A. ovis and rickettsiae. These results raise the possibility that-apart from cattle and roe deer as already reported-sheep and red deer might also play a reservoir role in the epidemiology of rickettsioses.

  12. Infections and risk factors for livestock with species of Anaplasma, Babesia and Brucella under semi-nomadic rearing in Karamoja Region, Uganda.

    Science.gov (United States)

    Lolli, Chiara; Marenzoni, Maria Luisa; Strona, Paolo; Lappo, Pier Giorgio; Etiang, Patrick; Diverio, Silvana

    2016-03-01

    A survey was conducted to estimate the prevalence of Anaplasma, Babesia and Brucella spp. infections in cattle, goats and sheep in the Karamoja Region of Uganda and to identify possible risk factors existing in this semi-nomadic and pastoral area. Low cost laboratory tests were used to diagnose infections (Rose Bengal test for Brucella spp. antibodies and direct microscopic examination for Anaplasma and Babesia spp.). Multivariable logistic regression models were applied to identify possible risk factors linked to gender, animal species, age (only for cattle) and districts. A total of 3935 cattle, 729 goats and 306 sheep of five districts of the Karamoja Region were tested. Seroprevalence for Brucella was 9.2 % (CI, 95 %: 8.4-10), for Anaplasma 19.5 % (CI 95 %: 18.4-20.6) and for Babesia 16 % (CI 95 %: 15-17.1). Significant differences in infections prevalence were observed against risk factors associated with districts and species. Cattle were the species with higher risk of the infections. Female gender was identified as at risk only for Brucella spp. infection. Cattle more than one year old had greater likelihood to be Brucella seropositive. Co-infections of Anaplasma and Babesia spp. were statistically associated, especially in goats and sheep. Further studies to identify risk factors related to host species and geographical districts are needed. The influence on the semi-nomadic agro-pastoral system in Karamoja of animal raids and animal mixing should be further investigated. Findings were important to sensitize Karamojong undertaking measures on infection control, especially on cattle, which are their main source of food.

  13. Responsabilidad Social Matriz de indicadores sustentables que refleja el impacto de la forestación en tierras marginales del Partido de Bahía Blanca, Argentina

    Directory of Open Access Journals (Sweden)

    Regina del Carmen Durán Durán

    2009-01-01

    Full Text Available Actualmente, se han empezado a considerar otras obligaciones que tienen las empresas para con su comunidad; se trata de aspectos vinculados con las dimensiones sociales y ambientales. Desde este contexto, nuestro trabajo tiene como punto de partida el concepto de responsabilidad social desde la noción de sustentabilidad. El objetivo es evaluar la forestación como instrumento para mejorar la sostenibilidad de los sistemas productivos tradicionales en tierras marginales del Partido de Bahía Blanca, mitigando los impactos del desarrollo no responsable de la producción primaria. Para ello, se han identificado técnicas de manejo generadoras de externalidades positivas en otras actividades agropecuarias complementarias, donde existen limitantes edafológicas, apoyándose en las tres dimensiones del concepto de sustentabilidad: ecológica, económica, sociopolítica y cultural. De igual forma, se diseñó una matriz de evaluación y ponderación de impactos, que contempla indicadores cuantitativos y cualitativos, de cuya aplicación surge la forestación como una alternativa sustentable

  14. Ehrlichia canis and Anaplasma platys in ticks of dogs in Cuiaba, Mato GrossoEhrlichia canis e Anaplasma platys em carrapatos de cães de Cuiabá, Mato Grosso

    Directory of Open Access Journals (Sweden)

    Valéria Dutra

    2012-06-01

    Full Text Available Diseases transmitted by arthropods such as Rhipicephalus sanguineus, are caused by a spectrum of pathogens. Among these are the canine monocytic ehrlichiosis and cyclical thrombocytopenia with a cosmopolitan distribution. Aiming to verify the presence of DNA of Anaplasma platys and Ehrlichia canis in ticks R. sanguineus collected in the period 2008 to 2009 of 380 infected dogs. Ticks, after maceration, were subjected to DNA extraction and then nested PCR was performed for amplification of A. platys and E. canis. Of these, 81 (29.7% amplified DNA from ehrlichiais agents, where 38 (17.9% amplified in E. canis and 32 (15.7% for A. platys. The observation of two pathogens, combined with worldwide distribution of the tick R. sanguineus, demonstrates the high risk of infection with these pathogens in dogs in the city of Cuiaba. Doenças transmitidas por artrópodes, como o Rhipicephalus sanguineus, são causadas por um espectro de patógenos. Dentre estas, estão a erliquiose monocítica canina e trombocitopenia cíclica com distribuição cosmopolita. Com o objetivo de verificar a presença de DNA de Anaplasma platys e Ehrlichia canis em carrapatos R. sanguineus coletados no período de 2008 a 2009 de 380 cães infestados. Os carrapatos, após a maceração, foram submetidos a extração de DNA e, em seguida, foi realizada a Nested PCR para a amplificação da espécie A. platys e E. canis. Destes, 81 (29.7% amplificaram o DNA dos agentes ehrlichiais, onde 38 (17.9% amplificaram para E. canis e 32 (15.7% para A. platys. A observação dos dois patógenos, combinado com distribuição mundial do carrapato R. sanguineus, demonstra o elevado risco de infecção por esses patógenos de cães na cidade de Cuiabá.

  15. Molecular epidemiology of the emerging zoonosis agent Anaplasma phagocytophilum (Foggie, 1949) in dogs and ixodid ticks in Brazil.

    Science.gov (United States)

    Santos, Huarrisson A; Thomé, Sandra M G; Baldani, Cristiane D; Silva, Claudia B; Peixoto, Maristela P; Pires, Marcus S; Vitari, Gabriela L V; Costa, Renata L; Santos, Tiago M; Angelo, Isabele C; Santos, Leandro A; Faccini, João L H; Massard, Carlos L

    2013-12-11

    Anaplasma phagocytophilum is an emerging pathogen of humans, dogs and other animals, and it is transmitted by ixodid ticks. The objective of the current study was a) detect A. phagocytophilum in dogs and ixodid ticks using real-time Polymerase Chain Reaction (qPCR); and b) Determine important variables associated to host, environment and potential tick vectors that are related to the presence of A. phagocytophilum in dogs domiciled in Rio de Janeiro, Brazil. We tested blood samples from 398 dogs and samples from 235 ticks, including 194 Rhipicephalus sanguineus sensu lato, 15 Amblyomma cajennense, 8 Amblyomma ovale and 18 pools of Amblyomma sp. nymphs. A semi-structured questionnaire was applied by interviewing each dog owner. Deoxyribonucleic acid obtained from ticks and dog buffy coat samples were amplified by qPCR (msp2 gene). The sequencing of 16S rRNA and groESL heat shock operon genes and a phylogenetic analysis was performed. The multiple logistic regression model was created as a function of testing positive dogs for A. phagocytophilum. Among the 398 blood samples from dogs, 6.03% were positive for A. phagocytophilum. Anaplasma phagocytophilum was detected in one A. cajennense female tick and in five R. sanguineus sensu lato ticks (four males and one female). The partial sequences of the 16S rRNA, and groESL genes obtained were highly similar to strains of A. phagocytophilum isolated from wild birds from Brazil and human pathogenic strains. The tick species collected in positive dogs were R. sanguineus sensu lato and A. cajennense, with A.cajennense being predominant. Tick infestation history (OR = 2.86, CI = 1.98-14.87), dog size (OR = 2.41, IC: 1.51-12.67), the access to forest areas (OR = 3:51, CI: 1.52-16.32), hygiene conditions of the environment in which the dogs lived (OR = 4.35, CI: 1.86-18.63) and Amblyomma sp. infestation (OR = 6.12; CI: 2.11-28.15) were associated with A. phagocytophilum infection in dogs. This is the

  16. Candidatus Neoehrlichia mikurensis and Anaplasma phagocytophilum: prevalences and investigations on a new transmission path in small mammals and ixodid ticks.

    Science.gov (United States)

    Obiegala, Anna; Pfeffer, Martin; Pfister, Kurt; Tiedemann, Tim; Thiel, Claudia; Balling, Anneliese; Karnath, Carolin; Woll, Dietlinde; Silaghi, Cornelia

    2014-12-04

    Small mammals are crucial for the life history of ixodid ticks, but their role and importance in the transmission cycle of tick-borne pathogens is mostly unknown. Candidatus Neoehrlichia mikurensis (CNM) and Anaplasma phagocytophilum are both tick-borne pathogens, and rodents are discussed to serve as main reservoir hosts for CNM but not for the latter especially in Germany. Analysing the prevalence of both pathogens in small mammals and their ticks in endemic regions may help to elucidate possible transmission paths in small mammal populations and between small mammals and ticks. In 2012 and 2013, small mammals were trapped at three different sites in Germany. DNA was extracted from different small mammal tissues, from rodent neonates, foetuses and from questing and attached ticks. DNA samples were tested for CNM and A. phagocytophilum by real-time PCR. Samples positive for A. phagocytophilum were further characterized at the 16S rRNA gene locus. CNM was detected in 28.6% of small mammals and in 2.2% of questing and 3.8% of attached ticks. Altogether 33 positive ticks were attached to 17 different hosts, while positive ticks per host ranged between one and seven. The prevalences for this pathogen differed significantly within small mammal populations comparing sites (χ(2): 13.3987; p: 0.0004) and between sexes. Male rodents had an approximately two times higher chance of infection than females (OR: 1.9652; 95% CI: 1.32-2.92). The prevalence for CNM was 31.8% (95% CI: 22-44) in rodent foetuses and neonates (23 of 67) from positive dams, and 60% (95% CI: 35.7-80.25) of positive gravid or recently parturient rodents (9 out of 15) had at least one positive foetus or neonate. Anaplasma phagocytophilum was detected at a low percentage in rodents (0-5.6%) and host-attached ticks (0.5-2.9%) with no significant differences between rodent species. However, attached nymphs were significantly more often infected than attached larvae (χ(2): 25.091; p: <0.0001). This study

  17. Molecular detection of Dirofilaria immitis, Hepatozoon canis, Babesia spp., Anaplasma platys and Ehrlichia canis in dogs on Costa Rica.

    Science.gov (United States)

    Wei, Lanjing; Kelly, Patrick; Ackerson, Kate; El-Mahallawy, Heba S; Kaltenboeck, Bernhard; Wang, Chengming

    2014-03-01

    Although vector-borne diseases are important causes of morbidity and mortality in dogs in tropical areas, there is little information on these conditions in Costa Rica. In PCRs of blood from dogs in Costa Rica, we did not detect DNAs of Rickettsia (R.) felis and Coxiella (C.) burnetii but we did find evidence of infection with Dirofilaria (D.) immitis (9/40, 22.5%), Hepatozoon (H.) canis (15/40, 37.5%), Babesia spp. (10/40, 25%; 2 with B. gibsoni and 8 with B. vogeli), Anaplasma (A.) platys (3/40, 7.5%) and Ehrlichia (E.) canis (20/40, 50%). Nine dogs (22.5%) were free of any vector-borne pathogens while 14 (35%) were infected with a single pathogen, 11 (27.5%) with two, 4 (10%) with three, 1 (2.5%) with four, and 1 (2.5%) with five pathogens. Dogs in Costa Rica are commonly infected with vector-borne agents.

  18. Anaplasma phagocytophilum MSP4 and HSP70 Proteins Are Involved in Interactions with Host Cells during Pathogen Infection

    Directory of Open Access Journals (Sweden)

    Marinela Contreras

    2017-07-01

    Full Text Available Anaplasma phagocytophilum transmembrane and surface proteins play a role during infection and multiplication in host neutrophils and tick vector cells. Recently, A. phagocytophilum Major surface protein 4 (MSP4 and Heat shock protein 70 (HSP70 were shown to be localized on the bacterial membrane, with a possible role during pathogen infection in ticks. In this study, we hypothesized that A. phagocytophilum MSP4 and HSP70 have similar functions in tick-pathogen and host-pathogen interactions. To address this hypothesis, herein we characterized the role of these bacterial proteins in interaction and infection of vertebrate host cells. The results showed that A. phagocytophilum MSP4 and HSP70 are involved in host-pathogen interactions, with a role for HSP70 during pathogen infection. The analysis of the potential protective capacity of MSP4 and MSP4-HSP70 antigens in immunized sheep showed that MSP4-HSP70 was only partially protective against pathogen infection. This limited protection may be associated with several factors, including the recognition of non-protective epitopes by IgG in immunized lambs. Nevertheless, these antigens may be combined with other candidate protective antigens for the development of vaccines for the control of human and animal granulocytic anaplasmosis. Focusing on the characterization of host protective immune mechanisms and protein-protein interactions at the host-pathogen interface may lead to the discovery and design of new effective protective antigens.

  19. Comparative strain analysis of Anaplasma phagocytophilum infection and clinical outcomes in a canine model of granulocytic anaplasmosis.

    Science.gov (United States)

    Scorpio, Diana G; Dumler, J Stephen; Barat, Nicole C; Cook, Judith A; Barat, Christopher E; Stillman, Brett A; DeBisceglie, Kristen C; Beall, Melissa J; Chandrashekar, Ramaswamy

    2011-03-01

    A pilot study was conducted to determine whether existing human or canine strains of Anaplasma phagocytophilum would reproduce clinical disease in experimentally inoculated dogs similar to dogs with naturally acquired granulocytic anaplasmosis. Six hounds were inoculated intravenously with one human and two canine strains of A. phagocytophilum that were propagated in vitro in HL-60 cells or in infected autologous neutrophils. Infected dogs were monitored for lethargy, anorexia, petechiae, lymphadenopathy, and fever. Dogs were assessed for complete blood count (CBC), serum chemistry, and serology (IFA and SNAP® 4Dx®); for A. phagocytophilum blood load by quantitative polymerase chain reaction; and for cytokine production. Prominent clinical signs were generalized lymphadenopathy and scleral injection; only one dog developed fever lasting 4 days. Notable laboratory alterations included sustained leukopenia and thrombocytopenia in all dogs. A. phagocytophilum morulae were noted in blood between days 10 and 11, although all dogs retained A. phagocytophilum DNA in blood through day 60. All dogs seroconverted by days 10-15 by IFA, and by days 17-30 by SNAP 4Dx; cytokine analyses revealed 10-fold increases in interleukin-2 and interleukin-18 in the neutrophil-propagated 98E4 strain-infected dog. All A. phagocytophilum strains produced infection, although canine 98E4 strain reproduced clinical signs, hematologic changes, and inflammatory cytokine elevations most consistent with granulocytic anaplasmosis when recognized clinically. Therefore, this strain should be considered for use in future studies of A. phagocytophilum canine infection models.

  20. The Prostaglandin E2-EP3 Receptor Axis Regulates Anaplasma phagocytophilum-Mediated NLRC4 Inflammasome Activation.

    Directory of Open Access Journals (Sweden)

    Xiaowei Wang

    2016-08-01

    Full Text Available Rickettsial agents are sensed by pattern recognition receptors but lack pathogen-associated molecular patterns commonly observed in facultative intracellular bacteria. Due to these molecular features, the order Rickettsiales can be used to uncover broader principles of bacterial immunity. Here, we used the bacterium Anaplasma phagocytophilum, the agent of human granulocytic anaplasmosis, to reveal a novel microbial surveillance system. Mechanistically, we discovered that upon A. phagocytophilum infection, cytosolic phospholipase A2 cleaves arachidonic acid from phospholipids, which is converted to the eicosanoid prostaglandin E2 (PGE2 via cyclooxygenase 2 (COX2 and the membrane associated prostaglandin E synthase-1 (mPGES-1. PGE2-EP3 receptor signaling leads to activation of the NLRC4 inflammasome and secretion of interleukin (IL-1β and IL-18. Importantly, the receptor-interacting serine/threonine-protein kinase 2 (RIPK2 was identified as a major regulator of the immune response against A. phagocytophilum. Accordingly, mice lacking COX2 were more susceptible to A. phagocytophilum, had a defect in IL-18 secretion and exhibited splenomegaly and damage to the splenic architecture. Remarkably, Salmonella-induced NLRC4 inflammasome activation was not affected by either chemical inhibition or genetic ablation of genes associated with PGE2 biosynthesis and signaling. This divergence in immune circuitry was due to reduced levels of the PGE2-EP3 receptor during Salmonella infection when compared to A. phagocytophilum. Collectively, we reveal the existence of a functionally distinct NLRC4 inflammasome illustrated by the rickettsial agent A. phagocytophilum.

  1. Infection of Anaplasma phagocytophilum and Ehrlichia spp. in Opossums and Dogs in Campeche, Mexico: The Role of Tick Infestation

    Directory of Open Access Journals (Sweden)

    Edgar Rojero-Vázquez

    2017-12-01

    Full Text Available In recent years, some tick-borne diseases such as anaplasmosis and ehrlichiosis became widespread worldwide, threatening the health of humans, domestic animals and wildlife. The aims of this study were to determine the presence of Anaplasma phagocytophilum, Ehrlichia canis, and Ehrlichia chaffeensis in 102 opossums (Didelphis spp. and 44 owned free-ranging dogs in southeastern Mexico using a specific polymerase chain reaction (PCR. A. phagocytophilum was detected in opossums and dogs with a prevalence of 3 and 27%, respectively. E. canis was only present in 7% of dogs, while we didn't detect E. chaffeensis in any host. We report the first evidence of infections of A. phagocytophilum in Didelphis virginiana and D. marsupialis in Mexico. The infection rates and patterns we found of A. phagocytophilum suggest that dogs are more directly involved in the ecology of this pathogen than opossums. Despite the small prevalence found, our results are of public health concern because of the zoonotic capabilities of A. phagocytophilum, the high tick infestation rates found and because both opossums and free-ranging dogs can achieve high population densities in the region.

  2. Molecular epidemiology of Anaplasma platys, Ehrlichia canis and Babesia vogeli in stray dogs in Paraná, Brazil

    Directory of Open Access Journals (Sweden)

    Claudia M. Ribeiro

    Full Text Available ABSTRACT: Hemoparasitic infections are tick-borne diseases, which affect animals and humans. Considering the importance of canine hemoparasitic infections in veterinary clinics, this study aimed to determine the occurrence of Anaplasma platys, Ehrlichia canis and Babesia vogeli in blood samples from 182 dogs not domiciled in the city of Pato Branco, southwestern region of Paraná State, Brazil, using polymerase chain reaction (PCR. The prevalence of A. platys and B. vogeli was 32.9% and 10.9% respectively, and A. platys infection prevailed (p<0.001. The number of dogs positive for A. platys was larger in Winter (p<0.05. All blood samples were negative for E. canis. In the dogs, infestation by Amblyomma cajennense predominated over that by Rhipicephalus sanguineus (p<0.001; but there was no significant association between PCR and the variables presence of ticks, sex and age. Dogs infected by A. platys and B. vogeli showed thrombocytopenia, lymphopenia and leukocytosis; but there was no correlation between such hematological changes and infection by hemoparasites. This appears to be the first molecular study that demonstrates the existence of A. platys and B. vogeli in dogs from the southwestern region of Paraná.

  3. Molecular characterization and specific detection of Anaplasma species (AP-sd) in sika deer and its first detection in wild brown bears and rodents in Hokkaido, Japan.

    Science.gov (United States)

    Moustafa, Mohamed Abdallah Mohamed; Lee, Kyunglee; Taylor, Kyle; Nakao, Ryo; Sashika, Mariko; Shimozuru, Michito; Tsubota, Toshio

    2015-12-01

    A previously undescribed Anaplasma species (herein referred to as AP-sd) has been detected in sika deer, cattle and ticks in Japan. Despite being highly similar to some strains of A. phagocytophilum, AP-sd has never been detected in humans. Its ambiguous epidemiology and the lack of tools for its specific detection make it difficult to understand and interpret the prevalence of this Anaplasma species. We developed a method for specific detection, and examined AP-sd prevalence in Hokkaido wildlife. Our study included 250 sika deer (Cervus nippon yesoensis), 13 brown bears (Ursus arctos yesoensis) and 252 rodents including 138 (Apodemus speciosus), 45 (Apodemus argenteus), 42 (Myodes rufocanus) and 27 (Myodes rutilus) were collected from Hokkaido island, northern Japan, collected during 2010 to 2015. A 770 bp and 382 bp segment of the 16S rRNA and gltA genes, respectively, were amplified by nested PCR. Results were confirmed by cloning and sequencing of the positive PCR products. A reverse line blot hybridization (RLB) based on the 16S rRNA gene was then developed for the specific detection of AP-sd. The prevalence of AP-sd by nested PCR in sika deer was 51% (128/250). We detected this Anaplasma sp. for the first time in wild brown bears and rodents with a prevalence of 15% (2/13) and 2.4% (6/252), respectively. The sequencing results of the 16S rRNA and gltA gene amplicons were divergent from the selected A. phagocytophilum sequences in GenBank. Using a newly designed AP-sd specific probe for RLB has enabled us to specifically detect this Anaplasma species. Besides sika deer and cattle, wild brown bears and rodents were identified as potential reservoir hosts for AP-sd. This study provided a high throughput molecular method that specifically detects AP-sd, and which can be used to investigate its ecology and its potential as a threat to humans in Japan. Copyright © 2015 Elsevier B.V. All rights reserved.

  4. Detection of Borrelia lusitaniae, Rickettsia sp. IRS3, Rickettsia monacensis, and Anaplasma phagocytophilum in Ixodes ricinus collected in Madeira Island, Portugal.

    Science.gov (United States)

    de Carvalho, Isabel Lopes; Milhano, Natacha; Santos, Ana Sofia; Almeida, Victor; Barros, Silvia C; De Sousa, Rita; Núncio, Maria Sofia

    2008-08-01

    A total of 300 Ixodes ricinus ticks were tested by polymerase chain reaction (PCR) for the presence of Borrelia spp., Rickettsia spp., and Anaplasma phagocytophilum. Sequence analysis demonstrated 8 (2.7%) ticks infected with B. lusitaniae, 60 (20%) with Rickettsia spp., and 1 (0.3%) with A. phagocytophilum. Seven (2.3%) ticks were coinfected with B. lusitaniae and Rickettsia spp., 2 (0.6%) with R. monacensis, and 5 (1.7%) with Rickettsia sp. IRS3. The results of this study suggest simultaneous transmission of multiple tick-borne agents on Madeira Island, Portugal.

  5. OCORRÊNCIA DE Anaplasma bovis (Donatien & Lestoquard, 1936, Dumler et al. 2001 NA REGIÃO DE BOM JESUS DO ITABAPOANA, RJ

    Directory of Open Access Journals (Sweden)

    Orlando Augusto Melo Junior

    2010-12-01

    Full Text Available In the present study, 400 capillary blood smears collected from the ear and the tail of 200 bovines were microscopically examinedfor the presence of hemoparasites. The diagnosis was based on the direct research, semonstrating the etiologic agent inclusions. Eleven bovines (5.5% were considered infected by Anaplasma bovis, confirming the presence of this hemoparasite in the city of Bom Jesus do Itabapoana, the first city of the northwesten region of the state of Rio de Janeiro to register such occurrence.

  6. Longitudinal field study on bovine Babesia spp. and Anaplasma phagocytophilum infections during a grazing season in Belgium.

    Science.gov (United States)

    Lempereur, Laetitia; Lebrun, Maude; Cuvelier, Pascale; Sépult, Géraldine; Caron, Yannick; Saegerman, Claude; Shiels, Brian; Losson, Bertrand

    2012-04-01

    Anaplasmosis and babesiosis are major tick-borne diseases with a high economic impact but are also a public health concern. Blood samples collected in the spring, summer, and autumn of 2010 from 65 cows in seven different farms in Belgium were monitored with an indirect immunofluorescence antibody test to assess seroprevalence against these pathogens. Seroprevalences to Babesia spp. were measured as 10.7%, 20%, and 12.3% in spring, summer, and autumn, respectively, whereas seroprevalences to Anaplasma phagocytophilum were 30.8%, 77%, and 56.9%, respectively. A total of 805 Ixodes ricinus ticks were collected at the same time from both cattle (feeding ticks) and grazed pastures (questing ticks). The infection level of ticks, assessed by PCR assay, for Babesia spp. DNA was 14.6% and 7.9% in feeding and questing ticks, respectively, whereas 21.7% and 3% of feeding and questing ticks were found be positive for A. phagocytophilum cDNA. Fifty-five PCR-positive samples were identified by sequencing as Babesia sp. EU1, of which five from feeding ticks were positive for both A. phagocytophilum and Babesia sp. EU1. The high density of wild cervids in the study area could explain these observations, as deer are considered to be the main hosts for adults of I. ricinus. However, the absence of Babesia divergens both in feeding and questing ticks is surprising, as the study area is known to be endemic for cattle babesiosis. Increasing cervid populations and comorbidity could play an import role in the epidemiology of these tick-borne diseases.

  7. Monoinfections caused by Borrelia burgdorferi and Borrelia burgdorferi / Anaplasma phagocytophilum co-infections in forestry workers and farmers

    Directory of Open Access Journals (Sweden)

    Małgorzata Tokarska-Rodak

    2015-10-01

    Full Text Available Background: The presence of co-infections induced by tick-borne pathogens in humans is an important epidemiological phenomenon. This issue has attracted growing attention of doctors and people working under conditions of an increased risk of being exposed to tick bites. Material and Methods: The research group consisted of 93 individuals with current anti-immunoglobulin M/G (IgM/ IgG Borrelia burgdorferi or IgG anti-Anaplasma phagocytophilum. The respondents were identified during the screening survey in a group of farmers and foresters occupationally exposed to tick bites. The aim of the work was to analyse the frequency of antibodies to specific antigens of B. burgdorferi and the levels of cytokines in forestry workers and farmers with B. burgdorferi monoinfections and B. burgdorferi / A. phagocytophilum co-infections. Statistical analysis was performed using the Chi2, Mann-Whitney U and Kruskal-Wallis tests. Results: There is a stronger generation of IgG antibodies to B. burgdorferi antigens in patients with B. burgdorferi / A. phagocytophilum co-infections, such as variable major protein-like sequence expressed (VlsE (p < 0.05, p19 (p < 0.02, p17 (p < 0.05 and complement regulator-acquiring surface protein 3 (CRASP3 (p < 0.02 compared to persons with B. burgdorferi monoinfections. The discrepancies in the synthesis of cytokines interleukin 6 (IL-6, IL-10, and tumor necrosis factor α (TNF-α have not been found in persons with B. burgdorferi monoinfections and B. burgdorferi / A. phagocytophilum co-infection. Conclusions: The immune response directed against B. burgdorferi is stronger in patients co-infected with B. burgdorferi and A. phagocytophilum than in those with monoinfection. Med Pr 2015;66(5:645–651

  8. Whole genome transcription profiling of Anaplasma phagocytophilum in human and tick host cells by tiling array analysis

    Directory of Open Access Journals (Sweden)

    Chavez Adela

    2008-07-01

    Full Text Available Abstract Background Anaplasma phagocytophilum (Ap is an obligate intracellular bacterium and the agent of human granulocytic anaplasmosis, an emerging tick-borne disease. Ap alternately infects ticks and mammals and a variety of cell types within each. Understanding the biology behind such versatile cellular parasitism may be derived through the use of tiling microarrays to establish high resolution, genome-wide transcription profiles of the organism as it infects cell lines representative of its life cycle (tick; ISE6 and pathogenesis (human; HL-60 and HMEC-1. Results Detailed, host cell specific transcriptional behavior was revealed. There was extensive differential Ap gene transcription between the tick (ISE6 and the human (HL-60 and HMEC-1 cell lines, with far fewer differentially transcribed genes between the human cell lines, and all disproportionately represented by membrane or surface proteins. There were Ap genes exclusively transcribed in each cell line, apparent human- and tick-specific operons and paralogs, and anti-sense transcripts that suggest novel expression regulation processes. Seven virB2 paralogs (of the bacterial type IV secretion system showed human or tick cell dependent transcription. Previously unrecognized genes and coding sequences were identified, as were the expressed p44/msp2 (major surface proteins paralogs (of 114 total, through elevated signal produced to the unique hypervariable region of each – 2/114 in HL-60, 3/114 in HMEC-1, and none in ISE6. Conclusion Using these methods, whole genome transcription profiles can likely be generated for Ap, as well as other obligate intracellular organisms, in any host cells and for all stages of the cell infection process. Visual representation of comprehensive transcription data alongside an annotated map of the genome renders complex transcription into discernable patterns.

  9. EL NIVEL EDUCATIVO Y SOCIOECONÓMICO DEL HOGAR Y HABILIDADES PRE-LECTORAS EN ESCUELAS URBANO Y URBANO-MARGINALES DE LA PROVINCIA DE MENDOZA-ARGENTINA

    Directory of Open Access Journals (Sweden)

    Yanina Canales Jara

    2016-01-01

    Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

  10. Anaplasma phagocytophilum and Babesia spp. in roe deer (Capreolus capreolus), fallow deer (Dama dama) and mouflon (Ovis musimon) in Germany.

    Science.gov (United States)

    Kauffmann, Melanie; Rehbein, Steffen; Hamel, Dietmar; Lutz, Walburga; Heddergott, Mike; Pfister, Kurt; Silaghi, Cornelia

    2017-02-01

    Infections with the tick-borne pathogens Anaplasma phagocytophilum and Babesia spp. can cause febrile disease in several mammalian species, including humans. Wild ruminants in Europe are suggested to serve as reservoir hosts for particular strains or species of these pathogens. The aims of this study were to investigate the occurrence of A. phagocytophilum and Babesia spp. in roe deer (Capreolus capreolus), fallow deer (Dama dama) and mouflon (Ovis musimon orientalis) in Germany, and the diversity and host association of genetic variants of A. phagocytophilum and Babesia species. From 2009 to 2010, 364 spleen samples from 153 roe deer, 43 fallow deer and 168 mouflon from 13 locations in Germany were tested for DNA of A. phagocytophilum and Babesia spp. by real-time PCR or conventional PCR, respectively. Variants of A. phagocytophilum were investigated with a nested PCR targeting the partial 16S rRNA gene, and species of piroplasms were identified by sequencing. DNA of A. phagocytophilum was detected in 303 (83.2%) samples: roe deer, 96.1% (147/153); fallow deer, 72.1% (31/43); and mouflon, 74.4% (125/168). Sequence analysis of 16S rRNA-PCR products revealed the presence of nine different genetic variants. DNA of Babesia spp. was found in 113 (31.0%) samples: roe deer, 62.8% (96/153); fallow deer, 16.3% (6/43); and mouflon, 6.5% (11/168). Babesia capreoli, Babesia sp. EU1 (referred to also as B. venatorum), B. odocoilei-like and a Theileria species were identified. Co-infections with A. phagocytophilum and Babesia spp. were detected in 30.0% of the animals which were tested positive for A. phagocytophilum and/or Babesia spp. Roe deer had a significantly higher percentage of co-infections (60.8%), followed by fallow deer (14.0%) and mouflon (6.5%). Thus, the results suggest that roe deer plays a key role in the endemic cycles of the pathogens investigated. Copyright © 2016 Elsevier Ltd. All rights reserved.

  11. Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud

    Directory of Open Access Journals (Sweden)

    Élise Prébin

    2009-03-01

    Full Text Available Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud. Cet article a pour sujet ma relation à la société sud-coréenne, non seulement en tant qu’anthropologue mais aussi en tant que personne adoptée d’origine coréenne. Il relate la manière dont plusieurs sortes de relations ont dû être gérées pendant le terrain. Il a fallu d’un côté me rapprocher de mes informateurs pour pouvoir mener un terrain classique dans une société inconnue, comprendre une culture autre et traiter un sujet relevant des sciences sociales : le retour des adoptés étrangers dans leur pays d’origine. De l’autre, il a fallu établir une bonne distance avec ma famille biologique coréenne en m’en éloignant momentanément. Ma relation avec elle était en effet instable du fait qu’elle reposait sur une contradiction : mon statut d’étrangère en dépit de l’intimité que supposaient les liens du sang. Pourtant, cette relation continue entre ma famille biologique et moi-même a éclairé certaines ambiguïtés relatives au statut des adoptés dans la société sud-coréenne que le temps limité du terrain n’avait pas permis de saisir. Cet article ébauche donc une réflexion épistémologique sur la pertinence d’éléments biographiques dans le traitement anthropologique de certains sujets. Je montre en l’occurrence comment le don en mariage d’une fille biologique adoptée conjure de manière satisfaisante un don en adoption toujours problématique.Finding the right distance: stranger, marginal, ethnologist and relative in south Korea. The topic of this article is my relation to the South Korean society, not only as a social anthropologist but also as a Korean adoptee. I relate the way I had to manage contrasted relations while conducting fieldwork. On one hand, I endeavoured to get closer to my informants in order to conduct classic fieldwork in an unknown society, to understand a different culture

  12. Molecular and serological detection of Theileria equi, Babesia caballi and Anaplasma phagocytophilum in horses and ticks in Maranhão, Brazil

    Directory of Open Access Journals (Sweden)

    Rita de Maria Seabra Nogueira

    Full Text Available ABSTRACT: Equine piroplasmosis is a tick-borne disease caused by the intraeytrhocytic protozoans Babesia caballi and Theileria equi. It has been reported as a main equine parasitic disease. In addition, Anaplasma phagocytophilum, the causative agent of granulocytic ehrlichiosis, causes a seasonal disease in horses. Both diseases, can be detrimental to animal health. In this sense, blood samples and ticks were collected from 97 horses raised in the microregion of Baixada Maranhense, Maranhão State, Brazil. Serum samples were subjected to Indirect Fluorescence Antibody Test (IFAT and blood samples and ticks to Polymerase Chain Reaction (PCR to evaluate the infection by Theileria equi, Babesia caballi and Anaplasma phagocytophilum. The overall seroprevalence was 38.14%, 18.55% and 11.34% for T. equi, B. caballi and A. phagocytophilum, respectively. The results of PCR from blood samples showed 13.40% and 3.09% positive samples to T. equi and B. caballi, respectively. A total of 170 tick specimens were collected and identified as Dermacentor nitens, Amblyomma cajennense sensu lato and Rhipicephalus (Boophilus microplus. It was detected 2.35% (4/170 and 0.59% (1/170 positive tick samples by PCR for T. equi and B. caballi, respectively. All samples were negative to A. phagocytophilum. No statically difference (p>0.05 was observed when gender, age, use of ectoparasiticide and tick presence were analyzed. A BLASTn analysis of the sequenced samples indicated 97 to 100% similarity with T. equi 18S rRNA gene sequences in GenBank and 98 to 100% with B. caballi. Genetic analysis classified the obtained sequences as T. equi and B. caballi cluster, respectively. It can be concluded that these pathogens occur and are circulating in the studied area.

  13. Efficacy of sarolaner in the prevention of Borrelia burgdorferi and Anaplasma phagocytophilum transmission from infected Ixodes scapularis to dogs.

    Science.gov (United States)

    Honsberger, Nicole A; Six, Robert H; Heinz, Thomas J; Weber, Angela; Mahabir, Sean P; Berg, Thomas C

    2016-05-30

    The efficacy of sarolaner (Simparica™, Zoetis) to prevent transmission primarily of Borrelia burgdorferi and secondarily of Anaplasma phagocytophilum from infected wild-caught Ixodes scapularis to dogs was evaluated in a placebo-controlled laboratory study. Twenty-four purpose-bred laboratory Beagles seronegative for B. burgdorferi and A. phagocytophilum antibodies were allocated randomly to one of three treatment groups: placebo administered orally on Days 0 and 7, or sarolaner at 2mg/kg administered orally on Day 0 (28 days prior to tick infestation) or on Day 7 (21 days prior to tick infestation). On Day 28, each dog was infested with approximately 25 female and 25 male wild caught adult I. scapularis that were determined to have prevalence of 57% for B. burgdorferi and 6.7% for A. phagocytophilum by PCR. In situ tick counts were conducted on Days 29 and 30. On Day 33, all ticks were counted and removed. Acaricidal efficacy was calculated based on the reduction of geometric mean live tick counts in the sarolaner-treated groups compared to the placebo-treated group for each tick count. Blood samples collected from each dog on Days 27, 49, 63, 77, 91 and 104 were tested for the presence of B. burgdorferi and A. phagocytophilum antibodies using the SNAP(®) 4Dx(®) Plus Test, and quantitatively assayed for B. burgdorferi antibodies using an ELISA test. Skin biopsies collected on Day 104 were tested for the presence of B. burgdorferi by bacterial culture and PCR. Geometric mean live tick counts for placebo-treated dogs were 14.8, 12.8, and 19.1 on Days 29, 30, and 33, respectively. The percent reductions in mean live tick counts at 1, 2, and 5 days after infestation were 86.3%, 100%, and 100% for the group treated with sarolaner 21 days prior to infestation, and 90.9%, 97.1%, and 100% for the group treated with sarolaner 28 days prior to infestation. Geometric mean live tick counts for both sarolaner-treated groups were significantly lower than those for the

  14. High throughput pyrosequencing technology for molecular differential detection of Babesia vogeli, Hepatozoon canis, Ehrlichia canis and Anaplasma platys in canine blood samples.

    Science.gov (United States)

    Kaewkong, Worasak; Intapan, Pewpan M; Sanpool, Oranuch; Janwan, Penchom; Thanchomnang, Tongjit; Kongklieng, Amornmas; Tantrawatpan, Chairat; Boonmars, Thidarut; Lulitanond, Viraphong; Taweethavonsawat, Piyanan; Chungpivat, Sudchit; Maleewong, Wanchai

    2014-06-01

    Canine babesiosis, hepatozoonosis, ehrlichiosis, and anaplasmosis are tick-borne diseases caused by different hemopathogens. These diseases are causes of morbidity and mortality in dogs. The classic method for parasite detection and differentiation is based on microscopic observation of blood smears. The limitations of the microscopic method are that its performance requires a specially qualified person with professional competence, and it is ineffective in differentiating closely related species. This study applied PCR amplification with high throughput pyrosequencing for molecular differential detection of the following 4 hemoparasites common to tropical areas in dog blood samples: Babesia vogeli, Hepatozoon canis, Ehrlichia canis, and Anaplasma platys. PCR was initially used to amplify specific target regions of the ribosomal RNA genes of each parasite using 2 primer pairs that included 18S rRNA for protozoa (B. vogeli and H. canis) and 16S rRNA for rickettsia (E. canis and A. platys). Babesia vogeli and H. canis were discriminated using 9 nucleotide positions out of 30 base pairs, whereas E. canis and A. platys were differentiated using 15 nucleotide positions out of 34 base pairs that were determined from regions adjacent to 3' ends of the sequencing primers. This method provides a challenging alternative for a rapid diagnosis and surveillance of these tick-borne diseases in canines. Copyright © 2014 Elsevier GmbH. All rights reserved.

  15. Anaplasma phagocytophilum inhibits human neutrophil apoptosis via upregulation of bfl-1, maintenance of mitochondrial membrane potential and prevention of caspase 3 activation.

    Science.gov (United States)

    Ge, Yan; Yoshiie, Kiyotaka; Kuribayashi, Futoshi; Lin, Mingqun; Rikihisa, Yasuko

    2005-01-01

    The inhibition of neutrophil apoptosis plays a central role in human granulocytic anaplasmosis. Intracellular signalling pathways through which the obligatory intracellular bacterium Anaplasma phagocytophilum inhibits the spontaneous apoptosis of human peripheral blood neutrophils were investigated. bfl-1 mRNA levels in uninfected neutrophils after 12 h in culture were reduced to approximately 5-25% of 0 h levels, but remained high in infected neutrophils. The eukaryotic RNA synthesis inhibitor, actinomycin D, prevented the maintenance of bfl-1 mRNA levels by A. phagocytophilum. Differences in mcl-1, bax, bcl-w, bad or bak mRNA levels in infected versus uninfected neutrophils were not remarkable. By using mitochondrial fluorescent dyes, Mitotracker Red and JC-1, it was found that most uninfected neutrophils lost mitochondrial membrane potential after 10-12 h incubation, whereas A. phagocytophilum-infected neutrophils maintained high membrane potential. Caspase 3 activity and the degree of apoptosis were lower in dose-dependent manner in A. phagocytophilum-infected neutrophils at 16 h post infection, as compared to uninfected neutrophils. Anti-active caspase 3 antibody labelling showed less positively stained population in infected neutrophils compared to those in uninfected neutrophils after 12 h incubation. These results suggest that A. phagocytophilum inhibits human neutrophil apoptosis via transcriptional upregulation of bfl-1 and inhibition of mitochondria-mediated activation of caspase 3.

  16. Molecular Survey on Rickettsia spp., Anaplasma phagocytophilum, Borrelia burgdorferi Sensu Lato, and Babesia spp. in Ixodes ricinus Ticks Infesting Dogs in Central Italy.

    Science.gov (United States)

    Morganti, Giulia; Gavaudan, Stefano; Canonico, Cristina; Ravagnan, Silvia; Olivieri, Emanuela; Diaferia, Manuela; Marenzoni, Maria Luisa; Antognoni, Maria Teresa; Capelli, Gioia; Silaghi, Cornelia; Veronesi, Fabrizia

    2017-11-01

    Dogs are a common feeding hosts for Ixodes ricinus and may act as reservoir hosts for zoonotic tick-borne pathogens (TBPs) and as carriers of infected ticks into human settings. The aim of this work was to evaluate the presence of several selected TBPs of significant public health concern by molecular methods in I. ricinus recovered from dogs living in urban and suburban settings in central Italy. A total of 212 I. ricinus specimens were collected from the coat of domestic dogs. DNA was extracted from each specimen individually and tested for Rickettsia spp., Borrelia burgdorferi sensu lato, Babesia spp., and Anaplasma phagocytophilum, using real-time and conventional PCR protocols, followed by sequencing. Sixty-one ticks (28.8%) tested positive for TBPs; 57 samples were infected by one pathogen, while four showed coinfections. Rickettsia spp. was detected in 39 specimens (18.4%), of which 32 were identified as Rickettsia monacensis and seven as Rickettsia helvetica. Twenty-two samples (10.4%) tested positive for A. phagocytophilum; Borrelia lusitaniae and Borrelia afzelii were detected in two specimens and one specimen, respectively. One tick (0.5%) was found to be positive for Babesia venatorum (EU1). Our findings reveal the significant exposure of dogs to TBPs of public health concern and provide data on the role of dogs in the circulation of I. ricinus-borne pathogens in central Italy.

  17. Prevalence of Babesia canis, Borrelia burgdorferi sensu lato, and Anaplasma phagocytophilum in hard ticks collected from meadows of Lubelskie Voivodship (eastern Poland

    Directory of Open Access Journals (Sweden)

    Dzięgiel Beata

    2014-03-01

    Full Text Available The aim of the study was to assess the distribution of Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, and Babesia canis in adult females and males of Ixodes ricinus and Dermacentor reticulatus ticks, inhabiting meadows near large forest complexes throughout the Lubelskie Voivodship (eastern region of Poland. Ticks were collected using the flagging method. Among 720 ticks collected, 506 were identified as D. reticulatus, and 214 as I. ricinus. DNA of B. canis and B. burgdorferi s.l. was detected in 21.3% and 0.6% of D. reticulatus ticks, respectively. In I. ricinus ticks, DNA specific to B. burgdorferi s.l. and A. phagocytophilum was detected in 5.6% and 10.3%, respectively. Co-infections of B. burgdorferi s.l. and A. phagocytophilum were found in two I. ricinus ticks. These results indicate that the Lublin region is an area at risk of tick-borne diseases of humans and animals, which must be considered in clinical practice.

  18. SEROLOGICAL EVIDENCE OF EXPOSURE TO Anaplasma phagocytophilum IN HORSES FROM THE RIO DE JANEIRO STATE MOUNTED POLICE BRED IN THE URBAN ZONE

    Directory of Open Access Journals (Sweden)

    Marcia Farias Rolim

    2015-07-01

    Full Text Available Anaplasma phagocytophilum is an emergent hemoparasite in regions where ticks are regularly found. In order to investigate the rate of anti-A. phagocytophilum antibody in horses of the Mounted Police of Rio de Janeiro state and therefore the presence of this agent, 41 horses from the Cavalry Squadron (CS and 50 from the Regiment of Mounted Police (RMP were selected. For the serologic diagnosis the Indirect Fluorescent Antibody test was performed. In the present work, among 91 equine sera samples anti-A. phagocytophilum antibodies, with titer ≥ 1:80, were detected in 11 animals (12%, being five (5% from males and six (7% females, with no statistical difference. The adult animals with ages varying between five and 14 years presented the highest rate of positive reaction, although antibodies were detected in animals of all ages. We did not observe statistic differences in relation to the presence of anti-A. phagocytophilum antibodies among the animals bred in the CS and RMP. The presence of anti-A.phagocytophilim antibodies in horses of the Mounted Police with no clinical signs is indicative that the parasite is present in the enzootic form among the horses of the urban area. The circulation of the parasite among the animals is not dependent of the presence of tick infestations.

  19. Allocation of the transmission service cost with base in marginal costs of the transmission network expansion; Asignacion del costo del servicio de transmision con base en costos marginales de expansion de la red de transmision

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Casillas, Manuel E.; Nieva Gomez, Rolando [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    The transmission charges to the users must be completely defined in those systems where the restructuring has broken up the traditional functions of the companies; in order to introduce competition in the generation and commercialization segments of the electrical energy. The fundamentals of a method used are explained to assure the transmission service cases between their users. The method is based on the marginal expansion costs of the transmission network. Their more known applications have been in competitive markets of energy, in particular, where the energy price is the same one in all the localities. Nevertheless, it can be used under other forms of organization of the electrical industry. In order to illustrate results, the obtained ones from their application to the most important part of the transmission network of the Mexican system that operates interconnected, are presented. [Spanish] Los cargos de transmision a los usuarios deben estar completamente definidos en aquellos sistemas donde la reestructuracion ha desagregado las funciones tradicionales de las empresas; para introducir competencia en los segmentos de generacion y comercializacion de la energia electrica. Se explican los fundamentos de un metodo utilizado para asegurar los casos del servicio de transmision entre sus usuarios. El metodo se basa en los costos marginales de expansion de la red de transmision. Sus aplicaciones mas conocidas han sido en mercados competitivos de energia, en particular, donde el precio de la energia es el mismo en todas las localidades. Sin embargo, puede utilizarse bajo otras formas de organizacion de la industria electrica. Con el proposito de ilustrar resultados, se muestran los obtenidos de su aplicacion a la parte mas importante de la red de transmision del sistema mexicano que opera interconectada.

  20. Prevalence of Ehrlichia canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, Bartonella vinsonii berkhoffii, and Rickettsia spp. in dogs from Grenada.

    Science.gov (United States)

    Yabsley, Michael J; McKibben, John; Macpherson, Calum N; Cattan, Peggy F; Cherry, Natalie A; Hegarty, Barbara C; Breitschwerdt, Edward B; O'Connor, Tom; Chandrashekar, Ramaswamy; Paterson, Tara; Perea, Marta Lanza; Ball, Geoffrey; Friesen, Stanley; Goedde, Jill; Henderson, Brooke; Sylvester, Wayne

    2008-02-14

    To identify the tick-borne pathogens in dogs from Grenada, we conducted a serologic survey for Ehrlichia canis in 2004 (104 dogs) and a comprehensive serologic and molecular survey for a variety of tick-borne pathogens in 2006 (73 dogs). In 2004 and 2006, 44 and 32 dogs (42.3% and 43.8%) were seropositive for E. canis, respectively. In 2006, several tick-borne pathogens were identified by serology and PCR. DNA of E. canis, Anaplasma platys, Babesia canis vogeli, Hepatozoon canis, and Bartonella sp. were identified in 18 (24.7%), 14 (19.2%), 5 (7%), 5 (7%), and 1 (1.4%) dogs, respectively. Six (8.2%) dogs were seropositive for Bartonella vinsonii subsp. berkhoffii. All dogs were seronegative and PCR-negative for Rickettsia spp. Coinfection with two or three pathogens was observed in eight dogs. Partial 16S rRNA E. canis and A. platys sequences were identical to sequences in GenBank. Partial 18S rRNA gene sequences from the Grenadian H. canis were identical to each other and had one possible mismatch (ambiguous base) from H. canis detected from Spain and Brazil. Grenadian B. c. vogeli sequences were identical to B. c. vogeli from Brazil and Japan. All of the detected pathogens are transmitted, or suspected to be transmitted, by Rhipicephalus sanguineus. Results of this study indicate that dogs from Grenada are infected with multiple tick-borne pathogens; therefore, tick-borne diseases should be included as differentials for dogs exhibiting thrombocytopenia, leukopenia, fever, or lethargy. One pathogen, E. canis, is also of potential public health significance.

  1. A comparative study of clinical manifestations, haematological and serological responses after experimental infection with Anaplasma phagocytophilum in two Norwegian sheep breeds

    Directory of Open Access Journals (Sweden)

    Sandstedt Karin

    2011-02-01

    Full Text Available Abstract Background It has been questioned if the old native Norwegian sheep breed, Old Norse Sheep (also called Norwegian Feral Sheep, normally distributed on coastal areas where ticks are abundant, is more protected against tick-borne infections than other Norwegian breeds due to a continuously high selection pressure on pasture. The aim of the present study was to test this hypothesis in an experimental infection study. Methods Five-months-old lambs of two Norwegian sheep breeds, Norwegian White (NW sheep and Old Norse (ON sheep, were experimentally infected with a 16S rRNA genetic variant of Anaplasma phagocytophilum (similar to GenBank accession number M73220. The experiment was repeated for two subsequent years, 2008 and 2009, with the use of 16 lambs of each breed annually. Ten lambs of each breed were inoculated intravenously each year with 0.4 ml A. phagocytophilum-infected blood containing approximately 0.5 × 106 infected neutrophils/ml. Six lambs of each breed were used as uninfected controls. Half of the primary inoculated lambs in each breed were re-challenged with the same infectious dose at nine (2008 and twelve (2009 weeks after the first challenge. The clinical, haematological and serological responses to A. phagocytophilum infection were compared in the two sheep breeds. Results The present study indicates a difference in fever response and infection rate between breeds of Norwegian sheep after experimental infection with A. phagocytophilum. Conclusion Although clinical response seems to be less in ON-lambs compared to NW-lambs, further studies including more animals are needed to evaluate if the ON-breed is more protected against tick-borne infections than other Norwegian breeds.

  2. Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents--analyzing the host-pathogen-vector interface in a metropolitan area.

    Science.gov (United States)

    Silaghi, Cornelia; Woll, Dietlinde; Hamel, Dietmar; Pfister, Kurt; Mahling, Monia; Pfeffer, Martin

    2012-09-05

    The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice), were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures.

  3. Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents – Analyzing the host-pathogen-vector interface in a metropolitan area

    Directory of Open Access Journals (Sweden)

    Silaghi Cornelia

    2012-09-01

    Full Text Available Abstract Background The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Methods Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice, were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. Results 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Conclusion Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures.

  4. Babesia spp. and Anaplasma phagocytophilum in questing ticks, ticks parasitizing rodents and the parasitized rodents – Analyzing the host-pathogen-vector interface in a metropolitan area

    Science.gov (United States)

    2012-01-01

    Background The aims of this study were to evaluate the host-tick-pathogen interface of Babesia spp. and Anaplasma phagocytophilum in restored areas in both questing and host-attached Ixodes ricinus and Dermacentor reticulatus and their small mammalian hosts. Methods Questing ticks were collected from 5 sites within the city of Leipzig, Germany, in 2009. Small mammals were trapped at 3 of the 5 sites during 2010 and 2011. DNA extracts of questing and host-attached I. ricinus and D. reticulatus and of several tissue types of small mammals (the majority bank voles and yellow-necked mice), were investigated by PCR followed by sequencing for the occurrence of DNA of Babesia spp. and by real-time PCR for A. phagocytophilum. A selected number of samples positive for A. phagocytophilum were further investigated for variants of the partial 16S rRNA gene. Co-infection with Rickettsia spp. in the questing ticks was additionally investigated. Results 4.1% of questing I. ricinus ticks, but no D. reticulatus, were positive for Babesia sp. and 8.7% of I. ricinus for A. phagocytophilum. Sequencing revealed B. microti, B. capreoli and Babesia spp. EU1 in Leipzig and sequence analysis of the partial 16S RNA gene of A. phagocytophilum revealed variants either rarely reported in human cases or associated with cervid hosts. The statistical analysis revealed significantly less ticks infected with A. phagocytophilum in a city park in Leipzig as compared to the other sampling sites. A. phagocytophilum-DNA was detected in 2 bank voles, DNA of B. microti in 1 striped field-mouse and of Babesia sp. EU1 in the skin tissue of a mole. Co-infections were detected. Conclusion Our results show the involvement of small mammals in the natural endemic cycles of tick-borne pathogens. A more thorough understanding of the interactions of ticks, pathogens and hosts is the essential basis for effective preventive control measures. PMID:22950642

  5. Serological survey of Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, and Ehrlichia canis infections in rural and urban dogs in Central Italy

    Directory of Open Access Journals (Sweden)

    Valentina Virginia Ebani

    2014-11-01

    Full Text Available [b]Introduction[i][/i][/b][i]. Borrelia burgdorferi [/i]sensu lato (s.l. and Anaplasma phagocytophilum are well known zoonotic pathogens, whereas[i] Ehrlichia canis[/i] is usually considered to be of veterinary concern, although on the basis of recent reports it also seems to be able to infect humans. [b]objective[/b]. The aim of the study was to determine the seroprevalence of [i]B. burgdorferi [/i]s.l., A. phagocytophilum and [i]E. canis[/i] in an Italian canine population, and to verify if there are differences between dogs living in urban areas and those from a rural environment. [b]materials and method.[/b] Blood sera of 1,965 dogs, 1,235 from cities and 730 from rural areas, were tested by indirect immunofluorescent assay (IFAT. [b]results[/b]. The overall seroprevalence was highest for E. canis (7.07%, followed by [i]A. phagocytophilum[/i] (4.68%, and [i]B. burgdorferi[/i] s.l. (1.47%. Rural dogs showed the highest seroprevalence to [i]B. burgdorferi[/i] s.l. and [i]A. phagocytophilum[/i]. No significant differences were observed between rural and urban [i]E. canis[/i]-positive dogs. A low percentage (1.32% of dogs with dual seropositivity was detected, and no triple positive reactions were observed. No significant differences were detected in the seroprevalence of the three agents in relationship to the age and gender of the dogs. Seroprevalence in the five years considered were not statistically different, except for the lowest rate for [i]E. canis[/i] observed in 2012. [b]conclusions[/b]. The results confirm the presence of [i]B. burgdorferi[/i] s.l., [i]A. phagocytophilum[/i] and [i]E. canis[/i] in Italian dogs in both urban and rural areas. Monitoring pet dogs, which share the same environment with their owners, is useful for identifying the presence of tick-borne disease agents of both veterinary and public health significance

  6. Tissue-specific signatures in the transcriptional response to Anaplasma phagocytophilum infection of Ixodes scapularis and Ixodes ricinus tick cell lines

    Directory of Open Access Journals (Sweden)

    Pilar eAlberdi

    2016-02-01

    Full Text Available Anaplasma phagocytophilum are transmitted by Ixodes spp. ticks and have become one of the most common and relevant tick-borne pathogens due to their impact on human and animal health. Recent results have increased our understanding of the molecular interactions between Ixodes scapularis and A. phagocytophilum through the demonstration of tissue-specific molecular pathways that ensure pathogen infection, development and transmission by ticks. However, little is known about the Ixodes ricinus genes and proteins involved in the response to A. phagocytophilum infection. The tick species I. scapularis and I. ricinus are evolutionarily closely related and therefore similar responses are expected in A. phagocytophilum-infected cells. However, differences may exist between I. scapularis ISE6 and I. ricinus IRE/CTVM20 tick cells associated with tissue-specific signatures of these cell lines. To address this hypothesis, the transcriptional response to A. phagocytophilum infection was characterized by RNA sequencing and compared between I. scapularis ISE6 and I. ricinus IRE/CTVM20 tick cell lines. The transcriptional response to infection of I. scapularis ISE6 cells resembled that of tick hemocytes while the response in I. ricinus IRE/CTVM20 cells was more closely related to that reported previously in infected tick midguts. The inhibition of cell apoptosis by A. phagocytophilum appears to be a key adaptation mechanism to facilitate infection of both vertebrate and tick cells and was used to investigate further the tissue-specific response of tick cell lines to pathogen infection. The results supported a role for the intrinsic pathway in the inhibition of cell apoptosis by A. phagocytophilum infection of I. scapularis ISE6 cells. In contrast, the results in I. ricinus IRE/CTVM20 cells were similar to those obtained in tick midguts and suggested a role for the JAK/STAT pathway in the inhibition of apoptosis in tick cells infected with A. phagocytophilum

  7. El nivel educativo y socioeconómico del hogar y habilidades pre-lectoras en escuelas urbano y urbano-marginales de la provincia de Mendoza-Argentina

    Directory of Open Access Journals (Sweden)

    Yanina Canales, Jara

    2016-05-01

    Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

  8. Prevalence of Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi sensu lato, Anaplasma spp. and Leishmania infantum in apparently healthy and CVBD-suspect dogs in Portugal - a national serological study

    Directory of Open Access Journals (Sweden)

    Cardoso Luís

    2012-03-01

    Full Text Available Abstract Background Canine vector-borne diseases (CVBDs are caused by a wide range of pathogens transmitted to dogs by arthropods including ticks and insects. Many CVBD-agents are of zoonotic concern, with dogs potentially serving as reservoirs and sentinels for human infections. The present study aimed at assessing the seroprevalence of infection with or exposure to Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi sensu lato, Anaplasma spp. and Leishmania infantum in dogs in Portugal. Methods Based on 120 veterinary medical centres from all the regions of mainland and insular Portugal, 557 apparently healthy and 628 CVBD-suspect dogs were sampled. Serum, plasma or whole blood was tested for qualitative detection of D. immitis antigen and antibodies to E. canis, B. burgdorferi s. l., Anaplasma spp. and L. infantum with two commercial in-clinic enzyme-linked immunosorbent assay kits. Odds ratios (OR were calculated by logistic regression analysis to identify independent risk factors of exposure to the vector-borne agents. Results Total positivity levels to D. immitis, E. canis, B. burgdorferi, Anaplasma spp., L. infantum, one or more agents and mixed agents were 3.6%, 4.1%, 0.2%, 4.5%, 4.3%, 14.0% and 2.0% in the healthy group, and 8.9%, 16.4%, 0.5%, 9.2%, 25.2%, 46.3% and 11.6% in the clinically suspect group, respectively. Non-use of ectoparasiticides was a risk factor for positivity to one or more agents both in the apparently healthy (OR = 2.1 and CVBD-suspect (OR = 1.5 dogs. Seropositivity to L. infantum (OR = 7.6, E. canis (OR = 4.1 and D. immitis (OR = 2.4 were identified as risk factors for the presence of clinical signs compatible with CVBDs. Positivity to mixed agents was not found to be a risk factor for disease. Conclusions Dogs in Portugal are at risk of becoming infected with vector-borne pathogens, some of which are of zoonotic concern. CVBDs should be considered by practitioners and prophylactic measures must be put in

  9. Immunisation of smallholder dairy cattle against anaplasmosis and babesiosis in Malawi

    DEFF Research Database (Denmark)

    Tjørnehøj, Kirsten; Lawrence, J. A.; Kafuwa, P. T.

    1997-01-01

    A field study was conducted in the Southern Region of Malawi to evaluate the possible benefits of immunisation of improved dairy cattle against Anaplasma marginale, Babesia bigemina and Babesia bovis. Friesian crossbred heifers were immunised when they were being reared on Government farms. They ...

  10. Molecular approaches to detect and study the organisms causing ...

    African Journals Online (AJOL)

    This review will summarise the molecular approaches used to detect and analyse the genomes of Babesia bovis, B. bigemina and Anaplasma marginale which cause bovine babesiosis and anaplasmosis. These tick borne diseases are widely distributed in Africa, Asia, Australia, and Central and South America and for ...

  11. Isotope Identification

    Energy Technology Data Exchange (ETDEWEB)

    Karpius, Peter Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2017-09-18

    The objective of this training modules is to examine the process of using gamma spectroscopy for radionuclide identification; apply pattern recognition to gamma spectra; identify methods of verifying energy calibration; and discuss potential causes of isotope misidentification.

  12. The risk of exposure to Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Babesia sp. and co-infections in Ixodes ricinus ticks on the territory of Niepołomice forest (southern Poland).

    Science.gov (United States)

    Asman, Marek; Nowak, Magdalena; Cuber, Piotr; Strzelczyk, Joanna; Szilman, Ewa; Szilman, Piotr; Trapp, Gizela; Siuda, Krzysztof; Solarz, Krzysztof; Wiczkowski, Andrzej

    2013-01-01

    Niepołomice Forest is located about 20 kilometers east of Cracow (Malopolska province, southern Poland). Its natural and touristic values, as well as wide range of hosts occurring within indicate this to be an area of high risk of exposure to Ixodes ricinus and tick-borne diseases it transfers. I. ricinus is a common species in Poland and Europe. Its seasonal activity begins in Poland in the early spring, and ends with late autumn. A total number of 129 specimens of I. ricinus was collected by flagging in Niepołomice Forest. DNA was isolated by ammonia method from 30 randomly-selected individuals. PCR was used to detect tick-borne pathogens with primers specific for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato and Babesia sp. Molecular studies confirmed the presence of all three pathogens in I. ricinus. A. phagocytophilum was found in 76.7%, Babesia sp., 60%, B. burgdorferi s. l., in 3.3% of studied ticks. A. phagocytophilum co-infection with Babesia sp., was found in 46.7% of the specimens. A co-infection of all three tested pathogens was recorded in one case (3.3%). In Poland the problem of tick-borne diseases is a growing issue, therefore people residing in southern Polish touristic areas should be informed about the prevention and protection against ticks.

  13. Whale Identification

    Science.gov (United States)

    1991-01-01

    R:BASE for DOS, a computer program developed under NASA contract, has been adapted by the National Marine Mammal Laboratory and the College of the Atlantic to provide and advanced computerized photo matching technique for identification of humpback whales. The program compares photos with stored digitized descriptions, enabling researchers to track and determine distribution and migration patterns. R:BASE is a spinoff of RIM (Relational Information Manager), which was used to store data for analyzing heat shielding tiles on the Space Shuttle Orbiter. It is now the world's second largest selling line of microcomputer database management software.

  14. Diamond identification

    International Nuclear Information System (INIS)

    Lang, A.R.

    1979-01-01

    Methods of producing sets of records of the internal defects of diamonds as a means of identification of the gems by x-ray topography are described. To obtain the records one can either use (a) monochromatic x-radiation reflected at the Bragg angle from crystallographically equivalent planes of the diamond lattice structure, Bragg reflections from each such plane being recorded from a number of directions of view, or (b) white x-radiation incident upon the diamond in directions having a constant angular relationship to each equivalent axis of symmetry of the diamond lattice structure, Bragg reflections being recorded for each direction of the incident x-radiation. By either method an overall point-to-point three dimensional representation of the diamond is produced. (U.K.)

  15. Investigação molecular de Ehrlichia spp. e Anaplasma platys em felinos domésticos: alterações clínicas, hematológicas e bioquímicas

    Directory of Open Access Journals (Sweden)

    Elisabete S Correa

    2011-10-01

    Full Text Available Ehrlichia sp. e Anaplasma platys são micro-organismos Gram negativos, parasitos intracelulares obrigatórios, residindo em vacúolos citoplasmáticos de leucócitos e plaquetas, encontrados no sangue periférico ou em tecidos. Poucos relatos têm sido feitos sobre erliquiose e anaplasmose em gatos no Brasil, os quais são baseados na presença de mórulas em leucócitos e plaquetas, ou pela detecção de anticorpos. O objetivo deste trabalho foi investigar a infecção natural por Ehrlichia sp. e A.platys em gatos no Município de Campos dos Goytacazes-RJ, através da hematoscopia e pela detecção do DNA desses agentes. Foram utilizadas amostras de sangue total e de soro de 91 gatos, independente de raça, sexo e idade. Realizaram-se hemograma, bioquímica sérica e PCR, utilizando oligonucleotídes para Ehrlichia sp. e A.platys. Os dados de hematoscopia mostraram que 9,89% dos gatos apresentaram mórulas em macroplaquetas. O DNA de A.platys foi detectado em 13,18% dos 91 animais e em 44,44% das amostras positivas à hematoscopia. O DNA de Ehrlichia sp. não foi detectado em nenhuma amostra. Nenhuma alteração foi observada nos sinais clínicos nem nos resultados laboratoriais nos animais estudados. Os dados sugerem que os felinos domésticos podem atuar como potenciais reservatórios para A. platys, como forma não sintomática das enfermidades relacionadas

  16. Diagnosis of hemoparasitosis trough the spread-smear technique using a drop of blood clot

    OpenAIRE

    Neusa Saltiél Stobbe; Eunice Leonora Chaplin; Maria das Graças de Souza Paiva; Nilton Rogério Santos Silva; Flávio A. Pacheco Araújo; Elinor Fortes

    1992-01-01

    The spread-smear technique using a drop of blood clot and stained by diluted and undimitcd Giemsa stain was evaluated for the search of blood cell types and recognition of Babesia bovis, Babesia bigemina and Anaplasma marginale hemoparasites. The blood clot samples were taken from a 6 month-old calf experimentally inoculated with the blood from a Cattle Tick Fever carrier. The Technique was sumitable for the observation of different blood cells and for the recognition of the hemoparasites.

  17. Muon identification in JADE

    International Nuclear Information System (INIS)

    Allison, J.; Armitage, J.C.M.; Baines, J.T.M.; Ball, A.H.; Bamford, G.; Barlow, R.J.; Bowdery, C.K.; Chrin, J.T.M.; Duerdoth, I.P.; Glendinning, I.; Greenshaw, T.; Hassard, J.F.; Hill, P.; King, B.T.; Loebinger, F.K.; Macbeth, A.A.; McCann, H.; Mercer, D.; Mills, H.E.; Murphy, P.G.; Prosper, H.B.; Rowe, P.; Stephens, K.

    1985-01-01

    The method of identification of high energy muons in the JADE detector is described in detail. The performance of the procedure is discussed in detail for the case of prompt identification in multihadronic final states. (orig.)

  18. Identification for Control

    DEFF Research Database (Denmark)

    Tøffner-Clausen, S.

    1995-01-01

    Identification of model error bounds for robust control design has recently achieved much attention.......Identification of model error bounds for robust control design has recently achieved much attention....

  19. Anaplasma phagocytophilum: deceptively simple or simply deceptive?

    Czech Academy of Sciences Publication Activity Database

    Severo, M. S.; Stephens, K. D.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2012-01-01

    Roč. 7, č. 6 (2012), s. 719-731 ISSN 1746-0913 Institutional support: RVO:60077344 Keywords : obligate intracellular bacterium * rickettsial agents * ticks * vector-borne diseases Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 4.018, year: 2012

  20. Bovine babesiosis and anaplasmosis complex: diagnosis and evaluation of the risk factors from Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Lucimar Souza Amorim

    Full Text Available Direct diagnoses were made by using - blood smears and nested PCR (nPCR tests on 309 blood samples from crossbred dairy cattle in the municipality of Ibicaraí, Bahia. From diagnostic blood smear slides, the observed parasitic frequencies were 31.1% for Anaplasma marginale and 20.4% for Babesia sp. From nPCR diagnoses, they were 63% for A. marginale, 34% for Babesia bigemina and 20.4% for Babesia bovis. There were significant differences (P <0.01 between the two diagnostic methods (nPCR and blood smear slides. The compliance obtained from the kappa test was 0.41 and 0.48 for A. marginale and Babesia sp., respectively. The tick samples from the six farms analyzed using nPCR were only positive for A. marginale. Evaluation of the risk factors relating to the presence of ticks and the age of the animals showed that there was a significant association (P <0.01 with the frequency of animals infected with both pathogens. Therefore, under the conditions studied, nPCR proved to be a good tool for diagnosing the agents of the bovine babesiosis and anaplasmosis complex because of its sensitivity and specificity in comparison with blood smears. The municipality of Ibicaraí is an area with endemic prevalence of bovine babesiosis and anaplasmosis confirmed by nPCR and A. marginale is the main agent of the disease.

  1. Opportunity identification competence

    NARCIS (Netherlands)

    Baggen, Yvette

    2017-01-01

    Opportunities and their identification are of significant importance for competitiveness in today’s complex and turbulent business environment because they serve as a key influencing factor for new value-creation. Opportunity identification (OI) is interesting not only from the perspective of new

  2. Improved Palmprint Identification System

    Directory of Open Access Journals (Sweden)

    Harshala C. Salave

    2015-03-01

    Full Text Available Abstract Generally private information is provided by using passwords or Personal Identification Numbers which is easy to implement but it is very easily stolen or forgotten or hack. In Biometrics for individuals identification uses human physiological which are constant throughout life like palm face DNA iris etc. or behavioral characteristicswhich is not constant in life like voice signature keystroke etc.. But mostly gain more attention to palmprint identification and is becoming more popular technique using for identification and promising alternatives to the traditional password or PIN based authentication techniques. In this paper propose palmprint identification using veins on the palm and fingers. Here use fusion of techniques such as Discrete Wavelet transformDWT Canny Edge Detector Gaussian Filter Principle Component AnalysisPCA.

  3. Remote spectroscopic identification of bloodstains

    NARCIS (Netherlands)

    Bremmer, Rolf H.; Edelman, Gerda; Vegter, Tessa Dijn; Bijvoets, Ted; Aalders, Maurice C. G.

    2011-01-01

    Blood detection and identification at crime scenes are crucial for harvesting forensic evidence. Unfortunately, most tests for the identification of blood are destructive and time consuming. We present a fast and nondestructive identification test for blood, using noncontact reflectance

  4. ACE - Manufacturer Identification Code (MID)

    Data.gov (United States)

    Department of Homeland Security — The ACE Manufacturer Identification Code (MID) application is used to track and control identifications codes for manufacturers. A manufacturer is identified on an...

  5. Trastornos por consumo de alcohol (AUDIT en adolescentes y jovenes marginales de bandas juveniles de Mexico Transtornos por consumo de álcool (AUDIT em adolescentes e jovens marginais de bandos juvenis do México Alcohol consumption disorder (AUDIT for marginal adolescents and youth from juvenile gangs of Mexico

    Directory of Open Access Journals (Sweden)

    Francisco Rafael Guzmán Facundo

    2007-12-01

    Full Text Available Adolescentes y jóvenes que pertenecen a bandas juveniles con frecuencia son omitidos de las encuestas nacionales sobre consumo de alcohol y drogas. El objetivo del estudio fue conocer los trastornos por consumo de alcohol, y analizar el efecto de factores personales sobre estos, en 125 adolescentes y jóvenes margínales de bandas juveniles de Monterrey, NL. México. Los resultados indicaron que 70% mostró consumo excesivo, 62% se clasificó con consumo perjudicial y el 50% con dependencia. Los factores que más contribuyeron en la predicción del consumo excesivo fueron la edad, sexo y el bajo nivel educativo, para el consumo perjudicial fueron la edad y problemas de salud mental, y para el consumo dependiente fueron la edad, los años de escolaridad y los problemas de salud mental. Estos resultados posibilitarán la reflexión de la necesidad de diseñar programas adecuados dirigidos a la prevención en este grupo de jóvenes marginales.Adolescentes e jovens que pertencem a bandos juvenis com freqüência são omitidos dos estudos nacionais sobre consumo de álcool e drogas. O objetivo da presente pesquisa foi conhecer os transtornos por consumo de álcool e analisar o efeito de fatores pessoais sobre estes, em 125 adolescentes e jovens marginais de bandos juvenis do México. Os resultados mostraram que 70% têm consumo excessivo, 62% se classificou em um consumo prejudicial, e o 50% com dependência. Os fatores que maior contribuíram na predição do consumo excessivo foram a idade, sexo e o baixo nível educacional, para o consumo prejudicial foram a idade e os problemas de saúde mental, e para o consumo dependente foram a idade, os anos de escolaridade e os problemas de saúde mental. Estes resultados possibilitaram a reflexão da necessidade de elaboração de programas adequados direcionados à prevenção neste grupo de jovens.Adolescents and youngers who are involved in gangs, are frequently excluded from the national surveys about

  6. TALENT IDENTIFICATION IN FOOTBALL

    Directory of Open Access Journals (Sweden)

    Bojan Rakojević

    2008-08-01

    Full Text Available There is incerasing emphasis on clubs to detect players and nurture and guide them throught the talent identification proces. More over, different factors may contribute to performance prediction at different ages. Thus any such model would need to be agespecific (Reilly et al, 2000. The aim of this paper was to determine essential principles of proces talent identification and determine antropometric, physiological and psychological profile and football-specifc skills that could be used for talent identification in players aged 10-12 years.

  7. Las calles y los barrios marginales de Daca

    OpenAIRE

    LeBeau, Nellie; Tuckfield, Hugh

    2017-01-01

    Cada año, alrededor de medio millón de personas busca alojamiento en Daca, a causa del nexo entre el cambio climático, la pobreza y la degradación del medio ambiente. Muchas de estas personas terminan viviendo en las calles.

  8. Margins in Swedish district heating systems; Marginaler i Fjaerrvaermesystem

    Energy Technology Data Exchange (ETDEWEB)

    Selinder, Patrik; Zinko, Heimo [ZW Energiteknik AB, Nykoeping (Sweden)

    2003-03-01

    It can be assumed on good reasons that the Swedish district heating nets are designed with relatively large margins concerning the transportable power. This is done historically to be able to transport the necessary power that can be called for on the coldest winter days but which occur rarely and also due to the former (until 2001) applied recommendations for the dimensioning of hot water flows. The aim of this project was to investigate the possibilities of reducing the connecting power to customers, both from a technical and from the customer point of view. The heating system of a building in Sweden is normally dimensioned according to a certain outdoor air temperature (DUT in Swedish). According to the Swedish Building Code, DUT20 is defined for a given location in such a way that if the heating system is designed for this temperature, the room temperature is allowed to decrease by 3 deg C in the average once in 20 years. That means that for economical reasons, a power deficiency is accounted for in the case of strong cold. The value of DUT is depending on the thermal inertia of the building. Buildings with high thermal inertia can have a higher DUT and vice versa. A reduced system size can in principle mean smaller size of pipes and consumer substations and more power available for additional customers to be connected. In principle, that means a more profitable district heating operation. Besides costs, another problem with oversized capacities are possible operational problems due to slow dynamic system responses, for instance at restarting occasions after a pump stop. A smaller valve size will result in a better system dynamic and may result in a more compliant system operation and increased delivery quality. By choosing just right DUT for every building and abandoning safety margins, it is shown in the report that the connecting power can be reduced in especially medium light to heavy buildings with larger time constants. However, this also means that the occasions with power deficiency will occur more often. The lower limit for the reduction of connection power is depending on the level of comfort the customers are prepared to accept. These questions have been discussed with selected customer representatives. The mentioned practice of oversizing of the heating power deliverable to the buildings presents a relatively large margin for reduction of consumable power without decreasing the level of heating comfort too much. In the report this method is recommended under the name 'stingy' (= adequate) dimensioning; it is still according to the recommendation of the Swedish building code based on DUT20 and following the regulations of the Swedish District Heating Association for the domestic hot water dimensioning. The result will be a decrease of about 30% of the connected power in most buildings, and somewhat more in the heaviest buildings. Further reduction of the connecting power will implicate a more strong impact on the heating comfort. We call this 'deficiency dimensioning' and we cannot really recommend it apart from some special customer groups who might accept this heating quality by receiving some kind of economic compensation.

  9. Une étude marginale de littérature

    Directory of Open Access Journals (Sweden)

    Bibiane Fréché

    2011-07-01

    Full Text Available Rencontrer une note, selon un propos célèbre prêté au dramaturge Noel Coward, « is like going downstairs to answer the doorbel while making love ». (p. 11Andréas Pfersmann est maître de conférence à l’Université de la Polynésie française. Il étudie depuis près de vingt ans l’annotation. Tout aussi marginal que marginalisé dans les études françaises, le sujet n’est pas neuf pour autant. Les scientifiques allemands planchent depuis la fin du XIXe siècle sur le sujet et le monde anglo-saxon lui...

  10. Tick-Pathogen Interactions and Vector Competence: Identification of Molecular Drivers for Tick-Borne Diseases

    Czech Academy of Sciences Publication Activity Database

    de la Fuente, J.; Antunes, S.; Bonnet, S.; Cabezas Cruz, Alejandro; Domingos, A.G.; Estrada-Peňa, A.; Johnson, N.; Kocan, K.M.; Mansfield, K. L.; Nijhof, A.M.; Papa, A.; Rudenko, Natalia; Villar, M.; Alberdi, P.; Torina, A.; Ayllón, N.; Vancová, Marie; Golovchenko, Maryna; Grubhoffer, Libor; Caracappa, S.; Fooks, A. R.; Gortazar, C.; Rego, Ryan O. M.

    2017-01-01

    Roč. 7, APR 7 (2017), č. článku 114. ISSN 2235-2988 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : tick * Anaplasma * flavivirus * Babesia * Borrelia * Microbiome * immunology * vaccine Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 4.300, year: 2016

  11. Identification and Authentication Policy

    National Research Council Canada - National Science Library

    Gimble, Thomas

    1999-01-01

    .... We will accomplish the audit objective in two phases. In this phase, we reviewed current DoD Component policies on the use of identification and authentication controls to access information systems...

  12. Limited data speaker identification

    Indian Academy of Sciences (India)

    recognition can be either identification or verification depending on the task objective. .... like Bayesian formalism, voting method and Dempster-Shafer (D–S) theory ..... self-organizing map (SOM) (Kohonen 1990), learning vector quantization ...

  13. Regularities in eyewitness identification.

    Science.gov (United States)

    Clark, Steven E; Howell, Ryan T; Davey, Sherrie L

    2008-06-01

    What do eyewitness identification experiments typically show? We address this question through a meta-analysis of 94 comparisons between target-present and target-absent lineups. The analyses showed that: (a) correct identifications and correct-nonidentifications were uncorrelated, (b) suspect identifications were more diagnostic with respect to the suspect's guilt or innocence than any other response, (c) nonidentifications were diagnostic of the suspect's innocence, (d) the diagnosticity of foil identifications depended on lineup composition, and (e) don't know responses were nondiagnostic with respect to guilt or innocence. Results of diagnosticity analyses for simultaneous and sequential lineups varied for full-sample versus direct-comparison analyses. Diagnosticity patterns also varied as a function of lineup composition. Theoretical, forensic, and legal implications are discussed.

  14. L’architecture rurale lorraine du XIVe siècle à la première moitié du XVIe siècle : de l’identification aux marqueurs chronologiques

    Directory of Open Access Journals (Sweden)

    Ivan Ferraresso

    2012-04-01

    Full Text Available Part marginale du patrimoine lorrain, la maison rurale médiévale est peu étudiée. Les destructions provoquées par les guerres modernes et contemporaines peuvent en partie expliquer sa faible représentation mais quelques traces sont encore perceptibles. Leur étude systématique permettrait de comprendre la chronologie, les mutations et les permanences de l’habitat rural en Lorraine. Or, ces éléments, parfois très morcelés, rendent difficiles l’identification et l’analyse du bâtiment initial. De plus les critères de datation, dont la fiabilité est variable, imposent une étude fouillée du bâtiment pour exploiter les informations les plus infimes.Rural dwellings of the Middle Ages are not an outstanding feature of the heritage in the Lorraine region and have been little studied. The wars of the nineteenth end twentieth centuries explain this relative lack of interest but some surviving traces can still be analysed. This analysis allows for some conclusions as to the chronology, the changes and the permanent features of the region’s rural dwellings. These elements, sometimes broadly scattered, make the identification and analysis of the original dwelling difficult. Dating criteria, of varying reliability, impose an analytical approach in which the building has to be studied in minute detail in order to identify the slightest detail of informative

  15. Bunch identification module

    International Nuclear Information System (INIS)

    Fox, J.D.

    1981-01-01

    This module provides bunch identification and timing signals for the PEP Interaction areas. Timing information is referenced to the PEP master oscillator, and adjusted in phase as a function of region. Identification signals are generated in a manner that allows observers in all interaction regions to agree on an unambiguous bunch identity. The module provides bunch identification signals via NIM level logic, upon CAMAC command, and through LED indicators. A front panel ''region select'' switch allows the same module to be used in all regions. The module has two modes of operation: a bunch identification mode and a calibration mode. In the identification mode, signals indicate which of the three bunches of electrons and positrons are interacting, and timing information about beam crossing is provided. The calibration mode is provided to assist experimenters making time of flight measurements. In the calibration mode, three distinct gating signals are referenced to a selected bunch, allowing three timing systems to be calibrated against a common standard. Physically, the bunch identifier is constructed as a single width CAMAC module. 2 figs., 1 tab

  16. Identification of physical models

    DEFF Research Database (Denmark)

    Melgaard, Henrik

    1994-01-01

    of the model with the available prior knowledge. The methods for identification of physical models have been applied in two different case studies. One case is the identification of thermal dynamics of building components. The work is related to a CEC research project called PASSYS (Passive Solar Components......The problem of identification of physical models is considered within the frame of stochastic differential equations. Methods for estimation of parameters of these continuous time models based on descrete time measurements are discussed. The important algorithms of a computer program for ML or MAP...... design of experiments, which is for instance the design of an input signal that are optimal according to a criterion based on the information provided by the experiment. Also model validation is discussed. An important verification of a physical model is to compare the physical characteristics...

  17. Defect identification using positrons

    International Nuclear Information System (INIS)

    Beling, C.D.; Fung, S.

    2001-01-01

    The current use of the lifetime and Doppler broadening techniques in defect identification is demonstrated with two studies, the first being the identification of carbon vacancy in n-6H SiC through lifetime spectroscopy, and the second the production of de-hydrogenated voids in α-Si:H through light soaking. Some less conventional ideas are presented for more specific defect identification, namely (i) the amalgamation of lifetime and Doppler techniques with conventional deep level transient spectroscopy in what may be called ''positron-deep level transient spectroscopy'', and (ii) the extraction of more spatial information on vacancy defects by means of what may be called ''Fourier transform Doppler broadening of annihilation radiation spectroscopy'' (orig.)

  18. Hob Identification Methods

    Directory of Open Access Journals (Sweden)

    Andrzej Piotrowski

    2018-03-01

    Full Text Available In industrial practice, hobs are manufactured and used. The problem boils down to the identification of a hob with defining its profile, which depends on many design and technological parameters (such as the grinding wheel size, profile, type and positioning during machining. This makes the basis for the correct execution and sharpening of the tool. The accuracy of the hob determines the quality of gear wheel teeth being shaped. The article presents the hob identification methods that are possible to be used in industrial and laboratory practice.

  19. Simplified Multimodal Biometric Identification

    Directory of Open Access Journals (Sweden)

    Abhijit Shete

    2014-03-01

    Full Text Available Multibiometric systems are expected to be more reliable than unimodal biometric systems for personal identification due to the presence of multiple, fairly independent pieces of evidence e.g. Unique Identification Project "Aadhaar" of Government of India. In this paper, we present a novel wavelet based technique to perform fusion at the feature level and score level by considering two biometric modalities, face and fingerprint. The results indicate that the proposed technique can lead to substantial improvement in multimodal matching performance. The proposed technique is simple because of no preprocessing of raw biometric traits as well as no feature and score normalization.

  20. Plant Transporter Identification

    DEFF Research Database (Denmark)

    Larsen, Bo

    Membrane transport proteins (transporters) play a critical role for numerous biological processes, by controlling the movements of ions and molecules in and out of cells. In plants, transporters thus function as gatekeepers between the plant and its surrounding environment and between organs......, tissues, cells and intracellular compartments. Since plants are highly compartmentalized organisms with complex transportation infrastructures, they consequently have many transporters. However, the vast majority of predicted transporters have not yet been experimentally verified to have transport...... activity. This project contains a review of the implemented methods, which have led to plant transporter identification, and present our progress on creating a high-throughput functional genomics transporter identification platform....

  1. Denture identification using unique identification authority of India barcode

    OpenAIRE

    Sudhindra Mahoorkar; Anoop Jain

    2013-01-01

    Over the years, various denture marking systems have been reported in the literature for personal identification. They have been broadly divided into surface marking and inclusion methods. In this technique, patient's unique identification number and barcode printed in the patient's Aadhaar card issued by Unique Identification Authority of India (UIDAI) are used as denture markers. This article describes a simple, quick, and economical method for identification of individual.

  2. Denture identification using unique identification authority of India barcode.

    Science.gov (United States)

    Mahoorkar, Sudhindra; Jain, Anoop

    2013-01-01

    Over the years, various denture marking systems have been reported in the literature for personal identification. They have been broadly divided into surface marking and inclusion methods. In this technique, patient's unique identification number and barcode printed in the patient's Aadhaar card issued by Unique Identification Authority of India (UIDAI) are used as denture markers. This article describes a simple, quick, and economical method for identification of individual.

  3. Identification markings for gemstones

    International Nuclear Information System (INIS)

    Dreschhoff, G.A.M.; Zeller, E.J.

    1980-01-01

    A method is described of providing permanent identification markings to gemstones such as diamond crystals by irradiating the cooled gemstone with protons in the desired pattern. The proton bombardment results in a reaction limited to a defined plane and converting the bombarded area of the plane into a different crystal lattice from that of the preirradiated stone. (author)

  4. Radio Frequency Identification

    Indian Academy of Sciences (India)

    Radio Frequency Identification (RFID) has been around sinceearly 2000. Its use has currently become commonplace as thecost of RFID tags has rapidly decreased. RFID tags have alsobecome more 'intelligent' with the incorporation of processorsand sensors in them. They are widely used now in manyinnovative ways.

  5. Mexican Identification. Project Mexico.

    Science.gov (United States)

    Castellano, Rita

    This document presents an outline and teacher's guide for a community college-level teaching module in Mexican identification, designed for students in introductory courses in the social sciences. Although intended specifically for cultural anthropology, urban anthropology, comparative social organization and sex roles in cross-cultural…

  6. Aplicación de modelos estructurales marginales para estimar los efectos de la terapia antirretroviral en 5 cohortes de seroconvertores al virus de la inmunodeficiencia humana Marginal structural models application to estimate the effects of antiretroviral therapy in 5 cohorts of HIV seroconverters

    Directory of Open Access Journals (Sweden)

    Santiago Pérez-Hoyos

    2007-02-01

    Full Text Available Los métodos convencionales tienen limitaciones para ajustar por factores de confusión dependientes del tiempo para evaluar la efectividad poblacional de tratamientos en estudios observacionales. En este trabajo se muestra un nuevo tipo de metodología, los modelos estructurales marginales (MEM, y se estima la efectividad de la terapia antirretroviral de gran actividad (TARGA sobre la incidencia de sida o muerte. Sujetos y métodos: Se identificaron los sujetos sin TARGA seguidos a partir de 1997 en las cohortes de seroconvertores al virus de la inmunodeficiencia humana (VIH del proyecto GEMES (Grupo de Estudio Multicéntrico Español de Seroconvertores. Para estimar el efecto sobre la incidencia de sida o muerte, se obtuvieron los parámetros de un MEM mediante una regresión logística ponderada por probabilidad inversa. La estimación de los pesos se basó en el recuento de CD4, el tiempo desde la seroconversión, el sexo, la edad, la categoría de trasmisión y el tratamiento previo. Resultados: Los 917 sujetos elegibles se siguieron durante una media de 3,4 años, durante los cuales se observaron 139 desenlaces de interés. El 42,1% de los participantes recibió TARGA durante el estudio. La tasa relativa fue de 1,01 (intervalo de confianza &(IC& del 95%, 0,68-1,49 mediante un modelo de Cox convencional sin covariables, y de 0,90 (IC del 95%, 0,61-1,32 mediante un modelo de Cox convencional con covariables cambiantes en el tiempo. La tasa relativa causal estimada por un MEM fue de 0,74 (IC del 95%, 0,49-1,12. Conclusiones: El efecto beneficioso del TARGA encontrado por los MEM está bien establecido, pero los modelos convencionales no pudieron detectarlo. El uso de un MEM permitió ajustar apropiadamente por la variable CD4, que es a la vez una variable de confusión dependiente del tiempo y está afectada por el uso previo de tratamiento.Objectives: Standard methods to evaluate population effectiveness of treatments in observational

  7. Dental plaque identification at home

    Science.gov (United States)

    ... this page: //medlineplus.gov/ency/article/003426.htm Dental plaque identification at home To use the sharing ... a sticky substance that collects around and between teeth. The home dental plaque identification test shows where ...

  8. Identification of nonlinear anelastic models

    International Nuclear Information System (INIS)

    Draganescu, G E; Bereteu, L; Ercuta, A

    2008-01-01

    A useful nonlinear identification technique applied to the anelastic and rheologic models is presented in this paper. First introduced by Feldman, the method is based on the Hilbert transform, and is currently used for identification of the nonlinear vibrations

  9. Embedded System for Biometric Identification

    OpenAIRE

    Rosli, Ahmad Nasir Che

    2010-01-01

    This chapter describes the design and implementation of an Embedded System for Biometric Identification from hardware and software perspectives. The first part of the chapter describes the idea of biometric identification. This includes the definition of

  10. Identification of southern radio sources

    International Nuclear Information System (INIS)

    Savage, A.; Bolton, J.G.; Wright, A.E.

    1977-01-01

    Identifications are suggested for 53 radio sources from the southern zones of the Parkes 2700-MHz survey, 32 with galaxies, 11 with suggested QSOs and 10 with confirmed QSOs. The identifications were made from the ESO quick blue survey plates, the SRC IIIa-J deep survey plates and the Palomar Sky Survey prints. Accurate optical positions have been measured for four of the new identifications and for two previously suggested identifications. A further nine previously suggested QSO identifications have also been confirmed by two-colour photography or spectroscopy. (author)

  11. Identification of Rotating Machines

    Directory of Open Access Journals (Sweden)

    T. Kreuzinger-Janik

    2000-01-01

    Full Text Available In this paper a method is proposed for unbalance identification ofelastic rotors. The method is essentially based on the rotordynamic theory combined with experimental modal analysis and allows to identify the unbalance distribution on the complete rotor. A rotor test rig designed for rotordynamic experiments, modal analysis and especially for the unbalance identification has been developed. It allows an arbitrary excitation with a particularly developed noncontact magnetic exciter, as well as measuring vibrations in radial direction with non-contact laser sensors and eddy currents. Special effects of rotordynamic like anisotropic journal bearings and gyroscopic forces can be simulated. Experimental and theoretical results like mode shapes and unbalance parameters for the laboratory model are presented in detail.

  12. Structural Identification Problem

    Directory of Open Access Journals (Sweden)

    Suvorov Aleksei

    2016-01-01

    Full Text Available The identification problem of the existing structures though the Quasi-Newton and its modification, Trust region algorithms is discussed. For the structural problems, which could be represented by means of the mathematical modelling of the finite element code discussed method is extremely useful. The nonlinear minimization problem of the L2 norm for the structures with linear elastic behaviour is solved by using of the Optimization Toolbox of Matlab. The direct and inverse procedures for the composition of the desired function to minimize are illustrated for the spatial 3D truss structure as well as for the problem of plane finite elements. The truss identification problem is solved with 2 and 3 unknown parameters in order to compare the computational efforts and for the graphical purposes. The particular commands of the Matlab codes are present in this paper.

  13. SYMPOSIUM: Particle identification

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    1989-07-15

    Typical elementary particle experiments consist of a source of interactions (an external beam and a fixed target or two colliding beams) and a detector system including most of the following components: a tracking system and analysis magnet, calorimetry (measurement of energy deposition), hadron and electron identification, muon detection, trigger counters and processors, and data acquisition electronics. Experiments aimed at future high luminosity hadron collider (proton-proton or proton-antiproton) projects such as an upgraded Tevatron at Fermilab, the Large Hadron Collider (LHC) idea at CERN, and the proposed US Superconducting Supercollider (SSC), must ideally cover the entire solid angle and be capable of not only surviving the collisions, but also providing high resolution event information at incredible interaction rates. The Symposium on Particle Identification at High Luminosity Hadron Colliders held at Fermilab from 5-7 April (sponsored by Fermilab, the US Department of Energy, and the SSC Central Design Group) focused on this single facet of detector technology.

  14. Identification of microstructures

    International Nuclear Information System (INIS)

    Padilha, A.F.; Ambrozio Filho, F.

    1984-01-01

    The identification of phases in a material can require the utilization of several techniques. The most used technique and discussed are: optical microscope, scanning electron microscope, transmission electron microscope, X-ray diffraction and 'in-situ' chemical analysis of the phases. The microstructures were classified, in according to the size and phase volumetric fraction, in four types. For each type the most appropriate techniques for identifying the phases are discussed. (E.G.) [pt

  15. PINS Spectrum Identification Guide

    Energy Technology Data Exchange (ETDEWEB)

    A.J. Caffrey

    2012-03-01

    The Portable Isotopic Neutron Spectroscopy—PINS, for short—system identifies the chemicals inside munitions and containers without opening them, a decided safety advantage if the fill chemical is a hazardous substance like a chemical warfare agent or an explosive. The PINS Spectrum Identification Guide is intended as a reference for technical professionals responsible for the interpretation of PINS gamma-ray spectra. The guide is divided into two parts. The three chapters that constitute Part I cover the science and technology of PINS. Neutron activation analysis is the focus of Chapter 1. Chapter 2 explores PINS hardware, software, and related operational issues. Gamma-ray spectral analysis basics are introduced in Chapter 3. The six chapters of Part II cover the identification of PINS spectra in detail. Like the PINS decision tree logic, these chapters are organized by chemical element: phosphorus-based chemicals, chlorine-based chemicals, etc. These descriptions of hazardous, toxic, and/or explosive chemicals conclude with a chapter on the identification of the inert chemicals, e.g. sand, used to fill practice munitions.

  16. First confirmed report of outbreak of theileriosis/anaplasmosis in a cattle farm in Henan, China.

    Science.gov (United States)

    Cui, Yanyan; Wang, Xiaoxing; Zhang, Yan; Yan, Yaqun; Dong, Haiju; Jian, Fuchun; Shi, Ke; Zhang, Longxian; Wang, Rongjun; Ning, Changshen

    2018-01-01

    Tick-borne diseases (TBDs) impose a significant constraint to livestock production world widely. In this paper, we presented a case of TBD in a cattle farm in Henan, China. 35 blood samples (7 samples sent by veterinarian, 28 samples gathered by our colleagues) were collected from ill, surviving and asymptomatic cattle and microscopic observation and PCR assays were conducted to characterize the pathogens. Genus Ixodes feeding on these cattle were collected and identified. Theileria annulata-like and Anaplasma marginale-like pathogens were observed in the blood smears stained with Giemsa staining under microscope. Furthermore, 5 out of 7 cattle blood samples were found to be positive for T. annulata by PCR. In the 28 blood specimens, three were positive for T. annulata, while A. marginale DNA was detected in nine blood DNA samples. Besides, 56 ticks feeding on cattle were collected from this farm and were all identified as Rhipisephalus microplus, meanwhile, 10 of them were found to be positive for A. marginale. In addition, phylogenetic analysis of the msp4 gene sequences of A. marginale obtained in this study showed that the isolate from cattle (KX840009) fell in the same clade with that of R. microplus (KX904527), sharing 100% similarity. To the best of our knowledge, this is the first confirmed report of outbreak of theileriosis/anaplasmosis in cattle farms in Henan, China. Copyright © 2017. Published by Elsevier B.V.

  17. [Natural infection by hemoparasites in calves submitted to chemoprophylaxis at 30 days of age].

    Science.gov (United States)

    da Silva, Rosângela A; Corrêa, Fabíola do N; Botteon, Rita de Cássia C M; Botteon, Paulo de Tarso L

    2007-01-01

    The tick-borne disease (TBD) brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%), B. bovis (11.1%) and A. marginale (13.9%). Six animals had clinical symptoms (16.7%) and one dead (2.8%). The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

  18. Identification for automotive systems

    CERN Document Server

    Hjalmarsson, Håkan; Re, Luigi

    2012-01-01

    Increasing complexity and performance and reliability expectations make modeling of automotive system both more difficult and more urgent. Automotive control has slowly evolved from an add-on to classical engine and vehicle design to a key technology to enforce consumption, pollution and safety limits. Modeling, however, is still mainly based on classical methods, even though much progress has been done in the identification community to speed it up and improve it. This book, the product of a workshop of representatives of different communities, offers an insight on how to close the gap and exploit this progress for the next generations of vehicles.

  19. Identification of southern radio sources

    International Nuclear Information System (INIS)

    Savage, A.; Bolton, J.G.; Wright, A.E.

    1976-01-01

    Identifications are suggested for 36 radio sources from the southern zones of the Parkes 2700 MHz survey, 28 with galaxies, six with confirmed and two with suggested quasi-stellar objects. The identifications were made from the ESO quick blue survey plates, the SRC IIIa-J deep survey plates and the Palomar sky survey prints. Accurate optical positions have also been measured for nine of the objects and for five previously suggested identifications. (author)

  20. Patient identification and tube labelling

    DEFF Research Database (Denmark)

    van Dongen-Lases, Edmée C; Cornes, Michael P; Grankvist, Kjell

    2016-01-01

    of phlebotomy procedures with the CLSI H3-A6 guideline was unacceptably low, and that patient identification and tube labelling are amongst the most critical steps in need of immediate attention and improvement. The process of patient identification and tube labelling is an essential safety barrier to prevent...... patient identity mix-up. Therefore, the EFLM Working Group aims to encourage and support worldwide harmonisation of patient identification and tube labelling procedures in order to reduce the risk of preanalytical errors and improve patient safety. With this Position paper we wish to raise awareness...... and provide recommendations for proper patient and sample identification procedures....

  1. Diagnosis of hemoparasitosis trough the spread-smear technique using a drop of blood clot

    Directory of Open Access Journals (Sweden)

    Neusa Saltiél Stobbe

    1992-12-01

    Full Text Available The spread-smear technique using a drop of blood clot and stained by diluted and undimitcd Giemsa stain was evaluated for the search of blood cell types and recognition of Babesia bovis, Babesia bigemina and Anaplasma marginale hemoparasites. The blood clot samples were taken from a 6 month-old calf experimentally inoculated with the blood from a Cattle Tick Fever carrier. The Technique was sumitable for the observation of different blood cells and for the recognition of the hemoparasites.

  2. Channel Identification Machines

    Directory of Open Access Journals (Sweden)

    Aurel A. Lazar

    2012-01-01

    Full Text Available We present a formal methodology for identifying a channel in a system consisting of a communication channel in cascade with an asynchronous sampler. The channel is modeled as a multidimensional filter, while models of asynchronous samplers are taken from neuroscience and communications and include integrate-and-fire neurons, asynchronous sigma/delta modulators and general oscillators in cascade with zero-crossing detectors. We devise channel identification algorithms that recover a projection of the filter(s onto a space of input signals loss-free for both scalar and vector-valued test signals. The test signals are modeled as elements of a reproducing kernel Hilbert space (RKHS with a Dirichlet kernel. Under appropriate limiting conditions on the bandwidth and the order of the test signal space, the filter projection converges to the impulse response of the filter. We show that our results hold for a wide class of RKHSs, including the space of finite-energy bandlimited signals. We also extend our channel identification results to noisy circuits.

  3. Channel identification machines.

    Science.gov (United States)

    Lazar, Aurel A; Slutskiy, Yevgeniy B

    2012-01-01

    We present a formal methodology for identifying a channel in a system consisting of a communication channel in cascade with an asynchronous sampler. The channel is modeled as a multidimensional filter, while models of asynchronous samplers are taken from neuroscience and communications and include integrate-and-fire neurons, asynchronous sigma/delta modulators and general oscillators in cascade with zero-crossing detectors. We devise channel identification algorithms that recover a projection of the filter(s) onto a space of input signals loss-free for both scalar and vector-valued test signals. The test signals are modeled as elements of a reproducing kernel Hilbert space (RKHS) with a Dirichlet kernel. Under appropriate limiting conditions on the bandwidth and the order of the test signal space, the filter projection converges to the impulse response of the filter. We show that our results hold for a wide class of RKHSs, including the space of finite-energy bandlimited signals. We also extend our channel identification results to noisy circuits.

  4. Extremely secure identification documents

    International Nuclear Information System (INIS)

    Tolk, K.M.; Bell, M.

    1997-09-01

    The technology developed in this project uses biometric information printed on the document and public key cryptography to ensure that an adversary cannot issue identification documents to unauthorized individuals or alter existing documents to allow their use by unauthorized individuals. This process can be used to produce many types of identification documents with much higher security than any currently in use. The system is demonstrated using a security badge as an example. This project focused on the technologies requiring development in order to make the approach viable with existing badge printing and laminating technologies. By far the most difficult was the image processing required to verify that the picture on the badge had not been altered. Another area that required considerable work was the high density printed data storage required to get sufficient data on the badge for verification of the picture. The image processing process was successfully tested, and recommendations are included to refine the badge system to ensure high reliability. A two dimensional data array suitable for printing the required data on the badge was proposed, but testing of the readability of the array had to be abandoned due to reallocation of the budgeted funds by the LDRD office

  5. HEMOPARASITOSIS EN GANADERÍA DOBLE PROPÓSITO VENEZOLANA, DIAGNÓSTICO Y CONTROL: UNA REVISIÓN

    Directory of Open Access Journals (Sweden)

    Rita Tamasaukas

    2010-01-01

    Full Text Available Este trabajo de revisión de tesis doctoral incluye resultados de investigaciones realizadas en el periodo 1971 a 2009 sobre cuatro hemoparasitosis causados por protozoarios y rickettsiales en Venezuela y otros países, con énfasis en la infección mixta en rebaños bovinos, y su diagnóstico y control. En Venezuela, las afecciones causadas por agentes hemotrópicos parasitarios están distribuidas en todos los estados del país con vocación ganadera, en especial, en rebaños bovinos y bufalinos. Entre aquellos encontramos a especies del género Anaplasma (Anaplasma marginale, Babesia (Babesia bigemina y B. bovis, y Trypanosoma (Trypanosoma vivax, con una frecuencia endémica y con variaciones estacionales.

  6. Talent identification in Hungary: From identification to investigation

    Directory of Open Access Journals (Sweden)

    Szilvia Péter-Szarka

    2015-03-01

    Full Text Available This article provides an outline of talent identification practices and challenges in Hungary. First, it gives a summary of gifted education in the country; then the general challenges of talent identification are introduced: difficulties of defining talent, talent as potential, environmental factors, the role of perseverance and motivation, and individual variety. Later, recent Hungarian identification practices are shown, followed by a summary and a conclusion about how our identification practice should be developed into an investigation of individual characetristics. We propose stronger focus on the use of cognitive profile tests, investigation of interest-based characteristics, the use of observation and dynamic assessment methods, teacher nomination and emphasizing the need for effort. The focus from identification toward investigation exploring individual needs and characteristics to provide the most appropriate pathway for development in the 21st century seems to be a more effective way of talent support than mere selection.

  7. EDUCATIONAl. RESOURCE IDENTIFICATION IN THE ...

    African Journals Online (AJOL)

    RESOURCE IDENTIFICATION. IN THE ... Identification of educational resources in the local environ- ment is of ... The environment to which a person is exposed and in which, or .... this respect on the re-use of resources - each ele- ment or ...

  8. Tau reconstruction and identification algorithm

    Indian Academy of Sciences (India)

    CMS has developed sophisticated tau identification algorithms for tau hadronic decay modes. Production of tau lepton decaying to hadrons are studied at 7 TeV centre-of-mass energy with 2011 collision data collected by CMS detector and has been used to measure the performance of tau identification algorithms by ...

  9. Identification of platform levels

    DEFF Research Database (Denmark)

    Mortensen, Niels Henrik

    2005-01-01

    reduction, ability to launch a wider product portfolio without increasing resources and reduction of complexity within the whole company. To support the multiple product development process, platform based product development has in many companies such as Philips, VW, Ford etc. proven to be a very effective...... product development in one step and therefore the objective of this paper is to identify levels of platform based product development. The structure of this paper is as follows. First the applied terminology for platforms will be briefly explained and then characteristics between single and multi product...... development will be examined. Based on the identification of the above characteristics five platform levels are described. The research presented in this paper is a result of MSc, Ph.D projects at the Technical University of Denmark and consultancy projects within the organisation of Institute of Product...

  10. Electron identification at CDF

    International Nuclear Information System (INIS)

    Kim, Shinhong

    1990-01-01

    Electron identification at CDF is performed using the information of lateral and longitudinal shower spread, the track-cluster position match and the energy-momentum match. The tracking chamber with a solenoidal magnetic field at CDF is powerful for rejecting the backgrounds such as the π ± - π 0 overlaps, the π 0 /γ conversions and interactive π ± in electromagnetic calorimeter: The energy- momentum match cut can decrease the background due to the π ± - π 0 overlaps for non-isolated electrons with Et above 10 GeV by a factor of 20. The conversion electrons are identified using track information with an efficiency of 80 ± 3%. The charge of electrons from W decay can be determined in the pseudorapidity range of |η| < 1.7 at CDF. The charge determination is useful for background estimation of Drell-Yan physics and heavy flavor physics. 5 refs., 5 figs

  11. Automatic identification in mining

    Energy Technology Data Exchange (ETDEWEB)

    Puckett, D; Patrick, C [Mine Computers and Electronics Inc., Morehead, KY (United States)

    1998-06-01

    The feasibility of monitoring the locations and vital statistics of equipment and personnel in surface and underground mining operations has increased with advancements in radio frequency identification (RFID) technology. This paper addresses the use of RFID technology, which is relatively new to the mining industry, to track surface equipment in mine pits, loading points and processing facilities. Specific applications are discussed, including both simplified and complex truck tracking systems and an automatic pit ticket system. This paper concludes with a discussion of the future possibilities of using RFID technology in mining including monitoring heart and respiration rates, body temperatures and exertion levels; monitoring repetitious movements for the study of work habits; and logging air quality via personnel sensors. 10 refs., 5 figs.

  12. Plutonium waste container identification

    International Nuclear Information System (INIS)

    Schmierer, T.J.

    1979-01-01

    The purpose of this paper is to define the parameters of a method for identifying plutonium waste containers. This information will form the basis for a permanent committee to develop a complete identification program for use throughout the world. Although a large portion of the information will be on handwritten notebooks and may not be as extensive as is desired, it will all be helpful. The final information will be programmed into computer language and be available to all interested parties as well as a central control committee which will have the expertise to provide each government with advice on the packaging, storage, and measurement of the waste for which it is responsible. As time progresses, this central control committee should develop permanent storage sites and establish a system of records which will last for hundreds of years

  13. Advances of operational modal identification

    International Nuclear Information System (INIS)

    Zhang, L.

    2001-01-01

    Operational modal analysis has shown many advantages compared to the traditional one. In this paper, the development of ambient modal identification in time domain is summarized. The mathematical models for modal identification have been presented as unified framework for time domain (TD) System realization algorithms, such as polyrefence (PRCE), extended Ibrahim time domain (EITD) and eigensystem realization algorithm (ERA), etc., and recently developed Stochastic subspace technique (SST). The latest technique named as frequency domain decomposition (FDD) is introduced for operational modal identification, which has many advantages as a frequency domain (FD) technique. Applications of the operational modal analysis in civil and mechanical engineering have shown the success and accuracy of the advanced operational modal identification algorithms- FDD and SST techniques. The major issues of TD and FD operational modal identification are also discussed. (author)

  14. Retrospective study of hemoparasites in cattle in southern Italy by reverse line blot hybridization.

    Science.gov (United States)

    Ceci, Luigi; Iarussi, Fabrizio; Greco, Beatrice; Lacinio, Rosanna; Fornelli, Stefania; Carelli, Grazia

    2014-06-01

    Tick-borne diseases are widespread in tropical and temperate regions and are responsible for important economic losses in those areas. In order to assess the presence and prevalence of various pathogens in southern Italy, we retrospectively analyzed cattle blood samples collected for a previous study in 2000 using reverse line blot (RLB) hybridization. The study had been carried out in three regions of southern Italy on 1,500 randomly selected and apparently healthy adult cattle. RLB showed that 43.7% of the cattle were positive for nine different species of hemoparasites with either a single infection or a mixed infection. Theileria buffeli was the most common species found, being present in 27.3% of the animals, followed by Anaplasma marginale in 18.1%, Anaplasma centrale in 13.8%, Babesia bigemina and Anaplasma bovis in 4.2%, Anaplasma phagocytophilum in 1.7%, Babesia bovis in 1.6%, Babesia major in 0.2% and Babesia divergens in 0.1%. Complete blood counts showed different degrees of anemia in 363 animals (24.2%) and of these, 169 were RLB-positive for at least one pathogen. Among the ticks that were collected from the cattle, the following species were identified: Rhipicephalus bursa, Ixodes ricinus, Hyalomma marginatum, Boophilus annulatus, Dermacentor marginatus and Haemaphysalis (sulcata, parva, inermis and punctata). The results obtained confirmed the spread of endemic tick-borne pathogens in the regions studied.

  15. Personal and interpersonal risk factors in the consumption of illicit drugs by marginal adolescents and young people from juvenile gangs Factores de riesgo personales e interpersonales en el consumo drogas ilícitas en adolescentes y jóvenes marginales de bandas juveniles Fatores de risco pessoais e interpessoais no consumo de drogas ilícitas em adolescentes e jovens marginais de bandos juvenis

    Directory of Open Access Journals (Sweden)

    Francisco Rafael Guzmán Facundo

    2008-06-01

    Full Text Available Marginal populations are groups which are known to present higher risks of drug consumption. It is possible to identify adolescents and young people from juvenile gangs that constitute this group. The purpose of this study was to analyze the effect of personal and interpersonal risk factors of drug consumption in 175 marginal adolescents and young people who belong to juvenile gangs in Mexico. Results showed a significant effect of personal factors on drug use, with an estimated variation of 26.1%. The factors that presented the highest rates were: gender, age and mental problems. The interpersonal factors (relationships with friends who have maladaptive behaviors and inappropriate relationships with parents showed an effect with an estimated variation of 15%. These results will allow for reflection and, in the future, the elaboration of adequate preventive programs aimed at this group of young people.Grupos reconocidos con mayor riesgo para consumir drogas, son los marginales, dentro de estos podemos localizar a los adolescentes y jóvenes de bandas juveniles. El objetivo del estudio fue analizar el efecto de los factores de riesgo personales e interpersonales sobre el consumo de drogas, en 175 adolescentes y jóvenes margínales de bandas juveniles de México. Los resultados mostraron efecto significativo de los factores personales sobre el consumo de drogas, con una varianza explicada del 26.1%, los factores que mostraron una mayor contribución fueron; el sexo, edad y problemas de salud mental. Los factores interpersonales (relación con amigos con conductas mal adaptadas y relación inapropiada con padres mostraron un efecto sobre el consumo de drogas, con una varianza explicada del 15%. Estos resultados posibilitarán la reflexión y en un futuro diseñar programas adecuados dirigidos a la prevención en este grupo de jóvenes.Grupos reconhecidos com maior risco para o consumo de drogas, são os de populações marginais, e, dentro destas

  16. Improved autonomous star identification algorithm

    International Nuclear Information System (INIS)

    Luo Li-Yan; Xu Lu-Ping; Zhang Hua; Sun Jing-Rong

    2015-01-01

    The log–polar transform (LPT) is introduced into the star identification because of its rotation invariance. An improved autonomous star identification algorithm is proposed in this paper to avoid the circular shift of the feature vector and to reduce the time consumed in the star identification algorithm using LPT. In the proposed algorithm, the star pattern of the same navigation star remains unchanged when the stellar image is rotated, which makes it able to reduce the star identification time. The logarithmic values of the plane distances between the navigation and its neighbor stars are adopted to structure the feature vector of the navigation star, which enhances the robustness of star identification. In addition, some efforts are made to make it able to find the identification result with fewer comparisons, instead of searching the whole feature database. The simulation results demonstrate that the proposed algorithm can effectively accelerate the star identification. Moreover, the recognition rate and robustness by the proposed algorithm are better than those by the LPT algorithm and the modified grid algorithm. (paper)

  17. Simultaneous Detection of Bovine Theileria and Babesia Species by Reverse Line Blot Hybridization

    Science.gov (United States)

    Gubbels, J. M.; de Vos, A. P.; van der Weide, M.; Viseras, J.; Schouls, L. M.; de Vries, E.; Jongejan, F.

    1999-01-01

    A reverse line blot (RLB) assay was developed for the identification of cattle carrying different species of Theileria and Babesia simultaneously. We included Theileria annulata, T. parva, T. mutans, T. taurotragi, and T. velifera in the assay, as well as parasites belonging to the T. sergenti-T. buffeli-T. orientalis group. The Babesia species included were Babesia bovis, B. bigemina, and B. divergens. The assay employs one set of primers for specific amplification of the rRNA gene V4 hypervariable regions of all Theileria and Babesia species. PCR products obtained from blood samples were hybridized to a membrane onto which nine species-specific oligonucleotides were covalently linked. Cross-reactions were not observed between any of the tested species. No DNA sequences from Bos taurus or other hemoparasites (Trypanosoma species, Cowdria ruminantium, Anaplasma marginale, and Ehrlichia species) were amplified. The sensitivity of the assay was determined at 0.000001% parasitemia, enabling detection of the carrier state of most parasites. Mixed DNAs from five different parasites were correctly identified. Moreover, blood samples from cattle experimentally infected with two different parasites reacted only with the corresponding species-specific oligonucleotides. Finally, RLB was used to screen blood samples collected from carrier cattle in two regions of Spain. T. annulata, T. orientalis, and B. bigemina were identified in these samples. In conclusion, the RLB is a versatile technique for simultaneous detection of all bovine tick-borne protozoan parasites. We recommend its use for integrated epidemiological monitoring of tick-borne disease, since RLB can also be used for screening ticks and can easily be expanded to include additional hemoparasite species. PMID:10325324

  18. Pescara benchmarks: nonlinear identification

    Science.gov (United States)

    Gandino, E.; Garibaldi, L.; Marchesiello, S.

    2011-07-01

    Recent nonlinear methods are suitable for identifying large systems with lumped nonlinearities, but in practice most structural nonlinearities are distributed and an ideal nonlinear identification method should cater for them as well. In order to extend the current NSI method to be applied also on realistic large engineering structures, a modal counterpart of the method is proposed in this paper. The modal NSI technique is applied on one of the reinforced concrete beams that have been tested in Pescara, under the project titled "Monitoring and diagnostics of railway bridges by means of the analysis of the dynamic response due to train crossing", financed by Italian Ministry of Research. The beam showed a softening nonlinear behaviour, so that the nonlinearity concerning the first mode is characterized and its force contribution is quantified. Moreover, estimates for the modal parameters are obtained and the model is validated by comparing the measured and the reconstructed output. The identified estimates are also used to accurately predict the behaviour of the same beam, when subject to different initial conditions.

  19. Pescara benchmarks: nonlinear identification

    International Nuclear Information System (INIS)

    Gandino, E; Garibaldi, L; Marchesiello, S

    2011-01-01

    Recent nonlinear methods are suitable for identifying large systems with lumped nonlinearities, but in practice most structural nonlinearities are distributed and an ideal nonlinear identification method should cater for them as well. In order to extend the current NSI method to be applied also on realistic large engineering structures, a modal counterpart of the method is proposed in this paper. The modal NSI technique is applied on one of the reinforced concrete beams that have been tested in Pescara, under the project titled M onitoring and diagnostics of railway bridges by means of the analysis of the dynamic response due to train crossing , financed by Italian Ministry of Research. The beam showed a softening nonlinear behaviour, so that the nonlinearity concerning the first mode is characterized and its force contribution is quantified. Moreover, estimates for the modal parameters are obtained and the model is validated by comparing the measured and the reconstructed output. The identified estimates are also used to accurately predict the behaviour of the same beam, when subject to different initial conditions.

  20. Liquid identification by Hilbert spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lyatti, M; Divin, Y; Poppe, U; Urban, K, E-mail: M.Lyatti@fz-juelich.d, E-mail: Y.Divin@fz-juelich.d [Forschungszentrum Juelich, 52425 Juelich (Germany)

    2009-11-15

    Fast and reliable identification of liquids is of great importance in, for example, security, biology and the beverage industry. An unambiguous identification of liquids can be made by electromagnetic measurements of their dielectric functions in the frequency range of their main dispersions, but this frequency range, from a few GHz to a few THz, is not covered by any conventional spectroscopy. We have developed a concept of liquid identification based on our new Hilbert spectroscopy and high- T{sub c} Josephson junctions, which can operate at the intermediate range from microwaves to THz frequencies. A demonstration setup has been developed consisting of a polychromatic radiation source and a compact Hilbert spectrometer integrated in a Stirling cryocooler. Reflection polychromatic spectra of various bottled liquids have been measured at the spectral range of 15-300 GHz with total scanning time down to 0.2 s and identification of liquids has been demonstrated.

  1. Liquid identification by Hilbert spectroscopy

    Science.gov (United States)

    Lyatti, M.; Divin, Y.; Poppe, U.; Urban, K.

    2009-11-01

    Fast and reliable identification of liquids is of great importance in, for example, security, biology and the beverage industry. An unambiguous identification of liquids can be made by electromagnetic measurements of their dielectric functions in the frequency range of their main dispersions, but this frequency range, from a few GHz to a few THz, is not covered by any conventional spectroscopy. We have developed a concept of liquid identification based on our new Hilbert spectroscopy and high- Tc Josephson junctions, which can operate at the intermediate range from microwaves to THz frequencies. A demonstration setup has been developed consisting of a polychromatic radiation source and a compact Hilbert spectrometer integrated in a Stirling cryocooler. Reflection polychromatic spectra of various bottled liquids have been measured at the spectral range of 15-300 GHz with total scanning time down to 0.2 s and identification of liquids has been demonstrated.

  2. Liquid identification by Hilbert spectroscopy

    International Nuclear Information System (INIS)

    Lyatti, M; Divin, Y; Poppe, U; Urban, K

    2009-01-01

    Fast and reliable identification of liquids is of great importance in, for example, security, biology and the beverage industry. An unambiguous identification of liquids can be made by electromagnetic measurements of their dielectric functions in the frequency range of their main dispersions, but this frequency range, from a few GHz to a few THz, is not covered by any conventional spectroscopy. We have developed a concept of liquid identification based on our new Hilbert spectroscopy and high- T c Josephson junctions, which can operate at the intermediate range from microwaves to THz frequencies. A demonstration setup has been developed consisting of a polychromatic radiation source and a compact Hilbert spectrometer integrated in a Stirling cryocooler. Reflection polychromatic spectra of various bottled liquids have been measured at the spectral range of 15-300 GHz with total scanning time down to 0.2 s and identification of liquids has been demonstrated.

  3. System Identification with Quantized Observations

    CERN Document Server

    Wang, Le Yi; Zhang, Jifeng; Zhao, Yanlong

    2010-01-01

    This book presents recently developed methodologies that utilize quantized information in system identification and explores their potential in extending control capabilities for systems with limited sensor information or networked systems. The results of these methodologies can be applied to signal processing and control design of communication and computer networks, sensor networks, mobile agents, coordinated data fusion, remote sensing, telemedicine, and other fields in which noise-corrupted quantized data need to be processed. Providing a comprehensive coverage of quantized identification,

  4. Fingerprints identification of radiotherapy patients

    International Nuclear Information System (INIS)

    Lartigau, E.F.; Forrest, M.; Audebaud, S.; Dewitte, A.; Giscard, S.; Leclercq, B.

    2012-01-01

    The identification of patient plays a key role in the quality and safety of radiotherapy. It does impact on all professional staff and on patients. After the regulatory authority approval (Cnil), a pilot study has been performed on 1901 patients. Acceptance has been very high (> 93%) with a low risk of mis-identification (< 0.1%). The next step will be to implement and test a bimodal system in order to improve registration capacity and sensitivity. (authors)

  5. Musical practices and social identifications

    Directory of Open Access Journals (Sweden)

    Pablo Vila

    2012-12-01

    Full Text Available The article presents a theoretical proposal for the relationship between musical practices and social identifications. Looking to differentiate himself from homological theories on this relationship, Vila proposes that musical practices articulate an identification anchored on the body, through the different alliances we establish between our diverse, fragmented, situational and imaginary narrative identities, and the diverse, fragmented, situational and imaginary narrative identities different musical practices attempt to materialize.

  6. Decision Processes in Eyewitness Identification

    OpenAIRE

    Moreland, Molly Bettis

    2015-01-01

    The dominant theory of decision-making in eyewitness identification, based on a distinction between absolute and relative judgments, assumes that relative judgments (identifying the best match relative to the other lineup members) increases identification errors (Wells, 1984). This distinction also assumes that comparisons among lineup members underlying relative judgments increases errors, as evidenced by the sequential lineup advantage (Lindsay & Wells, 1985). Sequential lineups preclude co...

  7. Selective structural source identification

    Science.gov (United States)

    Totaro, Nicolas

    2018-04-01

    In the field of acoustic source reconstruction, the inverse Patch Transfer Function (iPTF) has been recently proposed and has shown satisfactory results whatever the shape of the vibrating surface and whatever the acoustic environment. These two interesting features are due to the virtual acoustic volume concept underlying the iPTF methods. The aim of the present article is to show how this concept of virtual subsystem can be used in structures to reconstruct the applied force distribution. Some virtual boundary conditions can be applied on a part of the structure, called virtual testing structure, to identify the force distribution applied in that zone regardless of the presence of other sources outside the zone under consideration. In the present article, the applicability of the method is only demonstrated on planar structures. However, the final example show how the method can be applied to a complex shape planar structure with point welded stiffeners even in the tested zone. In that case, if the virtual testing structure includes the stiffeners the identified force distribution only exhibits the positions of external applied forces. If the virtual testing structure does not include the stiffeners, the identified force distribution permits to localize the forces due to the coupling between the structure and the stiffeners through the welded points as well as the ones due to the external forces. This is why this approach is considered here as a selective structural source identification method. It is demonstrated that this approach clearly falls in the same framework as the Force Analysis Technique, the Virtual Fields Method or the 2D spatial Fourier transform. Even if this approach has a lot in common with these latters, it has some interesting particularities like its low sensitivity to measurement noise.

  8. Parental Power and Adolescents' Parental Identification.

    Science.gov (United States)

    Acock, Alan C.; Yang, Wen Shan

    1984-01-01

    Combines McDonald's social power of parental identification with sex-linked models of parental identification to account for the identification of daughters (N=199) and sons (N=147) with their parents. Found that because of a halo effect, a gain in identification with one parent is not at the other parent's expense. (JAC)

  9. Broad-range survey of vector-borne pathogens and tick host identification of Ixodes ricinus from Southern Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Hönig, Václav; Carolan, H. E.; Vavrušková, Zuzana; Massire, C.; Mosel, M.l R.; Crowder, C. D.; Rounds, M. A.; Ecker, D. J.; Růžek, Daniel; Grubhoffer, Libor; Luft, B. J.; Eshoo, M. W.

    2017-01-01

    Roč. 93, č. 11 (2017), č. článku fix129. ISSN 0168-6496 EU Projects: European Commission(XE) 278976 - ANTIGONE Institutional support: RVO:60077344 Keywords : burgdorferi sensu-lato * tick * Ixodes ricinus * pcr-esi/ms * Borrelia * host * Lyme borreliosis * Babesia * Anaplasma * Rickettsia Subject RIV: EE - Microbiology, Virology OBOR OECD: Microbiology Impact factor: 3.720, year: 2016

  10. [Projective identification in human relations].

    Science.gov (United States)

    Göka, Erol; Yüksel, Fatih Volkan; Göral, F Sevinç

    2006-01-01

    Melanie Klein, one of the pioneers of Object Relations Theory, first defined "projective identification", which is regarded as one of the most efficacious psychoanalytic concepts after the discovery of the "unconscious". Examination of the literature on "projective identification" shows that there are various perspectives and theories suggesting different uses of this concept. Some clinicians argue that projective identification is a primitive defense mechanism observed in severe psychopathologies like psychotic disorder and borderline personality disorder, where the intra-psychic structure has been damaged severely. Others suggest it to be an indispensable part of the transference and counter-transference between the therapist and the patient during psychotherapy and it can be used as a treatment material in the therapy by a skillful therapist. The latter group expands the use of the concept through normal daily relationships by stating that projective identification is one type of communication and part of the main human relation mechanism operating in all close relationships. Therefore, they suggest that projective identification has benign forms experienced in human relations as well as malign forms seen in psychopathologies. Thus, discussions about the definition of the concept appear complex. In order to clarify and overcome the complexity of the concept, Melanie Klein's and other most important subsequent approaches are discussed in this review article. Thereby, the article aims to explain its important function in understanding the psychopathologies, psychotherapeutic relationships and different areas of normal human relations.

  11. Talent identification in youth soccer.

    Science.gov (United States)

    Unnithan, Viswanath; White, Jordan; Georgiou, Andreas; Iga, John; Drust, Barry

    2012-01-01

    The purpose of this review article was firstly to evaluate the traditional approach to talent identification in youth soccer and secondly present pilot data on a more holistic method for talent identification. Research evidence exists to suggest that talent identification mechanisms that are predicated upon the physical (anthropometric) attributes of the early maturing individual only serve to identify current performance levels. Greater body mass and stature have both been related to faster ball shooting speed and vertical jump capacity respectively in elite youth soccer players. This approach, however, may prematurely exclude those late maturing individuals. Multiple physiological measures have also been used in an effort to determine key predictors of performance; with agility and sprint times, being identified as variables that could discriminate between elite and sub-elite groups of adolescent soccer players. Successful soccer performance is the product of multiple systems interacting with one another. Consequently, a more holistic approach to talent identification should be considered. Recent work, with elite youth soccer players, has considered whether multiple small-sided games could act as a talent identification tool in this population. The results demonstrated that there was a moderate agreement between the more technically gifted soccer player and success during multiple small-sided games.

  12. Electron identification capabilities of CBM

    Energy Technology Data Exchange (ETDEWEB)

    Lebedev, Semen [GSI, Darmstadt (Germany)]|[JINR, Dubna (Russian Federation)

    2008-07-01

    The Compressed Baryonic Matter (CBM) experiment at the future FAIR facility at Darmstadt will measure dileptons emitted from the hot and dense phase in heavy-ion collisions. In case of an electron measurement, a high purity of identified electrons is required in order to suppress the background. Electron identification in CBM will be performed by a RICH and TRD detectors. In this contribution we will present routines which have been developed for electron identification in CBM. A RICH ring recognition algorithm based on the Hough Transform has been implemented. An ellipse fitting algorithm has been elaborated because most of the CBM RICH rings have elliptic shapes, moreover, it helps to improve ring-track matching and electron identification procedures. An Artificial Neural Network can be used in order to suppress fake rings. The electron identification in RICH is substantially improved by the use of TRD information for which 3 different algorithms are implemented. Results of primary electron identification are presented. All developed algorithms were tested on large statistics of simulated events and are included into the CBM software framework for common use.

  13. Concealed identification symbols and nondestructive determination of the identification symbols

    Science.gov (United States)

    Nance, Thomas A.; Gibbs, Kenneth M.

    2014-09-16

    The concealing of one or more identification symbols into a target object and the subsequent determination or reading of such symbols through non-destructive testing is described. The symbols can be concealed in a manner so that they are not visible to the human eye and/or cannot be readily revealed to the human eye without damage or destruction of the target object. The identification symbols can be determined after concealment by e.g., the compilation of multiple X-ray images. As such, the present invention can also provide e.g., a deterrent to theft and the recovery of lost or stolen objects.

  14. Multiple independent identification decisions: a method of calibrating eyewitness identifications.

    Science.gov (United States)

    Pryke, Sean; Lindsay, R C L; Dysart, Jennifer E; Dupuis, Paul

    2004-02-01

    Two experiments (N = 147 and N = 90) explored the use of multiple independent lineups to identify a target seen live. In Experiment 1, simultaneous face, body, and sequential voice lineups were used. In Experiment 2, sequential face, body, voice, and clothing lineups were used. Both studies demonstrated that multiple identifications (by the same witness) from independent lineups of different features are highly diagnostic of suspect guilt (G. L. Wells & R. C. L. Lindsay, 1980). The number of suspect and foil selections from multiple independent lineups provides a powerful method of calibrating the accuracy of eyewitness identification. Implications for use of current methods are discussed. ((c) 2004 APA, all rights reserved)

  15. Targeting ticks for control of selected hemoparasitic diseases of cattle.

    Science.gov (United States)

    Kocan, K M

    1995-03-01

    Development in and transmission of hemoparasites by tick vectors are phenomena closely synchronized with the tick feeding cycle. In all known life cycles, initial infection of tick tissues occurs in midgut epithelial cells and transmission is effected as ticks feed after parasites have developed and multiplied in salivary glands. Many factors reviewed affect development and transmission of hemoparasites by ticks including age of ticks, artificial temperature, climate and/or season, tick stage or sex, hemoparasite variation, concurrent infection of ticks with other pathogens, host cell susceptibility, transovarial transmission, effect of hemoparasites on tick biology, and the effect of infecting parasitemia level in cattle on infection rates in ticks. Four hemoparasites of cattle, Anaplasma marginale, Cowdria ruminantium, Theileria parva, and Babesia spp., are all dependent on ticks for biological transmission. Babesia is transmitted transovarially whereas the other three are transmitted transstadially. Mechanical transfer of infective blood via fomites and mouthparts of biting arthropods is also a major means of transmission for Anaplasma marginale but not of the others. Potential control methods for hemoparasites that target parasites as they are developing in their respective tick hosts include tick control, vaccines (against ticks and parasites), and drugs (against ticks and parasites). Successful application of control strategies will be dependent upon thorough understanding of parasite developmental cycles, biology of the tick vectors and the immune response of cattle to ticks and to hemoparasites. The most effective control measures will be those that are targeted against both ticks and the hemoparasites they vector.

  16. Basics of identification measurement technology

    Science.gov (United States)

    Klikushin, Yu N.; Kobenko, V. Yu; Stepanov, P. P.

    2018-01-01

    All available algorithms and suitable for pattern recognition do not give 100% guarantee, therefore there is a field of scientific night activity in this direction, studies are relevant. It is proposed to develop existing technologies for pattern recognition in the form of application of identification measurements. The purpose of the study is to identify the possibility of recognizing images using identification measurement technologies. In solving problems of pattern recognition, neural networks and hidden Markov models are mainly used. A fundamentally new approach to the solution of problems of pattern recognition based on the technology of identification signal measurements (IIS) is proposed. The essence of IIS technology is the quantitative evaluation of the shape of images using special tools and algorithms.

  17. Automatic identification of mass spectra

    International Nuclear Information System (INIS)

    Drabloes, F.

    1992-01-01

    Several approaches to preprocessing and comparison of low resolution mass spectra have been evaluated by various test methods related to library search. It is shown that there is a clear correlation between the nature of any contamination of a spectrum, the basic principle of the transformation or distance measure, and the performance of the identification system. The identification of functionality from low resolution spectra has also been evaluated using several classification methods. It is shown that there is an upper limit to the success of this approach, but also that this can be improved significantly by using a very limited amount of additional information. 10 refs

  18. ESR identification of irradiated foodstuffs

    International Nuclear Information System (INIS)

    Raffi, J.

    1993-01-01

    The conditions required to use Electron Spin Resonance (ESR) in identification of irradiated foods is first described. Then we present the results of an intercomparison sponsored by the Community Bureau of Reference involving 22 european laboratories. Qualitative identification of irradiated beef bones, dried grapes and papaya is very easy. Kinetical studies are necessary in case of fish species. Further researches are required in case of pistachio-nuts. Although all laboratories could distinguish between the two dose ranges used in case of meat bones (i.e. 1-3 and 7-10 kGy), there is an overlap of the results from the different laboratories. 2 tabs., 3 figs

  19. Identification of southern radio sources

    International Nuclear Information System (INIS)

    Savage, A.

    1976-01-01

    Identifications are suggested for 32 radio sources from the southern zones of the Parkes 2700 MHz survey, 18 with galaxies, one with a confirmed and 12 with possible quasistellar objects, and one with a supernova remnant in the Large Magellanic Cloud. The identifications were made from the ESO IIa-O quick blue survey plates, the SRC IIIa-J deep survey plates and the Palomar sky survey prints. Accurate optical positions have also been measured for 10 of the objects and for five previously suggested QSOs. (author)

  20. Molecular detection of tick-borne pathogens in cattle from Southwestern Ethiopia.

    Directory of Open Access Journals (Sweden)

    Zerihun Hailemariam

    Full Text Available Tick-borne diseases (TBDs cause significant losses among livestock and impact the livelihoods of resource-poor farming communities worldwide. In Ethiopia, detailed studies on the epidemiology of tick-borne pathogens (TBPs in cattle using sensitive molecular detection methods are scarce. The objective of this study was to determine the prevalence and species composition of bovine TBPs of veterinary significance in local cattle populations. A comprehensive cross-sectional epidemiological study was conducted in cattle populations of Illubabor zone in Southwestern Ethiopia from June to August 2013. For this purpose, blood samples were collected from 392 cattle. A combination of polymerase chain reaction (PCR and a Reverse Line Blot (RLB hybridization assay was employed for the detection of TBPs in these samples. The PCR/RLB results of the 392 blood samples indicated a high overall prevalence of 96.9% for TBPs, including Theileria mutans (66.1%, Theileria orientalis (51.8%, Anaplasma sp. Omatjenne (25.5%, Anaplasma marginale (14.5%, Babesia bigemina (14.0% and Theileria velifera (13.0% and minor occurrences of Ehrlichia ruminantium (0.5% and Ehrlichia minasensis (0.26%. Moreover, three novel Anaplasma genotypes were detected in bovine blood samples. A phylogenetic analysis revealed that they most likely represent three, but at least two, new species. The prevalence of the three novel Anaplasma species, preliminary designated as Anaplasma sp. Hadesa, Anaplasma sp. Saso and Anaplasma sp. Dedessa, was 12.5%, 14.3% and 5.6%, respectively. Overall, a total of 227 cattle (57.9% were found to be co-infected with two or more TBPs simultaneously and 86 different species combinations were observed. The findings show a very high burden of infection of cattle with TBPs in Ethiopia. The high frequency of co-infections suggests that clinical manifestations might be complex. Further research is required to determine the pathogenicity, host cell types and vector of

  1. Group devaluation and group identification

    NARCIS (Netherlands)

    Leach, C.W.; Rodriguez Mosquera, P.M.; Vliek, M.L.W.; Hirt, E.

    2010-01-01

    In three studies, we showed that increased in-group identification after (perceived or actual) group devaluation is an assertion of a (preexisting) positive social identity that counters the negative social identity implied in societal devaluation. Two studies with real-world groups used order

  2. Red Blood Cell Antibody Identification

    Science.gov (United States)

    ... antibodies may or may not be associated with adverse reactions, and identification of the specific type of RBC ... the only things that can cause a transfusion reaction. The recipient's immune ... or to drugs that the donor may have taken. Rarely, antibodies in the plasma ...

  3. Professional Identification for Biomedical Engineers

    Science.gov (United States)

    Long, Francis M.

    1973-01-01

    Discusses four methods of professional identification in biomedical engineering including registration, certification, accreditation, and possible membership qualification of the societies. Indicates that the destiny of the biomedical engineer may be under the control of a new profession, neither the medical nor the engineering. (CC)

  4. Team reasoning and group identification

    NARCIS (Netherlands)

    Hindriks, Frank

    The team reasoning approach explains cooperation in terms of group identification, which in turn is explicated in terms of agency transformation and payoff transformation. Empirical research in social psychology is consistent with the significance of agency and payoff transformation. However, it

  5. Anaplasma phagocytophilum in questing Ixodes ricinus ticks from Romania.

    Science.gov (United States)

    Matei, Ioana Adriana; Kalmár, Zsuzsa; Magdaş, Cristian; Magdaş, Virginia; Toriay, Hortenzia; Dumitrache, Mirabela Oana; Ionică, Angela Monica; D'Amico, Gianluca; Sándor, Attila D; Mărcuţan, Daniel Ioan; Domşa, Cristian; Gherman, Călin Mircea; Mihalca, Andrei Daniel

    2015-04-01

    Granulocytic anaplasmosis is a common vector-borne disease of humans and animals with natural transmission cycle that involves tick vectors, among which Ixodes ricinus is the most important. The present paper reports the prevalence and geographical distribution of A. phagocytophilum in 10,438 questing Ixodes ricinus ticks collected at 113 locations from 40 counties of Romania. The unfed ticks were examined for the presence of A. phagocytophilum by PCR targeting a portion of ankA gene. The overall prevalence of infection was 3.42%, with local prevalences ranging between 0.29% and 22.45%, with an average prevalence of 5.39% in the infected localities. The infection with A. phagocytophilum was detected in 72 out of 113 localities and in 34 out of 40 counties. The highest prevalence was recorded in females followed by males and nymphs. The results and the distribution model have shown a large distribution of A. phagocytophilum, covering Romania's entire territory. This study is the first large scale survey of the presence of A. phagocytophilum in questing I. ricinus ticks from Romania. Copyright © 2015 Elsevier GmbH. All rights reserved.

  6. System parameter identification information criteria and algorithms

    CERN Document Server

    Chen, Badong; Hu, Jinchun; Principe, Jose C

    2013-01-01

    Recently, criterion functions based on information theoretic measures (entropy, mutual information, information divergence) have attracted attention and become an emerging area of study in signal processing and system identification domain. This book presents a systematic framework for system identification and information processing, investigating system identification from an information theory point of view. The book is divided into six chapters, which cover the information needed to understand the theory and application of system parameter identification. The authors' research pr

  7. Genetic Diversity of Tick-Borne Rickettsial Pathogens; Insights Gained from Distant Strains

    Directory of Open Access Journals (Sweden)

    Sebastián Aguilar Pierlé

    2014-01-01

    Full Text Available The ability to capture genetic variation with unprecedented resolution improves our understanding of bacterial populations and their ability to cause disease. The goal of the pathogenomics era is to define genetic diversity that results in disease. Despite the economic losses caused by vector-borne bacteria in the Order Rickettsiales, little is known about the genetic variants responsible for observed phenotypes. The tick-transmitted rickettsial pathogen Anaplasma marginale infects cattle in tropical and subtropical regions worldwide, including Australia. Genomic analysis of North American A. marginale strains reveals a closed core genome defined by high levels of Single Nucleotide Polymorphisms (SNPs. Here we report the first genome sequences and comparative analysis for Australian strains that differ in virulence and transmissibility. A list of genetic differences that segregate with phenotype was evaluated for the ability to distinguish the attenuated strain from virulent field strains. Phylogenetic analyses of the Australian strains revealed a marked evolutionary distance from all previously sequenced strains. SNP analysis showed a strikingly reduced genetic diversity between these strains, with the smallest number of SNPs detected between any two A. marginale strains. The low diversity between these phenotypically distinct bacteria presents a unique opportunity to identify the genetic determinants of virulence and transmission.

  8. 75 FR 10414 - Researcher Identification Card

    Science.gov (United States)

    2010-03-08

    ... capturing administrative information on the characteristics of our users. Other forms of identification are... use bar-codes on researcher identification cards in the Washington, DC, area. The plastic cards we... plastic researcher identification cards as part of their security systems, we issue a plastic card to...

  9. Teaching Bird Identification & Vocabulary with Twitter

    Science.gov (United States)

    Hallman, Tyler A.; Robinson, W. Douglas

    2015-01-01

    Species identification is essential to biology, conservation, and management. The ability to focus on specific diagnostic characteristics of a species helps improve the speed and accuracy of identification. Birds are excellent subjects for teaching species identification because, in combination with their different shapes and sizes, their plumages…

  10. An identification procedure for foodborne microbial hazards.

    NARCIS (Netherlands)

    Gerwen, van S.J.C.; Wit, de J.C.; Notermans, S.; Zwietering, M.H.

    1997-01-01

    A stepwise and interactive identification procedure for foodborne microbial hazards has been developed in which use is made of several levels of detail ranging from rough hazard identification to comprehensive hazard identification. This approach allows one to tackle the most obvious hazards first,

  11. 21 CFR 820.60 - Identification.

    Science.gov (United States)

    2010-04-01

    ... 21 Food and Drugs 8 2010-04-01 2010-04-01 false Identification. 820.60 Section 820.60 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) MEDICAL DEVICES QUALITY SYSTEM REGULATION Identification and Traceability § 820.60 Identification. Each manufacturer shall...

  12. Franjas marginales de Brassica campestris L. (nabo) en cultivo de repollo. Efecto sobre pulgones y sus parasitoides: Título abreviado: Franjas marginales de Brassica campestris L. ....

    OpenAIRE

    Curis, M. C; Saravia Steudtner, F; Favaro, J. C; Sánchez, D; Bertolaccini, I

    2014-01-01

    La diversidad vegetal en los agroecosistemas afecta la dinámica poblacional de las plagas y de sus enemigos naturales, siendo una alternativa de control el uso de franjas trampa en algunos cultivos. El objetivo del trabajo fue determinar como una franja marginal de Brassicas campestris L. (Brassicales, Brassicaceae), afecta a la población de los pulgones de B. oleracea var. capitata y de sus parasitoides. El estudio se llevó a cabo en Santa Fe, a partir de febrero de 2012. Se estableció en un...

  13. Identification of Potential Hazard using Hazard Identification and Risk Assessment

    Science.gov (United States)

    Sari, R. M.; Syahputri, K.; Rizkya, I.; Siregar, I.

    2017-03-01

    This research was conducted in the paper production’s company. These Paper products will be used as a cigarette paper. Along in the production’s process, Company provides the machines and equipment that operated by workers. During the operations, all workers may potentially injured. It known as a potential hazard. Hazard identification and risk assessment is one part of a safety and health program in the stage of risk management. This is very important as part of efforts to prevent occupational injuries and diseases resulting from work. This research is experiencing a problem that is not the identification of potential hazards and risks that would be faced by workers during the running production process. The purpose of this study was to identify the potential hazards by using hazard identification and risk assessment methods. Risk assessment is done using severity criteria and the probability of an accident. According to the research there are 23 potential hazard that occurs with varying severity and probability. Then made the determination Risk Assessment Code (RAC) for each potential hazard, and gained 3 extreme risks, 10 high risks, 6 medium risks and 3 low risks. We have successfully identified potential hazard using RAC.

  14. Individual identification via electrocardiogram analysis.

    Science.gov (United States)

    Fratini, Antonio; Sansone, Mario; Bifulco, Paolo; Cesarelli, Mario

    2015-08-14

    During last decade the use of ECG recordings in biometric recognition studies has increased. ECG characteristics made it suitable for subject identification: it is unique, present in all living individuals, and hard to forge. However, in spite of the great number of approaches found in literature, no agreement exists on the most appropriate methodology. This study aimed at providing a survey of the techniques used so far in ECG-based human identification. Specifically, a pattern recognition perspective is here proposed providing a unifying framework to appreciate previous studies and, hopefully, guide future research. We searched for papers on the subject from the earliest available date using relevant electronic databases (Medline, IEEEXplore, Scopus, and Web of Knowledge). The following terms were used in different combinations: electrocardiogram, ECG, human identification, biometric, authentication and individual variability. The electronic sources were last searched on 1st March 2015. In our selection we included published research on peer-reviewed journals, books chapters and conferences proceedings. The search was performed for English language documents. 100 pertinent papers were found. Number of subjects involved in the journal studies ranges from 10 to 502, age from 16 to 86, male and female subjects are generally present. Number of analysed leads varies as well as the recording conditions. Identification performance differs widely as well as verification rate. Many studies refer to publicly available databases (Physionet ECG databases repository) while others rely on proprietary recordings making difficult them to compare. As a measure of overall accuracy we computed a weighted average of the identification rate and equal error rate in authentication scenarios. Identification rate resulted equal to 94.95 % while the equal error rate equal to 0.92 %. Biometric recognition is a mature field of research. Nevertheless, the use of physiological signals

  15. Bovine anaplasmosis with emphasis on immune responses and protection

    International Nuclear Information System (INIS)

    Ristic, M.

    1980-01-01

    Anaplasmosis is an infectious and transmissible disease manifested by progressive anaemia and the appearance of other characteristic disease symptoms. It is a world-wide tick-borne disease of cattle and some wild ruminants caused by the rickettsia Anaplasma marginale. By drawing on information obtained from studies of plasmodial cell cultures, a method has recently been developed for short-term in vitro cultivation of A. marginale. An attenuated Anaplasma organism capable of growth in both ovine and bovine erythrocytes was used to demonstrate that the in vitro system provided the necessary requirements for active transfer of the organism from cell to cell. Organismal antigens are found in the erythrocytes of infected animals, whereas soluble antigens are derived from their erythrocytes and serum. Serums from convalescing animals interact with these antigens in agglutination, complement fixation, fluorescent antibody and precipitation tests. Passive transfer of sera from immune to susceptible cattle, however, does not seem to confer protection against the infection and development of the disease. Studies that employed various tests for measuring cell-mediated immune (CMI) responses (leukocyte migration inhibition, blast transformation and cytotoxicity), in association with information collected simultaneously on antibody activity, have shown that both humoral and cellular immune responses are needed for the development of protective immunity in anaplasmosis. It was further shown that an active replication of Anaplasma is essential for induction of these two types of immune responses. Consequently, live virulent and attenuated immunogens fulfil requirements for induction of protective immunity. With the virulent agent, however, development of protective immunity is preceded by induction of auto-immune responses apparently associated with pathogenesis of anaemia in anaplasmosis. Inactivated immunogens derived from blood of infected cattle and used in combination with

  16. Neutral particles identification at LHCb

    CERN Multimedia

    Quintana, Boris Julien

    2018-01-01

    Important analyses of the core LHCb physics program rely on calorimetry to identify photons, high-energy neutral pions and electrons. For this purpose, the LHCb calorimeter system is composed of a scintillating pad plane, a preshower detector, an electromagnetic and a hadronic sampling calorimeters. The interaction of a given particle in these detectors leaves a specific signature. This is exploited for particle identification (PID) by combining calorimeters and tracking information into multi-variate classifiers. In this contribution, we focus on the identification of photons against high-energy neutral pion and hadronic backgrounds. Performance on Run 1 data will be shown. Small discrepancies with simulation predictions are then discussed, with special emphasis on the methods to correctly estimate PID cut efficiencies by means of large calibration samples of abundant beauty and charm decays to final states with photons. Finally, the technical aspects of the collection of these samples in Run 2 are presented...

  17. A bimodal biometric identification system

    Science.gov (United States)

    Laghari, Mohammad S.; Khuwaja, Gulzar A.

    2013-03-01

    Biometrics consists of methods for uniquely recognizing humans based upon one or more intrinsic physical or behavioral traits. Physicals are related to the shape of the body. Behavioral are related to the behavior of a person. However, biometric authentication systems suffer from imprecision and difficulty in person recognition due to a number of reasons and no single biometrics is expected to effectively satisfy the requirements of all verification and/or identification applications. Bimodal biometric systems are expected to be more reliable due to the presence of two pieces of evidence and also be able to meet the severe performance requirements imposed by various applications. This paper presents a neural network based bimodal biometric identification system by using human face and handwritten signature features.

  18. Identification methods of irradiated food

    International Nuclear Information System (INIS)

    Raffi, J.J.

    1991-01-01

    After a general review of the different possible methods, the stress is put upon the ones close to application: electron spin resonance, thermoluminescence and method of lipids. The problem of the specificity of each method is discussed (proof or presumption): they are then placed in the context of the programme of identification of irradiated foods just co-organized by the author with the Community Bureau of Reference (CEC) [fr

  19. PARAMETER IDENTIFICATION AND STOCHASTIC CONTROL ...

    African Journals Online (AJOL)

    parameta identification examples treated in PART I. OPTIMAL PREDICTION. As aJ.ady discussed in PART I, a discrete linear system cm be modeled by the polynomial. A(z-1)y., = z°""B(z-1)ut + C(z-1)wt (15) where Yt is the output seq~. u the control. ""'l'mcc. IOl:l ~a 2m>-lDC8ll white process noise with variance q. dis the ...

  20. News about ionized food identification

    International Nuclear Information System (INIS)

    Raffi, J.

    1995-01-01

    The ionizing radiations are used to clean food and increase their preservation life. If a lot of countries permits ionized products commercialization, others are opposed to it. To control the commercial exchanges, check the applied treatment aim and give to the consumers a better information, several ionized food identification methods were perfected and several are about to be recognized as european standards. 4 refs. 3 figs, 1 tab

  1. Star identification methods, techniques and algorithms

    CERN Document Server

    Zhang, Guangjun

    2017-01-01

    This book summarizes the research advances in star identification that the author’s team has made over the past 10 years, systematically introducing the principles of star identification, general methods, key techniques and practicable algorithms. It also offers examples of hardware implementation and performance evaluation for the star identification algorithms. Star identification is the key step for celestial navigation and greatly improves the performance of star sensors, and as such the book include the fundamentals of star sensors and celestial navigation, the processing of the star catalog and star images, star identification using modified triangle algorithms, star identification using star patterns and using neural networks, rapid star tracking using star matching between adjacent frames, as well as implementation hardware and using performance tests for star identification. It is not only valuable as a reference book for star sensor designers and researchers working in pattern recognition and othe...

  2. Expert software for accident identification

    International Nuclear Information System (INIS)

    Dobnikar, M.; Nemec, T.; Muehleisen, A.

    2003-01-01

    Each type of an accident in a Nuclear Power Plant (NPP) causes immediately after the start of the accident variations of physical parameters that are typical for that type of the accident thus enabling its identification. Examples of these parameter are: decrease of reactor coolant system pressure, increase of radiation level in the containment, increase of pressure in the containment. An expert software enabling a fast preliminary identification of the type of the accident in Krsko NPP has been developed. As input data selected typical parameters from Emergency Response Data System (ERDS) of the Krsko NPP are used. Based on these parameters the expert software identifies the type of the accident and also provides the user with appropriate references (past analyses and other documentation of such an accident). The expert software is to be used as a support tool by an expert team that forms in case of an emergency at Slovenian Nuclear Safety Administration (SNSA) with the task to determine the cause of the accident, its most probable scenario and the source term. The expert software should provide initial identification of the event, while the final one is still to be made after appropriate assessment of the event by the expert group considering possibility of non-typical events, multiple causes, initial conditions, influences of operators' actions etc. The expert software can be also used as an educational/training tool and even as a simple database of available accident analyses. (author)

  3. Identification of computer graphics objects

    Directory of Open Access Journals (Sweden)

    Rossinskyi Yu.M.

    2016-04-01

    Full Text Available The article is devoted to the use of computer graphics methods in problems of creating drawings, charts, drafting, etc. The widespread use of these methods requires the development of efficient algorithms for the identification of objects of drawings. The article analyzes the model-making algorithms for this problem and considered the possibility of reducing the time using graphics editing operations. Editing results in such operations as copying, moving and deleting objects specified images. These operations allow the use of a reliable identification of images of objects methods. For information on the composition of the image of the object along with information about the identity and the color should include information about the spatial location and other characteristics of the object (the thickness and style of contour lines, fill style, and so on. In order to enable the pixel image analysis to structure the information it is necessary to enable the initial code image objects color. The article shows the results of the implementation of the algorithm of encoding object identifiers. To simplify the process of building drawings of any kind, and reduce time-consuming, method of drawing objects identification is proposed based on the use as the ID information of the object color.

  4. Library correlation nuclide identification algorithm

    International Nuclear Information System (INIS)

    Russ, William R.

    2007-01-01

    A novel nuclide identification algorithm, Library Correlation Nuclide Identification (LibCorNID), is proposed. In addition to the spectrum, LibCorNID requires the standard energy, peak shape and peak efficiency calibrations. Input parameters include tolerances for some expected variations in the calibrations, a minimum relative nuclide peak area threshold, and a correlation threshold. Initially, the measured peak spectrum is obtained as the residual after baseline estimation via peak erosion, removing the continuum. Library nuclides are filtered by examining the possible nuclide peak areas in terms of the measured peak spectrum and applying the specified relative area threshold. Remaining candidates are used to create a set of theoretical peak spectra based on the calibrations and library entries. These candidate spectra are then simultaneously fit to the measured peak spectrum while also optimizing the calibrations within the bounds of the specified tolerances. Each candidate with optimized area still exceeding the area threshold undergoes a correlation test. The normalized Pearson's correlation value is calculated as a comparison of the optimized nuclide peak spectrum to the measured peak spectrum with the other optimized peak spectra subtracted. Those candidates with correlation values that exceed the specified threshold are identified and their optimized activities are output. An evaluation of LibCorNID was conducted to verify identification performance in terms of detection probability and false alarm rate. LibCorNID has been shown to perform well compared to standard peak-based analyses

  5. Printed Identification Key or Web-Based Identification Guide: An Effective Tool for Species Identification?

    Directory of Open Access Journals (Sweden)

    Thomas Edison E. dela Cruz

    2012-09-01

    Full Text Available Species identification is often done with the aid of traditional dichotomous keys. This printed material is based on one’s decision between two alternatives, which is followed by another pair of alternatives until the final species name is reached. With the advent of internet technology, the use of an online database offers an updatable and accumulative approach to species identification. It can also be accessed anytime, and this is very useful for fast-changing groups of organisms. In this paper, we report the preference of sophomore Bachelor of Science (B.Sc. in Microbiology students to two identification guides as a tool in taxonomy. We wish to test our hypothesis that today’s students will prefer to use web-based ID guides over printed dichotomous keys. We also describe how these printed dichotomous key and web-based ID guides were used by the students as one of their laboratory activities in the course Biology of Algae and Fungi.  

  6. [A accurate identification method for Chinese materia medica--systematic identification of Chinese materia medica].

    Science.gov (United States)

    Wang, Xue-Yong; Liao, Cai-Li; Liu, Si-Qi; Liu, Chun-Sheng; Shao, Ai-Juan; Huang, Lu-Qi

    2013-05-01

    This paper put forward a more accurate identification method for identification of Chinese materia medica (CMM), the systematic identification of Chinese materia medica (SICMM) , which might solve difficulties in CMM identification used the ordinary traditional ways. Concepts, mechanisms and methods of SICMM were systematically introduced and possibility was proved by experiments. The establishment of SICMM will solve problems in identification of Chinese materia medica not only in phenotypic characters like the mnorphous, microstructure, chemical constituents, but also further discovery evolution and classification of species, subspecies and population in medical plants. The establishment of SICMM will improve the development of identification of CMM and create a more extensive study space.

  7. Pride, Shame and Group Identification

    Directory of Open Access Journals (Sweden)

    Alessandro eSalice

    2016-04-01

    Full Text Available Self-conscious emotions such as shame and pride are emotions that typically focus on the self of the person who feels them. In other words, the intentional object of these emotions is assumed to be the subject that experiences them. Many reasons speak in its favor and yet this account seems to leave a question open: how to cash out those cases in which one genuinely feels ashamed or proud of what someone else does?This paper contends that such cases do not necessarily challenge the idea that shame and pride are about the emoting subject. Rather, we claim that some of the most paradigmatic scenarios of shame and pride induced by others can be accommodated by taking seriously the consideration that, in such cases, the subject group-identifies with the other. This is the idea that, in feeling these forms of shame or pride, the subject is conceiving of herself as a member of the same group as the subject acting shamefully or in an admirable way. In other words, these peculiar emotive responses are elicited in the subject insofar as, and to the extent that, she is (or sees herself as being a member of a group – the group to which those who act shamefully or admirably also belong.By looking into the way in which the notion of group identification can allow for an account of hetero-induced shame and pride, this paper attempts to achieve a sort of mutual enlightenment that brings to light not only an important and generally neglected form of self-conscious emotions, but also relevant features of group identification. In particular, it generates evidence for the idea that group identification is a psychological process that the subject does not have to carry out intentionally in the sense that it is not necessarily triggered by the subject’s conative states like desires or intentions.

  8. Pride, Shame, and Group Identification.

    Science.gov (United States)

    Salice, Alessandro; Montes Sánchez, Alba

    2016-01-01

    Self-conscious emotions such as shame and pride are emotions that typically focus on the self of the person who feels them. In other words, the intentional object of these emotions is assumed to be the subject that experiences them. Many reasons speak in its favor and yet this account seems to leave a question open: how to cash out those cases in which one genuinely feels ashamed or proud of what someone else does? This paper contends that such cases do not necessarily challenge the idea that shame and pride are about the emoting subject. Rather, we claim that some of the most paradigmatic scenarios of shame and pride induced by others can be accommodated by taking seriously the consideration that, in such cases, the subject "group-identifies" with the other. This is the idea that, in feeling these forms of shame or pride, the subject is conceiving of herself as a member of the same group as the subject acting shamefully or in an admirable way. In other words, these peculiar emotive responses are elicited in the subject insofar as, and to the extent that, she is (or sees herself as being) a member of a group - the group to which those who act shamefully or admirably also belong. By looking into the way in which the notion of group identification can allow for an account of hetero-induced shame and pride, this paper attempts to achieve a sort of mutual enlightenment that brings to light not only an important and generally neglected form of self-conscious emotions, but also relevant features of group identification. In particular, it generates evidence for the idea that group identification is a psychological process that the subject does not have to carry out intentionally in the sense that it is not necessarily triggered by the subject's conative states like desires or intentions.

  9. Antipatterns identification, refactoring, and management

    CERN Document Server

    Neill, Colin J

    2005-01-01

    AntiPatterns: Identification, Refactoring, and Management catalogs 48 bad management practices and environments common to software development, IT, and other organizations. The authors cover antipatterns of management, along with environmental/cultural antipatterns and personality antipatterns/phenotypes. Through the classification of these harmful practices, you will be able to correctly identify problems in your own work environment, and take action to correct them. The authors apply their extensive work and consultative experience, as well as the experience of the many professionals that t

  10. The BESIII muon identification system

    International Nuclear Information System (INIS)

    Zhang Jiawen; Qian Sen; Chen Jin; Du Zhizhen; Han Jifeng; Li Rubo; Liu Jichen; Liang Hao; Mao, Yajun; Ma Liehua; Wang Yifang; Xie Yigang; Xie Yuguang; Zhang Qingmin; Zhao Jianbing; Zhao, T.; Zhou, Yongzhao

    2010-01-01

    The muon identification system of BESIII experiment at the IHEP is described. The muon counter (MUC) is composed of resistive plate chambers (RPCs) working in self-quenching streamer mode with the gas mixture Ar/C 2 F 4 H 2 /C 4 H 10 =50/42/8. The design, the construction, the mass production and the quality control result of the detectors are described in detail. The paper also presents the performance of the bare RPCs and the superlayer modules with cosmic rays. Finally, the subsystems of MUC, including the RPC superlayer modules, the gas systems, the HV and LV system and the readout electronic system, are also presented.

  11. The identification of critical groups

    International Nuclear Information System (INIS)

    Hunt, G.J.; Shepherd, J.G.

    1980-01-01

    The criteria for critical group identification are summarized and the extent to which they are satisfied by possible numerical methods are examined, drawing on UK experience in dose estimation within a system for setting controls on liquid radioactive waste discharges from major nuclear installations. The nature of the exposure pathway is an important factor in identifying an appropriate method. It is held that there is a greater uncertainty in estimating individual exposure from internal exposure than that from external exposure due to the greater relevance of metabolic variations. Accordingly different methods are proposed for numerical treatment of data associated with internal exposure pathways compared with external exposure pathways. (H.K.)

  12. The CPLEAR particle identification detector

    International Nuclear Information System (INIS)

    Angelopoulos, A.; Apostolakis, A.; Rozaki, E.; Sakeliou, L.; Backenstoss, G.; Kuzminski, J.; Rickenbach, R.; Wildi, M.; Carlson, P.; Francis, D.; Jansson, K.; Jon-And, K.; Kerek, A.; Szilagyi, S.; Carvalho, J.; Cobbaert, H.; Ferreira-Marques, R.; Machado, E.; Onofre, A.; Pinto da Cunha, J.; Policarpo, A.; Charalambous, S.; Chardalas, M.; Dedoussis, S.; Touramanis, C.; Fassnacht, P.; Pelucchi, F.; Fetcher, W.; Gerber, H.J.; Fuglesang, C.; Kesseler, G.; Montanet, F.; Go, A.; Lawry, T.; Miller, J.; Roberts, B.L.; Varner, G.; Warner, D.; Zimmerman, D.; Kokkas, P.; Pavlopoulos, P.; Sarigiannis, K.; Triantis, F.

    1992-01-01

    The CPLEAR experiment will measure CP violation parameters in the neutral kaon system, using a low energy antiproton beam from the Low Energy Antiproton Ring (LEAR) at CERN. One of its subdetectors, the Particle Identification Detector (PID), makes a fast separation of pions and kaons, which is essential for the experiment. This article describes the design of the PID and its performance during beam tests and during initial runs at LEAR. A pion rejection efficiency of 99.7% for the first level trigger (after 60 ns) is found in the relevant momentum region. (orig.)

  13. Public Anxieties and Projective Identification

    DEFF Research Database (Denmark)

    Steffen, Vibeke

    2016-01-01

    The capacity to receive occult messages and look into the future is claimed by individuals in most societies and probably always has been. In Denmark, clairvoyance is a popular service offered at the alternative market for counseling and healing. During my fieldwork among Danish spiritualist...... what to whom. Drawing on Jung's concept of the wounded healer to highlight the clairvoyant's role as a channel for societal anxieties and Melanie Klein's concept of projective identification as a framework for understanding the defense mechanisms at stake in object relations, I argue...

  14. Identification of petroleum pollution sources

    International Nuclear Information System (INIS)

    Begak, O.Yu.; Syroezhko, A.M.

    2001-01-01

    A possibility of preliminary identification of petroleum pollution sources was investigated on specimens of the Khanty-Mansi autonomous district six deposits and specimens of soil and water polluted by these petroleums. Investigations were conducted using IR Fourier spectroscopy and gamma spectrometry, as well as methods of chromato-mass spectrometry and capillary gas liquid chromatography. Every of studied samples of petroleum from different deposits have an individual radiation impression. Insignificant total content of radionuclides in samples is specific to the Khanty-Mansi petroleum region. Gamma spectrometry admits to identify potential source of petroleum pollution using radionuclides of uranium and thorium series [ru

  15. Facial image identification using Photomodeler

    DEFF Research Database (Denmark)

    Lynnerup, Niels; Andersen, Marie; Lauritsen, Helle Petri

    2003-01-01

    consist of many images of the same person taken from different angles. We wanted to see if it was possible to combine such a suite of images in useful 3-D renderings of facial proportions.Fifteen male adults were photographed from four different angles. Based on these photographs, a 3-D wireframe model......We present the results of a preliminary study on the use of 3-D software (Photomodeler) for identification purposes. Perpetrators may be photographed or filmed by surveillance systems. The police may wish to have these images compared to photographs of suspects. The surveillance imagery will often...

  16. The CPLEAR particle identification detector

    Energy Technology Data Exchange (ETDEWEB)

    Angelopoulos, A.; Apostolakis, A.; Rozaki, E.; Sakeliou, L. (Univ. Athens (Greece)); Backenstoss, G.; Kuzminski, J.; Rickenbach, R.; Wildi, M. (Univ. Basel (Switzerland)); Carlson, P.; Francis, D.; Jansson, K.; Jon-And, K.; Kerek, A.; Szilagyi, S. (Manne Siegbahn Inst. Stockholm (Sweden)); Carvalho, J.; Cobbaert, H.; Ferreira-Marques, R.; Machado, E.; Onofre, A.; Pinto da Cunha, J.; Policarpo, A. (Univ. Coimbra, LIP (Portugal) Technical Univ., Delft (Netherlands)); Charalambous, S.; Chardalas, M.; Dedoussis, S.; Touramanis, C. (Univ. Thessaloniki (Greece)); Fassnacht, P.; Pelucchi, F. (CPPM, Marseille (France) CSNSM, Orsay (France) P. Scherrer Inst., Villingen (Switzerland) DPhPe, CEN-Saclay, 91 - Gif-sur-Yvette (France)); Fetcher, W.; Gerber, H.J. (Inst. fuer Mittelenergiephysik, ETH Villingen (Switzerland)); Fuglesang, C.; Kesseler, G.; Montanet, F. (CERN, Geneva (Switzerland)); Go, A.; Lawry, T.; Miller, J.; Roberts, B.L.; Varner, G.; Warner, D.; Zimmerman, D. (Univ. Boston,; CPLEAR Collaboration

    1992-01-01

    The CPLEAR experiment will measure CP violation parameters in the neutral kaon system, using a low energy antiproton beam from the Low Energy Antiproton Ring (LEAR) at CERN. One of its subdetectors, the Particle Identification Detector (PID), makes a fast separation of pions and kaons, which is essential for the experiment. This article describes the design of the PID and its performance during beam tests and during initial runs at LEAR. A pion rejection efficiency of 99.7% for the first level trigger (after 60 ns) is found in the relevant momentum region. (orig.).

  17. Comparative genomics and transcriptomics of trait-gene association

    Directory of Open Access Journals (Sweden)

    Pierlé Sebastián

    2012-11-01

    Full Text Available Abstract Background The Order Rickettsiales includes important tick-borne pathogens, from Rickettsia rickettsii, which causes Rocky Mountain spotted fever, to Anaplasma marginale, the most prevalent vector-borne pathogen of cattle. Although most pathogens in this Order are transmitted by arthropod vectors, little is known about the microbial determinants of transmission. A. marginale provides unique tools for studying the determinants of transmission, with multiple strain sequences available that display distinct and reproducible transmission phenotypes. The closed core A. marginale genome suggests that any phenotypic differences are due to single nucleotide polymorphisms (SNPs. We combined DNA/RNA comparative genomic approaches using strains with different tick transmission phenotypes and identified genes that segregate with transmissibility. Results Comparison of seven strains with different transmission phenotypes generated a list of SNPs affecting 18 genes and nine promoters. Transcriptional analysis found two candidate genes downstream from promoter SNPs that were differentially transcribed. To corroborate the comparative genomics approach we used three RNA-seq platforms to analyze the transcriptomes from two A. marginale strains with different transmission phenotypes. RNA-seq analysis confirmed the comparative genomics data and found 10 additional genes whose transcription between strains with distinct transmission efficiencies was significantly different. Six regions of the genome that contained no annotation were found to be transcriptionally active, and two of these newly identified transcripts were differentially transcribed. Conclusions This approach identified 30 genes and two novel transcripts potentially involved in tick transmission. We describe the transcriptome of an obligate intracellular bacterium in depth, while employing massive parallel sequencing to dissect an important trait in bacterial pathogenesis.

  18. Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

    Science.gov (United States)

    Beckley, Carl S; Shaban, Salisu; Palmer, Guy H; Hudak, Andrew T; Noh, Susan M; Futse, James E

    2016-01-01

    Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc) were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B. bigemina prevalence

  19. Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

    Directory of Open Access Journals (Sweden)

    Carl S Beckley

    Full Text Available Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B

  20. Mastering system identification in 100 exercises

    CERN Document Server

    Schoukens, J; Rolain, Yves

    2012-01-01

    "This book enables readers to understand system identification and linear system modeling through 100 practical exercises without requiring complex theoretical knowledge. The contents encompass state-of-the-art system identification methods, with both time and frequency domain system identification methods covered, including the pros and cons of each. Each chapter features MATLAB exercises, discussions of the exercises, accompanying MATLAB downloads, and larger projects that serve as potential assignments in this learn-by-doing resource"--

  1. Quantile driven identification of structural derivatives

    OpenAIRE

    Andrew Chesher

    2001-01-01

    Conditions are derived under which there is local nonparametric identification of derivatives of structural equations in nonlinear triangular simultaneous equations systems. The attack on this problem is via conditional quantile functions and exploits local quantile independence conditions. The identification conditions include local analogues of the order and rank conditions familiar in the analysis of linear simultaneous equations models. The objects whose identification is sought are deriv...

  2. Unique Physician Identification Number (UPIN) Directory

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Unique Physician Identification Number (UPIN) Directory contains selected information on physicians, doctors of Osteopathy, limited licensed practitioners and...

  3. Trends and progress in system identification

    CERN Document Server

    Eykhoff, Pieter

    1981-01-01

    Trends and Progress in System Identification is a three-part book that focuses on model considerations, identification methods, and experimental conditions involved in system identification. Organized into 10 chapters, this book begins with a discussion of model method in system identification, citing four examples differing on the nature of the models involved, the nature of the fields, and their goals. Subsequent chapters describe the most important aspects of model theory; the """"classical"""" methods and time series estimation; application of least squares and related techniques for the e

  4. Identification and authentication. Common biometric methods review

    OpenAIRE

    Lysak, A.

    2012-01-01

    Major biometric methods used for identification and authentication purposes in modern computing systems are considered in the article. Basic classification, application areas and key differences are given.

  5. Fieldable Nuclear Material Identification System

    International Nuclear Information System (INIS)

    Radle, James E.; Archer, Daniel E.; Carter, Robert J.; Mullens, James Allen; Mihalczo, John T.; Britton, Charles L. Jr.; Lind, Randall F.; Wright, Michael C.

    2010-01-01

    The Fieldable Nuclear Material Identification System (FNMIS), funded by the NA-241 Office of Dismantlement and Transparency, provides information to determine the material attributes and identity of heavily shielded nuclear objects. This information will provide future treaty participants with verifiable information required by the treaty regime. The neutron interrogation technology uses a combination of information from induced fission neutron radiation and transmitted neutron imaging information to provide high confidence that the shielded item is consistent with the host's declaration. The combination of material identification information and the shape and configuration of the item are very difficult to spoof. When used at various points in the warhead dismantlement sequence, the information complimented by tags and seals can be used to track subassembly and piece part information as the disassembly occurs. The neutron transmission imaging has been developed during the last seven years and the signature analysis over the last several decades. The FNMIS is the culmination of the effort to put the technology in a usable configuration for potential treaty verification purposes.

  6. Regime identification in ASDEX Upgrade

    International Nuclear Information System (INIS)

    Giannone, L; Sips, A C C; Kardaun, O; Spreitler, F; Suttrop, W

    2004-01-01

    The ability to recognize the transition from the L-mode to the H-mode or from the H-mode to the improved H-mode reliably from a conveniently small number of measurements in real time is of increasing importance for machine control. Discriminant analysis has been applied to regime identification of plasma discharges in the ASDEX Upgrade tokamak. An observation consists of a set of plasma parameters averaged over a time slice in a discharge. The data set consists of all observations over different discharges and time slices. Discriminant analysis yields coefficients allowing the classification of a new observation. The results of a frequentist and a formal Bayesian approach to discriminant analysis are compared. With five plasma variables, a failure rate of 1.3% for predicting the L-mode and the H-mode confinement regime was achieved. With five plasma variables, a failure rate of 5.3% for predicting the H-mode and the improved H-mode confinement regime was achieved. The coefficients derived by discriminant analysis have been applied subsequently to discharges to illustrate the operation of regime identification in a real time control system

  7. Comparison of Parameter Identification Techniques

    Directory of Open Access Journals (Sweden)

    Eder Rafael

    2016-01-01

    Full Text Available Model-based control of mechatronic systems requires excellent knowledge about the physical behavior of each component. For several types of components of a system, e.g. mechanical or electrical ones, the dynamic behavior can be described by means of a mathematic model consisting of a set of differential equations, difference equations and/or algebraic constraint equations. The knowledge of a realistic mathematic model and its parameter values is essential to represent the behaviour of a mechatronic system. Frequently it is hard or impossible to obtain all required values of the model parameters from the producer, so an appropriate parameter estimation technique is required to compute missing parameters. A manifold of parameter identification techniques can be found in the literature, but their suitability depends on the mathematic model. Previous work dealt with the automatic assembly of mathematical models of serial and parallel robots with drives and controllers within the dynamic multibody simulation code HOTINT as fully-fledged mechatronic simulation. Several parameters of such robot models were identified successfully by our embedded algorithm. The present work proposes an improved version of the identification algorithm with higher performance. The quality of the identified parameter values and the computation effort are compared with another standard technique.

  8. Mental Mechanisms for Topics Identification

    Directory of Open Access Journals (Sweden)

    Louis Massey

    2014-01-01

    Full Text Available Topics identification (TI is the process that consists in determining the main themes present in natural language documents. The current TI modeling paradigm aims at acquiring semantic information from statistic properties of large text datasets. We investigate the mental mechanisms responsible for the identification of topics in a single document given existing knowledge. Our main hypothesis is that topics are the result of accumulated neural activation of loosely organized information stored in long-term memory (LTM. We experimentally tested our hypothesis with a computational model that simulates LTM activation. The model assumes activation decay as an unavoidable phenomenon originating from the bioelectric nature of neural systems. Since decay should negatively affect the quality of topics, the model predicts the presence of short-term memory (STM to keep the focus of attention on a few words, with the expected outcome of restoring quality to a baseline level. Our experiments measured topics quality of over 300 documents with various decay rates and STM capacity. Our results showed that accumulated activation of loosely organized information was an effective mental computational commodity to identify topics. It was furthermore confirmed that rapid decay is detrimental to topics quality but that limited capacity STM restores quality to a baseline level, even exceeding it slightly.

  9. Identification methods for irradiated wheat

    International Nuclear Information System (INIS)

    Zhu Shengtao; Kume, Tamikazu; Ishigaki, Isao.

    1992-02-01

    The effect of irradiation on wheat seeds was examined using various kinds of analytical methods for the identification of irradiated seeds. In germination test, the growth of sprouts was markedly inhibited at 500Gy, which was not affected by storage. The decrease in germination percentage was detected at 3300Gy. The results of enzymatic activity change in the germ measured by Vita-Scope germinator showed that the seeds irradiated at 10kGy could be identified. The content of amino acids in ungerminated and germinated seeds were analyzed. Irradiation at 10kGy caused the decrease of lysine content but the change was small which need very careful operation to detect it. The chemiluminescence intensity increased with radiation dose and decreased during storage. The wheat irradiated at 10kGy could be identified even after 3 months storage. In the electron spin resonance (ESR) spectrum analysis, the signal intensity with the g value f 2.0055 of skinned wheat seeds increased with radiation dose. Among these methods, germination test was the most sensitive and effective for identification of irradiated wheat. (author)

  10. A Multiple Identity Approach to Gender: Identification with Women, Identification with Feminists, and Their Interaction

    OpenAIRE

    van Breen, Jolien A.; Spears, Russell; Kuppens, Toon; de Lemus, Soledad

    2017-01-01

    Across four studies, we examine multiple identities in the context of gender and propose that women's attitudes toward gender group membership are governed by two largely orthogonal dimensions of gender identity: identification with women and identification with feminists. We argue that identification with women reflects attitudes toward the content society gives to group membership: what does it mean to be a woman in terms of group characteristics, interests and values? Identification with f...

  11. Effectiveness of Reptile Species Identification--A Comparison of a Dichotomous Key with an Identification Book

    Science.gov (United States)

    Randler, Christoph; Zehender, Irene

    2006-01-01

    Species identification tasks are a prerequisite for an understanding of biodiversity. Here, we focused on different educational materials to foster the identification of six European reptile species. Our educational training unit was based on natural plastic models of six species and pupils either used an illustrated identification book or a…

  12. Identification of Light Damping in Structures

    DEFF Research Database (Denmark)

    Jensen, Jacob Laigaard; Brincker, Rune; Rytter, Anders

    is identification by ARMA models assuming a white noise input. Method 2 is identification by simulation of a free decay response. Experimental data on the free decay response has been obtained directly by measurement as well as by the random decrement technique. Two experimental cases has been considered. The first...

  13. Identification of Light Damping in Structures

    DEFF Research Database (Denmark)

    Jensen, J. L.; Brincker, Rune; Rytter, A.

    1990-01-01

    is identification by ARMA models assuming a white noise input.Method 2 is identification by simulation of a free decay response. Experimental data on the free decay response has been obtained directly by measurement as well as by the random decrement technique. Two experimental cases has been considered. the first...

  14. Site identification presentation: Basalt Waste Isolation Project

    International Nuclear Information System (INIS)

    1979-11-01

    The final step in the site identification process for the Basalt Waste Isolation Project is described. The candidate sites are identified. The site identification methodology is presented. The general objectives which must be met in selecting the final site are listed. Considerations used in the screening process are also listed. Summary tables of the guidelines used are included

  15. Identification of Polymers in University Class Experiments.

    Science.gov (United States)

    Bowen, Humphry J. M.

    1990-01-01

    The apparatus, reagents, preliminary classification, nomenclature, acquisition, and procedures used in the identification of synthetic polymers are described. Specific tests for the identification of the presence of hydrocarbons, chlorine, fluorine, sulfur, and nitrogen and the absence of halogens and sulfur are discussed. (CW)

  16. 47 CFR 25.206 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station identification. 25.206 Section 25.206 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS... identification is waived for all radio stations licensed under this part with the exception of satellite uplinks...

  17. Identification and Damage Detection on Structural Systems

    DEFF Research Database (Denmark)

    Brincker, Rune; Kirkegaard, Poul Henning; Andersen, Palle

    1994-01-01

    A short introduction is given to system identification and damage assessment in civil engineering structures. The most commonly used FFT-based techniques for system identification are mentioned, and the Random decrement technique and parametric methods based on ARMA models are introduced. Speed...

  18. Predicting nurses' acceptance of radiofrequency identification technology.

    Science.gov (United States)

    Norten, Adam

    2012-10-01

    The technology of radiofrequency identification allows for the scanning of radiofrequency identification-tagged objects and individuals without line-of-sight requirements. Healthcare organizations use radiofrequency identification to ensure the health and safety of patients and medical personnel and to uncover inefficiencies. Although the successful implementation of a system incorporating radiofrequency identification technologies requires acceptance and use of the technology, some nurses using radiofrequency identification in hospitals feel like "Big Brother" is watching them. This predictive study used a theoretical model assessing the effect of five independent variables: privacy concerns, attitudes, subjective norms, controllability, and self-efficacy, on a dependent variable, nurses' behavioral intention to use radiofrequency identification. A Web-based questionnaire containing previously validated questions was answered by 106 US RNs. Multiple linear regression showed that all constructs together accounted for 60% of the variance in nurses' intention to use radiofrequency identification. Of the predictors in the model, attitudes provided the largest unique contribution when the other predictors in the model were held constant; subjective norms also provided a unique contribution. Privacy concerns, controllability, and self-efficacy did not provide a significant contribution to nurses' behavioral intention to use radiofrequency identification.

  19. Organic consumption behavior : A social identification perspective

    NARCIS (Netherlands)

    Du, Shuili; Bartels, Jos; Reinders, Machiel; Sen, Sankar

    2017-01-01

    Consumer demand for organic food and non-food products has been growing dramatically. This study examines organic consumption behavior from a social identification perspective. Focusing on the central role of organic consumer identification (OCI), or the extent to which individuals categorize

  20. Particle identification in ALICE: a Bayesian approach

    NARCIS (Netherlands)

    Adam, J.; Adamova, D.; Aggarwal, M. M.; Rinella, G. Aglieri; Agnello, M.; Agrawal, N.; Ahammed, Z.; Ahn, S. U.; Aiola, S.; Akindinov, A.; Alam, S. N.; Albuquerque, D. S. D.; Aleksandrov, D.; Alessandro, B.; Alexandre, D.; Alfaro Molina, R.; Alici, A.; Alkin, A.; Almaraz, J. R. M.; Alme, J.; Alt, T.; Altinpinar, S.; Altsybeev, I.; Alves Garcia Prado, C.; Andrei, C.; Andronic, A.; Anguelov, V.; Anticic, T.; Antinori, F.; Antonioli, P.; Aphecetche, L.; Appelshaeuser, H.; Arcelli, S.; Arnaldi, R.; Arnold, O. W.; Arsene, I. C.; Arslandok, M.; Audurier, B.; Augustinus, A.; Averbeck, R.; Azmi, M. D.; Badala, A.; Baek, Y. W.; Bagnasco, S.; Bailhache, R.; Bala, R.; Balasubramanian, S.; Baldisseri, A.; Baral, R. C.; Barbano, A. M.; Barbera, R.; Barile, F.; Barnafoeldi, G. G.; Barnby, L. S.; Barret, V.; Bartalini, P.; Barth, K.; Bartke, J.; Bartsch, E.; Basile, M.; Bastid, N.; Bathen, B.; Batigne, G.; Camejo, A. Batista; Batyunya, B.; Batzing, P. C.; Bearden, I. G.; Beck, H.; Bedda, C.; Behera, N. K.; Belikov, I.; Bellini, F.; Bello Martinez, H.; Bellwied, R.; Belmont, R.; Belmont-Moreno, E.; Belyaev, V.; Benacek, P.; Bencedi, G.; Beole, S.; Berceanu, I.; Bercuci, A.; Berdnikov, Y.; Berenyi, D.; Bertens, R. A.; Berzano, D.; Betev, L.; Bhasin, A.; Bhat, I. R.; Bhati, A. K.; Bhattacharjee, B.; Bhom, J.; Bianchi, L.; Bianchi, N.; Bianchin, C.; Bielcik, J.; Bielcikova, J.; Bilandzic, A.; Biro, G.; Biswas, R.; Biswas, S.; Bjelogrlic, S.; Blair, J. T.; Blau, D.; Blume, C.; Bock, F.; Bogdanov, A.; Boggild, H.; Boldizsar, L.; Bombara, M.; Book, J.; Borel, H.; Borissov, A.; Borri, M.; Bossu, F.; Botta, E.; Bourjau, C.; Braun-Munzinger, P.; Bregant, M.; Breitner, T.; Broker, T. A.; Browning, T. A.; Broz, M.; Brucken, E. J.; Bruna, E.; Bruno, G. E.; Budnikov, D.; Buesching, H.; Bufalino, S.; Buncic, P.; Busch, O.; Buthelezi, Z.; Butt, J. B.; Buxton, J. T.; Cabala, J.; Caffarri, D.; Cai, X.; Caines, H.; Diaz, L. Calero; Caliva, A.; Calvo Villar, E.; Camerini, P.; Carena, F.; Carena, W.; Carnesecchi, F.; Castellanos, J. Castillo; Castro, A. J.; Casula, E. A. R.; Sanchez, C. Ceballos; Cepila, J.; Cerello, P.; Cerkala, J.; Chang, B.; Chapeland, S.; Chartier, M.; Charvet, J. L.; Chattopadhyay, S.; Chattopadhyay, S.; Chauvin, A.; Chelnokov, V.; Cherney, M.; Cheshkov, C.; Cheynis, B.; Barroso, V. Chibante; Chinellato, D. D.; Cho, S.; Chochula, P.; Choi, K.; Chojnacki, M.; Choudhury, S.; Christakoglou, P.; Christensen, C. H.; Christiansen, P.; Chujo, T.; Cicalo, C.; Cifarelli, L.; Cindolo, F.; Cleymans, J.; Colamaria, F.; Colella, D.; Collu, A.; Colocci, M.; Balbastre, G. Conesa; del Valle, Z. Conesa; Connors, M. E.; Contreras, J. G.; Cormier, T. M.; Morales, Y. Corrales; Cortes Maldonado, I.; Cortese, P.; Cosentino, M. R.; Costa, F.; Crochet, P.; Cruz Albino, R.; Cuautle, E.; Cunqueiro, L.; Dahms, T.; Dainese, A.; Danisch, M. C.; Danu, A.; Das, I.; Das, S.; Dash, A.; Dash, S.; De, S.; De Caro, A.; de Cataldo, G.; de Conti, C.; de Cuveland, J.; De Falco, A.; De Gruttola, D.; De Marco, N.; De Pasquale, S.; Deisting, A.; Deloff, A.; Denes, E.; Deplano, C.; Dhankher, P.; Di Bari, D.; Di Mauro, A.; Di Nezza, P.; Corchero, M. A. Diaz; Dietel, T.; Dillenseger, P.; Divia, R.; Djuvsland, O.; Dobrin, A.; Gimenez, D. Domenicis; Doenigus, B.; Dordic, O.; Drozhzhova, T.; Dubey, A. K.; Dubla, A.; Ducroux, L.; Dupieux, P.; Ehlers, R. J.; Elia, D.; Endress, E.; Engel, H.; Epple, E.; Erazmus, B.; Erdemir, I.; Erhardt, F.; Espagnon, B.; Estienne, M.; Esumi, S.; Eum, J.; Evans, D.; Evdokimov, S.; Eyyubova, G.; Fabbietti, L.; Fabris, D.; Faivre, J.; Fantoni, A.; Fasel, M.; Feldkamp, L.; Feliciello, A.; Feofilov, G.; Ferencei, J.; Fernandez Tellez, A.; Ferreiro, E. G.; Ferretti, A.; Festanti, A.; Feuillard, V. J. G.; Figiel, J.; Figueredo, M. A. S.; Filchagin, S.; Finogeev, D.; Fionda, F. M.; Fiore, E. M.; Fleck, M. G.; Floris, M.; Foertsch, S.; Foka, P.; Fokin, S.; Fragiacomo, E.; Francescon, A.; Frankenfeld, U.; Fronze, G. G.; Fuchs, U.; Furget, C.; Furs, A.; Girard, M. Fusco; Gaardhoje, J. J.; Gagliardi, M.; Gago, A. M.; Gallio, M.; Gangadharan, D. R.; Ganoti, P.; Gao, C.; Garabatos, C.; Garcia-Solis, E.; Gargiulo, C.; Gasik, P.; Gauger, E. F.; Germain, M.; Gheata, A.; Gheata, M.; Gianotti, P.; Giubellino, P.; Giubilato, P.; Gladysz-Dziadus, E.; Glaessel, P.; Gomez Coral, D. M.; Ramirez, A. Gomez; Gonzalez, A. S.; Gonzalez, V.; Gonzalez-Zamora, P.; Gorbunov, S.; Goerlich, L.; Gotovac, S.; Grabski, V.; Grachov, O. A.; Graczykowski, L. K.; Graham, K. L.; Grelli, A.; Grigoras, A.; Grigoras, C.; Grigoriev, V.; Grigoryan, A.; Grigoryan, S.; Grinyov, B.; Grion, N.; Gronefeld, J. M.; Grosse-Oetringhaus, J. F.; Grosso, R.; Guber, F.; Guernane, R.; Guerzoni, B.; Gulbrandsen, K.; Gunji, T.; Gupta, A.; Haake, R.; Haaland, O.; Hadjidakis, C.; Haiduc, M.; Hamagaki, H.; Hamar, G.; Hamon, J. C.; Harris, J. W.; Harton, A.; Hatzifotiadou, D.; Hayashi, S.; Heckel, S. T.; Hellbaer, E.; Helstrup, H.; Herghelegiu, A.; Herrera Corral, G.; Hess, B. A.; Hetland, K. F.; Hillemanns, H.; Hippolyte, B.; Horak, D.; Hosokawa, R.; Hristov, P.; Humanic, T. J.; Hussain, N.; Hussain, T.; Hutter, D.; Hwang, D. S.; Ilkaev, R.; Inaba, M.; Incani, E.; Ippolitov, M.; Irfan, M.; Ivanov, M.; Ivanov, V.; Izucheev, V.; Jacazio, N.; Jadhav, M. B.; Jadlovska, S.; Jadlovsky, J.; Jahnke, C.; Jakubowska, M. J.; Jang, H. J.; Janik, M. A.; Jayarathna, P. H. S. Y.; Jena, C.; Jena, S.; Bustamante, R. T. Jimenez; Jones, P. G.; Jusko, A.; Kalinak, P.; Kalweit, A.; Kamin, J.; Kaplin, V.; Kar, S.; Uysal, A. Karasu; Karavichev, O.; Karavicheva, T.; Karayan, L.; Karpechev, E.; Kebschull, U.; Keidel, R.; Keijdener, D. L. D.; Keil, M.; Khan, M. Mohisin; Khan, P.; Khan, S. A.; Khanzadeev, A.; Kharlov, Y.; Kileng, B.; Kim, D. W.; Kim, D. J.; Kim, D.; Kim, J. S.; Kim, M.; Kim, T.; Kirsch, S.; Kisel, I.; Kiselev, S.; Kisiel, A.; Kiss, G.; Klay, J. L.; Klein, C.; Klein-Boesing, C.; Klewin, S.; Kluge, A.; Knichel, M. L.; Knospe, A. G.; Kobdaj, C.; Kofarago, M.; Kollegger, T.; Kolojvari, A.; Kondratiev, V.; Kondratyeva, N.; Kondratyuk, E.; Konevskikh, A.; Kopcik, M.; Kostarakis, P.; Kour, M.; Kouzinopoulos, C.; Kovalenko, O.; Kovalenko, V.; Kowalski, M.; Meethaleveedu, G. Koyithatta; Kralik, I.; Kravcakova, A.; Krivda, M.; Krizek, F.; Kryshen, E.; Krzewicki, M.; Kubera, A. M.; Kucera, V.; Kuijer, P. G.; Kumar, J.; Kumar, L.; Kumar, S.; Kurashvili, P.; Kurepin, A.; Kurepin, A. B.; Kuryakin, A.; Kweon, M. J.; Kwon, Y.; La Pointe, S. L.; La Rocca, P.; Ladron de Guevara, P.; Lagana Fernandes, C.; Lakomov, I.; Langoy, R.; Lara, C.; Lardeux, A.; Lattuca, A.; Laudi, E.; Lea, R.; Leardini, L.; Lee, G. R.; Lee, S.; Lehas, F.; Lemmon, R. C.; Lenti, V.; Leogrande, E.; Monzon, I. Leon; Leon Vargas, H.; Leoncino, M.; Levai, P.; Lien, J.; Lietava, R.; Lindal, S.; Lindenstruth, V.; Lippmann, C.; Lisa, M. A.; Ljunggren, H. M.; Lodato, D. F.; Loenne, P. I.; Loginov, V.; Loizides, C.; Lopez, X.; Torres, E. Lopez; Lowe, A.; Luettig, P.; Lunardon, M.; Luparello, G.; Lutz, T. H.; Maevskaya, A.; Mager, M.; Mahajan, S.; Mahmood, S. M.; Maire, A.; Majka, R. D.; Malaev, M.; Maldonado Cervantes, I.; Malinina, L.; Mal'Kevich, D.; Malzacher, P.; Mamonov, A.; Manko, V.; Manso, F.; Manzari, V.; Marchisone, M.; Mares, J.; Margagliotti, G. V.; Margotti, A.; Margutti, J.; Marin, A.; Markert, C.; Marquard, M.; Martin, N. A.; Blanco, J. Martin; Martinengo, P.; Martinez, M. I.; Garcia, G. Martinez; Pedreira, M. Martinez; Mas, A.; Masciocchi, S.; Masera, M.; Masoni, A.; Mastroserio, A.; Matyja, A.; Mayer, C.; Mazer, J.; Mazzoni, M. A.; Mcdonald, D.; Meddi, F.; Melikyan, Y.; Menchaca-Rocha, A.; Meninno, E.; Perez, J. Mercado; Meres, M.; Miake, Y.; Mieskolainen, M. M.; Mikhaylov, K.; Milano, L.; Milosevic, J.; Mischke, A.; Mishra, A. N.; Miskowiec, D.; Mitra, J.; Mitu, C. M.; Mohammadi, N.; Mohanty, B.; Molnar, L.; Montano Zetina, L.; Montes, E.; De Godoy, D. A. Moreira; Moreno, L. A. P.; Moretto, S.; Morreale, A.; Morsch, A.; Muccifora, V.; Mudnic, E.; Muehlheim, D.; Muhuri, S.; Mukherjee, M.; Mulligan, J. D.; Munhoz, M. G.; Munzer, R. H.; Murakami, H.; Murray, S.; Musa, L.; Musinsky, J.; Naik, B.; Nair, R.; Nandi, B. K.; Nania, R.; Nappi, E.; Naru, M. U.; Natal da Luz, H.; Nattrass, C.; Navarro, S. R.; Nayak, K.; Nayak, R.; Nayak, T. K.; Nazarenko, S.; Nedosekin, A.; Nellen, L.; Ng, F.; Nicassio, M.; Niculescu, M.; Niedziela, J.; Nielsen, B. S.; Nikolaev, S.; Nikulin, S.; Nikulin, V.; Noferini, F.; Nomokonov, P.; Nooren, G.; Noris, J. C. C.; Norman, J.; Nyanin, A.; Nystrand, J.; Oeschler, H.; Oh, S.; Oh, S. K.; Ohlson, A.; Okatan, A.; Okubo, T.; Olah, L.; Oleniacz, J.; Oliveira Da Silva, A. C.; Oliver, M. H.; Onderwaater, J.; Oppedisano, C.; Orava, R.; Oravec, M.; Ortiz Velasquez, A.; Oskarsson, A.; Otwinowski, J.; Oyama, K.; Ozdemir, M.; Pachmayer, Y.; Pagano, D.; Pagano, P.; Paic, G.; Pal, S. K.; Pan, J.; Papikyan, V.; Pappalardo, G. S.; Pareek, P.; Park, W. J.; Parmar, S.; Passfeld, A.; Paticchio, V.; Patra, R. N.; Paul, B.; Pei, H.; Peitzmann, T.; Da Costa, H. Pereira; Peresunko, D.; Lara, C. E. Perez; Lezama, E. Perez; Peskov, V.; Pestov, Y.; Petracek, V.; Petrov, V.; Petrovici, M.; Petta, C.; Piano, S.; Pikna, M.; Pillot, P.; Pimentel, L. O. D. L.; Pinazza, O.; Pinsky, L.; Piyarathna, D. B.; Ploskon, M.; Planinic, M.; Pluta, J.; Pochybova, S.; Podesta-Lerma, P. L. M.; Poghosyan, M. G.; Polichtchouk, B.; Poljak, N.; Poonsawat, W.; Pop, A.; Porteboeuf-Houssais, S.; Porter, J.; Pospisil, J.; Prasad, S. K.; Preghenella, R.; Prino, F.; Pruneau, C. A.; Pshenichnov, I.; Puccio, M.; Puddu, G.; Pujahari, P.; Punin, V.; Putschke, J.; Qvigstad, H.; Rachevski, A.; Raha, S.; Rajput, S.; Rak, J.; Rakotozafindrabe, A.; Ramello, L.; Rami, F.; Raniwala, R.; Raniwala, S.; Raesaenen, S. S.; Rascanu, B. T.; Rathee, D.; Read, K. F.; Redlich, K.; Reed, R. J.; Reichelt, P.; Reidt, F.; Ren, X.; Renfordt, R.; Reolon, A. R.; Reshetin, A.; Reygers, K.; Riabov, V.; Ricci, R. A.; Richert, T.; Richter, M.; Riedler, P.; Riegler, W.; Riggi, F.; Ristea, C.; Rocco, E.; Rodriguez Cahuantzi, M.; Manso, A. Rodriguez; Roed, K.; Rogochaya, E.; Rohr, D.; Roehrich, D.; Ronchetti, F.; Ronflette, L.; Rosnet, P.; Rossi, A.; Roukoutakis, F.; Roy, A.; Roy, C.; Roy, P.; Montero, A. J. Rubio; Rui, R.; Russo, R.; Ryabinkin, E.; Ryabov, Y.; Rybicki, A.; Saarinen, S.; Sadhu, S.; Sadovsky, S.; Safarik, K.; Sahlmuller, B.; Sahoo, P.; Sahoo, R.; Sahoo, S.; Sahu, P. K.; Saini, J.; Sakai, S.; Saleh, M. A.; Salzwedel, J.; Sambyal, S.; Samsonov, V.; Sandor, L.; Sandoval, A.; Sano, M.; Sarkar, D.; Sarkar, N.; Sarma, P.; Scapparone, E.; Scarlassara, F.; Schiaua, C.; Schicker, R.; Schmidt, C.; Schmidt, H. R.; Schuchmann, S.; Schukraft, J.; Schulc, M.; Schutz, Y.; Schwarz, K.; Schweda, K.; Scioli, G.; Scomparin, E.; Scott, R.; Sefcik, M.; Seger, J. E.; Sekiguchi, Y.; Sekihata, D.; Selyuzhenkov, I.; Senosi, K.; Senyukov, S.; Serradilla, E.; Sevcenco, A.; Shabanov, A.; Shabetai, A.; Shadura, O.; Shahoyan, R.; Shahzad, M. I.; Shangaraev, A.; Sharma, M.; Sharma, M.; Sharma, N.; Sheikh, A. I.; Shigaki, K.; Shou, Q.; Shtejer, K.; Sibiriak, Y.; Siddhanta, S.; Sielewicz, K. M.; Siemiarczuk, T.; Silvermyr, D.; Silvestre, C.; Simatovic, G.; Simonetti, G.; Singaraju, R.; Singh, R.; Singha, S.; Singhal, V.; Sinha, B. C.; Sinha, T.; Sitar, B.; Sitta, M.; Skaali, T. B.; Slupecki, M.; Smirnov, N.; Snellings, R. J. M.; Snellman, T. W.; Song, J.; Song, M.; Song, Z.; Soramel, F.; Sorensen, S.; de Souza, R. D.; Sozzi, F.; Spacek, M.; Spiriti, E.; Sputowska, I.; Spyropoulou-Stassinaki, M.; Stachel, J.; Stan, I.; Stankus, P.; Stenlund, E.; Steyn, G.; Stiller, J. H.; Stocco, D.; Strmen, P.; Suaide, A. A. P.; Sugitate, T.; Suire, C.; Suleymanov, M.; Suljic, M.; Sultanov, R.; Sumbera, M.; Sumowidagdo, S.; Szabo, A.; Szanto de Toledo, A.; Szarka, I.; Szczepankiewicz, A.; Szymanski, M.; Tabassam, U.; Takahashi, J.; Tambave, G. J.; Tanaka, N.; Tarhini, M.; Tariq, M.; Tarzila, M. G.; Tauro, A.; Tejeda Munoz, G.; Telesca, A.; Terasaki, K.; Terrevoli, C.; Teyssier, B.; Thaeder, J.; Thakur, D.; Thomas, D.; Tieulent, R.; Timmins, A. R.; Toia, A.; Trogolo, S.; Trombetta, G.; Trubnikov, V.; Trzaska, W. H.; Tsuji, T.; Tumkin, A.; Turrisi, R.; Tveter, T. S.; Ullaland, K.; Uras, A.; Usai, G. L.; Utrobicic, A.; Vala, M.; Palomo, L. Valencia; Vallero, S.; Van Der Maarel, J.; Van Hoorne, J. W.; van Leeuwen, M.; Vanat, T.; Vyvre, P. Vande; Varga, D.; Vargas, A.; Vargyas, M.; Varma, R.; Vasileiou, M.; Vasiliev, A.; Vauthier, A.; Vechernin, V.; Veen, A. M.; Veldhoen, M.; Velure, A.; Vercellin, E.; Vergara Limon, S.; Vernet, R.; Verweij, M.; Vickovic, L.; Viesti, G.; Viinikainen, J.; Vilakazi, Z.; Baillie, O. Villalobos; Villatoro Tello, A.; Vinogradov, A.; Vinogradov, L.; Vinogradov, Y.; Virgili, T.; Vislavicius, V.; Viyogi, Y. P.; Vodopyanov, A.; Voelkl, M. A.; Voloshin, K.; Voloshin, S. A.; Volpe, G.; von Haller, B.; Vorobyev, I.; Vranic, D.; Vrlakova, J.; Vulpescu, B.; Wagner, B.; Wagner, J.; Wang, H.; Watanabe, D.; Watanabe, Y.; Weiser, D. F.; Westerhoff, U.; Whitehead, A. M.; Wiechula, J.; Wikne, J.; Wilk, G.; Wilkinson, J.; Williams, M. C. S.; Windelband, B.; Winn, M.; Yang, H.; Yano, S.; Yasin, Z.; Yokoyama, H.; Yoo, I. -K.; Yoon, J. H.; Yurchenko, V.; Yushmanov, I.; Zaborowska, A.; Zaccolo, V.; Zaman, A.; Zampolli, C.; Zanoli, H. J. C.; Zaporozhets, S.; Zardoshti, N.; Zarochentsev, A.; Zavada, P.; Zaviyalov, N.; Zbroszczyk, H.; Zgura, I. S.; Zhalov, M.; Zhang, C.; Zhao, C.; Zhigareva, N.; Zhou, Y.; Zhou, Z.; Zhu, H.; Zichichi, A.; Zimmermann, A.; Zimmermann, M. B.; Zinovjev, G.; Zyzak, M.

    2016-01-01

    We present a Bayesian approach to particle identification (PID) within the ALICE experiment. The aim is to more effectively combine the particle identification capabilities of its various detectors. After a brief explanation of the adopted methodology and formalism, the performance of the Bayesian

  1. Molecular identification of polydorid polychaetes (Annelida ...

    African Journals Online (AJOL)

    The early detection and correct identification of polydorid polychaete species is essential as they are often encountered as invasive alien pests in aquaculture facilities or the intertidal where they may modify the ecosystem. Accurate identification is, however, often hampered by high levels of morphological similarity among ...

  2. 47 CFR 80.519 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... drawbridges may be identified by use of the name of the bridge in lieu of the call sign. Identification must...) Stations must identify transmissions by announcing in the English language the station's assigned call sign. In lieu of the identification of the station by voice, the official call sign may be transmitted by...

  3. LPV system identification using series expansion models

    NARCIS (Netherlands)

    Toth, R.; Heuberger, P.S.C.; Hof, Van den P.M.J.; Santos, dos P.L.; Perdicoúlis, T.P.A.; Novara, C.; Ramos, J.A.; Rivera, D.E.

    2011-01-01

    This review volume reports the state-of-the-art in Linear Parameter Varying (LPV) system identification. Written by world renowned researchers, the book contains twelve chapters, focusing on the most recent LPV identification methods for both discrete-time and continuous-time models, using different

  4. Multivariate methods for particle identification

    CERN Document Server

    Visan, Cosmin

    2013-01-01

    The purpose of this project was to evaluate several MultiVariate methods in order to determine which one, if any, offers better results in Particle Identification (PID) than a simple n$\\sigma$ cut on the response of the ALICE PID detectors. The particles considered in the analysis were Pions, Kaons and Protons and the detectors used were TPC and TOF. When used with the same input n$\\sigma$ variables, the results show similar perfoance between the Rectangular Cuts Optimization method and the simple n$\\sigma$ cuts. The method MLP and BDT show poor results for certain ranges of momentum. The KNN method is the best performing, showing similar results for Pions and Protons as the Cuts method, and better results for Kaons. The extension of the methods to include additional input variables leads to poor results, related to instabilities still to be investigated.

  5. Expert system based radionuclide identification

    International Nuclear Information System (INIS)

    Aarnio, P.A.; Ala-Heikkil, J.J.; Hakulinen, T.T.; Nikkinen, M.T.

    1998-01-01

    An expert system coupled with the gamma spectrum analysis system SAMPO has been developed for automating the qualitative identification of radionuclides as well as for determining the quantitative parameters of the spectrum components. The program is written in C-language and runs in various environments ranging from PCs to UNIX workstations. The expert system utilizes a complete gamma library with over 2600 nuclides and 80,000 lines, and a rule base of about fifty criteria including energies, relative peak intensities, genesis modes, half lives, parent-daughter relationships, etc. The rule base is furthermore extensible by the user. This is not an original contribution but a somewhat updated version of papers and reports previously published elsewhere. (author)

  6. Enhancer Identification through Comparative Genomics

    Energy Technology Data Exchange (ETDEWEB)

    Visel, Axel; Bristow, James; Pennacchio, Len A.

    2006-10-01

    With the availability of genomic sequence from numerousvertebrates, a paradigm shift has occurred in the identification ofdistant-acting gene regulatory elements. In contrast to traditionalgene-centric studies in which investigators randomly scanned genomicfragments that flank genes of interest in functional assays, the modernapproach begins electronically with publicly available comparativesequence datasets that provide investigators with prioritized lists ofputative functional sequences based on their evolutionary conservation.However, although a large number of tools and resources are nowavailable, application of comparative genomic approaches remains far fromtrivial. In particular, it requires users to dynamically consider thespecies and methods for comparison depending on the specific biologicalquestion under investigation. While there is currently no single generalrule to this end, it is clear that when applied appropriately,comparative genomic approaches exponentially increase our power ingenerating biological hypotheses for subsequent experimentaltesting.

  7. Particle identification for beauty physics

    International Nuclear Information System (INIS)

    Ludlam, T.

    1987-01-01

    We look briefly at the requirements for particle identification for possible beauty experiments at the Tevatron, both in the fixed target and the collider mode. Techniques presently in use in high energy physics experiments, and under development, should make sensitive experiments feasible. However, in all cases the present state of the art must be advanced to meet the necessary requirements for segmentation andor rate capability. The most fundamentally difficult challenges appear to be the efficient tagging of soft electrons (for the collider experiment) and the need to handle interaction rates up to /approximately/ 10 9 HZ in the fixed target mode. In both cases we can find ''in principle'' demonstrations that the requirements can be met. We have considered only the most basic prooperties of detectors, however, and the real answers will come from careful studies of details. 20 refs., 10 figs

  8. Effective Deffect Identifications in Honeycombs

    Directory of Open Access Journals (Sweden)

    Jarmila Dedkova

    2008-01-01

    Full Text Available The image reconstruction problem based on Electrical Impedance Tomography (EIT is an ill-posed inverse problem of finding such conductivity distribution that minimizes some optimisation criterion, which can be given by a suitable primal objective function. This paper describes new algorithms for the reconstruction of the surface conductivity distribution, which are based on stochastic methods to be used for the acquirement of more accurate reconstruction results and stable solution. The proposed methods are expected to non-destructive test of materials. There are shown examples of the identification of voids or cracks in special structures called honeycombs. Instead of the experimental data we used the phantom evaluated voltage values based on the application of finite element method. The results obtained by this new approach are compared with results from the known deterministic approach to the same image reconstruction

  9. Notion of Identification: A Philosophical Case Study

    Directory of Open Access Journals (Sweden)

    Arto Mutanen

    2016-09-01

    Full Text Available Human life should be good life in the real world which is not merely a function of objective facts but also a function of subjective factors like hopes, fears, interests, etc. Goodness, or excellence, is an ethical notion. The factors of good life cannot be identified solely by using the so-called factual (descriptive methods of identification. This means that the identification cannot be fully “objective” or fully “public”. Furthermore, there is a need for other methods of identification that also take into account certain “subjective” aspects of the object of identification. Following Jaakko Hintikka we call these methods contextual (perspectival methods of identification. Here ethics is not a set of ethical rules but rather the practical study of human life. How should we live our unique life? A philosophical-conceptual study is thus practical for this purpose. This is what Aristotle called practical wisdom (phronēsis.

  10. Domingo de Ramos, dalla violenza urbana alla solidarietà marginale

    Directory of Open Access Journals (Sweden)

    Riccardo Badini

    2016-12-01

    Full Text Available The article aims to analyze the poetry of Domingo de Ramos (Peru 1960 through themes like violence, urban decay and migration and presents the translation of an unpublished poem. A path is traced from the vanguards to the socio historical and political context of the  80s Peru, not to mention the innate inclination of the poet for marginal realities.

  11. TAMIZAJE CERVICOUTERINO USANDO PAPANICOLAOU EN MUJERES DE BARRIOS MARGINALES DE LA REGION LORETO

    Directory of Open Access Journals (Sweden)

    Carmen Nuñez-Rengifo

    2011-07-01

    Full Text Available La presente investigación, tiene como objetivo conocer la frecuencia de las mujeres portadoras de lesiones producidas por la infección con Papiloma Virus Humano en las zonas y lugares de difícil acceso geográfico en la región Loreto, donde escasean los recursos y las posibilidades de acceder al servicio de salud sexual y reproductiva son difíciles. Se usó para ello la prueba de Papanicolaou como tamizaje de dichas lesiones. Con ello se pretende reforzar la gestión para la obtención de vacunas contra el PVH, para la nueva generación de mujeres de Loreto; capacitación a los profesionales obstetras para reforzar el manejo en el tratamiento y reducción del cáncer de cuello uterino de la región Loreto. Este estudio tiene un Diseño descriptivo transversal. Se realizó teniendo como estratégica básica los Barridos de Papanicolaou entre los años 2008 y 2009. Se realizaron cientos de intervenciones, lográndose sensibilizar a 25,000 mujeres en Loreto, utilizando la estrategia de Promoción de la Salud, el perifoneo, volanteo, charlas educativas, 5,000 visitas domiciliarias, entre otras. De las 2000 mujeres estudiadas 348 tuvieron algún tipo de normalidad de las células epiteliales. En 45 casos se encontró lesiones intra epiteliales de alto grado ó carcinoma escamoso invasivo.

  12. EL CINE ESPAÑOL COMO FUENTE DOCUMENTAL PARA EL ESTUDIO DE LOS BARRIOS MARGINALES

    Directory of Open Access Journals (Sweden)

    Aramis López Juan

    2008-01-01

    Full Text Available El cine como arte nuevo y técnico se instala en una sociedad moderna que tiene una percepción del mundo basada en la imagen. El cine y la fotografía son los introductores de esta modalidad perceptiva de la modernidad. Esta experiencia sensorial sitúa al hombre en un universo más amplio. El hombre contemporáneo comprende los mecanismos representativos del cine, sus códigos, sus metáforas e iconos. El cine ha nacido al mismo tiempo que los abuelos de los espectadores actuales, ha crecido con sus padres, y es conocido y comprendido universalmente

  13. Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina

    Directory of Open Access Journals (Sweden)

    Alonso, R.

    1989-04-01

    Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en un momento dado de las aguas freáticas de los abanicos aluviales por aguas termales ricas en sílice, propiciaría junto con la evaporización la precipitación de la silíceo Los nódulos silíceos crecerían desplazando el sedimento terrígeno que constituye la roca caja o reemplazando nódulos previa de ulexita.

  14. Maras y barras : Pandillas y violencia juvenil en los barrios marginales de Centroamérica

    NARCIS (Netherlands)

    Savenije, W.

    2009-01-01

    Street gangs -especially ‘Mara Salvatrucha’ [MS] and 18th Street Gang [18]- and student gangs are feared throughout Central America. This study looks at the violent and criminal acts they engage in, the attraction they hold over other young people, the solidarity among their members, and the

  15. Optimization of fuel cycles: marginal loss values; Optimisation des cycles de combustibles: valeurs marginales des pertes

    Energy Technology Data Exchange (ETDEWEB)

    Gaussens, J [Commissariat a l' Energie Atomique, 75 - Paris (France); Lasteyrie, B de; Doumerc, J [Compagnie pour l' Etude et la Realisation de Combustibles Atomiques, 75 - Paris (France)

    1965-07-01

    Uranium processing from the pit to the fuel element rod entails metal losses at every step. These losses become more and more expensive with the elaboration of the metal. Some of the uranium must be accepted as definitely lost whilst the rest could be recovered and recycled. The high cost of these losses, whether they are recycled or not, and the fact that the higher the enrichment is the higher their costs are, make it necessary to take them into account when optimizing fuel cycles. It is therefore felt important to determine their most desirable level from an economic point of view at the various nuclear fuel processing stages. However, in France as in some other countries, fissile material production is a state concern, whilst fuel element fabrication is carried out by private enterprise. Optimization criteria and the economic value of losses are therefore different for each of the two links in the fabrication chain. One can try in spite of this to reach an optimum which would conform to public interest, without interfering with the firm's sales policy. This entails using the fact that for a given output marginal costs are equal at the optimum. One can therefore adjust the level of the losses to attain this equation of marginal costs, as these are easier to obtain from the firm than a justification of the actual prices. One notices moreover that, although mainly concerned with losses, this global analysis can bring both the state and the firm to a better use of other production factors. An account is given of the theory of this economic optimization method and practical applications in the field of natural uranium-graphite moderated and CO{sub 2} cooled reactor fuel element fabrication are offered. (authors) [French] L'elaboration de l'uranium, de la mine a la cartouche d'element combustible, s'accompagne, a tous les stades, de pertes, de plus en plus onereuses, a mesure que le metal devient plus elabore. Une certaine proportion de l'uranium doit etre consideree comme definitivement perdue, alors que le reste pourrait etre recupere et recycle. Le cout eleve des pertes, recyclees ou non, d'autant plus eleve que l'uranium est plus enrichi, exige qu'il en soit tenu compte dans l'optimisation generale des cycles de combustible. Il importe donc de determiner leur niveau le plus souhaitable economiquement, aux diverses etapes d'elaboration du combustible nucleaire. Mais en France et dans d'autres pays, la production de matieres fissiles est geree par l'Etat, tandis que la fabrication de l'element combustible est effectuee par l'industrie privee. Les criteres d'optimisation et l'interet economique accorde aux pertes sont donc differents pour les deux parties de la chaine de fabrication. Pour tenter neanmoins d'atteindre un optimum conforme a l'interet collectif sans intervenir dans la politique de prix de l'entreprise, on peut utiliser la propriete des couts marginaux d'etre egaux entre eux a l'optimum, pour un volume de production donne. On peut donc ajuster le niveau des pertes pour realiser cette egalite des couts marginaux dont le calcul est plus facile a obtenir de la firme que la justification des prix eux-memes. On s'apercoit d'ailleurs que, bien qu'axee essentiellement sur les pertes, cette analyse globale peut conduire a une meilleure utilisation d'autres facteurs de production. On donne un expose theorique et des exemples pratiques de cette methode d'optimisation economique dans le cadre de la fabrication d'elements combustibles destines a des reacteurs du type: uranium naturel, moderes au graphite et refroidis par le gaz carbonique. (auteurs)

  16. TAMIZAJE CERVICOUTERINO USANDO PAPANICOLAOU EN MUJERES DE BARRIOS MARGINALES DE LA REGION LORETO

    Directory of Open Access Journals (Sweden)

    Carmen Nuñez Rengifo

    2011-06-01

    Full Text Available La presente investigación, tiene como objetivo conocer la frecuencia de las mujeres portadoras de lesiones producidas por la infección con Papiloma Virus Humano en las zonas y lugares de difícil acceso geográfico en la región Loreto, donde escasean los recursos y las posibilidades de acceder al servicio de salud sexual y reproductiva son difíciles. Se usó para ello la prueba de Papanicolaou como tamizaje de dichas lesiones. Con ello se pretende reforzar la gestión para la obtención de vacunas contra el PVH, para la nueva generación de mujeres de Loreto; capacitación a los profesionales obstetras para reforzar el manejo en el tratamiento y reducción del cáncer de cuello uterino de la región Loreto. Este estudio tiene un Diseño descriptivo transversal. Se realizó teniendo como estratégica básica los Barridos de Papanicolaou entre los años 2008 y 2009. Se realizaron cientos de intervenciones, lográndose sensibilizar a 25,000 mujeres en Loreto, utilizando la estrategia de Promoción de la Salud, el perifoneo, volanteo, charlas educativas, 5,000 visitas domiciliarias, entre otras. De las 2000 mujeres estudiadas 348 tuvieron algún tipo de normalidad de las células epiteliales. En 45 casos se encontró lesiones intra epiteliales de alto grado ó carcinoma escamoso invasivo.

  17. Optimization of fuel cycles: marginal loss values; Optimisation des cycles de combustibles: valeurs marginales des pertes

    Energy Technology Data Exchange (ETDEWEB)

    Gaussens, J. [Commissariat a l' Energie Atomique, 75 - Paris (France); Lasteyrie, B. de; Doumerc, J. [Compagnie pour l' Etude et la Realisation de Combustibles Atomiques, 75 - Paris (France)

    1965-07-01

    Uranium processing from the pit to the fuel element rod entails metal losses at every step. These losses become more and more expensive with the elaboration of the metal. Some of the uranium must be accepted as definitely lost whilst the rest could be recovered and recycled. The high cost of these losses, whether they are recycled or not, and the fact that the higher the enrichment is the higher their costs are, make it necessary to take them into account when optimizing fuel cycles. It is therefore felt important to determine their most desirable level from an economic point of view at the various nuclear fuel processing stages. However, in France as in some other countries, fissile material production is a state concern, whilst fuel element fabrication is carried out by private enterprise. Optimization criteria and the economic value of losses are therefore different for each of the two links in the fabrication chain. One can try in spite of this to reach an optimum which would conform to public interest, without interfering with the firm's sales policy. This entails using the fact that for a given output marginal costs are equal at the optimum. One can therefore adjust the level of the losses to attain this equation of marginal costs, as these are easier to obtain from the firm than a justification of the actual prices. One notices moreover that, although mainly concerned with losses, this global analysis can bring both the state and the firm to a better use of other production factors. An account is given of the theory of this economic optimization method and practical applications in the field of natural uranium-graphite moderated and CO{sub 2} cooled reactor fuel element fabrication are offered. (authors) [French] L'elaboration de l'uranium, de la mine a la cartouche d'element combustible, s'accompagne, a tous les stades, de pertes, de plus en plus onereuses, a mesure que le metal devient plus elabore. Une certaine proportion de l'uranium doit etre consideree comme definitivement perdue, alors que le reste pourrait etre recupere et recycle. Le cout eleve des pertes, recyclees ou non, d'autant plus eleve que l'uranium est plus enrichi, exige qu'il en soit tenu compte dans l'optimisation generale des cycles de combustible. Il importe donc de determiner leur niveau le plus souhaitable economiquement, aux diverses etapes d'elaboration du combustible nucleaire. Mais en France et dans d'autres pays, la production de matieres fissiles est geree par l'Etat, tandis que la fabrication de l'element combustible est effectuee par l'industrie privee. Les criteres d'optimisation et l'interet economique accorde aux pertes sont donc differents pour les deux parties de la chaine de fabrication. Pour tenter neanmoins d'atteindre un optimum conforme a l'interet collectif sans intervenir dans la politique de prix de l'entreprise, on peut utiliser la propriete des couts marginaux d'etre egaux entre eux a l'optimum, pour un volume de production donne. On peut donc ajuster le niveau des pertes pour realiser cette egalite des couts marginaux dont le calcul est plus facile a obtenir de la firme que la justification des prix eux-memes. On s'apercoit d'ailleurs que, bien qu'axee essentiellement sur les pertes, cette analyse globale peut conduire a une meilleure utilisation d'autres facteurs de production. On donne un expose theorique et des exemples pratiques de cette methode d'optimisation economique dans le cadre de la fabrication d'elements combustibles destines a des reacteurs du type: uranium naturel, moderes au graphite et refroidis par le gaz carbonique. (auteurs)

  18. NASA Technologies for Product Identification

    Science.gov (United States)

    Schramm, Fred, Jr.

    2006-01-01

    Since 1975 bar codes on products at the retail counter have been accepted as the standard for entering product identity for price determination. Since the beginning of the 21st century, the Data Matrix symbol has become accepted as the bar code format that is marked directly on a part, assembly or product that is durable enough to identify that item for its lifetime. NASA began the studies for direct part marking Data Matrix symbols on parts during the Return to Flight activities after the Challenger Accident. Over the 20 year period that has elapsed since Challenger, a mountain of studies, analyses and focused problem solutions developed by and for NASA have brought about world changing results. NASA Technical Standard 6002 and NASA Handbook 6003 for Direct Part Marking Data Matrix Symbols on Aerospace Parts have formed the basis for most other standards on part marking internationally. NASA and its commercial partners have developed numerous products and methods that addressed the difficulties of collecting part identification in aerospace operations. These products enabled the marking of Data Matrix symbols in virtually every situation and the reading of symbols at great distances, severe angles, under paint and in the dark without a light. Even unmarkable delicate parts now have a process to apply a chemical mixture called NanocodesTM that can be converted to a Data Matrix. The accompanying intellectual property is protected by 10 patents, several of which are licensed. Direct marking Data Matrix on NASA parts virtually eliminates data entry errors and the number of parts that go through their life cycle unmarked, two major threats to sound configuration management and flight safety. NASA is said to only have people and stuff with information connecting them. Data Matrix is one of the most significant improvements since Challenger to the safety and reliability of that connection. This presentation highlights the accomplishments of NASA in its efforts to develop

  19. Infecção natural por hemoparasitos em bezerros submetidos à quimio-profilaxia aos 30 dias de idade Natural infection by hemoparasites in calves submitted to chemo -prophylaxis wonder 30 days of age

    Directory of Open Access Journals (Sweden)

    Rosângela A. Da Silva

    2007-09-01

    Full Text Available O complexo Tristeza Parasitária acarreta grandes prejuízos à pecuária bovina nacional. Os principais agentes etiológicos são Babesia bigemina, B. bovis e Anaplasma marginale, sendo o carrapato Boophilus microplus o principal vetor. Este trabalho relata a ocorrência de infecção natural por hemoparasitos da tristeza parasitária bovina em 36 bezerros com alta infestação natural por carrapatos e submetidos à quimioprofilaxia aos 30 dias de idade. Babesia bigemina (33,3%, B. bovis (11,1% e A. marginale (13,9% foram detectados em esfregaços sangüíneos de 16 animais (44,4% de diferentes idades. Seis bezerros apresentaram sintomas (16,7% e um morreu (2,8%. O número de casos clínicos foi decorrente de uma associação de fatores, destacando-se a alta infestação precoce por carrapatos e a baixa imunidade passiva em período em que os bezerros ainda não haviam desenvolvido imunidade ativa suficiente.The tick-borne disease (TBD brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%, B. bovis (11.1% and A. marginale (13.9%. Six animals had clinical symptoms (16.7% and one dead (2.8%. The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

  20. Electro-optical fuel pin identification system

    International Nuclear Information System (INIS)

    Kirchner, T.L.

    1978-09-01

    A prototype Electro-Optical Fuel Pin Identification System referred to as the Fuel Pin Identification System (FPIS) has been developed by the Hanford Engineering Development Laboratory (HEDL) in support of the Fast Flux Test Facility (FFTF) presently under construction at HEDL. The system is designed to remotely read an alpha-numeric identification number that is roll stamped on the top of the fuel pin end cap. The prototype FPIS consists of four major subassemblies: optical read head, digital compression electronics, video display, and line printer

  1. Dramatization and attraction: new identification tools

    Directory of Open Access Journals (Sweden)

    V I Panteleeva

    2009-12-01

    Full Text Available The article provides the analysis of identification mechanisms and its presentation patterns in the contemporary megapolis, the reasons for identification challenges emerging in the contemporary multicultural world where the contemporary urban community offers the opportunity for identity transformation, so that the citizens of metropolis are faced with the challenge of finding new identification tools. The notions of «dramatization» and «social attraction» offered in the article for the identity problem analysis in the context of diverse style and taste options of the contemporary urban community serve to form an estimate of the behaviour of an individual who keeps deciding on his own behavioral pattern.

  2. On System Identification of Wind Turbines

    DEFF Research Database (Denmark)

    Kirkegaard, Poul Henning; Perisic, Nevena; Pedersen, B.J.

    Recently several methods have been proposed for the system identification of wind turbines which can be considered as a linear time-varying system due to the operating conditions. For the identification of linear wind turbine models, either black-box or grey-box identification can be used....... The operational model analysis (OMA) methodology can provide accurate estimates of the natural frequencies, damping ratios and mode shapes of the systems as long as the measurements have a low noise to signal ratio. However, in order to take information about the wind turbine into account a grey...

  3. Multi-level RF identification system

    Science.gov (United States)

    Steele, Kerry D.; Anderson, Gordon A.; Gilbert, Ronald W.

    2004-07-20

    A radio frequency identification system having a radio frequency transceiver for generating a continuous wave RF interrogation signal that impinges upon an RF identification tag. An oscillation circuit in the RF identification tag modulates the interrogation signal with a subcarrier of a predetermined frequency and modulates the frequency-modulated signal back to the transmitting interrogator. The interrogator recovers and analyzes the subcarrier signal and determines its frequency. The interrogator generates an output indicative of the frequency of the subcarrier frequency, thereby identifying the responding RFID tag as one of a "class" of RFID tags configured to respond with a subcarrier signal of a predetermined frequency.

  4. Multiscale global identification of porous structures

    Science.gov (United States)

    Hatłas, Marcin; Beluch, Witold

    2018-01-01

    The paper is devoted to the evolutionary identification of the material constants of porous structures based on measurements conducted on a macro scale. Numerical homogenization with the RVE concept is used to determine the equivalent properties of a macroscopically homogeneous material. Finite element method software is applied to solve the boundary-value problem in both scales. Global optimization methods in form of evolutionary algorithm are employed to solve the identification task. Modal analysis is performed to collect the data necessary for the identification. A numerical example presenting the effectiveness of proposed attitude is attached.

  5. Isotopic identification of intestinal strangulation

    International Nuclear Information System (INIS)

    Anderson, M.C.; Selby, J.B.

    1982-01-01

    A small series of eleven dogs prepared with a strangulating segment of jejunum demonstrated that a radionuclide, 99 mTc-labelled albumin, concentrates in the lumen and bowel wall of the affected intestinal segment. Modern scanning equipment accurately localized the strangulating loop. This technique has the potential of identifying patients with intestinal obstruction, in whom strangulation is a factor, prior to the development of impaired arterial inflow and frank gangrene. These findings confirmed earlier obstructions that were reported when nuclear scanning instrumentation was less sophisticated. Identification of patients at risk for intestinal strangulation requires a high index of suspicion. Excruciating cramping abdominal pain out of proportion to physical findings, roentgenogram evidence, and laboratory studies should alert the physician to the possibility of intestinal ischemia and closed loop obstruction. Radionuclide scanning in such cases may be of assistance in defining or excluding the diagnosis of a strangulating mechanism. The test is simple, relatively economical, and represents a low risk procedure to patients. It would have no place when the classic physical and laboratory findings of intestinal infarction are present

  6. Pride, Shame and Group Identification

    DEFF Research Database (Denmark)

    Salice, Alessandro; Montes Sanchez, Alba

    2016-01-01

    into the way in which the notion of group identification can allow for an account of hetero-induced shame and pride, this paper attempts to achieve a sort of mutual enlightenment that brings to light not only an important and generally neglected form of self-conscious emotions, but also relevant features...... scenarios of shame and pride induced by others can be accommodated by taking seriously the consideration that, in such cases, the subject “group-identifies” with the other. This is the idea that, in feeling these forms of shame or pride, the subject is conceiving of herself as a member of the same group...... as the subject acting shamefully or in an admirable way. In other words, these peculiar emotive responses are elicited in the subject insofar as, and to the extent that, she is (or sees herself as being) a member of a group – the group to which those who act shamefully or admirably also belong. By looking...

  7. Identification and analysis of needs

    International Nuclear Information System (INIS)

    Mendes de Magalhaes, E.

    1989-01-01

    Where the protection of human life is concerned, we consider that the identification and analysis of the requirements imposed by scientific developments must take into account their history, their applications and, clearly, their impact on biological environments. Now, scientific developments in the field of ionizing radiation have revealed that living beings are continuously subjected, from the moment of conception to death, to the influence of radiation with a wide range of stochastic and non-stochastic effects. However, cosmic radiation and the presence of radioactive elements in the soil, in the atmosphere and inside living beings constitute a group of factors considered to be in equilibrium with the biological environment, though they may be responsible for the spontaneous mutations that arise in any generation. The action of ionizing radiation of natural origin on the biological environment and heredity is a vast field of research, providing the basis from which the fundamental concepts of the science of radiation protection can be derived. However, we have to start from the above-mentioned assumption that the biological environment and the action or effect of natural radiation are in a state of equilibrium. This assumption underlies the philosophy of radiation protection, as illustrated by the ALARA principle

  8. Isotopic identification of intestinal strangulation

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, M.C.; Selby, J.B.

    1982-12-01

    A small series of eleven dogs prepared with a strangulating segment of jejunum demonstrated that a radionuclide, /sup 99/mTc-labelled albumin, concentrates in the lumen and bowel wall of the affected intestinal segment. Modern scanning equipment accurately localized the strangulating loop. This technique has the potential of identifying patients with intestinal obstruction, in whom strangulation is a factor, prior to the development of impaired arterial inflow and frank gangrene. These findings confirmed earlier obstructions that were reported when nuclear scanning instrumentation was less sophisticated. Identification of patients at risk for intestinal strangulation requires a high index of suspicion. Excruciating cramping abdominal pain out of proportion to physical findings, roentgenogram evidence, and laboratory studies should alert the physician to the possibility of intestinal ischemia and closed loop obstruction. Radionuclide scanning in such cases may be of assistance in defining or excluding the diagnosis of a strangulating mechanism. The test is simple, relatively economical, and represents a low risk procedure to patients. It would have no place when the classic physical and laboratory findings of intestinal infarction are present.

  9. A new paradigm for known metabolite identification in metabonomics/metabolomics: metabolite identification efficiency.

    Science.gov (United States)

    Everett, Jeremy R

    2015-01-01

    A new paradigm is proposed for assessing confidence in the identification of known metabolites in metabonomics studies using NMR spectroscopy approaches. This new paradigm is based upon the analysis of the amount of metabolite identification information retrieved from NMR spectra relative to the molecular size of the metabolite. Several new indices are proposed including: metabolite identification efficiency (MIE) and metabolite identification carbon efficiency (MICE), both of which can be easily calculated. These indices, together with some guidelines, can be used to provide a better indication of known metabolite identification confidence in metabonomics studies than existing methods. Since known metabolite identification in untargeted metabonomics studies is one of the key bottlenecks facing the science currently, it is hoped that these concepts based on molecular spectroscopic informatics, will find utility in the field.

  10. A New Paradigm for Known Metabolite Identification in Metabonomics/Metabolomics: Metabolite Identification Efficiency

    Directory of Open Access Journals (Sweden)

    Jeremy R. Everett

    2015-01-01

    Full Text Available A new paradigm is proposed for assessing confidence in the identification of known metabolites in metabonomics studies using NMR spectroscopy approaches. This new paradigm is based upon the analysis of the amount of metabolite identification information retrieved from NMR spectra relative to the molecular size of the metabolite. Several new indices are proposed including: metabolite identification efficiency (MIE and metabolite identification carbon efficiency (MICE, both of which can be easily calculated. These indices, together with some guidelines, can be used to provide a better indication of known metabolite identification confidence in metabonomics studies than existing methods. Since known metabolite identification in untargeted metabonomics studies is one of the key bottlenecks facing the science currently, it is hoped that these concepts based on molecular spectroscopic informatics, will find utility in the field.

  11. ISOLATION AND IDENTIFICATION OF FUNGI RESPONSIBLE FOR ...

    African Journals Online (AJOL)

    User

    technique. The diseased plant leaves were taken to the laboratory for culture, isolation, and identification ... The tree is native to Asia particularly eastern India, Burma, and the Andaman ..... in Southeastern Nigeria and Biological. Control with ...

  12. 2012 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2012 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  13. Forensic radiology: An emerging tool in identification

    Directory of Open Access Journals (Sweden)

    Raghav Kumar

    2015-01-01

    Full Text Available In any mass disaster condition, identification of the person is most important. For this purpose, the forensic investigators use different methods for identifying the dead. They consider skeletal remains of the dead as the initial step in identification. Radiographs carry great evidence to act as antemortem records and also assist in identifying the person, age, gender, race, etc. Forensic dentistry is also emerging as a new branch in forensics. So, the forensic dentist must be aware of different techniques, developments, and resources to incorporate the technology in order to achieve success in human identification. So, our aim of the present review is to focus on different radiological techniques and new developments available for successful identification of the dead.

  14. 2014 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2014 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  15. Training Needs Identification: A Turning Point.

    Science.gov (United States)

    Thomas, Edwin A.

    1982-01-01

    Describes a systematic approach to training needs identification that is directly tied to changing organizational events and performance requirements. The discussion includes nine questions which address performance expectations. (JJD)

  16. 2009 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2009 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  17. rights reserved Geophysical Identification of Hydrothermally Altered

    African Journals Online (AJOL)

    ADOWIE PERE

    Geophysical Identification of Hydrothermally Altered Structures That Favour .... aircraft. Total line kilometers of 36,500 were covered in the survey. Magnetic ... tie lines occur at about 2000 metres interval in the ... visual inspection of the map.

  18. Overview: Clinical Identification of Sexually Abused Children.

    Science.gov (United States)

    Corwin, David L.; Olafson, Erna

    1993-01-01

    This introduction to the special issue on clinical identification of sexually abused children reviews the history of the study of child sexual abuse and describes the 14 papers included in the special issue. (JDD)

  19. Identification of Intellectually Able Disadvantaged Filipino Children.

    Science.gov (United States)

    Naval-Severino, Teresita

    1992-01-01

    Preschool Filipino children from disadvantaged urban communities were assessed for giftedness. This article describes the identification procedures and tools used and presents a profile of the children in terms of socioeconomic, intellectual, and personality variables. (Author/JDD)

  20. 25 CFR 249.3 - Identification cards.

    Science.gov (United States)

    2010-04-01

    ... the issuance of an appropriate identification card to any Indian entitled thereto as prima facie... any Federal, State, or tribal enforcement officer shall be prima facie evidence that the person is not...

  1. Biometric National Identification Number Generation for Secure ...

    African Journals Online (AJOL)

    Biometric National Identification Number Generation for Secure Network Authentication Based Fingerprint. ... Username, Password, Remember me, or Register ... In this paper an authentication based finger print biometric system is proposed ...

  2. HMSRP Hawaiian Monk Seal Photo Identification Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This photo collection contains identification and other images and video of Hawaiian monk seals taken by PSD personnel and cooperating scientists as part of the...

  3. Raman and Photoluminescence Spectroscopy in Mineral Identification

    Science.gov (United States)

    Kuehn, J. W.

    2014-06-01

    Raman spectroscopy is particularly useful for rapid identification of minerals and gemstones. Raman spectrometers also allow PL studies for authentication of samples and geological provenance, diamond type screening and detection of HPHT treatments.

  4. Species identification and antifungal susceptibility pattern of ...

    African Journals Online (AJOL)

    Dalia Saad ElFeky

    2015-10-23

    Oct 23, 2015 ... gram Statistical Package for the Social Science (SPSS; SPSS. Inc., Chicago, IL .... reported from Saudi Arabia,28 Yemen29 and Kuwait,30 respec- tively. ... media was sufficient to make a final identification. Chromogenic ...

  5. 2010 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2010 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  6. 2011 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2011 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  7. Unsupervised statistical identification of genomic islands using ...

    Indian Academy of Sciences (India)

    Vibrio species. These investigations lead to observations that are of evolutionary ... Identification of genomic islands in prokaryotic genomes has received considerable attention in the literature due to .... For instance, selective pres- sures as a ...

  8. Early Identification of Psychosis: A Primer

    OpenAIRE

    Early Psychosis Initiative of British Columbia

    2000-01-01

    This document is an educational resource concerning the early identification of psychosis. Primary topics addressed include: an outline of the importance of early intervention; signs and symptoms of psychosis; and strategies for recognizing psychosis.  

  9. RESEARCH NOTE Parentage identification of Odontobutis ...

    Indian Academy of Sciences (India)

    44738

    Microsatellite-based parentage identification technology has been widely used .... (201505059), Jiangsu Province Six Talent Peaks of High Level Talents Project ... Kalinowski S. T., Taper M. L., Marshall T. C. 2007 Revising how the computer.

  10. 47 CFR 74.882 - Station identification.

    Science.gov (United States)

    2010-10-01

    ...'s call sign or designator, its location, and the call sign of the broadcasting station or name of... operation. Identification may be made by transmitting the station call sign by visual or aural means or by...

  11. OPTICAL correlation identification technology applied in underwater laser imaging target identification

    Science.gov (United States)

    Yao, Guang-tao; Zhang, Xiao-hui; Ge, Wei-long

    2012-01-01

    The underwater laser imaging detection is an effective method of detecting short distance target underwater as an important complement of sonar detection. With the development of underwater laser imaging technology and underwater vehicle technology, the underwater automatic target identification has gotten more and more attention, and is a research difficulty in the area of underwater optical imaging information processing. Today, underwater automatic target identification based on optical imaging is usually realized with the method of digital circuit software programming. The algorithm realization and control of this method is very flexible. However, the optical imaging information is 2D image even 3D image, the amount of imaging processing information is abundant, so the electronic hardware with pure digital algorithm will need long identification time and is hard to meet the demands of real-time identification. If adopt computer parallel processing, the identification speed can be improved, but it will increase complexity, size and power consumption. This paper attempts to apply optical correlation identification technology to realize underwater automatic target identification. The optics correlation identification technology utilizes the Fourier transform characteristic of Fourier lens which can accomplish Fourier transform of image information in the level of nanosecond, and optical space interconnection calculation has the features of parallel, high speed, large capacity and high resolution, combines the flexibility of calculation and control of digital circuit method to realize optoelectronic hybrid identification mode. We reduce theoretical formulation of correlation identification and analyze the principle of optical correlation identification, and write MATLAB simulation program. We adopt single frame image obtained in underwater range gating laser imaging to identify, and through identifying and locating the different positions of target, we can improve

  12. A biometric approach to laboratory rodent identification.

    Science.gov (United States)

    Cameron, Jens; Jacobson, Christina; Nilsson, Kenneth; Rögnvaldsson, Thorsteinn

    2007-03-01

    Individual identification of laboratory rodents typically involves invasive methods, such as tattoos, ear clips, and implanted transponders. Beyond the ethical dilemmas they may present, these methods may cause pain or distress that confounds research results. The authors describe a prototype device for biometric identification of laboratory rodents that would allow researchers to identify rodents without the complications of other methods. The device, which uses the rodent's ear blood vessel pattern as the identifier, is fast, automatic, noninvasive, and painless.

  13. Optical identification of A0620-00

    International Nuclear Information System (INIS)

    Wolfson, R.; Boley, F.

    1976-01-01

    Identification of the optical counterpart to the transient x-ray source A0620-00 was made on August 16, 1975, using image tube photography at the McGraw-Hill Observatory on Kitt Peak, Arizona. Spectra taken subsequent to the identification showed no stellar absorption or emission features. Photometric data gave a V magnitude of 11.2 +- 0.1. This is about 8 magnitudes brighter than the object appears on the Palomar Sky Survey

  14. Vulnerability Identification Errors in Security Risk Assessments

    OpenAIRE

    Taubenberger, Stefan

    2014-01-01

    At present, companies rely on information technology systems to achieve their business objectives, making them vulnerable to cybersecurity threats. Information security risk assessments help organisations to identify their risks and vulnerabilities. An accurate identification of risks and vulnerabilities is a challenge, because the input data is uncertain. So-called ’vulnerability identification errors‘ can occur if false positive vulnerabilities are identified, or if vulnerabilities remain u...

  15. P and e identification capabilities CAPRICE

    Energy Technology Data Exchange (ETDEWEB)

    Basini, G. [INFN, Laboratori Nazionali di Frascati, Rome (Italy); Codino, A.; Grimani, C. [Perugia Univ. (Italy)]|[INFN, Perugia (Italy); De Pascale, M.P. [Rome Univ. `Tor Vergata` (Italy)]|[INFN, Rome (Italy); Hof, M. [Siegen Univ. (Germany). Fachbereich Physik; Golden, R.L. [New Mexico State Univ., Las Cruces, NM (United States). Particle Astrophysics Lab.; Brancaccio, F.; Bocciolini, M. [Florence Univ. (Italy)]|[INFN, Florence (Italy); Barbiellini, G.; Boezio, M. [Trieste Univ. (Italy)]|[INFN, Trieste (Italy)

    1995-09-01

    The cosmic antiparticle ring imaging Cherenkov experiment (CAPRICE) flew on a stratospheric balloon 8-9 August 1994 over northern Canada and collected data for more than 21 hours with less than 5 g/cm{sup 2} of residual atmosphere. The instrument includes a solid radiator RICH detector and an electromagnetic calorimeter for particle identification in the magnetic spectrometer. Preliminary antiproton and positron identification capabilities are presented.

  16. Molecular identification of the first SIFamide receptor

    DEFF Research Database (Denmark)

    Jørgensen, Lars M; Hauser, Frank; Cazzamali, Giuseppe

    2006-01-01

    , an impressive sequence conservation (67-77% amino acid sequence identities between the seven-transmembrane areas; 82-87% sequence similarities). The identification of well-conserved SIFamide receptor orthologues in all other insects with a sequenced genome, suggests that the SIFamide/receptor couple must have...... an essential function in arthropods. This paper is the first report on the identification of a SIFamide receptor....

  17. Tax Multipliers: Pitfalls in Measurement and Identification

    OpenAIRE

    Daniel Riera-Crichton; Carlos A. Vegh; Guillermo Vuletin

    2012-01-01

    We contribute to the literature on tax multipliers by analyzing the pitfalls in identification and measurement of tax shocks. Our main focus is on disentangling the discussion regarding the identification of exogenous tax policy shocks (i.e., changes in tax policy that are not the result of policymakers responding to output fluctuations) from the discussion related to the measurement of tax policy (i.e., finding a tax policy variable under the direct control of the policymaker). For this purp...

  18. A new adaptive blind channel identification algorithm

    International Nuclear Information System (INIS)

    Peng Dezhong; Xiang Yong; Yi Zhang

    2009-01-01

    This paper addresses the blind identification of single-input multiple-output (SIMO) finite-impulse-response (FIR) systems. We first propose a new adaptive algorithm for the blind identification of SIMO FIR systems. Then, its convergence property is analyzed systematically. It is shown that under some mild conditions, the proposed algorithm is guaranteed to converge in the mean to the true channel impulse responses in both noisy and noiseless cases. Simulations are carried out to demonstrate the theoretical results.

  19. Fuel number identification method and device

    International Nuclear Information System (INIS)

    Doi, Takami; Seno, Makoto; Kikuchi, Takashi; Sakamoto, Hiromi; Takahashi, Masaki; Tanaka, Keiji.

    1997-01-01

    The present invention provides a method of and a device for automatically identifying fuel numbers impressed on fuel assemblies disposed in a fuel reprocessing facility, power plant and a reactor core at a high speed and at a high identification rate. Namely, three or more character images are photographed for one fuel assembly as an object of the identification under different illumination conditions. As a result, different character images by the number of the illumination directions can be obtained for identical impressed characters. Learning on a neural network system is applied to the images of all of the characters impressed on the fuel assembly obtained under illumination of predetermined directions. Then, result of the identification by the number of the illumination directions can be obtained for each of the characters as an object of the identification. As a result, since the result of the identification is determined based on a theory of decision of majority, highly automatic identification can be realized. (I.S.)

  20. Molecular DNA Analysis in Forensic Identification.

    Science.gov (United States)

    Dumache, Raluca; Ciocan, Veronica; Muresan, Camelia; Enache, Alexandra

    2016-01-01

    Serological and biochemical identification methods used in forensics have several major disadvantages, such as: long time in processing biological sample and lack of sensitivity and specificity. In the last 30 years, DNA molecular analysis has become an important tool in forensic investigations. DNA profiling is based on the short tandem repeats (STR) and aids in human identification from biological samples. Forensic genetics, can provide information on the events which occurred at the crime scene or to supplement other methods of forensic identification. Currently, the methods used in identification are based on polymerase chain reaction (PCR) analyses. This method analyses the autosomal STRs, the Y-chromosome, and the mitochondrial DNA. Correlation of biological samples present at the crime scene with identification, selection, and the probative value factor is therefore the first aspect to be taken into consideration in the forensic genetic analysis. In the last decade, because of the advances in the field of molecular biology, new biomarkers such as: microRNAs (miR), messenger RNA (mRNA), and DNA methylation have been studied and proposed to be used in the forensic identifications of body fluids.

  1. A pragmatics' view of patient identification.

    Science.gov (United States)

    Lichtner, Valentina; Galliers, Julia R; Wilson, Stephanie

    2010-10-01

    Patient identification is a central safety critical aspect of healthcare work. Most healthcare activities require identification of patients by healthcare staff, often in connection with the use of patient records. Indeed, the increasing reliance on electronic systems makes the correct matching of patients with their records a keystone for patient safety. Most research on patient identification has been carried out in hospital settings. The aim was to investigate the process of identification of patients and their records in the context of a primary healthcare clinic. A qualitative field study was carried out at a Walk-In Centre in London (UK). The identification of patients and their records was found to be a context-dependent process, both when formalised in procedures and when relying on informal practices. The authors discovered a range of formal and informal patient identifiers were used in this setting, depending on the task at hand. The theoretical lens of Pragmatics was applied to offer an explanation of this identification process. Context provides the cognitive scaffolding for a process of 'suitably constrained guesswork' about the identity of patients and their records. Implications for practice and for system design are discussed. Practitioners and technology designers should be aware of the risk for misidentifications inherent in this natural information processing activity.

  2. Pitch Correlogram Clustering for Fast Speaker Identification

    Directory of Open Access Journals (Sweden)

    Nitin Jhanwar

    2004-12-01

    Full Text Available Gaussian mixture models (GMMs are commonly used in text-independent speaker identification systems. However, for large speaker databases, their high computational run-time limits their use in online or real-time speaker identification situations. Two-stage identification systems, in which the database is partitioned into clusters based on some proximity criteria and only a single-cluster GMM is run in every test, have been suggested in literature to speed up the identification process. However, most clustering algorithms used have shown limited success, apparently because the clustering and GMM feature spaces used are derived from similar speech characteristics. This paper presents a new clustering approach based on the concept of a pitch correlogram that captures frame-to-frame pitch variations of a speaker rather than short-time spectral characteristics like cepstral coefficient, spectral slopes, and so forth. The effectiveness of this two-stage identification process is demonstrated on the IVIE corpus of 110 speakers. The overall system achieves a run-time advantage of 500% as well as a 10% reduction of error in overall speaker identification.

  3. Forensic bitemark identification: weak foundations, exaggerated claims

    Science.gov (United States)

    Saks, Michael J.; Albright, Thomas; Bohan, Thomas L.; Bierer, Barbara E.; Bowers, C. Michael; Bush, Mary A.; Bush, Peter J.; Casadevall, Arturo; Cole, Simon A.; Denton, M. Bonner; Diamond, Shari Seidman; Dioso-Villa, Rachel; Epstein, Jules; Faigman, David; Faigman, Lisa; Fienberg, Stephen E.; Garrett, Brandon L.; Giannelli, Paul C.; Greely, Henry T.; Imwinkelried, Edward; Jamieson, Allan; Kafadar, Karen; Kassirer, Jerome P.; Koehler, Jonathan ‘Jay’; Korn, David; Mnookin, Jennifer; Morrison, Alan B.; Murphy, Erin; Peerwani, Nizam; Peterson, Joseph L.; Risinger, D. Michael; Sensabaugh, George F.; Spiegelman, Clifford; Stern, Hal; Thompson, William C.; Wayman, James L.; Zabell, Sandy; Zumwalt, Ross E.

    2016-01-01

    Abstract Several forensic sciences, especially of the pattern-matching kind, are increasingly seen to lack the scientific foundation needed to justify continuing admission as trial evidence. Indeed, several have been abolished in the recent past. A likely next candidate for elimination is bitemark identification. A number of DNA exonerations have occurred in recent years for individuals convicted based on erroneous bitemark identifications. Intense scientific and legal scrutiny has resulted. An important National Academies review found little scientific support for the field. The Texas Forensic Science Commission recently recommended a moratorium on the admission of bitemark expert testimony. The California Supreme Court has a case before it that could start a national dismantling of forensic odontology. This article describes the (legal) basis for the rise of bitemark identification and the (scientific) basis for its impending fall. The article explains the general logic of forensic identification, the claims of bitemark identification, and reviews relevant empirical research on bitemark identification—highlighting both the lack of research and the lack of support provided by what research does exist. The rise and possible fall of bitemark identification evidence has broader implications—highlighting the weak scientific culture of forensic science and the law's difficulty in evaluating and responding to unreliable and unscientific evidence. PMID:28852538

  4. Automatic identification of tuberculosis mycobacterium

    Directory of Open Access Journals (Sweden)

    Cicero Ferreira Fernandes Costa Filho

    Full Text Available Introduction According to the Global TB control report of 2013, “Tuberculosis (TB remains a major global health problem. In 2012, an estimated 8.6 million people developed TB and 1.3 million died from the disease. Two main sputum smear microscopy techniques are used for TB diagnosis: Fluorescence microscopy and conventional microscopy. Fluorescence microscopy is a more expensive diagnostic method because of the high costs of the microscopy unit and its maintenance. Therefore, conventional microscopy is more appropriate for use in developing countries. Methods This paper presents a new method for detecting tuberculosis bacillus in conventional sputum smear microscopy. The method consists of two main steps, bacillus segmentation and post-processing. In the first step, the scalar selection technique was used to select input variables for the segmentation classifiers from four color spaces. Thirty features were used, including the subtractions of the color components of different color spaces. In the post-processing step, three filters were used to separate bacilli from artifact: a size filter, a geometric filter and a Rule-based filter that uses the components of the RGB color space. Results In bacillus identification, an overall sensitivity of 96.80% and an error rate of 3.38% were obtained. An image database with 120-sputum-smear microscopy slices of 12 patients with objects marked as bacillus, agglomerated bacillus and artifact was generated and is now available online. Conclusions The best results were obtained with a support vector machine in bacillus segmentation associated with the application of the three post-processing filters.

  5. 33 CFR 181.25 - Hull identification number format.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hull identification number format... (CONTINUED) BOATING SAFETY MANUFACTURER REQUIREMENTS Identification of Boats § 181.25 Hull identification number format. Each of the hull identification numbers required by § 181.23 must consist of twelve...

  6. 33 CFR 181.29 - Hull identification number display.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Hull identification number... SECURITY (CONTINUED) BOATING SAFETY MANUFACTURER REQUIREMENTS Identification of Boats § 181.29 Hull identification number display. Two identical hull identification numbers are required to be displayed on each...

  7. 30 CFR 77.215-1 - Refuse piles; identification.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Refuse piles; identification. 77.215-1 Section... COAL MINES Surface Installations § 77.215-1 Refuse piles; identification. A permanent identification marker, at least six feet high and showing the refuse pile identification number as assigned by the...

  8. 49 CFR 173.194 - Gas identification sets.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Gas identification sets. 173.194 Section 173.194... Gas identification sets. Gas identification sets containing poisonous material must be packaged in... silical gel, gas identification sets may be shipped as follows: (1) If the poisonous material does not...

  9. Applications of surface metrology in firearm identification

    International Nuclear Information System (INIS)

    Zheng, X; Soons, J; Vorburger, T V; Song, J; Renegar, T; Thompson, R

    2014-01-01

    Surface metrology is commonly used to characterize functional engineering surfaces. The technologies developed offer opportunities to improve forensic toolmark identification. Toolmarks are created when a hard surface, the tool, comes into contact with a softer surface and causes plastic deformation. Toolmarks are commonly found on fired bullets and cartridge cases. Trained firearms examiners use these toolmarks to link an evidence bullet or cartridge case to a specific firearm, which can lead to a criminal conviction. Currently, identification is typically based on qualitative visual comparison by a trained examiner using a comparison microscope. In 2009, a report by the National Academies called this method into question. Amongst other issues, they questioned the objectivity of visual toolmark identification by firearms examiners. The National Academies recommended the development of objective toolmark identification criteria and confidence limits. The National Institute of Standards and Technology (NIST) have applied its experience in surface metrology to develop objective identification criteria, measurement methods, and reference artefacts for toolmark identification. NIST developed the Standard Reference Material SRM 2460 standard bullet and SRM 2461 standard cartridge case to facilitate quality control and traceability of identifications performed in crime laboratories. Objectivity is improved through measurement of surface topography and application of unambiguous surface similarity metrics, such as the maximum value (ACCF MAX ) of the areal cross correlation function. Case studies were performed on consecutively manufactured tools, such as gun barrels and breech faces, to demonstrate that, even in this worst case scenario, all the tested tools imparted unique surface topographies that were identifiable. These studies provide scientific support for toolmark evidence admissibility in criminal court cases. (paper)

  10. A multiple identity approach to gender : Identification with women, identification with feminists, and their interaction

    NARCIS (Netherlands)

    van Breen, Jolien A.; Spears, Russell; Kuppens, Toon; de Lemus, Soledad

    2017-01-01

    Across four studies, we examine multiple identities in the context of gender and propose that women's attitudes toward gender group membership are governed by two largely orthogonal dimensions of gender identity: identification with women and identification with feminists. We argue that

  11. Multimodal Person Re-identification Using RGB-D Sensors and a Transient Identification Database

    DEFF Research Database (Denmark)

    Møgelmose, Andreas; Moeslund, Thomas B.; Nasrollahi, Kamal

    2013-01-01

    This paper describes a system for person re-identification using RGB-D sensors. The system covers the full flow, from detection of subjects, over contour extraction, to re-identification using soft biometrics. The biometrics in question are part-based color histograms and the subjects height...

  12. Performance Assessment of the CapitalBio Mycobacterium Identification Array System for Identification of Mycobacteria

    Science.gov (United States)

    Liu, Jingbo; Yan, Zihe; Han, Min; Han, Zhijun; Jin, Lingjie; Zhao, Yanlin

    2012-01-01

    The CapitalBio Mycobacterium identification microarray system is a rapid system for the detection of Mycobacterium tuberculosis. The performance of this system was assessed with 24 reference strains, 486 Mycobacterium tuberculosis clinical isolates, and 40 clinical samples and then compared to the “gold standard” of DNA sequencing. The CapitalBio Mycobacterium identification microarray system showed highly concordant identification results of 100% and 98.4% for Mycobacterium tuberculosis complex (MTC) and nontuberculous mycobacteria (NTM), respectively. The sensitivity and specificity of the CapitalBio Mycobacterium identification array for identification of Mycobacterium tuberculosis isolates were 99.6% and 100%, respectively, for direct detection and identification of clinical samples, and the overall sensitivity was 52.5%. It was 100% for sputum, 16.7% for pleural fluid, and 10% for bronchoalveolar lavage fluid, respectively. The total assay was completed in 6 h, including DNA extraction, PCR, and hybridization. The results of this study confirm the utility of this system for the rapid identification of mycobacteria and suggest that the CapitalBio Mycobacterium identification array is a molecular diagnostic technique with high sensitivity and specificity that has the capacity to quickly identify most mycobacteria. PMID:22090408

  13. Secret-key and identification rates for biometric identification systems with protected templates

    NARCIS (Netherlands)

    Ignatenko, T.; Willems, F.M.J.

    2010-01-01

    In this paper we consider secret generation in biometric identification systems with protected templates. This problem is closely related to the study of the bio metric identification capacity [Willems et al., 2003] and [O’Sullivan and Sclmmid, 2002] and the common randomness generation scheme

  14. Anaplasmose bovina: parâmetros clínicos e de patologia clínica em bezerros infectados experimentalmente.: parâmetros clínicos e de patologia clínica em bezerros infectados experimentalmente.

    OpenAIRE

    Leonardo Costa Tavares Coelho

    2007-01-01

    Avaliou-se o comportamento dos parâmetros de patologia clínica em cinco bezerros HPB, com idade entre 90 e 120 dias, inoculados com Anaplasma marginale. O período médio de incubação foi de 13 dias, a duração do período patente, quando foram realizadas as análises, foi de 14 dias e o período convalescente durou 10 dias. Foram avaliadas as alterações no equilíbrio ácido-básico, perfil eletrolítico, parâmetros bioquímicos e hematológicos. Os animais apresentaram anemia, inicialmente normocítica ...

  15. Oil pollution identification and dating

    International Nuclear Information System (INIS)

    Muet, B.; L'Ecluse, J.; Jaegher de, P.

    2005-01-01

    different samples with the relative abundance of these compounds. The next figure shows the decision chart of this method. Relative age determination is an important element to determine the pollution flow through the soil. The age of an organic pollution is determined through its biodegradation. In order to make a relative age determination of the pollution, Gallia Sana calculates the rates of Pristane/C17 and Phytane/C18 in different samples. If rates are similar, the age is the same. Gallia Sana's conclusions are summarized in 3 observations: - Chromatographic analysis showed that the pollution was due to heating fuel. - The identification using the NTCHEM001 method proved that the heating fuel was the same everywhere in the soil. So it comes from 1 source. - The relative age determination indicates that the pollution originated at 1 specific moment in time (1 incident). So, the soil pollution is due to an accidental flow from the fuel tank next to the zone

  16. Oil pollution identification and dating

    Energy Technology Data Exchange (ETDEWEB)

    Muet, B.; L' Ecluse, J.; Jaegher de, P. [Gallia Sana, 59 - Lille (France)

    2005-07-01

    different samples with the relative abundance of these compounds. The next figure shows the decision chart of this method. Relative age determination is an important element to determine the pollution flow through the soil. The age of an organic pollution is determined through its biodegradation. In order to make a relative age determination of the pollution, Gallia Sana calculates the rates of Pristane/C17 and Phytane/C18 in different samples. If rates are similar, the age is the same. Gallia Sana's conclusions are summarized in 3 observations: - Chromatographic analysis showed that the pollution was due to heating fuel. - The identification using the NTCHEM001 method proved that the heating fuel was the same everywhere in the soil. So it comes from 1 source. - The relative age determination indicates that the pollution originated at 1 specific moment in time (1 incident). So, the soil pollution is due to an accidental flow from the fuel tank next to the zone.

  17. Electron identification with the ATLAS detector

    CERN Document Server

    Tarna, Grigore; The ATLAS collaboration

    2017-01-01

    Electron identification is a crucial input to many ATLAS physics analysis. The electron identification used in ATLAS for run 2 is based on a likelihood discrimination to separate isolated electron candidates from candidates originating from photon conversions, hadron misidentification and heavy flavor decays. In addition, isolation variables are used as further handles to separate signal and background. The measurement of the efficiencies of the electron identification and isolationcuts are performed with the data using tag and probe techniques with large statistics sample of Z->ee and J/psi->ee decays. These measurements performed with pp collisions data at sqrt(s)=13 TeV in 2016 (2015) corresponding to an integrated luminosity of 33.9 (3.2) fb-1 of sqrt(s)=13 TeV pp are presented.

  18. Electron identification with the ATLAS detector

    CERN Document Server

    Tarna, Grigore; The ATLAS collaboration

    2017-01-01

    Electron identification is a crucial input to many ATLAS physics analysis. The electron identification used in ATLAS for run 2 is based on a likelihood discrimination to separate isolated electron candidates from candidates originating from photon conversions, hadron misidentification and heavy flavor decays. In addition, isolation variables are used as further handles to separate signal and background. The measurement of the efficiencies of the electron identification and isolationcuts are performed with the data using tag and probe techniques with large statistics sample of Z->ee and J/psi->ee decays. These measurements performed with pp collisions data at sqrt(s)=13 TeV in 2016 (2015) corresponding to an integrated luminosity of 33.9 (3.1)fb-1 of sqrt(s)=13 TeV pp are presented.

  19. Thermal processes identification using virtual instrumentation

    Directory of Open Access Journals (Sweden)

    Iosif OLAH

    2007-12-01

    Full Text Available In this paper the experimental identification problem of thermal processes is presented, in order to establish their mathematical models which permit the adoption of the automation solutions, respectively the specification of a suitable control law. With this aim in view, the authors resorted to use Virtual Instrumentation with the aid of the LabVIEW development medium. In order to solve the problem of acquisition and processing data from physical real processes, Virtual Instruments which provide at the end a mathematical model which is basis of choosing the automation equipment of the aim followed was designed and achieved. The achieved Virtual Instruments get the opportunity to be used either in student instruction field with the virtual processes identification techniques or to put the identification of some real processes to good use of diverse beneficiaries. The results of some experimental attempts which were achieved during different thermal processes, illustrate the utility of the demarches performed in this paper.

  20. Identification of Microorganisms by Modern Analytical Techniques.

    Science.gov (United States)

    Buszewski, Bogusław; Rogowska, Agnieszka; Pomastowski, Paweł; Złoch, Michał; Railean-Plugaru, Viorica

    2017-11-01

    Rapid detection and identification of microorganisms is a challenging and important aspect in a wide range of fields, from medical to industrial, affecting human lives. Unfortunately, classical methods of microorganism identification are based on time-consuming and labor-intensive approaches. Screening techniques require the rapid and cheap grouping of bacterial isolates; however, modern bioanalytics demand comprehensive bacterial studies at a molecular level. Modern approaches for the rapid identification of bacteria use molecular techniques, such as 16S ribosomal RNA gene sequencing based on polymerase chain reaction or electromigration, especially capillary zone electrophoresis and capillary isoelectric focusing. However, there are still several challenges with the analysis of microbial complexes using electromigration technology, such as uncontrolled aggregation and/or adhesion to the capillary surface. Thus, an approach using capillary electrophoresis of microbial aggregates with UV and matrix-assisted laser desorption ionization time-of-flight MS detection is presented.

  1. Biometric identification using knee X-rays.

    Science.gov (United States)

    Shamir, Lior; Ling, Shari; Rahimi, Salim; Ferrucci, Luigi; Goldberg, Ilya G

    2009-01-01

    Identification of people often makes use of unique features of the face, fingerprints and retina. Beyond this, a similar identifying process can be applied to internal parts of the body that are not visible to the unaided eye. Here we show that knee X-rays can be used for the identification of individual persons. The image analysis method is based on the wnd-charm algorithm, which has been found effective for the diagnosis of clinical conditions of knee joints. Experimental results show that the rank-10 identification accuracy using a dataset of 425 individuals is ~56%, and the rank-1 accuracy is ~34%. The dataset contained knee X-rays taken several years apart from each other, showing that the identifiable features correspond to specific persons, rather than the present clinical condition of the joint.

  2. Ultrasonographic identification of the cricothyroid membrane

    DEFF Research Database (Denmark)

    Kristensen, M S; Teoh, W H; Rudolph, S S

    2016-01-01

    Inability to identify the cricothyroid membrane by inspection and palpation contributes substantially to the high failure rate of cricothyrotomy. This narrative review summarizes the current evidence for application of airway ultrasonography for identification of the cricothyroid membrane compare...... ultrasonographic identification; a service that we should aim at making available in all locations where anaesthesia is undertaken and where patients with difficult airways could be encountered.......Inability to identify the cricothyroid membrane by inspection and palpation contributes substantially to the high failure rate of cricothyrotomy. This narrative review summarizes the current evidence for application of airway ultrasonography for identification of the cricothyroid membrane compared...... with the clinical techniques. We identified the best-documented techniques for bedside use, their success rates, and the necessary training for airway-ultrasound-naïve clinicians. After a short but structured training, the cricothyroid membrane can be identified using ultrasound in difficult patients by previously...

  3. Enhancing Privacy for Biometric Identification Cards

    Directory of Open Access Journals (Sweden)

    2009-01-01

    Full Text Available Most developed countries have started the implementation of biometric electronic identification cards, especially passports. The European Union and the United States of America struggle to introduce and standardize these electronic documents. Due to the personal nature of the biometric elements used for the generation of these cards, privacy issues were raised on both sides of the Atlantic Ocean, leading to civilian protests and concerns. The lack of transparency from the public authorities responsible with the implementation of such identification systems, and the poor technological approaches chosen by these authorities, are the main reasons for the negative popularity of the new identification methods. The following article shows an approach that provides all the benefits of modern technological advances in the fields of biometrics and cryptography, without sacrificing the privacy of those that will be the beneficiaries of the new system

  4. Identification methods for structural health monitoring

    CERN Document Server

    Papadimitriou, Costas

    2016-01-01

    The papers in this volume provide an introduction to well known and established system identification methods for structural health monitoring and to more advanced, state-of-the-art tools, able to tackle the challenges associated with actual implementation. Starting with an overview on fundamental methods, introductory concepts are provided on the general framework of time and frequency domain, parametric and non-parametric methods, input-output or output only techniques. Cutting edge tools are introduced including, nonlinear system identification methods; Bayesian tools; and advanced modal identification techniques (such as the Kalman and particle filters, the fast Bayesian FFT method). Advanced computational tools for uncertainty quantification are discussed to provide a link between monitoring and structural integrity assessment. In addition, full scale applications and field deployments that illustrate the workings and effectiveness of the introduced monitoring schemes are demonstrated.

  5. Complete Hexose Isomer Identification with Mass Spectrometry

    Science.gov (United States)

    Nagy, Gabe; Pohl, Nicola L. B.

    2015-04-01

    The first analytical method is presented for the identification and absolute configuration determination of all 24 aldohexose and 2-ketohexose isomers, including the D and L enantiomers for allose, altrose, galactose, glucose, gulose, idose, mannose, talose, fructose, psicose, sorbose, and tagatose. Two unique fixed ligand kinetic method combinations were discovered to create significant enough energetic differences to achieve chiral discrimination among all 24 hexoses. Each of these 24 hexoses yields unique ratios of a specific pair of fragment ions that allows for simultaneous determination of identification and absolute configuration. This mass spectrometric-based methodology can be readily employed for accurate identification of any isolated monosaccharide from an unknown biological source. This work provides a key step towards the goal of complete de novo carbohydrate analysis.

  6. Nosewitness Identification: Effects of Negative Emotion

    Science.gov (United States)

    Ferreira, Jacqueline; Rocha, Marta; Silva, Carlos F.; Olsson, Mats J.

    2015-01-01

    Every individual has a unique body odor (BO), similar to a fingerprint. In forensic research, identification of culprit BOs has been performed by trained dogs, but not by humans. We introduce the concept of nosewitness identification and present the first experimental results on BO memory in witness situations involving violent crimes. Two experiments indicated that BO associated with male characters in authentic videos could later be identified in BO lineup tests well above chance. Moreover, culprit BO in emotional crime videos could be identified considerably better than the BO of a male person in neutral videos. This indicates that nosewitness identification benefits from emotional encoding. Altogether, the study testifies to the virtue of body odor as a cue to identify individuals observed under negative emotion. PMID:25612211

  7. CEAI: CCM based Email Authorship Identification Model

    DEFF Research Database (Denmark)

    Nizamani, Sarwat; Memon, Nasrullah

    2013-01-01

    In this paper we present a model for email authorship identification (EAI) by employing a Cluster-based Classification (CCM) technique. Traditionally, stylometric features have been successfully employed in various authorship analysis tasks; we extend the traditional feature-set to include some...... more interesting and effective features for email authorship identification (e.g. the last punctuation mark used in an email, the tendency of an author to use capitalization at the start of an email, or the punctuation after a greeting or farewell). We also included Info Gain feature selection based...... reveal that the proposed CCM-based email authorship identification model, along with the proposed feature set, outperforms the state-of-the-art support vector machine (SVM)-based models, as well as the models proposed by Iqbal et al. [1, 2]. The proposed model attains an accuracy rate of 94% for 10...

  8. Crack identification by artificial neural network

    Energy Technology Data Exchange (ETDEWEB)

    Hwu, C.B.; Liang, Y.C. [National Cheng Kung Univ., Tainan (Taiwan, Province of China). Inst. of Aeronaut. and Astronaut.

    1998-04-01

    In this paper, a most popular artificial neural network called the back propagation neural network (BPN) is employed to achieve an ideal on-line identification of the crack embedded in a composite plate. Different from the usual dynamic estimate, the parameters used for the present crack identification are the strains of static deformation. It is known that the crack effects are localized which may not be clearly reflected from the boundary information especially when the data is from static deformation only. To remedy this, we use data from multiple-loading modes in which the loading modes may include the opening, shearing and tearing modes. The results show that our method for crack identification is always stable and accurate no matter how far-away of the test data from its training set. (orig.) 8 refs.

  9. Cost Optimal System Identification Experiment Design

    DEFF Research Database (Denmark)

    Kirkegaard, Poul Henning

    A structural system identification experiment design method is formulated in the light of decision theory, structural reliability theory and optimization theory. The experiment design is based on a preposterior analysis, well-known from the classical decision theory. I.e. the decisions concerning...... reflecting the cost of the experiment and the value of obtained additional information. An example concerning design of an experiment for parametric identification of a single degree of freedom structural system shows the applicability of the experiment design method....... the experiment design are not based on obtained experimental data. Instead the decisions are based on the expected experimental data assumed to be obtained from the measurements, estimated based on prior information and engineering judgement. The design method provides a system identification experiment design...

  10. Personal identification and sex determination using cheiloscopy

    Directory of Open Access Journals (Sweden)

    Ravindra Naik Gugulothu

    2015-01-01

    Full Text Available Introduction: Identification of an individual is a prerequisite for certification of death and for personal, social, and legal reasons. The study of lip prints (cheiloscopy was thought of as a method of identification of a person. It is safe to assume that cheiloscopy, in its present stage of development, has become a means of criminal identification dealing with lip prints. Aims and Objectives: To evaluate the lip prints of different individuals in various parts of the lip, to find out the incidence of any particular pattern in relation to specific gender, to ascertain the authenticity of lip prints as a tool for identification of an individual and establish its evidentiary value. Materials and Methods: The study was conducted on 500 subjects, which included 250 males (4 twins and 250 females, in the age group of 18-30 years. After application of lipstick evenly, the lip print of each subject was obtained on a simple bond paper. The lip prints of each individual were scanned using an image scanner set at a resolution of 600 dpi for better interpretation. Results: We had correctly matched the gender of 487 individuals out of 500 samples taken. We also found that no lip prints were similar among the 500 subjects and even in twins. Interpretation and Conclusion: Along with other traditional methods, cheiloscopy can also serve as a very important tool in the identification of a person based on the characteristic arrangement of lines and grooves appearing on the red portion of the lips. It can be used for sex determination and personal identification for forensic purposes.

  11. FORENSIC LINGUISTICS: AUTOMATIC WEB AUTHOR IDENTIFICATION

    Directory of Open Access Journals (Sweden)

    A. A. Vorobeva

    2016-03-01

    Full Text Available Internet is anonymous, this allows posting under a false name, on behalf of others or simply anonymous. Thus, individuals, criminal or terrorist organizations can use Internet for criminal purposes; they hide their identity to avoid the prosecuting. Existing approaches and algorithms for author identification of web-posts on Russian language are not effective. The development of proven methods, technics and tools for author identification is extremely important and challenging task. In this work the algorithm and software for authorship identification of web-posts was developed. During the study the effectiveness of several classification and feature selection algorithms were tested. The algorithm includes some important steps: 1 Feature extraction; 2 Features discretization; 3 Feature selection with the most effective Relief-f algorithm (to find the best feature set with the most discriminating power for each set of candidate authors and maximize accuracy of author identification; 4 Author identification on model based on Random Forest algorithm. Random Forest and Relief-f algorithms are used to identify the author of a short text on Russian language for the first time. The important step of author attribution is data preprocessing - discretization of continuous features; earlier it was not applied to improve the efficiency of author identification. The software outputs top q authors with maximum probabilities of authorship. This approach is helpful for manual analysis in forensic linguistics, when developed tool is used to narrow the set of candidate authors. For experiments on 10 candidate authors, real author appeared in to top 3 in 90.02% cases, on first place real author appeared in 70.5% of cases.

  12. System Identification A Frequency Domain Approach

    CERN Document Server

    Pintelon, Rik

    2012-01-01

    System identification is a general term used to describe mathematical tools and algorithms that build dynamical models from measured data. Used for prediction, control, physical interpretation, and the designing of any electrical systems, they are vital in the fields of electrical, mechanical, civil, and chemical engineering. Focusing mainly on frequency domain techniques, System Identification: A Frequency Domain Approach, Second Edition also studies in detail the similarities and differences with the classical time domain approach. It high??lights many of the important steps in the identi

  13. On-line signal trend identification

    International Nuclear Information System (INIS)

    Tambouratzis, T.; Antonopoulos-Domis, M.

    2004-01-01

    An artificial neural network, based on the self-organizing map, is proposed for on-line signal trend identification. Trends are categorized at each incoming signal as steady-state, increasing and decreasing, while they are further classified according to characteristics such signal shape and rate of change. Tests with model-generated signals illustrate the ability of the self-organizing map to accurately and reliably perform on-line trend identification in terms of both detection and classification. The proposed methodology has been found robust to the presence of white noise

  14. Optimized Experiment Design for Marine Systems Identification

    DEFF Research Database (Denmark)

    Blanke, M.; Knudsen, Morten

    1999-01-01

    Simulation of maneuvring and design of motion controls for marine systems require non-linear mathematical models, which often have more than one-hundred parameters. Model identification is hence an extremely difficult task. This paper discusses experiment design for marine systems identification...... and proposes a sensitivity approach to solve the practical experiment design problem. The applicability of the sensitivity approach is demonstrated on a large non-linear model of surge, sway, roll and yaw of a ship. The use of the method is illustrated for a container-ship where both model and full-scale tests...

  15. Signal trend identification with fuzzy methods

    International Nuclear Information System (INIS)

    Reifman, J.; Tsoukalas, L. H.; Wang, X.; Wei, T. Y. C.

    1999-01-01

    A fuzzy-logic-based methodology for on-line signal trend identification is introduced. Although signal trend identification is complicated by the presence of noise, fuzzy logic can help capture important features of on-line signals and classify incoming power plant signals into increasing, decreasing and steady-state trend categories. In order to verify the methodology, a code named PROTREN is developed and tested using plant data. The results indicate that the code is capable of detecting transients accurately, identifying trends reliably, and not misinterpreting a steady-state signal as a transient one

  16. Access control and personal identification systems

    CERN Document Server

    Bowers, Dan M

    1988-01-01

    Access Control and Personal Identification Systems provides an education in the field of access control and personal identification systems, which is essential in selecting the appropriate equipment, dealing intelligently with vendors in purchases of the equipment, and integrating the equipment into a total effective system. Access control devices and systems comprise an important part of almost every security system, but are seldom the sole source of security. In order for the goals of the total system to be met, the other portions of the security system must also be well planned and executed

  17. Fundamental problems in fault detection and identification

    DEFF Research Database (Denmark)

    Saberi, Ali; Stoorvogel, Anton A.; Sannuti, Peddapullaiah

    1999-01-01

    For certain fundamental problems in fault detection and identification, the necessary and sufficient conditions for their solvability are derived. These conditions are weaker than the ones found in the literature, since we do not assume any particular structure for the residual generator......For certain fundamental problems in fault detection and identification, the necessary and sufficient conditions for their solvability are derived. These conditions are weaker than the ones found in the literature, since we do not assume any particular structure for the residual generator...

  18. A Multiple Identity Approach to Gender: Identification with Women, Identification with Feminists, and Their Interaction

    Science.gov (United States)

    van Breen, Jolien A.; Spears, Russell; Kuppens, Toon; de Lemus, Soledad

    2017-01-01

    Across four studies, we examine multiple identities in the context of gender and propose that women's attitudes toward gender group membership are governed by two largely orthogonal dimensions of gender identity: identification with women and identification with feminists. We argue that identification with women reflects attitudes toward the content society gives to group membership: what does it mean to be a woman in terms of group characteristics, interests and values? Identification with feminists, on the other hand, is a politicized identity dimension reflecting attitudes toward the social position of the group: what does it mean to be a woman in terms of disadvantage, inequality, and relative status? We examine the utility of this multiple identity approach in four studies. Study 1 showed that identification with women reflects attitudes toward group characteristics, such as femininity and self-stereotyping, while identification with feminists reflects attitudes toward the group's social position, such as perceived sexism. The two dimensions are shown to be largely independent, and as such provide support for the multiple identity approach. In Studies 2–4, we examine the utility of this multiple identity approach in predicting qualitative differences in gender attitudes. Results show that specific combinations of identification with women and feminists predicted attitudes toward collective action and gender stereotypes. Higher identification with feminists led to endorsement of radical collective action (Study 2) and critical attitudes toward gender stereotypes (Studies 3–4), especially at lower levels of identification with women. The different combinations of high vs. low identification with women and feminists can be thought of as reflecting four theoretical identity “types.” A woman can be (1) strongly identified with neither women nor feminists (“low identifier”), (2) strongly identified with women but less so with feminists (

  19. A Multiple Identity Approach to Gender: Identification with Women, Identification with Feminists, and Their Interaction

    Directory of Open Access Journals (Sweden)

    Jolien A. van Breen

    2017-06-01

    Full Text Available Across four studies, we examine multiple identities in the context of gender and propose that women's attitudes toward gender group membership are governed by two largely orthogonal dimensions of gender identity: identification with women and identification with feminists. We argue that identification with women reflects attitudes toward the content society gives to group membership: what does it mean to be a woman in terms of group characteristics, interests and values? Identification with feminists, on the other hand, is a politicized identity dimension reflecting attitudes toward the social position of the group: what does it mean to be a woman in terms of disadvantage, inequality, and relative status? We examine the utility of this multiple identity approach in four studies. Study 1 showed that identification with women reflects attitudes toward group characteristics, such as femininity and self-stereotyping, while identification with feminists reflects attitudes toward the group's social position, such as perceived sexism. The two dimensions are shown to be largely independent, and as such provide support for the multiple identity approach. In Studies 2–4, we examine the utility of this multiple identity approach in predicting qualitative differences in gender attitudes. Results show that specific combinations of identification with women and feminists predicted attitudes toward collective action and gender stereotypes. Higher identification with feminists led to endorsement of radical collective action (Study 2 and critical attitudes toward gender stereotypes (Studies 3–4, especially at lower levels of identification with women. The different combinations of high vs. low identification with women and feminists can be thought of as reflecting four theoretical identity “types.” A woman can be (1 strongly identified with neither women nor feminists (“low identifier”, (2 strongly identified with women but less so with feminists (

  20. A Multiple Identity Approach to Gender: Identification with Women, Identification with Feminists, and Their Interaction.

    Science.gov (United States)

    van Breen, Jolien A; Spears, Russell; Kuppens, Toon; de Lemus, Soledad

    2017-01-01

    Across four studies, we examine multiple identities in the context of gender and propose that women's attitudes toward gender group membership are governed by two largely orthogonal dimensions of gender identity: identification with women and identification with feminists. We argue that identification with women reflects attitudes toward the content society gives to group membership: what does it mean to be a woman in terms of group characteristics, interests and values? Identification with feminists, on the other hand, is a politicized identity dimension reflecting attitudes toward the social position of the group: what does it mean to be a woman in terms of disadvantage, inequality, and relative status? We examine the utility of this multiple identity approach in four studies. Study 1 showed that identification with women reflects attitudes toward group characteristics, such as femininity and self-stereotyping, while identification with feminists reflects attitudes toward the group's social position, such as perceived sexism. The two dimensions are shown to be largely independent, and as such provide support for the multiple identity approach. In Studies 2-4, we examine the utility of this multiple identity approach in predicting qualitative differences in gender attitudes. Results show that specific combinations of identification with women and feminists predicted attitudes toward collective action and gender stereotypes. Higher identification with feminists led to endorsement of radical collective action (Study 2) and critical attitudes toward gender stereotypes (Studies 3-4), especially at lower levels of identification with women. The different combinations of high vs. low identification with women and feminists can be thought of as reflecting four theoretical identity "types." A woman can be (1) strongly identified with neither women nor feminists ("low identifier"), (2) strongly identified with women but less so with feminists ("traditional identifier"), (3

  1. Identification of Fungi by Machine Vision

    DEFF Research Database (Denmark)

    Dørge, Thorsten Carlheim; Carstensen, Jens Michael

    1999-01-01

    This paper presents some methods for identification and classification of fungal colonies into species solely by means of digital image analysis without any additinal chemical analysis needed. The methods described are completly automated hence objective once a digital image of the fungus has bee...

  2. System identification with information theoretic criteria

    NARCIS (Netherlands)

    A.A. Stoorvogel; J.H. van Schuppen (Jan)

    1995-01-01

    textabstractAttention is focused in this paper on the approximation problem of system identification with information theoretic criteria. For a class of problems it is shown that the criterion of mutual information rate is identical to the criterion of exponential-of-quadratic cost and to

  3. Towards a procedure for metaphor identification

    NARCIS (Netherlands)

    Steen, G.J.

    2002-01-01

    This article aims to demonstrate the possibility of a stepwise procedure for metaphor identification. It is situated against the background of a more encompassing and complete five-step procedure for deriving conceptual metaphorical mappings from linguistic metaphors. The mainly cognitive linguistic

  4. Model Identification of Integrated ARMA Processes

    Science.gov (United States)

    Stadnytska, Tetiana; Braun, Simone; Werner, Joachim

    2008-01-01

    This article evaluates the Smallest Canonical Correlation Method (SCAN) and the Extended Sample Autocorrelation Function (ESACF), automated methods for the Autoregressive Integrated Moving-Average (ARIMA) model selection commonly available in current versions of SAS for Windows, as identification tools for integrated processes. SCAN and ESACF can…

  5. Gait Correlation Analysis Based Human Identification

    Directory of Open Access Journals (Sweden)

    Jinyan Chen

    2014-01-01

    Full Text Available Human gait identification aims to identify people by a sequence of walking images. Comparing with fingerprint or iris based identification, the most important advantage of gait identification is that it can be done at a distance. In this paper, silhouette correlation analysis based human identification approach is proposed. By background subtracting algorithm, the moving silhouette figure can be extracted from the walking images sequence. Every pixel in the silhouette has three dimensions: horizontal axis (x, vertical axis (y, and temporal axis (t. By moving every pixel in the silhouette image along these three dimensions, we can get a new silhouette. The correlation result between the original silhouette and the new one can be used as the raw feature of human gait. Discrete Fourier transform is used to extract features from this correlation result. Then, these features are normalized to minimize the affection of noise. Primary component analysis method is used to reduce the features’ dimensions. Experiment based on CASIA database shows that this method has an encouraging recognition performance.

  6. Modeling and identification for robot motion control

    NARCIS (Netherlands)

    Kostic, D.; Jager, de A.G.; Steinbuch, M.; Kurfess, T.R.

    2004-01-01

    This chapter deals with the problems of robot modelling and identification for high-performance model-based motion control. A derivation of robot kinematic and dynamic models was explained. Modelling of friction effects was also discussed. Use of a writing task to establish correctness of the models

  7. Identification of bacteria using mass spectrometry techniques

    Czech Academy of Sciences Publication Activity Database

    Krásný, Lukáš; Hynek, R.; Hochel, I.

    2013-01-01

    Roč. 353, NOV 2013 (2013), s. 67-79 ISSN 1387-3806 R&D Projects: GA ČR GAP503/10/0664 Institutional support: RVO:61388971 Keywords : Mass spectrometry * Bacteria * Identification Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2013

  8. Vortex identification: new requirements and limitations

    Czech Academy of Sciences Publication Activity Database

    Kolář, Václav

    2007-01-01

    Roč. 28, č. 4 (2007), s. 638-652 ISSN 0142-727X R&D Projects: GA AV ČR IAA2060302 Institutional research plan: CEZ:AV0Z20600510 Keywords : vortex identification * vorticity decomposition * decomposition of motion Subject RIV: BK - Fluid Dynamics Impact factor: 1.283, year: 2007

  9. 78 FR 58785 - Unique Device Identification System

    Science.gov (United States)

    2013-09-24

    ... the UDI system because they are controlled in the supply chain by the kit rather than by constituent... reduce existing obstacles to the adequate identification of medical devices used in the United States. By... stated, ``We support FDA's objective to substantially reduce existing obstacles to the adequate...

  10. Identification of the Bacterial Community Responsible for ...

    African Journals Online (AJOL)

    Identification of bacteria community responsible for decontaminating Eleme petrochemical industrial effluent using 16S PCR denaturing gradient gel electrophoresis (DGGE) was determined. Gene profiles were determined by extracting DNA from bacterial isolates and amplified by polymerase chain reaction (PCR) using ...

  11. Standoff Human Identification Using Body Shape

    Energy Technology Data Exchange (ETDEWEB)

    Matzner, Shari; Heredia-Langner, Alejandro; Amidan, Brett G.; Boettcher, Evelyn J.; Lochtefeld, Darrell; Webb, Timothy

    2015-09-01

    The ability to identify individuals is a key component of maintaining safety and security in public spaces and around critical infrastructure. Monitoring an open space is challenging because individuals must be identified and re-identified from a standoff distance nonintrusively, making methods like fingerprinting and even facial recognition impractical. We propose using body shape features as a means for identification from standoff sensing, either complementing other identifiers or as an alternative. An important challenge in monitoring open spaces is reconstructing identifying features when only a partial observation is available, because of the view-angle limitations and occlusion or subject pose changes. To address this challenge, we investigated the minimum number of features required for a high probability of correct identification, and we developed models for predicting a key body feature—height—from a limited set of observed features. We found that any set of nine randomly selected body measurements was sufficient to correctly identify an individual in a dataset of 4426 subjects. For predicting height, anthropometric measures were investigated for correlation with height. Their correlation coefficients and associated linear models were reported. These results—a sufficient number of features for identification and height prediction from a single feature—contribute to developing systems for standoff identification when views of a subject are limited.

  12. Entropy based file type identification and partitioning

    Science.gov (United States)

    2017-06-01

    energy spectrum,” Proceedings of the Twenty-Ninth International Florida Artificial Intelligence Research Society Conference, pp. 288–293, 2016...ABBREVIATIONS AES Advanced Encryption Standard ANN Artificial Neural Network ASCII American Standard Code for Information Interchange CWT...the identification of file types and file partitioning. This approach has applications in cybersecurity as it allows for a quick determination of

  13. Visual Analysis in Traffic & Re-identification

    DEFF Research Database (Denmark)

    Møgelmose, Andreas

    and analysis, and person re-identification. In traffic sign detection, the work comprises a thorough survey of the state of the art, assembly of the worlds largest public dataset with U.S. traffic signs, and work in machine learning based detection algorithms. It was shown that detection of U.S. traffic signs...

  14. Best Practices in Intellectual Disability Identification

    Science.gov (United States)

    Fiorello, Catherine A.; Jenkins, Tiffany K.

    2018-01-01

    This article is an overview of identification of intellectual disabilities (ID), with a focus on meeting legal and ethical requirements when assessing children from culturally and linguistically diverse backgrounds and those living in poverty. Specific procedures and recommended instruments will be reviewed.

  15. New methodology for a person identification system

    Indian Academy of Sciences (India)

    Abstract. Reliable person identification is a key factor for any safety measure. Unlike other biometrics such as the palm, retina, gait, face and fingerprints, the characteristic of the iris is stable in a person's lifetime. Iris patterns are chaotically distributed and well suited for recognizing persons throughout their lifetime with.

  16. Identifications of Einstein Slew Survey sources

    Science.gov (United States)

    Schachter, Jonathan F.; Elvis, Martin S.; Plummer, David; Fabbiano, G.

    1992-01-01

    The status of identifications of the Einstien Slew Survey, a bright soft x-ray catalog with 550 new x-ray sources, is discussed. Possible counterparts were found for greater than 95 percent of the Slew Survey based on positional coincidences and color-color diagnostics. The survey will be fully identified via upcoming radio and optical observations.

  17. Identification and Characterisation of Major Hydrocarbons in ...

    African Journals Online (AJOL)

    Identification and Characterisation of Major Hydrocarbons in Thermally Degraded Low Density Polyethylene Films. ... There were alkanes, alkenes, halogenated alkanes, and very few aromatics in the liquid product and, the hydrocarbons were observed to range between C10 - C27. The FTIR and GC-MS results show the ...

  18. morphological identification of malaria vectors within anopheles

    African Journals Online (AJOL)

    DR. AMIN

    Africa among the human population. Determination of risk of malaria transmission requires quick and accurate methods of identification of Anopheles mosquitoes especially when targeting vector control. (Maxwell, et al., 2003). Anopheles mosquito transmits malaria. The most important vectors of malaria are members of.

  19. Genre Identification of Very Brief Musical Excerpts

    Science.gov (United States)

    Mace, Sandra T.; Wagoner, Cynthia L.; Teachout, David J.; Hodges, Donald A.

    2012-01-01

    The purpose of this study was to examine how well individuals were able to identify different music genres from very brief excerpts and whether musical training, gender and preference played a role in genre identification. Listeners were asked to identify genre from classical, jazz, country, metal, and rap/hip hop excerpts that were 125, 250, 500,…

  20. Identification of acquired antimicrobial resistance genes

    DEFF Research Database (Denmark)

    Zankari, Ea; Hasman, Henrik; Cosentino, Salvatore

    2012-01-01

    ObjectivesIdentification of antimicrobial resistance genes is important for understanding the underlying mechanisms and the epidemiology of antimicrobial resistance. As the costs of whole-genome sequencing (WGS) continue to decline, it becomes increasingly available in routine diagnostic laborato......ObjectivesIdentification of antimicrobial resistance genes is important for understanding the underlying mechanisms and the epidemiology of antimicrobial resistance. As the costs of whole-genome sequencing (WGS) continue to decline, it becomes increasingly available in routine diagnostic...... laboratories and is anticipated to substitute traditional methods for resistance gene identification. Thus, the current challenge is to extract the relevant information from the large amount of generated data.MethodsWe developed a web-based method, ResFinder that uses BLAST for identification of acquired...... antimicrobial resistance genes in whole-genome data. As input, the method can use both pre-assembled, complete or partial genomes, and short sequence reads from four different sequencing platforms. The method was evaluated on 1862 GenBank files containing 1411 different resistance genes, as well as on 23 de...

  1. Identification of a mammalian silicon transporter

    NARCIS (Netherlands)

    Ratcliffe, Sarah; Jugdaohsingh, Ravin; Vivancos, Julien; Marron, Alan; Deshmukh, Rupesh; Ma, Jian Feng; Mitani-Ueno, Namiki; Robertson, Jack; Wills, John; Boekschoten, Mark V.; Müller, Michael; Mawhinney, Robert C.; Kinrade, Stephen D.; Isenring, Paul; Bélanger, Richard R.; Powell, Jonathan J.

    2017-01-01

    Silicon (Si) has long been known to play a major physiological and structural role in certain organisms, including diatoms, sponges, and many higher plants, leading to the recent identification of multiple proteins responsible for Si transport in a range of algal and plant species. In mammals,

  2. Identification as a Mediator of Celebrity Effects.

    Science.gov (United States)

    Basil, Michael D.

    1996-01-01

    This study examined personal concern, perceived risk, and sexual behavior of 147 college students a year after Magic Johnson announced he tested positive for HIV (Human Immunodeficiency Virus). It found that identification mediates message effects, suggesting that a spokesperson with whom an audience can identify insures the greatest likelihood of…

  3. Identification and optimization problems in plasma physics

    International Nuclear Information System (INIS)

    Gilbert, J.C.

    1986-06-01

    Parameter identification of the current in a tokamak plasma is studied. Plasma equilibrium in a vacuum container with a diaphragm is analyzed. A variable metric method with reduced optimization with nonlinear equality constraints; and a quasi-Newton reduced optimization method with constraints giving priority to restoration are presented [fr

  4. Identification of spectral units on Phoebe

    OpenAIRE

    Coradini , A.; Tosi , F.; Gavrishin , A.I.; Capaccioni , F.; Cerroni , P.; Filacchione , G.; Adriani , A.; Brown , R.H.; Bellucci , G.; Formisano , V.; D'Aversa , E.; Lunine , J.I.; Baines , K.H.; Bibring , J.-P.; Buratti , B.J.

    2008-01-01

    Identification of spectral units on Phoebe (Coradini, A.) INAF-IFSI--> , Istituto di Fisica dello Spazio Interplanetario--> , Area Ricerca Tor Vergata--> , Via Fosso del Cavaliere 100--> , I-00133 Roma--> - ITALY (Coradini, A.) INAF-IFSI--> , Istituto di Fisica dello Spazio Interplanetario--> , Area Ricerca Tor Vergata--> , Via Fosso del Cavaliere 100--> , I-00133 Roma--> ...

  5. Identification of potentially competing Afrotropical and Palaearctic ...

    African Journals Online (AJOL)

    Identification of potentially competing Afrotropical and Palaearctic bird species in the Sahel. Jared M Wilson, Will RL Cresswell. Abstract. Areas experiencing a seasonal influx of migrants may be expected to have a high potential for competition between resident and migrant populations. Described differences in foraging ...

  6. Lineup Administrator Influences on Eyewitness Identification Decisions

    Science.gov (United States)

    Clark, Steven E.; Marshall, Tanya E.; Rosenthal, Robert

    2009-01-01

    The present research examines how a lineup administrator may influence eyewitness identification decisions through different forms of influence, after providing the witness with standard, unbiased instructions. Participant-witnesses viewed a staged crime and were later shown a target-present or target-absent lineup. The lineup administrators…

  7. Writer identification using curvature-free features

    NARCIS (Netherlands)

    He, Sheng; Schomaker, Lambertus

    2017-01-01

    Feature engineering takes a very important role in writer identification which has been widely studied in the literature. Previous works have shown that the joint feature distribution of two properties can improve the performance. The joint feature distribution makes feature relationships explicit

  8. Robust structural identification via polyhedral template matching

    DEFF Research Database (Denmark)

    Larsen, Peter Mahler; Schmidt, Søren; Schiøtz, Jakob

    2016-01-01

    Successful scientific applications of large-scale molecular dynamics often rely on automated methods for identifying the local crystalline structure of condensed phases. Many existing methods for structural identification, such as common neighbour analysis, rely on interatomic distances (or thres...... is made available under a Free and Open Source Software license....

  9. Particle identification at an asymmetric B Factory

    International Nuclear Information System (INIS)

    Coyle, P.; Eigen, G.; Hitlin, D.; Oddone, P.; Ratcliff, B.; Roe, N.; Va'vra, J.; Ypsilantis, T.

    1991-09-01

    Particle identification systems are an important component of any detector at a high-luminosity, asymmetric B Factory. In particular, excellent hadron identification is required to probe CP violation in B 0 decays to CP eigenstates. The particle identification systems discussed below also provide help in separating leptons from hadrons at low momenta. We begin this chapter with a discussion of the physics motivation for providing particle identification, the inherent limitations due to interactions and decays in flight, and the requirements for hermiticity and angular coverage. A special feature of an asymmetric B Factory is the resulting asymmetry in the momentum distribution as a function of polar angle; this will also be quantified and discussed. In the next section the three primary candidates, time-of-flight (TOF), energy loss (dE/dx), and Cerenkov counters, both ring-imaging and threshold, will be briefly described and evaluated. Following this, one of the candidates, a long-drift Cerenkov ring-imaging device, is described in detail to provide a reference design. Design considerations for a fast RICH are then described. A detailed discussion of aerogel threshold counter designs and associated R ampersand D conclude the chapter. 56 refs., 64 figs., 13 tabs

  10. Stimulus Probability Effects in Absolute Identification

    Science.gov (United States)

    Kent, Christopher; Lamberts, Koen

    2016-01-01

    This study investigated the effect of stimulus presentation probability on accuracy and response times in an absolute identification task. Three schedules of presentation were used to investigate the interaction between presentation probability and stimulus position within the set. Data from individual participants indicated strong effects of…

  11. Implant - Identification Tool for Forensic Dentistry

    Czech Academy of Sciences Publication Activity Database

    Dostálová, T.; Eliášová, H.; Seydlová, M.; Zvárová, Jana

    2008-01-01

    Roč. 19, č. 9 (2008), s. 926-926 ISSN 0905-7161. [EAO Annual Scientific Meeting /17./. 18.09.2008-20.09.2008, Warsaw] R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : forensic dentistry * identification * electronic health record Subject RIV: IN - Informatics, Computer Science

  12. A microbial identification framework for risk assessment.

    Science.gov (United States)

    Bernatchez, Stéphane; Anoop, Valar; Saikali, Zeina; Breton, Marie

    2018-06-01

    Micro-organisms are increasingly used in a variety of products for commercial uses, including cleaning products. Such microbial-based cleaning products (MBCP) are represented as a more environmentally-friendly alternative to chemically based cleaning products. The identity of the micro-organisms formulated into these products is often considered confidential business information and is not revealed or it is only partly revealed (i.e., identification to the genus, not to the species). That paucity of information complicates the evaluation of the risk associated with their use. The accurate taxonomic identification of those micro-organisms is important so that a suitable risk assessment of the products can be conducted. To alleviate difficulties associated with adequate identification of micro-organisms in MBCP and other products containing micro-organisms, a microbial identification framework for risk assessment (MIFRA) has been elaborated. It serves to provide guidance on a polyphasic tiered approach, combining the data obtained from the use of various methods (i.e., polyphasic approach) combined with the sequential selection of the methods (i.e., tiered) to achieve a satisfactory identity of the micro-organism to an acceptable taxonomic level. The MIFRA is suitable in various risk assessment contexts for micro-organisms used in any commercial product. Copyright © 2018. Published by Elsevier Ltd.

  13. Multimodal Authentication Techniques For Staff Identification And ...

    African Journals Online (AJOL)

    PROF. OLIVER OSUAGWA

    2014-12-01

    Dec 1, 2014 ... securing and protecting our identity and valuable data have become areas of great concern ... authentication, verification, tracking and identification systems. It helps to ... managing access while protecting both the ..... Microsoft Operating System XP/Vista, ... range support of fingerprint readers and template.

  14. Original Research Polymerase chain reaction identification of ...

    African Journals Online (AJOL)

    Molecular identification of T. b. rhodesiense in tsetse flies 11 ... Glossina bravepalpis, and Glossina fuscipes fuscipes5-7) are mainly confined ..... that the feeding habits of these flies are similar to one ... well established that Glossina morsitans morsitans are efficient ... some people.26,27 Notably, the high infection rates that.

  15. Reformulating Component Identification as Document Analysis Problem

    NARCIS (Netherlands)

    Gross, H.G.; Lormans, M.; Zhou, J.

    2007-01-01

    One of the first steps of component procurement is the identification of required component features in large repositories of existing components. On the highest level of abstraction, component requirements as well as component descriptions are usually written in natural language. Therefore, we can

  16. 2MASS Identifications for Galactic OB Stars

    OpenAIRE

    Reed, B. Cameron

    2007-01-01

    Cross-identifications for 14,574 intrinsically luminous galactic stars (mostly OB stars) to objects in the 2MASS survey have been determined using a search box of +/-0.0015 degrees (+/- 5.4 arcsec) in both RA and Dec. Instructions on obtaining the relevant files can be obtained at othello.alma.edu/~reed/OB-2MASS.doc.

  17. Mycobacterial Species Identification and Public Health Implications ...

    African Journals Online (AJOL)

    Mycobacterial Species Identification and Public Health Implications of Tuberculosis Among Nomadic Pastoralists in Three Local Governments of Plateau State, North ... Bovine and human tuberculosis is endemic in Nigeria, and apart from meat inspection at the abattoir, which is not very effective, no control measures are ...

  18. Language Policy and Group Identification in Taiwan

    Science.gov (United States)

    Liu, Ruey-Ying

    2012-01-01

    Taiwan is a multicultural and multilingual society. Generally speaking, Taiwanese residents fall into one of four ethnic groups. Each ethnic group has a different cultural context and a preferred language. Therefore, one's use of language may reveal his/her identification with an ethnic group, and language policy implementation may imply the power…

  19. Entrepreneurial Idea Identification through Online Social Networks

    Science.gov (United States)

    Lang, Matthew C.

    2010-01-01

    The increasing use of social network websites may signal a change in the way the next generation of entrepreneurs identify entrepreneurial ideas. An important part of the entrepreneurship literature emphasizes how vital the use of social networks is to entrepreneurial idea identification, opportunity recognition, and ultimately new venture…

  20. Uses of particle identification for supercollider physics

    International Nuclear Information System (INIS)

    Quigg, C.

    1989-05-01

    I summarize the basic characteristics of the Superconducting Super Collider and describe the experimental environment of its high- luminosity interaction regions. I then review some of the discovery possibilities opened by the SSC, with special attention to the advantages conferred by particle identification. 16 refs., 8 figs

  1. Online identification of linear loudspeakers parameters

    DEFF Research Database (Denmark)

    Pedersen, Bo Rohde; Rubak, Per

    2007-01-01

    Feed forward nonlinear error correction of loudspeakers can improve sound quality. For creating a realistic feed forward strategy identification of the loudspeaker parameters is needed. The strategy of the compensator is that the nonlinear behaviour of the loudspeakers has relatively small drift...

  2. Weed Identification and Control in Vegetable Crops.

    Science.gov (United States)

    Ferretti, Peter A., Comp.

    This agriculture extension service publication from Pennsylvania State University examines weed control and identification in vegetable crops. Contents include: (1) Types of weeds; (2) Reducing losses caused by weeds, general control methods and home garden weed control; (3) How herbicides are used; (4) Specific weeds in vegetable plantings; and…

  3. Identification of a new human coronavirus

    NARCIS (Netherlands)

    van der Hoek, Lia; Pyrc, Krzysztof; Jebbink, Maarten F.; Vermeulen-Oost, Wilma; Berkhout, Ron J. M.; Wolthers, Katja C.; Wertheim-van Dillen, Pauline M. E.; Kaandorp, Jos; Spaargaren, Joke; Berkhout, Ben

    2004-01-01

    Three human coronaviruses are known to exist: human coronavirus 229E (HCoV-229E), HCoV-OC43 and severe acute respiratory syndrome (SARS)-associated coronavirus (SARS-CoV). Here we report the identification of a fourth human coronavirus, HCoV-NL63, using a new method of virus discovery. The virus was

  4. Talent Identification in Track and Field.

    Science.gov (United States)

    Henson, Phillip; And Others

    Talent identification in most sports occurs through mass participation and the process of natural selection; track and field does not enjoy such widespread participation. This paper reports on a project undertaken for the following purposes: improve the means by which youth with the potential for high level performance can be identified; develop…

  5. Tier identification (TID) for tiered memory characteristics

    Science.gov (United States)

    Chang, Jichuan; Lim, Kevin T; Ranganathan, Parthasarathy

    2014-03-25

    A tier identification (TID) is to indicate a characteristic of a memory region associated with a virtual address in a tiered memory system. A thread may be serviced according to a first path based on the TID indicating a first characteristic. The thread may be serviced according to a second path based on the TID indicating a second characteristic.

  6. Radionuclide identification using subtractive clustering method

    International Nuclear Information System (INIS)

    Farias, Marcos Santana; Mourelle, Luiza de Macedo

    2011-01-01

    Radionuclide identification is crucial to planning protective measures in emergency situations. This paper presents the application of a method for a classification system of radioactive elements with a fast and efficient response. To achieve this goal is proposed the application of subtractive clustering algorithm. The proposed application can be implemented in reconfigurable hardware, a flexible medium to implement digital hardware circuits. (author)

  7. Structural Time Domain Identification Toolbox User's Guide

    DEFF Research Database (Denmark)

    Andersen, P.; Kirkegaard, Poul Henning; Brincker, Rune

    This manual describes the Structural Time Domain Identification toolbox for use with MA TLAB. This version of the tool box has been developed using the PC-based MA TLAB version 4.2c, but is compatible with prior versions of MATLAB and UNIX-based versions. The routines of the toolbox are the so...

  8. Age, job identification, and entrepreneurial intention

    NARCIS (Netherlands)

    Hatak, Isabella; Harms, Rainer; Fink, Matthias

    2015-01-01

    Purpose – The purpose of this paper is to examine how age and job identification affect entrepreneurial intention. Design/methodology/approach – The researchers draw on a representative sample of the Austrian adult workforce and apply binary logistic regression on entrepreneurial intention. Findings

  9. Parameter identification in the logistic STAR model

    DEFF Research Database (Denmark)

    Ekner, Line Elvstrøm; Nejstgaard, Emil

    We propose a new and simple parametrization of the so-called speed of transition parameter of the logistic smooth transition autoregressive (LSTAR) model. The new parametrization highlights that a consequence of the well-known identification problem of the speed of transition parameter is that th...

  10. 47 CFR 74.1283 - Station identification.

    Science.gov (United States)

    2010-10-01

    ... translator's call letters and location, giving the name, address and telephone number of the licensee or his... FM Broadcast Booster Stations § 74.1283 Station identification. (a) The call sign of an FM broadcast... requests for the assignment of particular combinations of letters will not be considered. (b) The call sign...

  11. Silicon vertex detector for superheavy elements identification

    Directory of Open Access Journals (Sweden)

    Bednarek A.

    2012-07-01

    Full Text Available Silicon vertex detector for superheavy elements (SHE identification has been proposed. It will be constructed using very thin silicon detectors about 5 μm thickness. Results of test of 7.3 μm four inch silicon strip detector (SSD with fission fragments and α particles emitted by 252Cf source are presented

  12. Early Identification of Reading Comprehension Difficulties

    Science.gov (United States)

    Catts, Hugh W.; Nielsen, Diane Corcoran; Bridges, Mindy Sittner; Liu, Yi-Syuan

    2016-01-01

    Most research on early identification of reading disabilities has focused on word reading problems and little attention has been given to reading comprehension difficulties. In this study, we investigated whether measures of language ability and/or response to language intervention in kindergarten uniquely predicted reading comprehension…

  13. Efficient Identification of Timed Automata : Theory and practice

    NARCIS (Netherlands)

    Verwer, S.E.

    2010-01-01

    This thesis contains a study in a subfield of artificial intelligence, learning theory, machine learning, and statistics, known as system (or language) identification. System identification is concerned with constructing (mathematical) models from observations. Such a model is an intuitive

  14. Error-Detecting Identification Codes for Algebra Students.

    Science.gov (United States)

    Sutherland, David C.

    1990-01-01

    Discusses common error-detecting identification codes using linear algebra terminology to provide an interesting application of algebra. Presents examples from the International Standard Book Number, the Universal Product Code, bank identification numbers, and the ZIP code bar code. (YP)

  15. Parameter Identification by Bayes Decision and Neural Networks

    DEFF Research Database (Denmark)

    Kulczycki, P.; Schiøler, Henrik

    1994-01-01

    The problem of parameter identification by Bayes point estimation using neural networks is investigated.......The problem of parameter identification by Bayes point estimation using neural networks is investigated....

  16. Molecular identification of Tribolium castaneum and T. confusum ...

    Indian Academy of Sciences (India)

    ful alternative method to identify the two sibling flour beetle species. ∗ ... represents a valuable addition or alternative to traditional phenotypic identification methods. Also, DNA ..... Buczkowski G. and Bennett G. 2009 Survey and identification.

  17. Improved system blind identification based on second-order ...

    Indian Academy of Sciences (India)

    An improved system blind identification method based on second- order cyclostationary statistics and the properties of group delay, has been ... In the last decade, there has been considerable research on achieving blind identification.

  18. System Identification Methods for Aircraft Flight Control Development and Validation

    Science.gov (United States)

    1995-10-01

    System-identification methods compose a mathematical model, or series of models, : from measurements of inputs and outputs of dynamic systems. This paper : discusses the use of frequency-domain system-identification methods for the : development and ...

  19. Eyewitness Identification Reform: Data, Theory, and Due Process.

    Science.gov (United States)

    Clark, Steven E

    2012-05-01

    Some commentators view my analyses (Clark, 2012, this issue) as an important step forward in assessing the costs and benefits of eyewitness identification reform. Others suggest that the trade-off between correct identifications lost and false identifications avoided is well-known; that the expected utility model is misspecified; and that the loss of correct identifications due to the use of reformed eyewitness identification procedures is irrelevant to policy decisions, as those correct identifications are the illegitimate product of suggestion and lucky guesses. Contrary to these criticisms, the loss of correct identifications has not been adequately considered in theoretical or policy matters, criticisms regarding the various utilities do not substantively change the nature of the trade-off, and the dismissal of lost correct identifications is based not on data but on an outdated theory of recognition memory. © The Author(s) 2012.

  20. Organizational identification and the communication of identity: Effects of message characteristics on cognitive and affective identification.

    NARCIS (Netherlands)

    Tanis, M.A.; Beukeboom, C.J.

    2011-01-01

    This paper reports an experimental study (N= 321) that tests how the cognitive and affective component of organizational identification (OI) can be affected by peripheral characteristics of organizational communication. Results show that adding cues in emails that signal organizational identity,