WorldWideScience

Sample records for anaplasma marginale identification

  1. Identification of Anaplasma marginale type IV secretion system effector proteins.

    Directory of Open Access Journals (Sweden)

    Svetlana Lockwood

    Full Text Available BACKGROUND: Anaplasma marginale, an obligate intracellular alphaproteobacterium in the order Rickettsiales, is a tick-borne pathogen and the leading cause of anaplasmosis in cattle worldwide. Complete genome sequencing of A. marginale revealed that it has a type IV secretion system (T4SS. The T4SS is one of seven known types of secretion systems utilized by bacteria, with the type III and IV secretion systems particularly prevalent among pathogenic Gram-negative bacteria. The T4SS is predicted to play an important role in the invasion and pathogenesis of A. marginale by translocating effector proteins across its membrane into eukaryotic target cells. However, T4SS effector proteins have not been identified and tested in the laboratory until now. RESULTS: By combining computational methods with phylogenetic analysis and sequence identity searches, we identified a subset of potential T4SS effectors in A. marginale strain St. Maries and chose six for laboratory testing. Four (AM185, AM470, AM705 [AnkA], and AM1141 of these six proteins were translocated in a T4SS-dependent manner using Legionella pneumophila as a reporter system. CONCLUSIONS: The algorithm employed to find T4SS effector proteins in A. marginale identified four such proteins that were verified by laboratory testing. L. pneumophila was shown to work as a model system for A. marginale and thus can be used as a screening tool for A. marginale effector proteins. The first T4SS effector proteins for A. marginale have been identified in this work.

  2. Identification of a vertically transmitted strain from Anaplasma marginale (UFMG3): Molecular and phylogenetic characterization, and evaluation of virulence.

    Science.gov (United States)

    Silvestre, Bruna T; Silveira, Júlia A G; Meneses, Rodrigo M; Facury-Filho, Elias J; Carvalho, Antônio U; Ribeiro, Múcio F B

    2016-02-01

    Bovine anaplasmosis is a disease caused by the intraerythrocytic rickettsia species Anaplasma marginale and results in great economic losses in tropical and subtropical regions. Vertical transmission is an important phenomenon that contributes to the persistence of different strains of the agent within the same herd. The identification of new strains and genetic characterization studies are essential to understanding their epidemiology and virulence and for vaccine development. The aim of this study was to perform molecular and phylogenetic characterizations of a new vertically transmitted strain from A. marginale and to evaluate its virulence by experimental inoculation of rickettsia-free calves. Thirty newborn Holstein calves were subjected to molecular tests for the detection of A. marginale, Babesia bovis and Babesia bigemina. Calves positive for A. marginale (n=3) were splenectomized and monitored for the clinical manifestations of anaplasmosis. Blood samples from one of the calves that presented rickettsemia of 42.8% and spontaneous recovery of clinical parameters were used for molecular and phylogenetic characterization (msp1a gene), and inoculum production was used for the evaluation of virulence. This strain was identified as UFMG3. Three tandem repeat forms (13 and MGI19) were identified from the analysis of the msp1a gene, in which the form MGI19 appeared twice. Analysis of these repeats revealed the presence of the sequences QASTSS and SSASGQQQESS and of aspartic acid (D) at position 20 of both repeats. Phylogenetic analysis showed a close relationship among the UFMG3, MGI19 and UFMG2 strains. For virulence evaluation, six Holstein calves were inoculated intravenously with 2×10(7)A. marginale UFMG3-infected erythrocytes. The calves showed maximum rickettsemia of 5.1%, a moderate decrease in packed cell volume and spontaneous recovery of clinical parameters without the need for treatment. The results of experimental inoculation suggest that the strain A

  3. Complete Genome Sequence of Anaplasma marginale subsp. centrale

    Science.gov (United States)

    Anaplasma marginale subsp. centrale is a naturally attenuated subtype that has been used as a vaccine for a century. We sequenced the genome of this organism and compared it to those of virulent senso stricto A. marginale strains. The comparison markedly narrows the number of outer membrane protein ...

  4. Anaplasma marginale and Theileria annulata in questing ticks from Portugal.

    Science.gov (United States)

    Antunes, S; Ferrolho, J; Domingues, N; Santos, A S; Santos-Silva, M M; Domingos, A

    2016-09-01

    Ticks are ubiquitous arthropods and vectors of several pathogenic agents in animals and humans. Monitoring questing ticks is of great importance to ascertain the occurrence of pathogens and the potential vector species, offering an insight into the risk of disease transmission in a given area. In this study 428 host-seeking ticks, belonging to nine species of Ixodidae and collected from 17 of the 23 Portuguese mainland subregions, were screened for several tick-borne agents with veterinary relevance: Anaplasma marginale, Anaplasma ovis, Anaplasma centrale, Babesia spp., Coxiella burnetii and Theileria spp. Prevalence was assessed by PCR and amplified amplicons sequenced for validation of results. Twenty ticks, in a total of 428, were found positive: one Ixodes ventalloi for Theileria annulata and four Dermacentor marginatus, one Haemaphysalis punctata, five Ixodes ricinus, five I. ventalloi, and four Rhipicephalus sanguineus sensu lato for A. marginale. According to the reviewed literature, this is the first report of A. marginale and T. annulata detection in I. ventalloi. Furthermore, the amplification of A. marginale DNA in several tick species suggests a broad range for this agent in Portugal that might include other uncommon species as R. sanguineus s.l. This work provides new data towards a better understanding of tick-pathogen associations and also contributes to the surveillance of tick-borne agents in geographic areas with limited information. PMID:27394441

  5. Comparison of Microscopy and PCR-RFLP for detection of Anaplasma marginale in carrier cattle

    Directory of Open Access Journals (Sweden)

    P Shayan

    2010-09-01

    Full Text Available Background and Objectives: In Iran, anaplasmosis is normally diagnosed with traditional Giemsa staining method. This is not applicable for identification of the carrier animals. The aim of this study was to compare the detection of Anaplasma marginale in two different numbers of microscopic fields (50 and 100 using conventional Giemsa staining method compared with the PCR-RFLP technique."nMaterials and Methods: In this study, examinations were performed on 150 blood samples from cattle without clinical signs. Sensitivity and specificity of two microscopic fields (50 and 100 fields were compared with A. marginale specific PCR-RFLP. The degree of agreement between PCR-RFLP and the two microscopic tests was determined by Kappa (κ values with 95% confidence intervals."nResults: PCR-RFLP showed that 58 samples were A. marginale, while routine microscopy showed erythrocytes harboring Anaplasma like structures in 16 and 75 blood samples determined in 50 and 100 microscopic fields respectively. Examination of 50 and 100 microscopic fields showed 25.8% and 91.4% sensitivity and 99% and 76.1% specificity compared to 100% sensitivity and specificity by PCR-RFLP. The Kappa coefficient between PCR-RFLP and Microscopy (50 fields indicated a fair level of agreement (0.29. The Kappa coefficient between PCR-RFLP and Microscopy (100 fields indicated a good level of agreement (0.64"nConclusion: Our results showed that the microscopic examination remains the convenient technique for day-to-day diagnosis of clinical cases in the laboratory but for the detection of carrier animal with low bacteremia, microscopy with 100 fields is preferable to Microscopy with 50 fields and molecular methods such as PCR-RFLP can be used as a safe method for identifying cattle persistently infected with A. marginale.

  6. The pathogen-occupied vacuoles of Anaplasma phagocytophilum and Anaplasma marginale interact with the endoplasmic reticulum

    Directory of Open Access Journals (Sweden)

    Hilary Kay Truchan

    2016-03-01

    Full Text Available The genus Anaplasma consists of tick-transmitted obligate intracellular bacteria that invade white or red blood cells to cause debilitating and potentially fatal infections. A. phagocytophilum, a human and veterinary pathogen, infects neutrophils to cause granulocytic anaplasmosis. A. marginale invades bovine erythrocytes. Evidence suggests that both species may also infect endothelial cells in vivo. In mammalian and arthropod host cells, A. phagocytophilum and A. marginale reside in host cell derived pathogen-occupied vacuoles (POVs. While it was recently demonstrated that the A. phagocytophilum-occupied vacuole (ApV intercepts membrane traffic from the trans-Golgi network, it is unclear if it or the A. marginale-occupied vacuole (AmV interacts with other secretory organelles. Here, we demonstrate that the ApV and AmV extensively interact with the host endoplasmic reticulum (ER in endothelial, myeloid, and/or tick cells. ER lumen markers, calreticulin and protein disulfide isomerase, and the ER membrane marker, derlin-1, were pronouncedly recruited to the peripheries of both POVs. ApV association with the ER initiated early and continued throughout the infection cycle. Both the ApV and AmV interacted with the rough ER and smooth ER. However, only derlin-1-positive rough ER derived vesicles were delivered into the ApV lumen where they localized with intravacuolar bacteria. Transmission electron microscopy identified multiple ER-POV membrane contact sites on the cytosolic faces of both species’ vacuoles that corresponded to areas on the vacuoles’ lumenal faces where intravacuolar Anaplasma organisms closely associated. A. phagocytophilum is known to hijack Rab10, a GTPase that regulates ER dynamics and morphology. Yet, ApV-ER interactions were unhindered in cells in which Rab10 had been knocked down, demonstrating that the GTPase is dispensable for the bacterium to parasitize the ER. These data establish the ApV and AmV as pathogen

  7. Gamma irradiation attenuation of Anaplasma Marginale and its possible use as vaccine against bovine anaplasmosis

    International Nuclear Information System (INIS)

    Bovine Anaplasmosis is one of the limiting in the cattle development at Colombia and others tropical countries. Bovine Anaplasmosis is an infectious disease caused by a microorganism called Anaplasma Marginale, it with invades the red globules producing erythrofagocitosis. In this job, were irradiated with different gamma beam intensity; microorganisms of Anaplasma Marginale, those which were used as innocuous. Animals of the groups (I,II,III) presented good protection against the disease; animals of the Group IV presented mild symptoms with subsequent recovery and strong symptoms

  8. Detection of genetic diversity of Anaplasma marginale isolates in Minas Gerais, Brazil

    Czech Academy of Sciences Publication Activity Database

    Pohl, A.E.; Cabezas Cruz, Alejandro; Ribeiro, M.F.B.; Goncalves da Silvera, J.; Silaghi, C.; Pfister, K.; Friche Passos, L.M.

    2013-01-01

    Roč. 22, č. 1 (2013), s. 129-135. ISSN 1984-2961 Institutional support: RVO:60077344 Keywords : Anaplasma marginale * MSP1a * DNA sequencing * microsatellites * tandem repeats * Brazil Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.961, year: 2013

  9. Subdominant outer membrane antigens in anaplasma marginale: conservation, antigenicity, and protective capacity using recombinant protein

    Science.gov (United States)

    Anaplasma marginale is a tick-borne rickettsial pathogen of cattle with a worldwide distribution. Currently a safe and efficacious vaccine is unavailable. Outer membrane protein (OMP) extracts or a well- defined surface protein complex reproducibly induce protective immunity. However, there are seve...

  10. First Molecular Characterization of Anaplasma marginale in Cattle and Rhipicephalus (Boophilus) microplus Ticks in Cebu, Philippines

    OpenAIRE

    YBAÑEZ, Adrian Patalinghug; Sivakumar, Thillaiampalam; YBAÑEZ, Rochelle Haidee Daclan; RATILLA, Jowarren Catingan; PEREZ, Zandro Obligado; GABOTERO, Shirleny Reyes; Hakimi, Hassan; KAWAZU, Shin-Ichiro; MATSUMOTO, Kotaro; Yokoyama, Naoaki; INOKUMA, Hisashi; 河津, 信一郎; 松本, 高太郎; 横山, 直明; 猪熊,壽

    2013-01-01

    Anaplasma marginale has been detected in the Philippines only by peripheral blood smear examination and serological methods. This study generally aimed to molecularly detect and characterize A. marginale in cattle and ticks in Cebu, Philippines. A total of 12 bovine blood samples and 60 Rhipicephalus (Boophilus) microplus ticks were collected on the Cebu Island in 2011. 16S rRNA-based screening-PCR and DNA sequencing revealed 8 cattle (66.7%) and 8 ticks (13.3%) to be positive for A. marginal...

  11. Immune responses in cattle vaccinated with gamma-irradiated Anaplasma marginale

    International Nuclear Information System (INIS)

    The infectivity and immunogenecity of gamma-irradiated Anaplasma marginale organisms were studied in bovine calves. The severity of Anaplasma infection based on per cent infected red blood cells, haematological values and mortality was more in animals immunized with blood exposed to 60 kR in comparison to those inoculated with blood irradiated at 70, 80 and 90 kR. The immunizing controls demonstrated a significantly high parasitaemia, marked anaemia and more deaths. Marked and prolonged cell-mediated and humoral immune responses detectable in the first 3 weeks of post-immunization may be responsible for conferring of protective immunity. (author)

  12. Effect of gamma irradiation on anaplasma marginale in bovines

    International Nuclear Information System (INIS)

    Because the costs of treatment of anaplasmosis are very high, it was considered of great usefulness to obtain the modification of the pathogenecity and the antigenecity of A. marginale by means of gamma radiation (60Co) to obtain a vaccine. This would be reflected favorably in saving lives as well as to obviate losses of meat and dairy production and the elimination of the risks derived from the introduction of selected cattle into the tropics. The main purpose of this study was to determine the optimal modification of the pathogenecity of A. marginale in splenectomized calves and adult cows, among 4 different radiation doses. (author)

  13. Effect of gamma irradiation on Anaplasma marginale in bovines

    Energy Technology Data Exchange (ETDEWEB)

    Romero, H.Q.; de Fernandez, M.V.G. (Universidad Nacional Autonoma de Mexico, Mexico City. Centro de Estudios Nucleares); Meza, B.R.; Rodriguez, E. (Universidad Nacional Autonoma de Mexico, Mexico City)

    1981-01-01

    Because the costs of treatment of anaplasmosis are very high, it was considered of great usefulness to obtain the modification of the pathogenecity and the antigenicity of A. marginale by means of gamma radiation (/sup 60/Co) to obtain a vaccine. This would be reflected favorably in saving lives as well as to obviate losses of meat and dairy production and the elimination of the risks derived from the introduction of selected cattle into the tropics. The main purpose of this study was to determine the optimal modification of the pathogenecity of A. marginale in splenectomized calves and adult cows, among 4 different radiation doses.

  14. Comparison of the Efficiency of Biological Transmission of Anaplasma marginale (Rickettsiales: Anaplasmataceae) by Dermacentor andersoni Stiles (Acari: Ixodidae) with Mechanical Transmission by the Horse Fly, Tabanus fuscicos

    Science.gov (United States)

    Mechanical transmission of Anaplasma marginale by horse flies (Tabanidae) is thought to be epidemiologically significant in some areas of the US. We compared the relative efficiencies of mechanical transmission of Anaplasma marginale by the horse fly, Tabanus fuscicostatus Hine during acute infectio...

  15. Immunization-induced anaplasma marginale-specific T lymphocyte reponses impaired by A. marginale infection are restored after eliminating the infection with tetracycline

    Science.gov (United States)

    Infection of cattle with Anaplasma marginale fails to prime sustained effector/memory T-cell responses, and high bacterial load may induce antigen-specific CD4 T exhaustion and deletion. We tested the hypothesis that clearance of persistent infection restores the exhausted T-cell response. We show t...

  16. Evaluating the effectiveness of an inactivated vaccine from Anaplasma marginale derived from tick cell culture.

    Science.gov (United States)

    Lasmar, Pedro Veloso Facury; Carvalho, Antônio Último de; Facury Filho, Elias Jorge; Bastos, Camila Valgas; Ribeiro, Múcio Flávio Barbosa

    2012-01-01

    The protective efficacy of an inactivated vaccine from Anaplasma marginale that was cultured in tick cells (IDE8) for use against bovine anaplasmosis was evaluated. Five calves (Group 1) were inoculated subcutaneously, at 21-day intervals, with three doses of vaccine containing 3 × 10(9) A. marginale initial bodies. Five control calves received saline solution alone (Group 2). Thirty-two days after the final inoculation, all the calves were challenged with approximately 3 × 10(5) erythrocytes infected with A. marginale high-virulence isolate (UFMG2). The Group 1 calves seroconverted 14 days after the second dose of vaccine. After the challenge, all the animals showed patent rickettsemia. There was no significant difference (p > 0.05) between the Group 1 and 2 calves during the incubation period, patency period or convalescence period. All the animals required treatment to prevent death. The results suggest that the inactivated vaccine from A. marginale produced in IDE8 induced seroconversion in calves, but was not effective for preventing anaplasmosis induced by the UFMG2 isolate under the conditions of this experiment. PMID:22832750

  17. Silencing of genes involved in Anaplasma marginale-tick interactions affects the pathogen developmental cycle in Dermacentor variabilis

    Directory of Open Access Journals (Sweden)

    Almazán Consuelo

    2009-07-01

    Full Text Available Abstract Background The cattle pathogen, Anaplasma marginale, undergoes a developmental cycle in ticks that begins in gut cells. Transmission to cattle occurs from salivary glands during a second tick feeding. At each site of development two forms of A. marginale (reticulated and dense occur within a parasitophorous vacuole in the host cell cytoplasm. However, the role of tick genes in pathogen development is unknown. Four genes, found in previous studies to be differentially expressed in Dermacentor variabilis ticks in response to infection with A. marginale, were silenced by RNA interference (RNAi to determine the effect of silencing on the A. marginale developmental cycle. These four genes encoded for putative glutathione S-transferase (GST, salivary selenoprotein M (SelM, H+ transporting lysosomal vacuolar proton pump (vATPase and subolesin. Results The impact of gene knockdown on A. marginale tick infections, both after acquiring infection and after a second transmission feeding, was determined and studied by light microscopy. Silencing of these genes had a different impact on A. marginale development in different tick tissues by affecting infection levels, the densities of colonies containing reticulated or dense forms and tissue morphology. Salivary gland infections were not seen in any of the gene-silenced ticks, raising the question of whether these ticks were able to transmit the pathogen. Conclusion The results of this RNAi and light microscopic analyses of tick tissues infected with A. marginale after the silencing of genes functionally important for pathogen development suggest a role for these molecules during pathogen life cycle in ticks.

  18. Molecular study on infection rates of Anaplasma ovis and Anaplasma marginale in sheep and cattle in West-Azerbaijan province, Iran.

    Science.gov (United States)

    Noaman, Vahid; Bastani, Davood

    2016-01-01

    This study was carried out to determine the presence and frequency of Anaplasma ovis and Anaplasma marginale in sheep and dairy cattle in West-Azerbaijan province, Iran. A total number of 200 blood samples were randomly collected via the jugular vein from apparently healthy cattle (100) and sheep (100). The extracted DNA from blood cells was screened using genus-specific (Anaplasma spp.) nested-polymerase chain reaction (PCR) based on 16S rRNA gene primer sets. Species-specific PCR was set up using major surface protein 4 (MSP4) gene primer set. None of cattle blood samples were positive for Anaplasma spp. by the first nested PCR. Five samples among the 100 sheep blood samples were both positive in the first nested PCR and A. ovis -specific PCR, based on MSP4 gene. In total, 5.00% of animals were A. ovis positive. This study identified a low prevalence of A. ovis in the blood of apparently healthy sheep in West Azerbaijan province. PMID:27482362

  19. Seroprevalence of IgG antibodies against Anaplasma marginale in cattle from south Mozambique Soroprevalência de anticorpos de classe IgG contra Anaplasma marginale em bovinos da região Sul de Moçambique

    Directory of Open Access Journals (Sweden)

    António Amélia Mucalane Tembue

    2011-12-01

    Full Text Available The current study aimed to investigate the seroprevalence of IgG antibodies to Anaplasma marginale in cattle from Maputo, Gaza and Inhambane provinces, south Mozambique. A total of 809 serum samples from cattle were obtained and tested by indirect enzyme-linked immunosorbent assay (i-ELISA. The chi-square test at 5% significance was used to assess the association between seroprevalence and the variables gender, age and geographic origin of animals. The overall seropositivity was 76.5% (n = 619 and anti-A. marginale antibodies were detected in 89.1% (n = 156, 68.4% (n = 308 and 84.2% (n = 155 of the animals in the provinces of Maputo, Gaza and Inhambane, respectively. A significant association (p 12 and 24 and 36 months, respectively. These results indicate that in southern Mozambique there are areas of enzootic stability to A. marginale. Thus, epidemiological monitoring is required to monitor the immune status of animals in the region.O objetivo do presente estudo foi investigar a soroprevalência de anticorpos da classe IgG contra Anaplasma marginale em bovinos de corte da região Sul de Moçambique. Para esse efeito, 809 amostras de soro foram coletadas e avaliadas pelo ensaio imunoadsorção enzimático indireto (ELISA-i. O teste Qui-Quadrado, a 5% de significância, foi utilizado para avaliar a associação entre a soroprevalência e as variáveis sexo, idade e origem geográfica dos animais. A soropositividade geral foi de 76,5% (n = 619, e anticorpos anti-A. marginale foram detectados em 89,1% (n = 156, 68,4% (n = 308 e 84,2% (n = 155 dos animais nas províncias de Maputo, Gaza e Inhambane, respectivamente. Uma associação significativa (p 12 a 24 36 meses, respectivamente. Os resultados demonstram que, no Sul de Moçambique, existem áreas de estabilidade enzoótica para A. marginale, em animais maiores de 12 meses. Assim, monitoramento epidemiológico deve ser realizado para o acompanhamento do status imunológico dos animais na região.

  20. Development of a multilocus sequence typing scheme for the study of Anaplasma marginale population structure over space and time.

    Science.gov (United States)

    Guillemi, Eliana C; Ruybal, Paula; Lia, Verónica; Gonzalez, Sergio; Lew, Sergio; Zimmer, Patricia; Lopez Arias, Ludmila; Rodriguez, Jose L; Rodriguez, Sonia Y; Frutos, Roger; Wilkowsky, Silvina E; Farber, Marisa D

    2015-03-01

    Bovine Anaplasmosis caused by Anaplasma marginale is a worldwide disease prevalent in tropical and subtropical regions where Rhipicephalus microplus is considered the most significant biological vector. Molecular markers previously applied for A. marginale typing are efficient for isolate discrimination but they are not a suitable tool for studying population structure and dynamics. Here we report the development of an MLST scheme based on the study of seven genes: dnaA, ftsZ, groEl, lipA, recA, secY and sucB. Five annotated genomes (Saint Maries, Florida, Mississippi, Puerto Rico and Virginia) and 53 bovine blood samples from different world regions were analyzed. High nucleotide diversity and a large proportion of synonymous substitutions, indicative of negative selection resulted from DnaSP 5.00.02 package application. Recombination events were detected in almost all genes, this evidence together with the coexistence of more than one A. marginale strain in the same sample might suggest the superinfection phenomena as a potential source of variation. The allelic profile analysis performed through GoeBURST shown two main CC that did not support geography. In addition, the AMOVA test confirmed the occurrence of at least two main genetically divergent groups. The composition of the emergent groups reflected the impact of both historical and environmental traits on A. marginale population structure. Finally, a web-based platform "Galaxy MLST-Pipeline" was developed to automate DNA sequence editing and data analysis that together with the Data Base are freely available to users. The A. marginale MLST scheme developed here is a valuable tool with a high discrimination power, besides PCR based strategies are still the better choice for epidemiological intracellular pathogens studies. Finally, the allelic profile describe herein would contribute to uncover the mechanisms in how intracellular pathogens challenge virulence paradigm. PMID:25550150

  1. Independence of Anaplasma marginale Strains with High and Low Transmission Efficiencies in the Tick Vector following Simultaneous Acquisition by Feeding on a Superinfected Mammalian Reservoir Host

    Science.gov (United States)

    Strain superinfection occurs when a second pathogen strain infects a host already carrying a primary strain. Anaplasma marginale superinfection occurs when the second strain encodes a unique variant surface repertoire as compared to the primary strain and the epidemiologic consequences depend on th...

  2. Seroprevalence estimation and management factors associated with high herd seropositivity for Anaplasma marginale in commercial dairy farms of Puerto Rico.

    Science.gov (United States)

    Urdaz-Rodríguez, J H; Fosgate, G T; Alleman, A R; Rae, D O; Donovan, G A; Melendez, P

    2009-10-01

    A cross-sectional study was conducted to determine individual cow seroprevalence of Anaplasma marginale in adult lactating dairy cattle of Puerto Rico (PR) and to assess the associations of farm management factors on herd seroprevalence. Antibody activity against A. marginale was determined using the MSP-5 competitive enzyme-linked immunosorbent assay. Serum samples were obtained from 2,414 adult lactating dairy cattle from 76 randomly selected commercial dairy farms. Herd seroprevalence ranged from 3 to 100% with an overall individual cow seroprevalence for A. marginale of 27.4%. Factors associated with high herd seropositivity were pasture grazing as the main feed source (OR = 6.5, 95% CI = 1.2-34), observed monkeys on the premises (OR = 13, 95% CI = 1.2-138), use of 11% permethrin (OR = 17, 95% CI = 2.2-129), farmers who attended an acaricide certification program (OR = 0.18, 95% CI = 0.04-0.74), and lack of a fly control program (OR = 5.6, 95% CI = 1.3-24). PMID:19337849

  3. Cattle experimentally infected by Anaplasma marginale: Influence of splenectomy on disease pathogenesis, oxidative profile, and antioxidant status.

    Science.gov (United States)

    Doyle, Rovaina L; França, Raqueli T; Oliveira, Camila B; Rezer, João F P; Klafke, Guilherme M; Martins, João R; Santos, Andrea P; do Nascimento, Naíla C; Mesick, Joanne B; Lopes, Sonia T A; Leal, Daniela B R; Da Silva, Aleksandro S; Andrade, Cinthia M

    2016-06-01

    Bovine anaplasmosis is caused by the obligate intraerythrocytic bacteria Anaplasma marginale. These bacteria are transmitted by tick species such as Rhipicephalus (Boophilus) microplus, blood-sucking insects, and fomites (needles, clippers, and other blood contaminated equipment). During the acute phase of infection, animals may develop fever, anemia, jaundice, and hepatosplenomegaly. The aims of this study are to quantify the bacteremia by quantitative PCR in eight naïve calves experimentally infected by A. marginale [splenectomized (n = 4), and intact/non-splenectomized (n = 4)], and to correlate these findings with markers of oxidative stress on days 0, 8, 15, 21 and 23 post-infection. Complete blood counts (CBC) were performed in both groups. Lipid peroxidation was estimated by quantifying thiobarbituric acid reactive substances (TBARS); and non-enzymatic antioxidants were assessed by erythrocyte content of non-protein thiols (NPSH). There were no significant differences in complete blood counts (CBC) between the two groups. However, both groups had a slight decrease on packet cell volume (PCV), erythrocytes and hemoglobin concentration, as well as an increase in total leukocyte counts due to elevated lymphocytes when comparing pre and post-infection with A. marginale. Progressive increase on TBARS levels and concomitant decrease on NPSH content were observed in all animals, without significant differences between splenectomized and intact animals. A positive correlation between bacteremia and TBARS, and a negative correlation between bacteremia and NPSH were observed in both groups with higher correlation for NPSH in splenectomized animals. A negative correlation between TBARS and NPSH levels was observed in both groups indicating lipid peroxidation without a non-enzymatic antioxidant response. The results of experimental infection by A. marginale in cattle showed that bacteremia has an impact on lipid peroxidation regardless of the splenectomy. PMID

  4. Prevalence and haemato-biochemical profile ofAnaplasma marginale infection in dairy animals of Punjab (India)

    Institute of Scientific and Technical Information of China (English)

    Ashuma; Amrita Sharma; Lachhman Das Singla; Paramjit Kaur; Mandeep Singh Bal; Balwinder Kaur Batth; Prayag Dutt Juyal

    2013-01-01

    Objective:To do the systematic comparison of prevalence of anaplasmosis byPCR andGiemsa stained thin blood smear (GSTBS) based parasitological assays in dairy cattle ofPunjab, which has not been reported yet.To analyse the haematobiochemical alterations in infected animals to arrive at the conclusion regarding the pathogenicity induced byAnaplasma marginale (A. marginale) in latent and patent infection.Methods:Study was conducted on320 animals (236 cows,62 calves and22 buffaloes) ofPunjab,India.PCR on genome ofA. marginale was performed by targeting msp1β gene using specific primersBAP-2/AL34S, amplifies products of size407 bp.Questionnaires based data on the characteristics of the infected animals and management strategies of the farm were collected and correlated.Results:Higher prevalence and more significant association was observed in thePCR based molecular diagnosis (P=0.00012) as compared to that inGSTBS (P=0.0288) based diagnosis with various regions under study.With respect to the regions, highest prevalence was recorded inFerozepur byPCR based diagnosis, while that inJalandhar byGSTBS examination.Similar marked significant association of thePCR based diagnosis with the age of the animals under study (P=0.00013) was observed elucidating no inverse age resistance toA. marginale in cow calves.Haematobiochemical profile of infected animals revealed marked anemia, liver dysfunction and increase globulin concentrate indicating rise in immunoglobulin level to counteract infection.Conclusions:PCR is far more sensitive in detecting the disease even in latent infection which may act as nidus for spread of anaplasmosis to susceptible animals in endemic areas.Severity of anaemia and liver dysfunction were comparable both in patent as well as latent infection indicating pathogenicity of both.

  5. Anaplasma marginale major surface protein 1a directs cell surface display of tick BM95 immunogenic peptides on Escherichia coli.

    Science.gov (United States)

    Canales, Mario; Almazán, Consuelo; Pérez de la Lastra, José M; de la Fuente, José

    2008-07-31

    The surface display of heterologous proteins on live Escherichia coli using anchoring motifs from outer membranes proteins has impacted on many areas of biochemistry, molecular biology and biotechnology. The Anaplasma marginale major surface protein 1a (MSP1a) contains N-terminal surface-exposed repeated peptides (28-289 amino acids) that are involved in pathogen interaction with host cell receptors and is surface-displayed when the recombinant protein is expressed in E. coli. Therefore, it was predicted that MSP1a would surface display on E. coli peptides inserted in the N-terminal repeats region of the protein. The Rhipicephalus (Boophilus) microplus BM86 and BM95 glycoproteins are homologous proteins that protect cattle against tick infestations. In this study, we demonstrated that a recombinant protein comprising tick BM95 immunogenic peptides fused to the A. marginale MSP1a N-terminal region is displayed on the E. coli surface and is recognized by anti-BM86 and anti-MSP1a antibodies. This system provides a novel approach to the surface display of heterologous antigenic proteins on live E. coli and suggests the possibility to use the recombinant bacteria for immunization studies against cattle tick infestations. PMID:18582976

  6. Serological detection of Anaplasma marginale, Babesia bovis and Babesia bigemina in beef cattle of the northern and central-western regions of Brazil

    Directory of Open Access Journals (Sweden)

    Jenevaldo Barbosa da Silva

    2015-06-01

    Full Text Available The objective of this study was to assess the occurrence of antibodies against Anaplasma marginale, Babesia bovis and Babesia bigemina in beef cattle of the northern and central-western regions of Brazil. A total of 1703 blood samples were collected from cattle from 100 farms distributed among 37 municipalities in the states of Mato Grosso, Pará and Tocantins. The search for antibodies was conducted using an indirect enzyme-linked immunosorbent assay (ELISA, and antibodies were observed for B. bovis, B. bigemina and A. marginale in cattle from Mato Grosso, Tocantins and Pará at rates of 99%, 90% and 41%; 99%, 70% and 52%; and 97%, 97% and 75%, respectively. The results show that the analyzed regions exhibit enzootic stability for infection with B. bovis and B. bigemina, whereas the same result was not observed with A. marginale.

  7. Immunogenicity of Outer Membrane Proteins VirB9-1 and VirB9-2, a Novel Nanovaccine against Anaplasma marginale

    Science.gov (United States)

    Cavallaro, Antonino S.; Zhang, Bing; Zhang, Jun; Deringer, James R.; Zhao, Chun-Xia; Brown, Wendy C.; Yu, Chengzhong; Mitter, Neena; Middelberg, Anton P. J.

    2016-01-01

    Anaplasma marginale is the most prevalent tick-borne livestock pathogen and poses a significant threat to cattle industry. In contrast to currently available live blood-derived vaccines against A. marginale, alternative safer and better-defined subunit vaccines will be of great significance. Two proteins (VirB9-1 and VirB9-2) from the Type IV secretion system of A. marginale have been shown to induce humoral and cellular immunity. In this study, Escherichia coli were used to express VirB9-1 and VirB9-2 proteins. Silica vesicles having a thin wall of 6 nm and pore size of 5.8 nm were used as the carrier and adjuvant to deliver these two antigens both as individual or mixed nano-formulations. High loading capacity was achieved for both proteins, and the mouse immunisation trial with individual as well as mixed nano-formulations showed high levels of antibody titres over 107 and strong T-cell responses. The mixed nano-formulation also stimulated high-level recall responses in bovine T-cell proliferation assays. These results open a promising path towards the development of efficient A. marginale vaccines and provide better understanding on the role of silica vesicles to deliver multivalent vaccines as mixed nano-formulations able to activate both B-cell and T-cell immunity, for improved animal health. PMID:27115492

  8. Eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no tratamento de bovinos naturalmente infectados por Anaplasma marginale

    OpenAIRE

    L.R. Alberton; C.F. Orlandini; T.M. Zampieri; A.Y. Nakamura; D.D. Gonçalves; R. Piau Júnior; M.M. Zaniolo; S.T. Cardim; O. Vidotto; Garcia, J. L.

    2015-01-01

    O agente de maior importância, em relação à anaplasmose bovina, é o Anaplasma marginale. Os principais sinais clínicos dessa enfermidade são anemia hemolítica, icterícia, dispneia, taquicardia, febre, fadiga, lacrimejamento, sialorreia, micção frequente, anorexia, perda de peso, aborto e morte. A terapia antimicrobiana é o principal protocolo terapêutico. O objetivo do presente trabalho foi avaliar a eficácia do dipropionato de imidocarb, da enrofloxacina e do cloridrato de oxitetraciclina no...

  9. Real time polymerase chain reaction to diagnose Anaplasma marginale in cattle and deer (Ozotoceros bezoarticus leucogaster of the Brazilian Pantanal Reação da polimerase em cadeia tempo real para diagnóstico de Anaplasma marginale em bovino e veado campeiro do Pantanal brasileiro Ozotoceros bezoarticus leucogaster

    Directory of Open Access Journals (Sweden)

    Graziela Picoloto

    2010-09-01

    Full Text Available Epizootiological study of Anaplasma marginale in regions that contain various reservoir hosts, co-existence of rickettsia pathogens, and common vectors is a complicated task. To achieve diagnosis of this rickettsia in cattle and campeiro deer of Brazilian Pantanal, a comparison was made between a real time polymerase chain reaction (RT-PCR with intercalating Sybr Green fluorochrome and primers based on msp5 gene of A. marginale; a conventional PCR (C-PCR; and parasitological examination using thin blood smear stained with Giemsa-MayGrunwald. Both PCRs showed good performance in the diagnosis of A. marginale in cattle, and were superior to the parasitological exam. The RT-PCR detected seven positive campeiro deer (16.3%. This rate was significantly higher compared to C-PCR, which identified one animal as positive (2.3%, and also compared to parasitological diagnosis, which did not find any positive animals. The dissociation temperature average of positive reactions in cattle (81.72 ºC ± 0.20 was identical to dissociation temperature found in the cervids (81.72 ºC ± 0.12, suggesting that both animal species were infected with A. marginale. We concluded that RT-PCR can be used for A. marginale diagnosis and in epizootiological studies of cattle and cervids; in spite of the small number of campeiro deer samples, the results indicated that this wildlife species has importance in the Anaplasma epizootiology in the Brazilian Pantanal.O estudo epizootiológico de Anaplasma marginale em regiões que existem vários reservatórios, co-existência de espécies de riquétsias patógenas e vetores comuns é uma tarefa complicada. Com o objetivo de obter o diagnóstico dessa riquétsia em bovinos e veado campeiro do Pantanal brasileiro foi avaliada uma reação da polimerase em cadeia em tempo real (PCR-TR com o fluoróforo intercalante de fita dupla de DNA Sybr Green e iniciadores baseados na seqüência do gene msp5 de A. marginale comparando-a a uma

  10. Evaluating the effectiveness of an inactivated vaccine from Anaplasma marginale derived from tick cell culture Avaliação da eficácia de uma vacina inativada de Anaplasma marginale derivada de cultura de células de carrapato

    Directory of Open Access Journals (Sweden)

    Pedro Veloso Facury Lasmar

    2012-06-01

    Full Text Available The protective efficacy of an inactivated vaccine from Anaplasma marginale that was cultured in tick cells (IDE8 for use against bovine anaplasmosis was evaluated. Five calves (Group 1 were inoculated subcutaneously, at 21-day intervals, with three doses of vaccine containing 3 × 10(9 A. marginale initial bodies. Five control calves received saline solution alone (Group 2. Thirty-two days after the final inoculation, all the calves were challenged with approximately 3 × 10(5 erythrocytes infected with A. marginale high-virulence isolate (UFMG2. The Group 1 calves seroconverted 14 days after the second dose of vaccine. After the challenge, all the animals showed patent rickettsemia. There was no significant difference (p > 0.05 between the Group 1 and 2 calves during the incubation period, patency period or convalescence period. All the animals required treatment to prevent death. The results suggest that the inactivated vaccine from A. marginale produced in IDE8 induced seroconversion in calves, but was not effective for preventing anaplasmosis induced by the UFMG2 isolate under the conditions of this experiment.Foi avaliada a eficácia de uma vacina protetora para Anaplasma marginale cultivada em células de carrapato (IDE8 para uso contra a anaplasmose bovina. Cinco bezerros (Grupo 1 foram inoculados por via subcutânea com três doses, intervalados de 21 dias, de vacina contendo 3 × 10(9 corpúsculos iniciais de A. marginale inicial. Cinco bezerros do grupo controle receberam apenas solução salina (Grupo 2. Trinta e dois dias após a inoculação final, todos os bezerros foram desafiados com aproximadamente 3 × 10(5 eritrócitos infectados com isolado de A. marginale alta virulência (UFMG2. Os bezerros do Grupo 1 soroconverteram-se 14 dias após a segunda dose da vacina. Após o desafio, todos os animais mostraram riquestsemia patente. Não houve diferença significativa (p > 0,05 entre bezerros do Grupo 1 e 2 em período de incuba

  11. Epitope-based vaccines with the Anaplasma marginale MSP1a functional motif induce a balanced humoral and cellular immune response in mice.

    Directory of Open Access Journals (Sweden)

    Paula S Santos

    Full Text Available Bovine anaplasmosis is a hemoparasitic disease that causes considerable economic loss to the dairy and beef industries. Cattle immunized with the Anaplasma marginale MSP1 outer membrane protein complex presents a protective humoral immune response; however, its efficacy is variable. Immunodominant epitopes seem to be a key-limiting factor for the adaptive immunity. We have successfully demonstrated that critical motifs of the MSP1a functional epitope are essential for antibody recognition of infected animal sera, but its protective immunity is yet to be tested. We have evaluated two synthetic vaccine formulations against A. marginale, using epitope-based approach in mice. Mice infection with bovine anaplasmosis was demonstrated by qPCR analysis of erythrocytes after 15-day exposure. A proof-of-concept was obtained in this murine model, in which peptides conjugated to bovine serum albumin were used for immunization in three 15-day intervals by intraperitoneal injections before challenging with live bacteria. Blood samples were analyzed for the presence of specific IgG2a and IgG1 antibodies, as well as for the rickettsemia analysis. A panel containing the cytokines' transcriptional profile for innate and adaptive immune responses was carried out through qPCR. Immunized BALB/c mice challenged with A. marginale presented stable body weight, reduced number of infected erythrocytes, and no mortality; and among control groups mortality rates ranged from 15% to 29%. Additionally, vaccines have significantly induced higher IgG2a than IgG1 response, followed by increased expression of pro-inflammatory cytokines. This is a successful demonstration of epitope-based vaccines, and protection against anaplasmosis may be associated with elicitation of effector functions of humoral and cellular immune responses in murine model.

  12. First molecular survey and identification of Anaplasma spp. in white yaks (Bos grunniens) in China.

    Science.gov (United States)

    Yang, Jifei; Liu, Zhijie; Niu, Qingli; Liu, Junlong; Guan, Guiquan; Xie, Jingying; Luo, Jianxun; Wang, Shuqing; Wang, Shufang; Yin, Hong

    2016-05-01

    Anaplasmosis is caused by a group of obligate intracellular bacteria in the genus Anaplasma, which are transmitted by ticks and infect humans, domestic animals and wildlife. This study was conducted to determine the prevalence and molecular characterization of Anaplasma spp. in semi-wild white yaks sampled in Tianzhu Tibetan Autonomous County, northwest China. Out of 332 samples tested, 35 (10·9%) were positive for Anaplasma spp. The positive rates were 6·2% (20/322) and 5·3% (17/322) for Anaplasma bovis and Anaplasma phagocytophilum in white yaks, respectively. None of the sample was positive for Anaplasma marginale. Two (0·6%) samples were simultaneously positive to A. bovis and A. phagocytophilum. Sequence analysis of the 16S rRNA gene revealed two genotypes (ApG1 and ApG2) of A. phagocytophilum and two sequence types (ST1 and ST2) of A. bovis in white yaks. This study is the first to document the presence of Anaplasma in white yaks. Our findings extend the host range for Anaplasma species and provide more valuable information for the control and management of anaplasmosis in white yaks. PMID:27003378

  13. The immunization-induced antibody response to the Anaplasma marginale major surface protein 2 and its association with protective immunity

    Science.gov (United States)

    Many vector-borne pathogens evade clearance via rapid variation in immunogenic surface expressed proteins. In the case of A. marginale, the generation of major surface protein 2 (Msp2) variants allows for immune escape and long-term pathogen persistence. In the experiments reported here, we pose t...

  14. Natural infection of calves by Anaplasma marginale in dairy herds of the Metalúrgica Region, Minas Gerais Infecção natural por Anaplasma marginale em bezerras de fazendas leiteiras da região Metalúrgica de Minas Gerais

    Directory of Open Access Journals (Sweden)

    Valeska S.P. Melo

    2001-12-01

    Full Text Available The dynamic of natural infections by Anaplasma marginale in calves was evaluated during a period of one year on two farms located in the Metalúrgica Region, State of Minas Gerais, Brazil. Blood samples were collected weekly for rickettsemia and packed cell volume (PCV determination. The animals born from March to July suffered the infection in October and November, independently of their age, whilst calves born from September to December acquired the infection during the first days of life. These animals presented patent rickettsemia from 30 days of life. During the patent period PCV decreased after one week of infection, ranging from 20 to 23%. It was concluded, that in the region studied, the transmission of A. marginale is influenced by climatic conditions, and that calves born during the dry season are more likely to acquire the infection when they are exposed to high transmission levels during the subsequent raining season.Realizou-se um estudo da dinâmica de infecções naturais por Anaplasma marginale, durante o período de um ano, em duas propriedades localizadas na Região Metalúrgica do Estado de Minas Gerais. Foram realizados esfregaços sangüíneos e determinação do volume globular (VG. Os animais que nasceram no período de março a julho sofreram a infecção em outubro e novembro, independentemente da idade, enquanto os que nasceram no período de setembro a dezembro adquiriram a infecção nos primeiros dias de vida, com parasitemia patente a partir de 30 dias de idade. Durante o período patente, o VG reduziu na primeira semana de infecção, variando entre 20 a 23%. Concluiu-se que a ocorrência da primo-infecção sofre influência das estações do ano e que bezerros nascidos na estação seca apresentam maior risco de infecção, quando expostos às condições de elevada transmissão durante a estação chuvosa subseqüente.

  15. Frequency of antibodies to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burdgorferi in cattle from the northeastern region of the state of Pará, Brazil Freqüência de anticorpos para Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax e Borrelia burgdorferi em bovinos do nordeste do Estado do Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Daniel S. Guedes Junior

    2008-06-01

    Full Text Available Babesiosis, anaplasmosis, and trypanosomosis are relevant diseases, potentially causing morbidity in cattle, leading to economic losses. Borreliosis is import as a potential zoonosis. The objective of this study was to determine, by indirect enzyme-linked immunosorbent assay (ELISA, the frequency of seropositive cattle to Babesia bigemina, B. bovis, Anaplasma marginale, Trypanosoma vivax and Borrelia burgdorferi in cattle from the Northeastern region of Pará, Brazil. Sera samples from 246 female adult cattle from municipalities of Castanhal and São Miguel do Guamá were used. Crude antigens ELISAs were used to detect antibodies to all agents, except to A. marginale, to which an indirect ELISA with recombinant major surface 1a protein (MSP1a antigen was used. Overall frequencies of seropositive animals were: B. bigemina - 99.2%; B. bovis - 98.8%; A. marginale - 68.3%; T. vivax - 93.1% and B. burgdorferi - 54.9%. The frequencies of seropositive cattle to B. bovis and B. bigemina suggest a high rate of transmission of these organisms by tick in the studied region, which can be classified as enzootically stable to these hemoprotozoans. The low frequency of seropositive cattle to A. marginale may be attributed to a lower sensitivity of the recombinant antigen ELISA utilized or a distinct rate of inoculation of this rickettsia by ticks, as compared with Babesia sp. transmission. The high frequency of seropositive cattle to T. vivax indicates that this hemoprotozoan is prevalent in herds from the Northeastern region of Pará. The rate of animal that showed homologues antibodies to B. burgdorferi indicates the presence of the tickborne spirochaetal agent in the cattle population in the studied region.A babesiose, a anaplasmose e a tripanossomose são enfermidades relevantes, potencialmente causadoras de morbidade em bovinos, levando a perdas econômicas. A borreliose assume importância como zoonose potencial. O objetivo desse estudo foi determinar

  16. Anaplasma marginale infection with persistent high-load bacteremia induces a dysfunctional memory CD4+ T lymphocyte response but sustained high IgG titers

    Science.gov (United States)

    Control of blood-borne infections is dependent on antigen-specific effector and memory T cells and high-affinity IgG responses. In chronic infections characterized by a high antigen load, it has been shown that antigen-specific T and B cells are vulnerable to downregulation and apoptosis. Anaplasma ...

  17. Frequency of Anaplasma marginale (Theiler 1910 and Babesia sp in mestizo bovine Zebu, in the Municipality of Ixiamas county Abel Iturralde Department of The La Paz, Bolivia

    Directory of Open Access Journals (Sweden)

    Mercado Alvaro

    2011-08-01

    Full Text Available The present work one carries out in the Municipality of Ixiamas County Abel Iturralde of the department of Peace-Bolivia, between May and August of 2010. The objective was to determine the presence of Anaplama sp and Babesia sp, through sanguine smear, they took 160 samples of blood, 40 bovine of the four areas they have been evaluated. The results indicate the presence of Anaplasma sp 6,90%, 6,20% in females and 9,70% in males, this represents 2,50% for the area TO, 5,00% area B, 17,50% area C and 2,50% area D. According to the category 12,50% in calves, 0,00% in torillos, 4,80% in bulls, 6,20% in cows and 14,30% in heifers. The presence of Babesia sp 3,13%, with relationship to the sex 3,10% in females and 3,22% in males, being observed 2,50% in the area TO, 5,00% in the area B, 5,00% in the area C and 0,00% in the area D, according to the category 0,00% in calves, torillos 4,80% bulls, 2,73% vacates and 7,14% in heifers.

  18. Subdominant antigens in bacterial vaccines: Am779 is subdominant in the anaplasma marginale outer membrane vaccine but does not associate with protective immunity

    Science.gov (United States)

    Identification of specific antigens responsible for the ability of complex immunogens to induce protection is a major goal in development of bacterial vaccines. Much of the investigation has focused on highly abundant and highly immunodominant outer membrane proteins. Recently however, genomic and p...

  19. Comparison of the serologic tests of Indirect Immunofluorescence, Rapid Conglutination, Indirect ELISA and Competition ELISA for detection of antibodies against Anaplasma marginale in cattle sera from different enzootic areas/ Comparação dos testes sorológicos de Imunofluorescência Indireta, Conglutinação Rápida, ELISA indireto e ELISA por competição para a detecção de anticorpos contra o Anaplasma marginale em soros de bovinos de diferentes áreas enzoóticas

    Directory of Open Access Journals (Sweden)

    João Luís Garcia

    2006-07-01

    Full Text Available The serological techniques Rapid Conglutination Test (RCT, Indirect ELISA (iELISA and Indirect Immunofluorescent Assay (IFA, using the competition ELISA (cELISA as gold test, were comparatively evaluated to detect antibodies against Anaplasma marginale. A total of 453 sera from vaccinated and non vaccinated cattle and, collected from enzootic stability and instability areas were tested. iELISA, IFA and TCR presented kappa index = 0.77 (substantial; 0.57 and 0.49 (moderate, sensibility of 90.6%; 90.2% and 73.7% and specificity of 86.6%; 62.8%, and 79.3%, respectively. Therefore, iELISA presented better specificity than IFA and RCT, and can be indicated for more detailed serological investigations, detection of persistently infected animals in cattle herds and for monitorating of vaccination programs. IFA and TCR can be used in prevalence studies and to monitor cattle movement between different geographical regions.Os testes sorológicos de Conglutinação Rápida (TCR Imunofluorescência Indireta (IFI e Imunoenzimáticos Indireto (iELISA utilizando ELISA por competição (cELISA, como padrão ouro, foram avaliados comparativamente para a detecção de anticorpos contra o Anaplasma marginale. Foram utilizadas 453 amostras de soros sangüíneos de bovinos vacinados e não-vacinados e de áreas de estabilidade e instabilidade enzoótica. O iELISA, IFI e TCR apresentaram respectivamente, índice kappa=0,77 (substancial, 0,57 e 0,49 (moderado, sensibilidade de 90,6%, 90,2% e 73,7% e especificidade de 86,6%, 62,8%, e 79,3%. O iELISA apresentou o melhor desempenho e maior especificidade, podendo ser indicado na avaliação do perfil sorológico de rebanhos, na detecção de animais persistentemente infectados e de animais submetidos a programas de vacinação. As técnicas de IFI e TCR, mesmo apresentando desempenho inferior, podem ser recomendadas para a realização de inquéritos epidemiológicos e para o monitoramento de animais em trânsito entre

  20. Effect of milk production system on the enzootic stability to Anaplasma marginale and Babesia bovis in calves in the Campo das Vertentes region of Minas Gerais state, BrazilEfeito do sistema de produção de leite sobre a estabilidade enzoótica para Anaplasma marginale e Babesia bovis em bezerras na região do Campo das Vertentes de Minas Gerais, Brasil

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães Rocha

    2012-04-01

    Full Text Available We conducted a cross-sectional observational study, in order to determine the frequency of anti-A. marginale and anti-B. bovis antibodies in calves from four to 12 months of age from ten farms that producing B type milk and an equal number that produce raw milk refrigerated, located in the Campo das Vertentes region of Minas Gerais state, in the period September 2008 to August 2009. Blood smears were performed, serologic testing by indirect immunofluorescence technique (IFAT, given the packed cell volume, rickettsemia, and the clinical scores of animals infected by A. marginale. In the farms that produce B type milk, the overall average frequency of seropositive calves was 94.47% (166/176 and 89.20% (157/176 for A. marginale and B. bovis, respectively. Already on the farms that produce raw milk refrigerated, the overall average frequency of A. marginale was 92.59% (149/161 and for B. bovis from 86.30% (139/161, and there was no significant difference (p > 0.05 in the frequency of calves infected for both hemoparasitic between the two systems of milk production. Statistically significant (p 0.05 among calves from properties that produce B type milk and raw milk refrigerated. The results of this study indicate that, in the Campos das Vertentes region of Minas Gerais, the production system does not interfere with the enzootic stability for A. marginale and B. bovis in calves from dairy farms B milk or raw milk refrigerated, with low probability of anaplasmosis and/or babesiosis in adults animals.Foi realizado um estudo observacional do tipo transversal, com o objetivo de determinar a frequência de anticorpos anti-A. marginale e B. bovis em 337 bezerras com idade entre quatro a 12 meses, oriundas de dez propriedades produtoras de leite B e igual número de fazendas de leite cru refrigerado (leite C, na região do Campo das Vertentes de Minas Gerais, no período de setembro de 2008 a agosto de 2009. Foram realizados esfregaços sangu

  1. Detection and identification of Anaplasma phagocytophilum, Borrelia burgdorferi, and Rickettsia helvetica in Danish Ixodes ricinus ticks

    DEFF Research Database (Denmark)

    Skarphédinsson, Sigurdur; Lyholm, Birgitte Fjendbo; Ljungberg, Marianne;

    2007-01-01

    % of adult ticks. The difference in prevalence between Anaplasma and Borrelia in adult ticks supports the idea that their maintenance cycles in nature may be different. Ticks were also infected with Rickettsia helvetica. Our study indicates that A. phagocytophilum prevalence in ticks in Denmark is as...

  2. Detection of Anaplasma antibodies in wildlife and domestic species in wildlife-livestock interface areas of Kenya by major surface protein 5 competitive inhibition enzyme-linked immunosorbent assay

    OpenAIRE

    J.J.N. Ngeranwa; S.P. Shompole; E.H. Venter; Wambugu, A.; J.E. Crafford; Penzhorn, B.L.

    2008-01-01

    The seroprevalence of Anaplasma antibodies in wildlife (eland, blue wildebeest, kongoni, impala, Thomson's gazelle, Grant's gazelle, giraffe and plains zebra) and domestic animal (cattle, sheep and goat) populations was studied in wildlife / livestock interface areas of Kenya. Serum samples were analyzed by competitive inhibition enzyme-linked immunosorbent assay (CI-ELISA), using a recombinant antigen (MSP-5) from Anaplasma marginale surface membrane. A monoclonal antibody, FC-16, was ...

  3. Comparative study of Anaplasma parasites in tick carrying buffaloes and cattle

    Institute of Scientific and Technical Information of China (English)

    RAJPUT Z.I.; HU Song-hua; ARIJO A.G.; HABIB M.; KHALID M.

    2005-01-01

    A comparative study on the prevalence of Anaplasma parasite was conducted on ticks carrying buffaloes and cattle.Five hundred blood samples of both animals (250 of each) were collected during February, March and April. Thin blood smears on glass slides were made, fixed in 100% methyl alcohol and examined. Microscopic examination revealed that 205 (41%) animals had Anaplasma parasites, out of which 89, 44 and 72 animals had Anaplasma marginale, Anaplasma centrale and mixed infection respectively. Infected buffaloes and cattle were 75 and 130 respectively. The infection in female was 53 and 92 in buffaloes and cattle respectively. Twenty-two and 92 blood samples of male were found positive in buffaloes and cattle respectively. Comparative study revealed that the cattle were 26.82% more susceptible than buffaloes. The parasite prevailing percentage in female of both animals was slightly higher than that of the male. This investigation was aimed at studying the comparative prevalence of Anaplasma parasite in tick carrying buffaloes and cattle.

  4. Cepas atenuadas de Babesia bovis e Babesia bigemina e de Anaplasma centrale como imunógenos no controle da tristeza parasitária bovina Attenuated strains of Babesia bovis and Babesia bigemina and of Anaplasma centrale as immunogens for tick borne disease control

    Directory of Open Access Journals (Sweden)

    Ana Maria Sastre Sacco

    2001-10-01

    Full Text Available Neste trabalho foram avaliadas cepas atenuadas de Babesia bovis e B. bigemina e Anaplasma centrale como imunógenos a serem utilizados no controle da Tristeza Parasitária Bovina. O processo de imunização demonstrou ser inócuo, imunogênico e eficiente, pelo menos no que diz respeito às babesias, pois protegeu os animais vacinados frente ao desafio com cepas heterólogas virulentas a campo, que provocou doença clínica e morte nos animais do grupo controle. O desafio a campo pelo Anaplasma marginale não se mostrou muito virulento ou patogênico, não sendo possível concluir que a imunização com A. centrale proteja os animais contra anaplasmose.Attenuated strains of Babesia bovis and B. bigemina and a strain of Anaplasma centrale were evaluated as immunogens against tick-borne disease. The immunization process was shown to be inocuous, immunogenic and efficient to protect cattle, at least against the babesias. Vaccinated animals proved to be protected when naturally challenged with heterologous and virulent strains, in contrast to control animals that showed clinical symptoms of the disease and had to be treated. The Anaplasma marginale challenge was not efficient since treatment was not necessary in the control animals, therefore it was not possible to conclude that immunization with A. centrale protected animals against anaplasmosis.

  5. Sequence analysis of the msp4 gene of Anaplasma ovis strains

    Science.gov (United States)

    de la Fuente, J.; Atkinson, M.W.; Naranjo, V.; Fernandez de Mera, I. G.; Mangold, A.J.; Keating, K.A.; Kocan, K.M.

    2007-01-01

    Anaplasma ovis (Rickettsiales: Anaplasmataceae) is a tick-borne pathogen of sheep, goats and wild ruminants. The genetic diversity of A. ovis strains has not been well characterized due to the lack of sequence information. In this study, we evaluated bighorn sheep (Ovis canadensis) and mule deer (Odocoileus hemionus) from Montana for infection with A. ovis by serology and sequence analysis of the msp4 gene. Antibodies to Anaplasma spp. were detected in 37% and 39% of bighorn sheep and mule deer analyzed, respectively. Four new msp4 genotypes were identified. The A. ovis msp4 sequences identified herein were analyzed together with sequences reported previously for the characterization of the genetic diversity of A. ovis strains in comparison with other Anaplasma spp. The results of these studies demonstrated that although A. ovis msp4 genotypes may vary among geographic regions and between sheep and deer hosts, the variation observed was less than the variation observed between A. marginale and A. phagocytophilum strains. The results reported herein further confirm that A. ovis infection occurs in natural wild ruminant populations in Western United States and that bighorn sheep and mule deer may serve as wildlife reservoirs of A. ovis. ?? 2006.

  6. Functional and Immunological Relevance of Anaplasma marginale Major Surface Protein 1a Sequence and Structural Analysis

    Czech Academy of Sciences Publication Activity Database

    Cabezas Cruz, Alejandro; Passos, L.M.F.; Lis, K.; Kenneil, R.; Valdés, James J.; Ferrolho, J.; Tonk, Miray; Pohl, A.E.; Grubhoffer, Libor; Zweygarth, E.; Shkap, V.; Ribeiro, M.F.B.; Estrada-Pena, A.; Kocan, K.M.; de la Fuente, J.

    2013-01-01

    Roč. 8, č. 6 (2013), e65243. E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 238511 - POSTICK Institutional support: RVO:60077344 Keywords : CD4(+) T-lymphocytes * B-cell epitopes * salivary glands Subject RIV: EC - Immunology Impact factor: 3.534, year: 2013

  7. Detection of Anaplasma antibodies in wildlife and domestic species in wildlife-livestock interface areas of Kenya by major surface protein 5 competitive inhibition enzyme-linked immunosorbent assay

    Directory of Open Access Journals (Sweden)

    J.J.N. Ngeranwa

    2008-09-01

    Full Text Available The seroprevalence of Anaplasma antibodies in wildlife (eland, blue wildebeest, kongoni, impala, Thomson's gazelle, Grant's gazelle, giraffe and plains zebra and domestic animal (cattle, sheep and goat populations was studied in wildlife / livestock interface areas of Kenya. Serum samples were analyzed by competitive inhibition enzyme-linked immunosorbent assay (CI-ELISA, using a recombinant antigen (MSP-5 from Anaplasma marginale surface membrane. A monoclonal antibody, FC-16, was used as the primary antibody, while anti-mouse conjugated to horseradish peroxidase was used as the secondary antibody. The results indicate a high seroprevalence in both wildlife and livestock populations, in contrast to earlier reports from Kenya, which indicated a low seroprevalence. The differences are attributed to the accurate analytical method used (CI-ELISA, as compared with agglutination techniques, clinical signs and microscopy employed by the earlier workers.

  8. Detection of Anaplasma antibodies in wildlife and domestic species in wildlife-livestock interface areas of Kenya by major surface protein 5 competitive inhibition enzyme-linked immunosorbent assay.

    Science.gov (United States)

    Ngeranwa, J J N; Shompole, S P; Venter, E H; Wambugu, A; Crafford, J E; Penzhorn, B L

    2008-09-01

    The seroprevalence of Anaplasma antibodies in wildlife (eland, blue wildebeest, kongoni, impala, Thomson's gazelle, Grant's gazelle, giraffe and plains zebra) and domestic animal (cattle, sheep and goat) populations was studied in wildlife/livestock interface areas of Kenya. Serum samples were analyzed by competitive inhibition enzyme-linked immunosorbent assay (CI-ELISA), using a recombinant antigen (MSP-5) from Anaplasma marginale surface membrane. A monoclonal antibody, FC-16, was used as the primary antibody, while anti-mouse conjugated to horseradish peroxidase was used as the secondary antibody. The results indicate a high seroprevalence in both wildlife and livestock populations, in contrast to earlier reports from Kenya, which indicated a low seroprevalence. The differences are attributed to the accurate analytical method used (CI-ELISA), as compared with agglutination techniques, clinical signs and microscopy employed by the earlier workers. PMID:19040134

  9. The Life and Death of Anaplasma

    Centers for Disease Control (CDC) Podcasts

    2012-03-30

    Dr. Setu Vora, medical director of critical care and physician director of performance improvement at Backus Hospital in Norwich, Connecticut, reads his poem The Life and Death of Anaplasma and discusses the poem’s origins.  Created: 3/30/2012 by National Center for Emerging and Zoonotic Infectious Diseases (NCEZID).   Date Released: 4/2/2012.

  10. Development of a multiplex PCR assay for simultaneous detection of Theileria annulata, Babesia bovis and Anaplasma marginale in cattle

    OpenAIRE

    Bilgiç, Huseyin B.; KARAGENÇ, Tülin; Simuunza, Martin; Shiels, Brian; Tait, Andy; Eren, Hasan; Weir, William

    2013-01-01

    Tropical theileriosis, bovine babesiosis and anaplasmosis are tick-borne protozoan diseases that impose serious constraints on the health and productivity of domestic cattle in tropical and sub-tropical regions of the world. A common feature of these diseases is that, following recovery from primary infection, animals become persistent carriers of the pathogen and continue to play a critical role in disease epidemiology, acting as reservoirs of infection. This study describes development and ...

  11. Molecular Characterization of Anaplasma and Ehrlichia Species in Different Cattle Breeds and Age Groups in Mbarara District (Western Uganda

    Directory of Open Access Journals (Sweden)

    Muhanguzi Dennis

    2010-07-01

    Full Text Available Anaplasma and Ehrlichia sp. (AEs cause significant economic losses to the livestock sector in Uganda. The aim of this study was to determine the prevalence of AEs in cattle from Kashaari county-Mbarara district (Uganda so as to compare the prevalence of AEs in different cattle breeds, age groups, sub county of origin and management systems and predictor(s of infection with AEs. Such information is deemed necessary to direct future tick-borne disease control programs. A single pair of primers w as used to am plify a 492-498bp fragment of the 16SRNA gene spanning the V1 region conserved for both AEs. PCR products were transferred onto the Reverse Line Blot (RLB membrane and AEs amplicons in the PCR products allowed to hybridize with AE species-specific oligonucleotides. The prevalence of Ehrlichia sp. was 5.1% (CI = 95%, 2.9-7.3% whereas that of Anaplasma species was 5.3 % (C I = 95%, 3-7.6%. Individual AEs detected include; A. bovis (5.1%, CI = 95%, 2.9-7.3%, E. ruminantium (4.5% , CI = 95%, 2.4-6.6%, A. marginale (3.7%, CI = 95%, 1.8-5.6%, A. (E. phagocytophilum (2.7%, CI = 95%, 1.1-4.3% , E. ovina/canis (2.7%, CI = 95%; 1.1-4.3%, E. sp. (omatjenne(1.9%, CI = 95 %, 0.5-3.3%. Cattle breed was found to be the best predictor of infection. To further understand bovine tick-borne parasites in Uganda, we recommend that studies covering a wider area and over longer periods, investigation of breed as a predictor of infection, molecular genetic characterization, transmission and pathogenicity studies on the different strains of AEs be carried out.

  12. Molecular evidence of potential novel spotted fever group rickettsiae, Anaplasma and Ehrlichia species in Amblyomma ticks parasitizing wild snakes

    OpenAIRE

    Kho, Kai Ling; Koh, Fui Xian; Tay, Sun Tee

    2015-01-01

    Background Amblyomma ticks parasitize a wide range of animals in tropical regions. This study describes the identification of Amblyomma ticks from wild snakes in Malaysia and the detection of potential human pathogens such as Rickettsia, Anaplasma, Ehrlichia and bartonellae in the ticks. Findings Twenty one adult ticks (twelve A. varanense and nine Amblyomma helvolum ticks) identified from seven Python molurus snakes in Sepang and a pool of six A. helvolum ticks from a Naja sumatrana snake in...

  13. Detection of Rickettsia and Anaplasma from hard ticks in Thailand.

    Science.gov (United States)

    Malaisri, Premnika; Hirunkanokpun, Supanee; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2015-12-01

    We collected a total of 169 adult hard ticks and 120 nymphs from under the leaves of plants located along tourist nature trails in ten localities. The results present data examining the vector competence of ticks of different genera and the presence of Rickettsia and Anaplasma species. The ticks belonged to three genera, Amblyomma, Dermacentor, and Haemaphysalis, comprising 11 species. Rickettsia bacteria were detected at three collection sites, while Anaplasma bacteria were detected at only one site. Phylogenetic analysis revealed new rickettsia genotypes from Thailand that were closely related to Rickettsia tamurae, Rickettsia monacensis, and Rickettsia montana. This study was also the first to show that Anaplasma bacteria are found in Haemaphysalis shimoga ticks and are closely related evolutionarily to Anaplasma bovis. These results provide additional information for the geographical distribution of tick species and tick-borne bacteria in Thailand and can therefore be applied for ecotourism management. PMID:26611960

  14. Natural Anaplasma phagocytophilum infection in ticks from a forest area of Selenge province, Mongolia

    OpenAIRE

    G Javkhlan; B Enkhtaivan; B Baigal; Myagmarsuren, P.; Battur, B.; Battsetseg, B

    2014-01-01

    Anaplasma phagocytophilum is a zoonotic agent of public health importance, infecting both humans and animals. An investigation of the presence of Anaplasma phagocytophilum as well as Anaplasma platys was conducted in a forest area of Selenge province, Mongolia, where ticks are widely distributed and tick-borne diseases are highly endemic. Ticks were collected and tested using polymerase chain reaction based on groEL methodology. Anaplasma phagocytophilum was detected in 14 (6%) of Ixodes pers...

  15. The natural history of Anaplasma phagocytophilum.

    Science.gov (United States)

    Woldehiwet, Zerai

    2010-02-10

    Anaplasma phagocytophilum is the recently designated name replacing three species of granulocytic bacteria, Ehrlichia phagocytophila, Ehrlichia equi and the agent of human granulocytic ehrlichiosis, after the recent reorganization of the families Rickettsiaceae and Anaplasmataceae in the order Rickettsiales. Tick-borne fever (TBF), which is caused by the prototype of A. phagocytophilum, was first described in 1932 in Scotland. A similar disease caused by a related granulocytic agent was first described in horses in the USA in 1969; this was followed by the description of two distinct granulocytic agents causing similar diseases in dogs in the USA in 1971 and 1982. Until the discovery of human granulocytic anaplasmosis (HGA) in the USA in 1994, these organisms were thought to be distinct species of bacteria infecting specific domestic animals and free-living reservoirs. It is now widely accepted that the agents affecting different animal hosts are variants of the same Gram-negative obligatory intracellular bacterium, which is transmitted by hard ticks belonging to the Ixodes persulcatus complex. One of its fascinating features is that it infects and actively grows in neutrophils by employing an array of mechanisms to subvert their bactericidal activity. It is also able to survive within an apparently immune host by employing a complex mechanism of antigenic variation. Ruminants with TBF and humans with HGA develop severe febrile reaction, bacteraemia and leukopenia due to neutropenia, lymphocytopenia and thrombocytopenia within a week of exposure to a tick bite. Because of the severe haematological disorders lasting for several days and other adverse effects on the host's immune functions, infected animals and humans are more susceptible to other infections. PMID:19811878

  16. Unidirectional Suppression of Anaplasma phagocytophilum Genotypes in Infected Lambs

    OpenAIRE

    Stuen, Snorre; Dahl, Hilde; Bergström, Karin; Moum, Truls

    2005-01-01

    Five-month-old lambs were simultaneously infected with different doses of two 16S rRNA genetic variants of Anaplasma phagocytophilum and thereafter followed for clinical observation and blood sampling. The result of the study indicates a unidirectional suppression of genotypes in infected lambs, at least during a certain period of an A. phagocytophilum infection.

  17. Lessons from Anaplasma phagocytophilum: Chromatin Remodeling by Bacterial Effectors

    OpenAIRE

    Rennoll-Bankert, Kristen E.; Dumler, J. Stephen

    2012-01-01

    Bacterial pathogens can alter global host gene expression via histone modifications and chromatin remodeling in order to subvert host responses, including those involved with innate immunity, allowing for bacterial survival. Shigella flexneri, Listeria monocytogenes, Chlamydia trachomatis, and Anaplasma phagocytophilum express effector proteins that modify host histones and chromatin structure. A. phagocytophilum modulates granulocyte respiratory burst in part by dampening transcription of se...

  18. Natural Anaplasma phagocytophilum infection in ticks from a forest area of Selenge province, Mongolia

    Directory of Open Access Journals (Sweden)

    G Javkhlan

    2014-03-01

    Full Text Available Anaplasma phagocytophilum is a zoonotic agent of public health importance, infecting both humans and animals. An investigation of the presence of Anaplasma phagocytophilum as well as Anaplasma platys was conducted in a forest area of Selenge province, Mongolia, where ticks are widely distributed and tick-borne diseases are highly endemic. Ticks were collected and tested using polymerase chain reaction based on groEL methodology. Anaplasma phagocytophilum was detected in 14 (6% of Ixodes persulcatus ticks and four (1% Dermacentor nuttalli ticks; infection of Anaplasma platys was detected in 1% of Ixodes persulcatus ticks and 10% of Dermacentor nuttalli ticks. The phylogenetic tree showed that the Anaplasma phagocytophilum clustered with the Russian group, most likely due to similar geographical locations. This finding is significant for both veterinary and public health officials given that these agents can cause both animal and human illness.

  19. Anaplasma phagocytophilum in ruminants in Europe.

    Science.gov (United States)

    Woldehiwet, Zerai

    2006-10-01

    The agent that causes tick-borne fever (TBF) in sheep was first described in 1940, 8 years after the disease was first recognized in Scotland. The same agent was soon shown to cause TBF in sheep and pasture fever in cattle in other parts of the UK, Scandinavia, and other parts of Europe. After the initial use of the name Rickettsia phagocytophila, the organism was given the name Cytoecetes phagocytophila to reflect its association with granulocytes and its morphological similarity with Cytoecetes microti. This name continued to be used by workers in the UK until the recent reclassification of the granulocytic ehrlichiae affecting ruminants, horses, and humans as variants of the same species, Anaplasma phagocytophilum. TBF and pasture fever are characterized by high fever, recurrent bacteremia, neutropenia, lymphocytopenia, thrombocytopenia, and general immunosuppression, resulting in more severe secondary infections such as tick pyemia, pneumonic pasteurellosis, listeriosis, and enterotoxemia. During the peak period of bacteremia as many as 90% of granulocytes may be infected. The agent is transmitted transtadially by the hard tick Ixodes ricinus, and possibly other ticks. After patent bacteremia, sheep, goats, and cattle become persistently infected "carriers," perhaps playing an important role in the maintenance of infection, in the flock/herd. Little is known about how efficiently ticks acquire and maintain infection in ruminant populations or whether "carrier" domestic ruminants play an important role as reservoirs of infection, but deer, other free-living ruminants, and wild rodents are also potential sources of infection. During the late 1990s serological evidence of infection of humans was demonstrated in several European countries, creating a renewed interest and increased awareness of the zoonotic potential of TBF variants. More recently, a few cases of human granulocytic anaplasmosis (HGA) have been reported in some European countries, but it remains to

  20. Genetic diversity of anaplasma species major surface proteins and implications for anaplasmosis serodiagnosis and vaccine development

    OpenAIRE

    de la Fuente, J.; Lew, A.; Lutz, H.; Meli, M. L.; Hofmann-Lehmann, R.; Shkap, V; Molad, T; Mangold, A J; Almazán, C; Naranjo, V.; Gortázar, C.; Torina, A; Caracappa, S.; García-Pérez, A. L.; Barral, M.

    2005-01-01

    The genus Anaplasma (Rickettsiales: Anaplasmataceae) includes several pathogens of veterinary and human medical importance. An understanding of the diversity of Anaplasma major surface proteins (MSPs), including those MSPs that modulate infection, development of persistent infections, and transmission of pathogens by ticks, is derived in part, by characterization and phylogenetic analyses of geographic strains. Information concerning the genetic diversity of Anaplasma spp. MSPs will likely in...

  1. Cine y deporte: Reinserción de jóvenes marginales

    OpenAIRE

    Velasco Rodríguez, Miguel Nicolás

    2014-01-01

    El trabajo se basa en el análisis de películas deportivas, siendo utilizadas como la base principal de obtención de la información sobre el tema: La reinserción de los jóvenes marginales. A través del estudio de tres largometrajes, estudios y teorías existentes se busca obtener datos que clarifiquen si existe una relación entre la práctica deportiva y los beneficios que puede tener en la reinserción de los jóvenes marginales.

  2. Mesure de l’utilité marginale et indice de prix chez Ragnar Frisch

    OpenAIRE

    Dupont-Kieffer, Ariane

    2014-01-01

    Cet article a pour objet de montrer comment Ragnar Frisch a fondé l’économétrie sur une articulation spécifique de la mesure théorique et de la mesure empirique des phénomènes. Ses travaux sur l’utilité marginale du revenu permettent d’illustrer sa démarche. Sa tentative de mesurer l’utilité marginale du revenu en 1926 puis à nouveau en 1932, afin d’estimer le pouvoir d’achat de la monnaie, se heurte à une difficulté d’ordre conceptuel : donner un prix à un bien composite ou «bien général», q...

  3. Prevalence of Anaplasma phagocytophilum infection and effect on lamb growth

    Directory of Open Access Journals (Sweden)

    Steinshamn Håvard

    2011-05-01

    Full Text Available Abstract Background A major challenge in sheep farming during the grazing season along the coast of south-western Norway is tick-borne fever (TBF caused by the bacteria Anaplasma phagocytophilum that is transmitted by the tick Ixodes ricinus. Methods A study was carried out in 2007 and 2008 to examine the prevalence of A. phagocytophilum infection and effect on weaning weight in lambs. The study included 1208 lambs from farms in Sunndal Ram Circle in Møre and Romsdal County in Mid-Norway, where ticks are frequently observed. All lambs were blood sampled and serum was analyzed by an indirect fluorescent antibody assay (IFA to determine an antibody status (positive or negative to A. phagocytophilum infection. Weight and weight gain and possible effect of infection were analyzed using ANOVA and the MIXED procedure in SAS. Results The overall prevalence of infection with A. phagocytophilum was 55%. A lower weaning weight of 3% (1.34 kg, p A. phagocytophilum infection compared to seronegative lambs at an average age of 137 days. Conclusions The results show that A. phagocytophilum infection has an effect on lamb weight gain. The study also support previous findings that A. phagocytophilum infection is widespread in areas where ticks are prevalent, even in flocks treated prophylactic with acaricides.

  4. Anaplasma phagocytophilum in Danish sheep: confirmation by DNA sequencing

    Directory of Open Access Journals (Sweden)

    Thamsborg Stig M

    2009-12-01

    Full Text Available Abstract Background The presence of Anaplasma phagocytophilum, an Ixodes ricinus transmitted bacterium, was investigated in two flocks of Danish grazing lambs. Direct PCR detection was performed on DNA extracted from blood and serum with subsequent confirmation by DNA sequencing. Methods 31 samples obtained from clinically normal lambs in 2000 from Fussingø, Jutland and 12 samples from ten lambs and two ewes from a clinical outbreak at Feddet, Zealand in 2006 were included in the study. Some of the animals from Feddet had shown clinical signs of polyarthritis and general unthriftiness prior to sampling. DNA extraction was optimized from blood and serum and detection achieved by a 16S rRNA targeted PCR with verification of the product by DNA sequencing. Results Five DNA extracts were found positive by PCR, including two samples from 2000 and three from 2006. For both series of samples the product was verified as A. phagocytophilum by DNA sequencing. Conclusions A. phagocytophilum was detected by molecular methods for the first time in Danish grazing lambs during the two seasons investigated (2000 and 2006.

  5. Ixodes scapularis saliva mitigates inflammatory cytokine secretion during Anaplasma phagocytophilum stimulation of immune cells

    Czech Academy of Sciences Publication Activity Database

    Chen, G.; Severo, M. S.; Sohail, M.; Sakhon, O. S.; Wikel, S. K.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2012-01-01

    Roč. 5, č. 1 (2012), s. 229. ISSN 1756-3305 Institutional support: RVO:60077344 Keywords : Tick * Ixodes scapularis * Saliva * Anaplasma phagocytophilum * Rickettsial agent Subject RIV: EC - Immunology Impact factor: 3.246, year: 2012 http://www.parasitesandvectors.com/content/5/1/229

  6. Seroprevalence of Borrelia burgdorferi, Anaplasma phagocytophilum, Ehrlichia canis, and Dirofilaria immitis among dogs in Canada

    OpenAIRE

    Villeneuve, Alain; Goring, Jonas; Marcotte, Lynne; Overvelde, Sébastien

    2011-01-01

    The seropositivity of dogs to Borrelia burgdorferi, Anaplasma phagocytophilum, and Ehrlichia canis antibodies, and Dirofilaria immitis antigen was assessed in Canada. Borrelia burgdorferi had the highest seroprevalence, while that of Dirofilaria immitis has not changed significantly in the past 20 y. The risk for these vector-borne infectious agents in Canadian dogs is low but widespread with foci of higher prevalence.

  7. Anaplasma phagocytophilum Infection in Small Mammal Hosts of Ixodes Ticks, Western United States

    OpenAIRE

    Janet E. Foley; Nieto, Nathan C.; Adjemian, Jennifer; Dabritz, Haydee; Brown, Richard N.

    2008-01-01

    A total of 2,121 small mammals in California were assessed for Anaplasma phagocytophilum from 2006 through 2008. Odds ratios were >1 for 4 sciurids species and dusky-footed woodrats. High seroprevalence was observed in northern sites. Ten tick species were identified. Heavily infested rodent species included meadow voles, woodrats, deer mice, and redwood chipmunks.

  8. Los impactos marginales del olivar ecologico de montana andaluz frente al convencional post-condicionalidad: una vision de los expertos

    OpenAIRE

    Montiel, Beatriz; Colombo, Sergio; Sayadi, Samir; Estevez, Ceferino

    2013-01-01

    Establecer y valorar los impactos marginales de la olivicultura ecologica despues de la aplicacion de la condicionalidad, supone una importante herramienta para determinar, en un futuro, posibiles pagos a los agricultores por el caracter multifuncional de este sistema productivo. Por ello, en el presente trabajo se plantea un cuestionario Delphi a una serie de expertos, con el objetivo de conocer su opinion sobre los impactos economicos, ambientales y sociales de explotaciones de olivar tradi...

  9. SERUM ANTIBODIES TO BORRELIA BURGDORFERI, ANAPLASMA PHAGOCYTOPHILUM, AND BABESIA MICROTI IN RECAPTURED WHITE-FOOTED MICE

    OpenAIRE

    Magnarelli, Louis A.; Williams, Scott C.; Norris, Steven J; Fikrig, Erol

    2013-01-01

    A mark-release-recapture study was conducted during 2007 through 2010 in six, tick-infested sites in Connecticut, United States to measure changes in antibody titers for Borrelia burgdorferi sensu stricto, Anaplasma phagocytophilum, and Babesia microti in Peromyscus leucopus (white-footed mice). There was an overall recapture rate of 40%, but only four tagged mice were caught in ≥2 yr. Sera from 561 mice were analyzed for total antibodies to B. burgdorferi and A. phagocytophilum by using whol...

  10. A molecular epidemiological survey of Babesia, Hepatozoon, Ehrlichia and Anaplasma infections of dogs in Japan

    OpenAIRE

    KUBO, Shotaro; TATENO, Morihiro; ICHIKAWA, Yasuaki; ENDO, Yasuyuki

    2015-01-01

    Tick-borne diseases are often encountered in canine clinical practice. In the present study, a molecular epidemiological survey of dogs in Japan was conducted to understand the prevalence and geographical distribution of Babesia spp., Hepatozoon spp., Ehrlichia spp. and Anaplasma spp. Pathogen-derived DNA in blood samples obtained from 722 dogs with a history of exposure to ticks and/or fleas was examined by PCR. The prevalence of Babesia gibsoni, Babesia odocoilei-like species, Hepatozoon ca...

  11. Understanding the human ehrlichiosisis and standing out a causal agent: anaplasma phagocytophilum

    OpenAIRE

    Hernández-Ayazo Helí; Marien-Clarete Said

    2013-01-01

    Introduction: Anaplasma phagocytophilum is an obligatory intracytoplasmatic bacteriathat belong to Rickettsiales order and that has been recognized as a cause of humandisease. Most of symptomatic patients report exposure to ticks (vector) one or twoweeks before the beginning of the disease. They present a febrile disease, however theclinical status extends since asymptomatic infection until fatal disease.Clinical case: Male patient with prolonged fever and with negative proofs in the searchof...

  12. Reservoir Competence of the Redwood Chipmunk (Tamias Ochrogenys) for Anaplasma Phagocytophilum

    OpenAIRE

    Nieto, Nathan C.; Janet E. Foley

    2009-01-01

    Granulocytic anaplasmosis (GA) is an emerging tick-transmitted disease that persists in rodent- Ixodes ricinus-complex tick cycles across the Holarctic. Although the putative reservoir for anaplasmosis in the western United States is the dusky-footed woodrat (Neotoma fuscipes), this rodent was not shown reservoir-competent because of failure of infection from woodrats to other animals via ticks. Redwood chipmunks are common in habitats where Anaplasma phagocytophilum is common, have high PCR-...

  13. Molecular characterization reveals distinct genospecies of Anaplasma phagocytophilum from diverse North American hosts

    OpenAIRE

    Rejmanek, Daniel; Bradburd, Gideon; Foley, Janet

    2012-01-01

    Anaplasma phagocytophilum is an emerging tick-borne pathogen that infects humans, domestic animals and wildlife throughout the Holarctic. In the far-western United States, multiple rodent species have been implicated as natural reservoirs for A. phagocytophilum. However, the presence of multiple A. phagocytophilum strains has made it difficult to determine which reservoir hosts pose the greatest risk to humans and domestic animals. Here we characterized three genetic markers (23S–5S rRNA inte...

  14. Nidicolous ticks of small mammals in Anaplasma phagocytophilum-enzootic sites in northern California

    OpenAIRE

    Foley, Janet; Rejmanek, Daniel; Fleer, Katryna; Nieto, Nathan

    2011-01-01

    Ixodes spp. tick-borne zoonotic diseases are present across the Holarctic in humans, domestic animals, and wildlife. Small mammals are reservoirs for the rickettsial pathogen Anaplasma phagocytophilum and tick vectors may include catholic-feeding bridge vectors as well as host-specialist or nidicolous ticks. Far western North American communities in which A. phagocytophilum is maintained are complex ecologically, with multiple reservoir host and tick species, multiple strains of the bacterial...

  15. First case of Anaplasma platys infection in a dog from Croatia

    Directory of Open Access Journals (Sweden)

    Dyachenko Viktor

    2012-03-01

    Full Text Available Abstract Background It is known that Anaplasma (A. platys, the causative agent of infectious canine cyclic thrombocytopenia, is endemic in countries of the Mediterranean basin. However, few reports are available from the Balkans. This case report describes a dog, which was imported from Croatia to Germany in May 2010. One month later the dog was presented to a local veterinarian in Germany due to intermittent/recurrent diarrhoea. Diagnostic tests were performed to identify infections caused by Anaplasma spp., Ehrlichia spp., Hepatozoon canis, Babesia spp., Leishmania spp., Borrelia burgdorferi and/or Dirofilaria immitis. Findings Haematological examination of a blood smear revealed basophilic inclusions in thrombocytes, which were confirmed as A. platys with a species-specific real-time PCR. Additionally, an infection with Babesia (B. vogeli was also detected (PCR and serology. No specific antibodies against Anaplasma antigen were detectable. Although the dog showed no specific clinical signs, thrombocytopenia, anaemia and elevated C-reactive protein (CRP were observed. Sequencing of a 1,348-bp partial ribosomal RNA gene revealed highest homology to A. platys sequences from Thailand, Japan and France. Conclusions A. platys was detected for first time in a dog imported from Croatia. As the dog was also co-infected by B. vogeli, unique serological and haematological findings were recorded. Thrombocytopenia, anaemia and elevated values of C-reactive protein were the laboratory test abnormalities observed in this case. A. platys infections should be considered in dogs coming from Croatia and adjacent regions.

  16. Prevalence of Anaplasma and Bartonella spp. in Ticks Collected from Korean Water Deer (Hydropotes inermis argyropus).

    Science.gov (United States)

    Kang, Jun-Gu; Ko, Sungjin; Kim, Heung-Chul; Chong, Sung-Tae; Klein, Terry A; Chae, Jeong-Byoung; Jo, Yong-Sun; Choi, Kyoung-Seong; Yu, Do-Hyeon; Park, Bae-Keun; Park, Jinho; Chae, Joon-Seok

    2016-02-01

    Deer serve as reservoirs of tick-borne pathogens that impact on medical and veterinary health worldwide. In the Republic of Korea, the population of Korean water deer (KWD, Hydropotes inermis argyropus) has greatly increased from 1982 to 2011, in part, as a result of reforestation programs established following the Korean War when much of the land was barren of trees. Eighty seven Haemaphysalis flava, 228 Haemaphysalis longicornis, 8 Ixodes nipponensis, and 40 Ixodes persulcatus (21 larvae, 114 nymphs, and 228 adults) were collected from 27 out of 70 KWD. A total of 89/363 ticks (266 pools, 24.5% minimum infection rate) and 5 (1.4%) fed ticks were positive for Anaplasma phagocytophilum using nested PCR targeting the 16S rRNA and groEL genes, respectively. The 16S rRNA gene fragment sequences of 88/89 (98.9%) of positive samples for A. phagocytophilum corresponded to previously described gene sequences from KWD spleen tissues. The 16S rRNA gene fragment sequences of 20/363 (5.5%) of the ticks were positive for A. bovis and were identical to previously reported sequences. Using the ITS specific nested PCR, 11/363 (3.0%) of the ticks were positive for Bartonella spp. This is the first report of Anaplasma and Bartonella spp. detected in ticks collected from KWD, suggesting that ticks are vectors of Anaplasma and Bartonella spp. between reservoir hosts in natural surroundings. PMID:26951985

  17. Migratory and carnivorous birds in Brazil: reservoirs for Anaplasma and Ehrlichia species?

    Science.gov (United States)

    Machado, Rosangela Zacarias; André, Marcos Rogério; Werther, Karin; de Sousa, Eliane; Gavioli, Fernando Antônio; Alves Junior, José Roberto Ferreira

    2012-08-01

    In order to investigate new hosts for Anaplasmataceae agents in Brazil, we collected blood samples from 21 wild birds. Using molecular techniques, we detected the presence of Anaplasma phagocytophilum, Ehrlichia chaffeensis, and an Ehrlichia species closely related to Ehrlichia canis in carnivorous avian blood samples. In addition, an Ehrlichia species closely related to an Ehrlichia species found in wild felines in Brazil was also detected in a goose blood sample. Wild birds may play a role as carriers of Anaplasmataceae agents in Brazil. PMID:22607070

  18. The first report of Anaplasma phagocytophilum and a novel Theileria spp. co-infection in a South African giraffe.

    Science.gov (United States)

    Zhang, Yan; Li, Tongyi; Cui, Yanyan; Wang, Jinhong; Lv, Yali; Wang, Rongjun; Jian, Fuchun; Zhang, Longxian; Wang, Jiantang; Yang, Guangcheng; Ning, Changshen

    2016-08-01

    Organisms of the genera Anaplasma and Theileria are important intracellular bacteria and parasites that cause various tick-borne diseases, threatening the health of numerous animals as well as human beings. In the present study, a 12-month-old male wild South African giraffe (Giraffa camelopardalis giraffa) originating from South Africa, and living in Zhengzhou Zoo (located in the urban district of Zhengzhou in the provincial capital of Henan), suddenly developed an unknown fatal disease and died 1day after the onset of the clinical signs. By microscopic examination of Giemsa-stained blood smears combined with nested PCR and DNA sequence analysis, Anaplasma phagocytophilum, Anaplasma bovis and a novel Theileria spp. were found in the blood of this giraffe. The six other Cervidae animals in the zoo and three ruminants living in the same colony house with them were found to be negative for both Anaplasma and Theileria in their blood specimens. We report on the first case of an A. phagocytophilum infection and the occurrence of a novel Theileria spp. in the blood of a giraffe. This is the first reported case of a multi-infection of A. bovis, A. phagocytophilum and Theileria spp. in a giraffe, as revealed by microscopic examination of blood smears and the results of nested PCR and DNA sequencing. PMID:27109775

  19. Prevalence of Anaplasma, Bartonella and Borrelia Species in Haemaphysalis longicornis collected from goats in North Korea.

    Science.gov (United States)

    Kang, Jun-Gu; Ko, Sungjin; Smith, W Barney; Kim, Heung-Chul; Lee, In-Yong; Chae, Joon-Seok

    2016-06-30

    North Korea is located on the northern part of the Korean Peninsula in East Asia. While tick-borne pathogens of medical and veterinary importance have been reported from China and South Korea, they have not been reported from North Korea. To screen for zoonotic tick-borne pathogens in North Korea, ticks were collected from domestic goats. A total of 292 (27 nymph, 26 male, 239 female) Haemaphysalis (H.) longicornis were collected and assayed individually for selected tick-borne pathogens. A total of 77 (26.4%) were positive for Anaplasma bovis, followed by Bartonella (B.) grahamii (15, 5.1%), Anaplasma phagocytophilum (12, 4.1%), Bartonella henselae (10, 3.4%), and Borrelia spp. (3, 1.0%) based on 16S ribosomal RNA and ITS species-specific nested polymerase chain reaction. Using the groEL-based nested PCR, a total of 6 and 1 H. longicornis were positive for B. grahamii and B. henselae, respectively. All products were sequenced and demonstrated 100% identity and homology with previously reported sequences from other countries in GenBank. This is the first report of the detection of tick-borne pathogens in the North Korea and suggests that farm animals may act as reservoirs for zoonotic tick-borne pathogens. PMID:26645342

  20. Adaptation marginale des restaurations classe II en composite avec des différents liners de cavité

    OpenAIRE

    Pecie, Raluca

    2013-01-01

    Le but a été d’évaluer l’influence des différents ‘cavity liners’ sur l’adaptation marginale (AM) des restaurations en composite dans 40 cavités classe II ( 4 groups). Dans chaque groupe, à l’exception du groupe contrôle, un liner a été appliqué sur le fond de cavité avant la mise en place du composite Herculite XRV Ultra (groupe A: contrôle/ groupe B: Premise Flowable lining/ groupe C: Herculite XRV Ultra lining/ groupe D: Optibond FL lining). L’AM a été évaluée avant et après le test de fat...

  1. Identification and Characterization of Anaplasma phagocytophilum Proteins Involved in Infection of the Tick Vector, Ixodes scapularis

    Czech Academy of Sciences Publication Activity Database

    Villar, M.; Ayllón, N.; Kocan, K.M.; Bonzón-Kulichenko, E.; Alberdi, P.; Blouin, E.F.; Weisheit, S.; Mateos-Hernández, L.; Cabezas-Cruz, A.; Bell-Sakyi, L.; Vancová, Marie; Bílý, Tomáš; Meyer, D.F.; Štěrba, Ján; Contreras, M.; Rudenko, Natalia; Grubhoffer, Libor; Vázquez, J.; de la Fuente, J.

    2015-01-01

    Roč. 10, č. 9 (2015), e0137237. E-ISSN 1932-6203 R&D Projects: GA MŠk(CZ) EE2.3.30.0032 EU Projects: European Commission(XE) 238511; European Commission(XE) 278976 Institutional support: RVO:60077344 Keywords : secretion system * outer membrane vesicles * gene expression Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.234, year: 2014

  2. Molecular characterization of two different strains of haemotropic mycoplasmas from a sheep flock with fatal haemolytic anaemia, concomitant Anaplasma ovis infection

    OpenAIRE

    Hornok, Sándor; Meli, Marina L; Erdős, András; Hajtós, István; Lutz, Hans; Hofmann-Lehmann, Regina

    2009-01-01

    Molecular characterization of two different strains of haemotropic mycoplasmas from a sheep flock with fatal haemolytic anaemia, concomitant Anaplasma ovis infection HUNGARY (Hornok, Sandor) HUNGARY Received: 2008-08-03 Revised: 2008-10-27 Accepted: 2008-10-29

  3. Molecular detection of Anaplasma platys, Ehrlichia canis, Hepatozoon canis and Rickettsia monacensis in dogs from Maio Island of Cape Verde archipelago.

    Science.gov (United States)

    Lauzi, Stefania; Maia, João P; Epis, Sara; Marcos, Ricardo; Pereira, Cristina; Luzzago, Camilla; Santos, Marta; Puente-Payo, Pablo; Giordano, Alessia; Pajoro, Massimo; Sironi, Giuseppe; Faustino, Augusto

    2016-07-01

    Tick-borne diseases are emerging worldwide and have an important zoonotic relevance. Dogs play an important role in the epidemiology of several zoonotic tick-borne pathogens acting as sentinels and/or reservoirs. This study focused on the molecular identification of tick-borne pathogens in blood samples of 153 autochthonous asymptomatic dogs in Maio Island, Cape Verde archipelago. Eighty-four (54.9%) dogs were positive for one or more pathogens. Fifty-five (35.9%) dogs were infected with Hepatozoon canis, 53 (34.6%) with Anaplasma platys, five (3.3%) with Ehrlichia canis and Rickettsia monacensis, an emerging human pathogen, was also identified in a single dog (0.7%). The former three pathogens cause important canine tick-borne diseases that are transmitted or potentially transmitted by Rhipicephalus sanguineus s.l., the only hard tick identified in Cape Verde. Furthermore, Wolbachia spp. was amplified from the blood of one dog. None of the dogs were positive for Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, Midichloria mitochondrii, Bartonella spp., Babesia spp. or Theileria spp. Fifty-four (35.3%) animals showed single infections and 30 (19.6%) co-infections, with A. platys and H. canis co-infection being the most frequent (28 dogs, 18.3%). The frequency of E. canis infection was statistically different among age groups (P=0.017), being higher among dogs older than 4 years compared to younger dogs. Infection by A. platys was also statistically different among age groups (P=0.031), being higher in dogs younger than 2 years compared to older dogs. The statistical analyses showed no significant association of PCR positivity with gender or location. The frequency of tick-borne pathogens detected in dogs in Maio Island, including R. monacensis, highlights the need to improve diagnosis and control in order to prevent the risk of transmission of these pathogens among dogs and humans living in or travelling to this touristic island. PMID:27177475

  4. Understanding the human ehrlichiosisis and standing out a causal agent: anaplasma phagocytophilum

    Directory of Open Access Journals (Sweden)

    Hernández-Ayazo Helí

    2013-06-01

    Full Text Available Introduction: Anaplasma phagocytophilum is an obligatory intracytoplasmatic bacteriathat belong to Rickettsiales order and that has been recognized as a cause of humandisease. Most of symptomatic patients report exposure to ticks (vector one or twoweeks before the beginning of the disease. They present a febrile disease, however theclinical status extends since asymptomatic infection until fatal disease.Clinical case: Male patient with prolonged fever and with negative proofs in the searchof hepatitis, malaria, dengue, leptospirosis and typhoid disease. In the peripheralblood smear with Wright’s stain, there were found granulocytes with intracytoplasmatic vacuoles called morulae (microcolonies of Anaplasma phagocytophilum. Diagnosticimpression was Human Granulocytic Anaplasmosis (HGA. Treatment with tetracyclinewas done and good evolution was reported.Conclusion: HGA should be a disease to have present in patients with prolonged febrileprofile. A detailed clinical history with information about exposure to ticks should begotten. It is important an early diagnosis to establish the differences with other similarinfections and to apply promptly indicated antibiotic therapy. Rev.cienc.biomed.2013;4(1:165-169RESUMEN:Introducción: Anaplasma phagocytophilum es una bacteria intracitoplasmática obligadaque pertenece al orden Rickettsiales, reconocido como causante de enfermedaden humanos. Pacientes sintomáticos reportan exposición a las garrapatas (vector unao dos semanas antes del inicio de la enfermedad. Presentan una enfermedad febril, noobstante el rango clínico se extiende desde infección asintomática hasta enfermedadfatal.Caso clínico: paciente masculino con cuadro febril prolongado. Pruebas negativas enla búsqueda de hepatitis, paludismo, dengue, leptospirosis y enfermedad tifoidea. Enel extendido de sangre periférica, con tinción de Wright se encontraron granulocitoscon vacuolas intracitoplasmáticas llamadas mórulas (microcolonias

  5. Responsabilidad Social Matriz de indicadores sustentables que refleja el impacto de la forestación en tierras marginales del Partido de Bahía Blanca, Argentina

    OpenAIRE

    Regina del Carmen Durán Durán

    2009-01-01

    Actualmente, se han empezado a considerar otras obligaciones que tienen las empresas para con su comunidad; se trata de aspectos vinculados con las dimensiones sociales y ambientales. Desde este contexto, nuestro trabajo tiene como punto de partida el concepto de responsabilidad social desde la noción de sustentabilidad. El objetivo es evaluar la forestación como instrumento para mejorar la sostenibilidad de los sistemas productivos tradicionales en tierras marginales del Partido de Bahía Bla...

  6. Análisis de la dinámica relacional generada por las websites de Internet en el desarrollo de los turismos marginales

    Directory of Open Access Journals (Sweden)

    José Mª Prat

    2012-01-01

    Full Text Available El conocimiento de los actores turísticos del territorio, y de sus relaciones, es un elemento básico para la gestión activa de cualquier destino turístico. Como que, gracias a las nuevas tecnologías de la información y a la popularizacióndel uso de Internet, se han creado una gran cantidad de relaciones sociales gracias a las websites, interrelacionadas, que han permitido una rápida y amplia difusión promocional de aquellos destinos que ofrecen unas alternativas turísticas más marginales, como respuesta a los nuevos planteamientos post-fordistas del turismo, generándose una dinámica relacional que se ha beneficiado del rápido desarrollo de las TIC's. En este trabajo se han analizado dichas relaciones entre websites, en el caso del desarrollo de dos turismos marginales, el naturista y el swinger, en Cap d'Agde, en el sur de Francia, comprobándose la existencia de una relación directa entre la dinámica relacional del territorio y elgrado de desarrollo de los turismos marginales.

  7. Natural infection of Anaplasma platys in dogs from Umbria region (Central Italy

    Directory of Open Access Journals (Sweden)

    Maria Teresa Antognoni

    2014-03-01

    Full Text Available Anaplasma platys is a tick-borne pathogen causing the Infectious Canine Cyclic Thrombocytopenia. The pathogenesis of this disease is not yet well understood, due to the wide variety of clinico-pathological patterns described worldwide and to the high prevalence of co-infections with other vector-borne pathogens occurring in endemic areas. The present paper reports 3 cases of infection by A. platys occurring in dogs native to Central Italy, considered a non-endemic area to date. Infections were initially diagnosed based on clinical data and observation of morulae within platelets and then confirmed by biomolecular techniques. Moreover, two dogs showed an immune-mediated hemolytic anemia, as yet not described in literature in association with A. platys infection. The symptoms and the pathological findings observed will be discussed, as well as the importance to include this pathogen in the differential diagnosis of tick-borne diseases even in Central Italy.

  8. Co-infections with Borrelia species, Anaplasma phagocytophilum and Babesia spp. in patients with tick-borne encephalitis

    OpenAIRE

    Moniuszko, A.; Dunaj, J.; Święcicka, I.; Zambrowski, G.; Chmielewska-Badora, J.; Żukiewicz-Sobczak, W.; Zajkowska, J.; Czupryna, P.; Kondrusik, M.; Grygorczuk, S.; Swierzbinska, R.; Pancewicz, S.

    2014-01-01

    The purpose of this study was evaluation of the prevalence of co-infection with Borrelia species, A. phagocytophilum and Babesia spp. in patients with tick-borne encephalitis (TBE). At total of 110 patients with TBE were included in the study. Serological tests for tick-borne encephalitis virus (TBEV), PCR for Borrelia species, Anaplasma phagocytophilum and Babesia spp., blood smears for A. phagocytophilum and Babesia spp. and BLAST analysis for Babesia spp. were performed. Results showed a s...

  9. Seroprevalence of Anaplasma phagocytophilum among healthy dogs and horses in Israel.

    Science.gov (United States)

    Levi, O; Waner, T; Baneth, G; Keysary, A; Bruchim, Y; Silverman, J; Harrus, S

    2006-03-01

    The presence of reacting antibodies to Anaplasma phagocytophilum has previously been demonstrated in Israel, both in humans and the golden jackal (Canis aureus syriacus). This study was undertaken to determine the seroprevalence of A. phagocytophilum antibodies in two additional potential hosts, domestic dogs and horses in order to investigate the possibility of exposure to the organism in Israel. Of 195 dogs tested, 9% were seroreactive with A. phagocytophilum antigen and 30% were seroreactive to Ehrlichia canis. Twenty-nine percent of the dogs seropositive for E. canis were also reactive to A. phagocytophilum. Two dogs had immunofluorescence antibody (IFA) antibody titres for A. phagocytophilum greater than E. canis. The equine serological survey (n = 300) revealed no seroreactive horses. The results presented in this study suggest that dogs in Israel could have been accidentally exposed to A. phagocytophilum, for example by ticks carried on migrating birds, however, the possibility of cross-reaction with E. canis should also be considered. In spite of the high prevalence of ticks on horses in Israel during the summer months, no evidence for exposure to A. phagocytophilum was apparent. PMID:16626404

  10. First report of Anaplasma phagocytophilum and Babesia microti in rodents in Finland.

    Science.gov (United States)

    Kallio, Eva R; Begon, Michael; Birtles, Richard J; Bown, Kevin J; Koskela, Esa; Mappes, Tapio; Watts, Phillip C

    2014-06-01

    Tick-borne diseases pose an increasingly important public health problem in Europe. Rodents are the reservoir host for many tick-transmitted pathogens, including Anaplasma phagocytophilum and Babesia microti, which can cause human granulocytic anaplasmosis and babesiosis, respectively. To estimate the presence of these pathogens in rodents in Finland, we examined blood samples from 151 bank voles (Myodes glareolus) and demonstrate, for the first time, that A. phagocytophilum and B. microti commonly infect bank voles (in 22% and 40% of animals, respectively) in Finland. Sequence analysis of a fragment of 18S rRNA showed that the B. microti strain isolated was identical to the Munich strain, which is considered to be nonzoonotic. The A. phagocytophilum strain (based on a fragment of the msp4 gene) was identical to one found earlier in rodents in the United Kingdom that is transmitted by the tick Ixodes trianguliceps, all the life stages of which feed on small mammals. The infection probability of B. microti in the bank voles was the greater the older the individual was, and males were more often infected than females. A. phagocytophilum infection probability first increased and then decreased with the age of individual without any difference between sexes. While these pathogens presumably pose a limited zoonotic risk to humans in Finland, they might have important interactions with other rodent pathogens and therefore affect infection dynamics of, for example, zoonotic pathogens. PMID:24848684

  11. Superinfection occurs in Anaplasma phagocytophilum infected sheep irrespective of infection phase and protection status

    Directory of Open Access Journals (Sweden)

    Bergström Karin

    2009-10-01

    Full Text Available Abstract Background Anaplasma phagocytophilum infection in domestic ruminants is widespread in the coastal areas of southern Norway. The bacteria may persist in mammalian hosts. Several genetic variants of A. phagocytophilum exist. In the present study, we investigate whether superinfection occurs in the acute and persistent phase of the infection. Methods Five-month-old lambs of the Norwegian Dala breed were experimentally infected with two 16S rRNA gene variants of A. phagocytophilum, i.e. A. phagocytophilum variant 1 (GenBank accession number M73220 and variant 2 (GenBank acc. no. AF336220. Eighteen lambs were used, two lambs in each group. Eight groups were experimentally inoculated with either variant 1 or 2 on day 0. Six of these groups were then challenged with the other variant on either days 7, 42 or 84, respectively. One group was left uninfected. The occurrence of A. phagocytophilum in blood samples was determined using semi-nested PCR analysis and gene sequencing. Specific antibodies were measured by an indirect immunofluorescence antibody assay (IFA. Results A. phagocytophilum variant 1 and 2 differed significantly with regards to clinical reaction and cross-immunity in infected lambs. Both variants were found in the blood after challenge. However, variant 1 was detected most frequently. Conclusion The present experiment indicates that superinfection of different genotypes occurs during the acute as well as the persistent phase of an A. phagocytophilum infection, even in lambs protected against the challenged infection.

  12. Introduction to the alpha-proteobacteria: Wolbachia and Bartonella, Rickettsia, Brucella, Ehrlichia, and Anaplasma.

    Science.gov (United States)

    Bowman, Dwight D

    2011-11-01

    Wolbachia is an obligate intracellular endosymbiont and likely mutualist living within the heartworm Dirofilaria immitis and a number of other filarial nematodes in the family Onchocercidae. The bacterial infection is passed from worm to worm transovarially; the organisms are in ovarian cells, the developing microfilariae, and multiply and persist in all later developmental stages through the mosquito and into the next host. Besides being present in the ovaries of the adult worms, they also are present in large numbers within the hypodermal tissues of the nematode. It is now know that these bacteria that were first observed in heartworms more than 30 years ago are actually related to similar Wolbachia bacteria that are found in arthropods. Wolbachia is an alpha-proteobacteria, and this group includes a number of important arthropod-transmitted bacterial agents of dogs and cats: Rickettsia rickettsii, R. felis, Anaplasma platys, Ehrlichia canis, E. chaffeensis, and E. ewingii. Alpha-proteobacteria are also important as obligate intracellular mutualists in plants in which they are responsible for nitrogen fixation. Recent work on the treatment of heartworms in dogs with doxycycline stems from related work with the human filarial nematode Onchocerca volvulus that causes river blindness in people. PMID:22152604

  13. First molecular survey of Anaplasma bovis in small ruminants from Tunisia.

    Science.gov (United States)

    Ben Said, Mourad; Belkahia, Hanène; Karaoud, Maroua; Bousrih, Maha; Yahiaoui, Mouna; Daaloul-Jedidi, Monia; Messadi, Lilia

    2015-09-30

    To date, no information is available regarding the presence of Anaplasma bovis in the South Mediterranean area. In this study, prevalence, risk factors, and genetic diversity of A. bovis were assessed in small ruminants. A total of 563 healthy small ruminants (260 sheep and 303 goats), from 25 randomly selected flocks located in 5 localities from two bioclimatic areas in Tunisia, were investigated for the detection of A. bovis in blood by nested polymerase chain reaction (nPCR) assay. The overall infection rates of A. bovis were 42.7 and 23.8% in sheep and goats, respectively. Goats located in a sub-humid area were statistically more infected than those located in a humid area. A. bovis prevalence rate varied significantly according to sheep and goat flocks, and to the sheep breed. Infection with A. bovis was validated by sequencing. Sequence analysis based on the 16S rRNA gene showed that A. bovis from Tunisian goats and sheep clustered with other strain sequences detected from wild and domestic animals and published in GenBank. This study gives the first insight of presence of A. bovis DNA in small ruminants in Tunisia and suggests that these animal species may be playing an important role in the bovine anaplasmosis natural cycle caused by A. bovis in the South Mediterranean ecosystem. PMID:26088935

  14. Global proteomic analysis of two tick-borne emerging zoonotic agents: Anaplasma phagocytophilum and Ehrlichia chaffeensis

    Energy Technology Data Exchange (ETDEWEB)

    Lin, Mingqun ..; Kikuchi, Takane; Brewer, Heather M.; Norbeck, Angela D.; Rikihisa, Yasuko

    2011-02-17

    Anaplasma phagocytophilum and Ehrlichia chaffeensis are obligatory intracellular {alpha}-proteobacteria that infect human leukocytes and cause potentially fatal emerging zoonoses. In the present study, we determined global protein expression profiles of these bacteria cultured in the human promyelocytic leukemia cell line, HL-60. Mass spectrometric (MS) analyses identified a total of 1,212 A. phagocytophilum and 1,021 E. chaffeensis proteins, representing 89.3 and 92.3% of the predicted bacterial proteomes, respectively. Nearly all bacterial proteins ({approx}99%) with known functions were expressed, whereas only approximately 80% of hypothetical proteins were detected in infected human cells. Quantitative MS/MS analyses indicated that highly expressed proteins in both bacteria included chaperones, enzymes involved in biosynthesis and metabolism, and outer membrane proteins, such as A. phagocytophilum P44 and E. chaffeensis P28/OMP-1. Among 113 A. phagocytophilum p44 paralogous genes, 110 of them were expressed and 88 of them were encoded by pseudogenes. In addition, bacterial infection of HL-60 cells up-regulated the expression of human proteins involved mostly in cytoskeleton components, vesicular trafficking, cell signaling, and energy metabolism, but down regulated some pattern recognition receptors involved in innate immunity. Our proteomics data represent a comprehensive analysis of A. phagocytophilum and E. chaffeensis proteomes, and provide a quantitative view of human host protein expression profiles regulated by bacterial infection. The availability of these proteomic data will provide new insights into biology and pathogenesis of these obligatory intracellular pathogens.

  15. A proline racemase based PCR for identification of Trypanosoma vivax in cattle blood.

    Directory of Open Access Journals (Sweden)

    Regassa Fikru

    Full Text Available A study was conducted to develop a Trypanosoma vivax (T. vivax specific PCR based on the T. vivax proline racemase (TvPRAC gene. Forward and reverse primers were designed that bind at 764-783 bp and 983-1002 bp of the gene. To assess its specificity, TvPRAC PCR was conducted on DNA extracted from different haemotropic pathogens: T. vivax from Nigeria, Ethiopia and Venezuela, T. congolense Savannah type, T. brucei brucei, T. evansi, T. equiperdum, T. theileri, Theileria parva, Anaplasma marginale, Babesia bovis and Babesia bigemina and from bovine, goat, mouse, camel and human blood. The analytical sensitivity of the TvPRAC PCR was compared with that of the ITS-1 PCR and the 18S PCR-RFLP on a dilution series of T. vivax DNA in water. The diagnostic performance of the three PCRs was compared on 411 Ethiopian bovine blood specimens collected in a former study. TvPRAC PCR proved to be fully specific for T. vivax, irrespective of its geographical origin. Its analytical sensitivity was lower than that of ITS-1 PCR. On these bovine specimens, TvPRAC PCR detected 8.3% T. vivax infections while ITS-1 PCR and 18S PCR-RFLP detected respectively 22.6 and 6.1% T. vivax infections. The study demonstrates that a proline racemase based PCR could be used, preferably in combination with ITS-1 PCR, as a species-specific diagnostic test for T. vivax infections worldwide.

  16. Los conventillos de Valparaíso, 1880-1920: Percepción de barrios y viviendas marginales. / The

    Directory of Open Access Journals (Sweden)

    Urbina C., María Ximena

    2002-01-01

    Full Text Available Las viviendas populares, los conventillos y ranchos urbanos y semiurbanos, reflejaron el modo de ser de una cultura, el modo de vivir de la gran mayoría de los porteños en tiempos en que la ciudad creció demográficamente y las viviendas y áreas llamadas "decentes" no daban abasto a la imperiosidad de buscar ganarse la vida en la urbe y hacerse citadino. En los barrios marginales de ranchos y de conventillos se expresaba lo más genuino de la vida urbana, lo popular, la vida de los más humildes que forjaron una forma de existencia arrabalera, quizá un substrato importante de la chilenidad. En este artículo nuestro objetivo es distinguir una tipología de conventillos - sin entrar en detalles de su descripción -, y perfilar la imagen, representación mental o percepción que de ellos se tenía en su época dorada, 1880-1920./Popular housing, "conventillos", urban and semi-urban ranches show the way of life and culture most of the people in Valparaiso in a time when the city experimented a population growth and proper housing was not enough to cover the growing demand due to the greater need to make a living in the city and becoming a city dweller. In this low class neighborhoods, ranches and "conventillos" the most genuine aspects of city life, that which is popular, the life of the humble, the slum dwellers, which is perhaps an important constituent of what is Chilean. In this article our objective is to define a type of "conventillos", nevertheless not describing them in detail, and then establish and image, a mental representation or perception that people had of them during their 'golden age' between the years 1880 and 1920.

  17. Detección de Anaplasma spp. en Garrapatas de Myrmecophaga tridactyla de Vida Libre en la Sabana Inundable de Casanare‚ Colombia -resumen-

    OpenAIRE

    César Rojano-Bolaño; V Contreras-Cogollo; L Miranda-Cortés; R Ávila-Avilán; Jorge Miranda-Regino; Laura Hernández-Fernández; Salim Mattar-Velilla; Santiago Monsalve-Buriticá

    2014-01-01

    La anaplasmosis es una enfermedad infecciosa causada por rickettsias del género Anaplasma spp. Su relevancia esta principalmente determinada por el grado de afectación endémica en el ganado doméstico. Una amplia variedad de mamíferos silvestres también son susceptibles a la infección. Las bacterias pueden ser intracitoplasmáticas‚ dañando las estructuras de las células pudiendo causar anemia e ictericia. Algunas especies de Anaplasma spp han sido reportadas como microorganismos potencialmente...

  18. Molecular Detection of Zoonotic Rickettsiae and Anaplasma spp. in Domestic Dogs and Their Ectoparasites in Bushbuckridge, South Africa.

    Science.gov (United States)

    Kolo, Agatha O; Sibeko-Matjila, Kgomotso P; Maina, Alice N; Richards, Allen L; Knobel, Darryn L; Matjila, Paul T

    2016-04-01

    Members of the order Rickettsiales are small, obligate intracellular bacteria that are vector-borne and can cause mild to fatal diseases in humans worldwide. There is little information on the zoonotic rickettsial pathogens that may be harbored by dogs from rural localities in South Africa. To characterize rickettsial pathogens infecting dogs, we screened 141 blood samples, 103 ticks, and 43 fleas collected from domestic dogs in Bushbuckridge Municipality, Mpumalanga Province of South Africa, between October 2011 and May 2012 using the reverse line blot (RLB) and Rickettsia genus and species-specific quantitative real-time PCR (qPCR) assays. Results from RLB showed that 49% of blood samples and 30% of tick pools were positive for the genus-specific probes for Ehrlichia/Anaplasma; 16% of the blood samples were positive for Ehrlichia canis. Hemoparasite DNA could not be detected in 36% of blood samples and 30% of tick pools screened. Seven (70%) tick pools and both flea pools were positive for Rickettsia spp; three (30%) tick pools were positive for Rickettsia africae; and both flea pools (100%) were positive for Rickettsia felis. Sequencing confirmed infection with R. africae and Candidatus Rickettsia asemboensis; an R. felis-like organism from one of the R. felis-positive flea pools. Anaplasma sp. South Africa dog strain (closely related to Anaplasma phagocytophilum), A. phagocytophilum, and an Orientia tsutsugamushi-like sequence were identified from blood samples. The detection of emerging zoonotic agents from domestic dogs and their ectoparasites in a rural community in South Africa highlights the potential risk of human infection that may occur with these pathogens. PMID:26974185

  19. Reversible switch from hemoglobin A to C in sheep and recovery from anemia following experimental infection with Anaplasma ovis

    OpenAIRE

    Elisa Pieragostini; Ferruccio Petazzi; Anna Caroli; Alessandra Torina; Giuseppe De Ruvo; Ingrid Alloggio

    2010-01-01

    Anemia causes a change in the type of circulating hemoglobin (Hb) in sheep carrying the βA-globin haplotype, where the Hb A is replaced with Hb C, unlike Hb B. The effect of the substitution of Hb A with Hb C on the recovery from anemia was investigated by comparing the hematological picture of sheep, following experimental infection with Anaplasma ovis. The blood values were obtained from 3 AB and 3 BB Hb sheep after the development of the disease where anemia is a pathognomonic symptom...

  20. Hematologic and Clinical Aspects of Experimental Ovine Anaplasmosis Caused by Anaplasma Ovis in Iran

    Directory of Open Access Journals (Sweden)

    A Gharabaghi

    2012-12-01

    Full Text Available Background: Anaplasma ovis infections can cause clinical symptoms in acute phase and lead to huge economic losses in flocks. The aim of the present study was to investigate the hematological and parasito­logical changes in experimental anaplasmosis in sheep with Iranian strain of A. ovis.Method: Five male sheep without any blood parasite infection were selected. One hundred ml hepari­nized blood was collected from splenectomised sheep that showed 6% A. ovis parasitemia. Inocu­lums of 20 ml blood were administered intravenously to each test animal. Hematological, parasito­logical and clinical changes of experimental anaplasmosis were studied in 0-38 days post infec­tion.Result: Parasitemia was detected 3 days post infection and reached its maximum level on the day 12 of experiment in test animals. Then the parasitemia was declined, but the organism could be found persistently until the last day of study. The red cell counts, packed cell volume and hemoglobin concentra­tion were decreased and mean corpuscular volume was increased significantly during the infection period. Reticulocytosis and basophilic stippling were also detected. No significant changes were observed in total and differential leukocyte count and animal body temperature.Conclusion: Experimental A. ovis infection in sheep resulted in marked normocytic normochromic anemia at the beginning of the infection which became macrocytic normochromic by the develop­ment of the disease. There were negative correlations between parasitemia and RBC, PCV and Hb values, therefore hematological assessment can be considered as a practical diagnostic tool in ovine anaplasmosis.

  1. Detection of Babesia and Anaplasma species in rabbits from Texas and Georgia, USA.

    Science.gov (United States)

    Yabsley, Michael J; Romines, Janean; Nettles, Victor F

    2006-01-01

    Rabbits have been shown to harbor a suite of zoonotic organisms, including a Babesia species, Borrelia burgdorferi, and Anaplasma phagocytophilum. In this study, we conducted a molecular survey for various tick-borne pathogens in three species of rabbits from Texas and Georgia. Of 18 black-tailed jackrabbits (Lepus californicus) tested from Texas, six (28%) were polymerase chain reaction (PCR) positive for Babesia, and nucleotide sequencing revealed two distinct species or strains. Two jackrabbits were infected with a Babesia species or strain (Babesia sp. A) that was nearly identical (99.9%) to a piroplasm previously detected in humans from Washington state, and the remaining four jackrabbits were infected with a Babesia species (Babesia sp. B) that was most similar (99.7%) to a Babesia species detected in cottontail rabbits from Massachusetts and humans from Kentucky and Missouri. Eleven (61%) black-tailed jackrabbits were positive for A. bovis, and one was positive for A. phagocytophilum. Two of four desert cottontails (Sylvilagus audubonii) from Texas were positive for the Babesia sp. B, and one desert cottontail each was positive for A. bovis and A. phagocytophilum. One of these desert cottontails was coinfected with the Babesia sp. B and A. phagocytophilum, and five jackrabbits were coinfected with Babesia species and A. bovis. Of 19 eastern cottontails (S. floridanus) from Georgia, only one (5.3%) was positive for A. phagocytophilum, and three (15.8%) were positive for A. bovis. No rabbits from Texas or Georgia were positive for Borrelia species. The only tick species detected on the Texas and Georgia rabbits was the rabbit tick, Haemaphysalis leporispalustris. These data extend the geographic and host range of these pathogens, and because both the Babesia species and A. phagocytophilum are potential zoonotic pathogens, it is important to be aware that these organisms are enzootic in parts of the southern United States. PMID:16584322

  2. First molecular detection and phylogenetic analysis of Anaplasma phagocytophilum in shelter dogs in Seoul, Korea.

    Science.gov (United States)

    Lee, Sukyee; Lee, Seung-Hun; VanBik, Dorene; Kim, Neung-Hee; Kim, Kyoo-Tae; Goo, Youn-Kyoung; Rhee, Man Hee; Kwon, Oh-Deog; Kwak, Dongmi

    2016-07-01

    In this study, the status of Anaplasma phagocytophilum infection was assessed in shelter dogs in Seoul, Korea, with PCR and phylogenetic analyses. Nested PCR on 1058 collected blood samples revealed only one A. phagocytophilum positive sample (female, age genetic variability of A. phagocytophilum was evaluated by genotyping, using the 16S rRNA, groEL, and msp2 gene sequences of the positive sample. BLASTn analysis revealed that the 16S rRNA, groEL, and msp2 genes had 99.6%, 99.9%, and 100% identity with the following sequences deposited in GenBank: a cat 16S rRNA sequence from Korea (KR021166), a rat groEL sequence from Korea (KT220194), and a water deer msp2 sequence from Korea (HM752099), respectively. Phylogenetic analyses classified the groEL gene into two distinct groups (serine and alanine), whereas the msp2 gene showed a general classification into two groups (USA and Europe) that were further subgrouped according to region. To the best of our knowledge, this study is the first to describe the molecular diagnosis of A. phagocytophilum in dogs reared in Korea. In addition, the high genetic identity of the 16S rRNA and groEL sequences between humans and dogs from the same region suggests a possible epidemiological relation. Given the conditions of climate change, tick ecology, and recent incidence of human granulocytic anaplasmosis in Korea, the findings of this study underscore the need to establish appropriate control programs for tick-borne diseases in Korea. PMID:27130537

  3. Wild boar (Sus scrofa) - reservoir host of Toxoplasma gondii, Neospora caninum and Anaplasma phagocytophilum in Slovakia.

    Science.gov (United States)

    Reiterová, Katarína; Špilovská, Silvia; Blaňarová, Lucia; Derdáková, Markéta; Čobádiová, Andrea; Hisira, Vladimír

    2016-06-01

    In Central Europe the wild boar population is permanently growing and consequently Cf foodborne infections. In this study serological and molecular detection of Toxoplasma gondii and Neospora caninum in wild boars was evaluated. Moreover, same samples were screened for the presence and genetic variability of tick-borne bacterium Anaplasma phagocytophilum. Blood samples collected from 113 wild boars from Southern Slovakia were examined for antibodies to T. gondii by indirect and to N. caninum by competitive ELISA. The presence of parasitic DNA in blood samples was determined by standard or real time PCR techniques. Antibodies against T. gondii and N. caninum were detected in 45 (39.8%) and 38 (33.6%) animals, respectively. Females were more frequently infected for both pathogens than males. The high seropositivity against both coccidia indicates a permanent occurrence of these pathogens in the studied locality. T. gondii DNA was confirmed in five seropositive boars (4.4%) and N. caninum in 23 blood samples (20.4%). Three out of 23 N. caninum PCR positive animals did not show seropositivity. Three out of 113 blood samples of wild boars were positive for A. phagocytophilum (2.7%). The obtained A. phagocytophilum sequences were 100% identical with GenBankTM isolates from Slovak dog (KC985242); German horse (JF893938) or wild boar (EF143810) and red deer (EF143808) from Poland. Coinfections of T. gondii with N. caninum and N. caninum with A. phagocytophilum were detected in single cases. Results suggest a potential zoonotic risk of toxoplasmosis transmission to humans and the spread of neosporosis to farm animals. PMID:27078648

  4. Analysis of the population structure of Anaplasma phagocytophilum using multilocus sequence typing.

    Science.gov (United States)

    Huhn, Christian; Winter, Christina; Wolfsperger, Timo; Wüppenhorst, Nicole; Strašek Smrdel, Katja; Skuballa, Jasmin; Pfäffle, Miriam; Petney, Trevor; Silaghi, Cornelia; Dyachenko, Viktor; Pantchev, Nikola; Straubinger, Reinhard K; Schaarschmidt-Kiener, Daniel; Ganter, Martin; Aardema, Matthew L; von Loewenich, Friederike D

    2014-01-01

    Anaplasma phagocytophilum is a Gram-negative obligate intracellular bacterium that replicates in neutrophils. It is transmitted via tick-bite and causes febrile disease in humans and animals. Human granulocytic anaplasmosis is regarded as an emerging infectious disease in North America, Europe and Asia. However, although increasingly detected, it is still rare in Europe. Clinically apparent A. phagocytophilum infections in animals are mainly found in horses, dogs, cats, sheep and cattle. Evidence from cross-infection experiments that A. phagocytophilum isolates of distinct host origin are not uniformly infectious for heterologous hosts has led to several approaches of molecular strain characterization. Unfortunately, the results of these studies are not always easily comparable, because different gene regions and fragment lengths were investigated. Multilocus sequence typing is a widely accepted method for molecular characterization of bacteria. We here provide for the first time a universal typing method that is easily transferable between different laboratories. We validated our approach on an unprecedented large data set of almost 400 A. phagocytophilum strains from humans and animals mostly from Europe. The typability was 74% (284/383). One major clonal complex containing 177 strains was detected. However, 54% (49/90) of the sequence types were not part of a clonal complex indicating that the population structure of A. phagocytophilum is probably semiclonal. All strains from humans, dogs and horses from Europe belonged to the same clonal complex. As canine and equine granulocytic anaplasmosis occurs frequently in Europe, human granulocytic anaplasmosis is likely to be underdiagnosed in Europe. Further, wild boars and hedgehogs may serve as reservoir hosts of the disease in humans and domestic animals in Europe, because their strains belonged to the same clonal complex. In contrast, as they were only distantly related, roe deer, voles and shrews are unlikely to

  5. Longitudinal analysis of tick densities and Borrelia, Anaplasma, and Ehrlichia infections of Ixodes ricinus ticks in different habitat areas in The Netherlands.

    NARCIS (Netherlands)

    Wielinga, Peter R; Gaasenbeek, Cor; Fonville, Manoj; Boer, Albert de; Vries, Ankje de; Dimmers, Wim; Akkerhuis Op Jagers, Gerard; Schouls, Leo M; Borgsteede, Fred; Giessen, Joke W B van der

    2006-01-01

    From 2000 to 2004, ticks were collected by dragging a blanket in four habitat areas in The Netherlands: dunes, heather, forest, and a city park. Tick densities were calculated, and infection with Borrelia burgdorferi and Anaplasma and Ehrlichia species was investigated by reverse line blot analysis.

  6. Longitudinal analysis of tick densities and Borrelia, Anaplasma, and Ehrlichia infections of Ixodes ricinus ticks in different habitat areas in the Netherlands

    NARCIS (Netherlands)

    Wielinga, P.R.; Gaasenbeek, C.P.H.; Fonville, M.; Boer, de A.G.; Vries, de A.; Dimmers, W.J.; Jagers op Akkerhuis, G.A.J.M.; Schouls, L.M.; Borgsteede, F.H.M.; Giessen, van der J.W.B.

    2006-01-01

    From 2000 to 2004, ticks were collected by dragging a blanket in four habitat areas in The Netherlands: dunes, heather, forest, and a city park. Tick densities were calculated, and infection with Borrelia burgdorferi and Anaplasma and Ehrlichia species was investigated by reverse line blot analysis.

  7. DETECTION OF ANTIBODIES TO ANAPLASMA, BARTONELLA AND COXIELLA IN RURAL INHABITANTS OF THE CARIBBEAN AREA OF COLOMBIA

    Directory of Open Access Journals (Sweden)

    Salim Máttar

    2006-12-01

    Full Text Available Objetivo. Establecer la seroprevalencia de Bartonella spp, Anaplasma phagocytophilum (antesErlichia y Coexiella burnetii. Materiales y métodos. Se analizaron sueros representativos de unsector de la población en el año 2003, recolectados de personas que trabajan en actividades delcampo en los departamentos de Córdoba y Sucre que sirvieron como población base de las muestrasque se obtuvieron. Los trabajadores rurales elegidos a participar tenían entra 16 – 65 años deedad. Los sueros fueron examinados por IFA para detección de anticuerpos contra IgG para Bartonellaspp, Erlichia Anaplasma phagocytophilum y Coexiella burnetii. Resultados. La seroprevalencia deanticuerpos de todos los microorganismos estudiados fue de 56.8%. De 81 muestras de sueroanalizadas el 26.6% fueron seropositivas contra C. burnetii, el 37.7% tuvieron anticuerpos contraBartonella y el 20% de los individuos evaluados fueron seropositivos para Anaplasmaphagocytophilum. Conclusiones. Nuestros datos indican que la prevalencia de anticuerpos contraBartonella, A. phagocytophilum y C. burnetii son altos en nuestra región. Los resultados indicanque estas enfermedades zoonoticas son muy comunes en las personas que residen en el área delcaribe colombiano. Este estudio demuestra por primera vez la presencia de estos microorganismosen Colombia.

  8. An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.

    Directory of Open Access Journals (Sweden)

    Adela S Oliva Chávez

    Full Text Available Anaplasma phagocytophilum, the causative agent of Human Granulocytic Anaplasmosis (HGA, is an obligately intracellular α-proteobacterium that is transmitted by Ixodes spp ticks. However, the pathogen is not transovarially transmitted between tick generations and therefore needs to survive in both a mammalian host and the arthropod vector to complete its life cycle. To adapt to different environments, pathogens rely on differential gene expression as well as the modification of proteins and other molecules. Random transposon mutagenesis of A. phagocytophilum resulted in an insertion within the coding region of an o-methyltransferase (omt family 3 gene. In wild-type bacteria, expression of omt was up-regulated during binding to tick cells (ISE6 at 2 hr post-inoculation, but nearly absent by 4 hr p.i. Gene disruption reduced bacterial binding to ISE6 cells, and the mutant bacteria that were able to enter the cells were arrested in their replication and development. Analyses of the proteomes of wild-type versus mutant bacteria during binding to ISE6 cells identified Major Surface Protein 4 (Msp4, but also hypothetical protein APH_0406, as the most differentially methylated. Importantly, two glutamic acid residues (the targets of the OMT were methyl-modified in wild-type Msp4, whereas a single asparagine (not a target of the OMT was methylated in APH_0406. In vitro methylation assays demonstrated that recombinant OMT specifically methylated Msp4. Towards a greater understanding of the overall structure and catalytic activity of the OMT, we solved the apo (PDB_ID:4OA8, the S-adenosine homocystein-bound (PDB_ID:4OA5, the SAH-Mn2+ bound (PDB_ID:4PCA, and SAM- Mn2+ bound (PDB_ID:4PCL X-ray crystal structures of the enzyme. Here, we characterized a mutation in A. phagocytophilum that affected the ability of the bacteria to productively infect cells from its natural vector. Nevertheless, due to the lack of complementation, we cannot rule out secondary

  9. An O-Methyltransferase Is Required for Infection of Tick Cells by Anaplasma phagocytophilum.

    Science.gov (United States)

    Oliva Chávez, Adela S; Fairman, James W; Felsheim, Roderick F; Nelson, Curtis M; Herron, Michael J; Higgins, LeeAnn; Burkhardt, Nicole Y; Oliver, Jonathan D; Markowski, Todd W; Kurtti, Timothy J; Edwards, Thomas E; Munderloh, Ulrike G

    2015-01-01

    Anaplasma phagocytophilum, the causative agent of Human Granulocytic Anaplasmosis (HGA), is an obligately intracellular α-proteobacterium that is transmitted by Ixodes spp ticks. However, the pathogen is not transovarially transmitted between tick generations and therefore needs to survive in both a mammalian host and the arthropod vector to complete its life cycle. To adapt to different environments, pathogens rely on differential gene expression as well as the modification of proteins and other molecules. Random transposon mutagenesis of A. phagocytophilum resulted in an insertion within the coding region of an o-methyltransferase (omt) family 3 gene. In wild-type bacteria, expression of omt was up-regulated during binding to tick cells (ISE6) at 2 hr post-inoculation, but nearly absent by 4 hr p.i. Gene disruption reduced bacterial binding to ISE6 cells, and the mutant bacteria that were able to enter the cells were arrested in their replication and development. Analyses of the proteomes of wild-type versus mutant bacteria during binding to ISE6 cells identified Major Surface Protein 4 (Msp4), but also hypothetical protein APH_0406, as the most differentially methylated. Importantly, two glutamic acid residues (the targets of the OMT) were methyl-modified in wild-type Msp4, whereas a single asparagine (not a target of the OMT) was methylated in APH_0406. In vitro methylation assays demonstrated that recombinant OMT specifically methylated Msp4. Towards a greater understanding of the overall structure and catalytic activity of the OMT, we solved the apo (PDB_ID:4OA8), the S-adenosine homocystein-bound (PDB_ID:4OA5), the SAH-Mn2+ bound (PDB_ID:4PCA), and SAM- Mn2+ bound (PDB_ID:4PCL) X-ray crystal structures of the enzyme. Here, we characterized a mutation in A. phagocytophilum that affected the ability of the bacteria to productively infect cells from its natural vector. Nevertheless, due to the lack of complementation, we cannot rule out secondary mutations

  10. Reversible switch from hemoglobin A to C in sheep and recovery from anemia following experimental infection with Anaplasma ovis

    Directory of Open Access Journals (Sweden)

    Elisa Pieragostini

    2010-01-01

    Full Text Available Anemia causes a change in the type of circulating hemoglobin (Hb in sheep carrying the βA-globin haplotype, where the Hb A is replaced with Hb C, unlike Hb B. The effect of the substitution of Hb A with Hb C on the recovery from anemia was investigated by comparing the hematological picture of sheep, following experimental infection with Anaplasma ovis. The blood values were obtained from 3 AB and 3 BB Hb sheep after the development of the disease where anemia is a pathognomonic symptom. The expression of the silent gene encoding for Hb C was detected by isoelectric focusing and quantified by high performance liquid chromatography. Both Hb AB genotype and Hb C occurrence were involved in the lower recovery from anemia in the trial.

  11. OCORRÊNCIA DE Anaplasma bovis (Donatien & Lestoquard, 1936, Dumler et al. 2001) NA REGIÃO DE BOM JESUS DO ITABAPOANA, RJ

    OpenAIRE

    Orlando Augusto Melo Junior; Antonio Peixoto Albernaz; José Tarcisio de Lima Thiebaut; Farlen Jose Bebber Miranda; Josias Alves Machado; Antonio Carlos Faber da Silva

    2010-01-01

    In the present study, 400 capillary blood smears collected from the ear and the tail of 200 bovines were microscopically examinedfor the presence of hemoparasites. The diagnosis was based on the direct research, semonstrating the etiologic agent inclusions. Eleven bovines (5.5%) were considered infected by Anaplasma bovis, confirming the presence of this hemoparasite in the city of Bom Jesus do Itabapoana, the first city of the northwesten region of the state of Rio de Janeiro to register suc...

  12. Prävalenz von hämotrophen Mycoplasma spp., Bartonella spp., Anaplasma phagocytophilum und Borrelia burgdorferi bei Katzen im Raum Berlin/Brandenburg

    OpenAIRE

    Morgenthal, Dinah

    2014-01-01

    Arthropod-borne infectious agents in the cat include Bartonella (B.) henselae, Bartonella (B.) clarridgeiae, Bartonella (B.) quintana, Anaplasma (A.) phagocytophilum and Borrelia (B.) burgdorferi. Moreover infections with Mycoplasma (M.) haemofelis, Candidatus Mycoplasma (C. M.) turicensis and Candidatus Mycoplasma (C. M.) haemominutum occur in the cat. The cat flea (Ctenocephalides felis) is supposed to be the main vector for Mycoplasma spp.; moreover, transmission via blood transfusion and ...

  13. Vigilancia Epidemiológica de Rickettsia‚ Ehrlichia y Anaplasma en Fauna Silvestre ex situ e in situ de algunas Regiones de Colombia -resumen-

    OpenAIRE

    Santiago Monsalve-Buriticá; César Rojano-Bolaño; Jorge Miranda-Regino; Lizeth Quintana-Diosa; Laura Hernandez-Fernandez; M J Loaiza-Escobar; Luz Dary Acevedo-Cendales; Salim Mattar-Velilla; J Londoño-Londoño; J D Rodas-González

    2014-01-01

    Las enfermedades causadas por bacterias del orden de los Rickettsiales son trasmitidas por ectoparásitos originados en vida silvestre‚ sin embargo‚ en Colombia no existe una línea base del conocimiento en este sentido. Estos microorganismos intracelulares son causantes de enfermedades transmisibles en pacientes humanos; convirtiéndolas en zoonosis de tipo emergente. Este estudio ha permitido determinar la presencia de microorganismos del orden de los Rickettsiales (Ehrlichia spp.‚ Anaplasma s...

  14. Prevalence of Human-Active and Variant 1 Strains of the Tick-Borne Pathogen Anaplasma phagocytophilum in Hosts and Forests of Eastern North America

    OpenAIRE

    Keesing, Felicia; McHenry, Diana J.; Hersh, Michelle; Tibbetts, Michael; Jesse L Brunner; Killilea, Mary; LoGiudice, Kathleen; Kenneth A Schmidt; Ostfeld, Richard S.

    2014-01-01

    Anaplasmosis is an emerging infectious disease caused by infection with the bacterium Anaplasma phagocytophilum. In the eastern United States, A. phagocytophilum is transmitted to hosts through the bite of the blacklegged tick, Ixodes scapularis. We determined the realized reservoir competence of 14 species of common vertebrate hosts for ticks by establishing the probability that each species transmits two important strains of A. phagocytophilum (A. phagocytophilum human-active, which causes ...

  15. Infections and risk factors for livestock with species of Anaplasma, Babesia and Brucella under semi-nomadic rearing in Karamoja Region, Uganda.

    Science.gov (United States)

    Lolli, Chiara; Marenzoni, Maria Luisa; Strona, Paolo; Lappo, Pier Giorgio; Etiang, Patrick; Diverio, Silvana

    2016-03-01

    A survey was conducted to estimate the prevalence of Anaplasma, Babesia and Brucella spp. infections in cattle, goats and sheep in the Karamoja Region of Uganda and to identify possible risk factors existing in this semi-nomadic and pastoral area. Low cost laboratory tests were used to diagnose infections (Rose Bengal test for Brucella spp. antibodies and direct microscopic examination for Anaplasma and Babesia spp.). Multivariable logistic regression models were applied to identify possible risk factors linked to gender, animal species, age (only for cattle) and districts. A total of 3935 cattle, 729 goats and 306 sheep of five districts of the Karamoja Region were tested. Seroprevalence for Brucella was 9.2 % (CI, 95 %: 8.4-10), for Anaplasma 19.5 % (CI 95 %: 18.4-20.6) and for Babesia 16 % (CI 95 %: 15-17.1). Significant differences in infections prevalence were observed against risk factors associated with districts and species. Cattle were the species with higher risk of the infections. Female gender was identified as at risk only for Brucella spp. infection. Cattle more than one year old had greater likelihood to be Brucella seropositive. Co-infections of Anaplasma and Babesia spp. were statistically associated, especially in goats and sheep. Further studies to identify risk factors related to host species and geographical districts are needed. The influence on the semi-nomadic agro-pastoral system in Karamoja of animal raids and animal mixing should be further investigated. Findings were important to sensitize Karamojong undertaking measures on infection control, especially on cattle, which are their main source of food. PMID:26888206

  16. A Molecular and Serological Survey of Rickettsiales Bacteria in Wild Sika Deer (Cervus nippon nippon) in Shizuoka Prefecture, Japan: High Prevalence of Anaplasma Species.

    Science.gov (United States)

    Wu, Dongxing; Wuritu; Yoshikawa, Yuko; Gaowa; Kawamori, Fumihiko; Ikegaya, Asaka; Ohtake, Masayoshi; Ohashi, Masataka; Shimada, Masahiko; Takada, Ayumi; Iwai, Katsuki; Ohashi, Norio

    2015-01-01

    We surveyed Rickettsiales bacteria, including Rickettsia, Ehrlichia, Anaplasma, and Neoehrlichia, in wild sika deer (Cervus nippon nippon) from Shizuoka prefecture, Japan. In spleen samples from 187 deer, Anaplasma phagocytophilum (deer type), A. bovis, and A. centrale were successfully detected by PCR assay targeting to 16S rDNA or p44/msp2, and their positive rates were 96.3% (180/187), 53.5% (100/187), and 78.1% (146/187), respectively. Additionally, 2 or 3 Anaplasma species could be detected from a single deer in 165 spleen samples (88.2%), indicating dual or triple infection. In contrast, A. phagocytophilum (human type) 16S rDNA, Rickettsia gltA, Ehrlichia p28/omp-1, and Neoehrlichia 16S rDNA could not be amplified. The serological test of 105 deer serum samples by immunofluorescence assay showed that the detection of antibodies against antigens of A. phagocytophilum HZ (US-human isolate) and Rickettsia japonica YH were 29.5% (31/105) and 75.2% (79/105), respectively. These findings suggest that A. phagocytophilum (deer type), A. centrale, and A. bovis are highly dominant and prevalent in wild sika deer from Shizuoka, a central region of Japan, and that the antibodies against some Rickettsiales bacteria have also been retained in deer blood. PMID:25971318

  17. Serological and molecular investigation of Ehrlichia spp. and Anaplasma spp. in ticks and blood of dogs, in the Thrace Region of Turkey.

    Science.gov (United States)

    Çetinkaya, Handan; Matur, Erdal; Akyazi, İbrahim; Ekiz, Elif Ergul; Aydin, Levent; Toparlak, Mufit

    2016-07-01

    In recent years, tick-borne diseases like ehrlichiosis and anaplasmosis became widespread worldwide threatening the health of both human and companion animals. Therefore, the aim of this study was to determine the presence of Anaplasma spp., and Ehrlichia spp. in dogs and ticks in the Thrace Region of Turkey. A total of 400 blood samples and 912 ticks were collected from dogs living in shelters that are located in four cities (Istanbul, Edirne, Tekirdag and Kirklareli) of the Thrace Region. Blood and buffy coat smears were prepared for microscopic examination. Hematologic and serologic analyses were performed using cell counter and commercial Snap3Dx test kit, respectively. Eight hundred fifty of collected ticks were classified as Rhipicephalus sanguineus, 33 as Rhipicephalus turanicus and 29 as Ixodes ricinus. After DNA extraction from blood samples and pooled ticks (127 tick pools, in total), nested PCR was performed to detect the DNA of Anaplasma spp., and Ehrlichia spp. The seroprevalence of Ehrlichia canis was 27.25% (109) by Snap3Dx test and the total molecular positivity was 11.75% (47) in dog blood samples and 21.25% (27) in tick pools by nested PCR. The frequencies of the infected blood samples with E. canis, Anaplasma phagocytophilum and Anaplasma platys were detected as 6%, 4% and 6%, respectively. E. canis and A. platys were detected in R. sanguineus pools with a ratio of 15.75% and 0.7%, respectively. In addition, A. platys was also detected in R. turanicus pools (0.7%). A. phagocytophilum was found only in I. ricinus pools (3.93%). Morulae of three species were detected in buffy coat and blood smears. While anemia was observed in dogs infected with E. canis and co-infected (with one or more species), thrombocytopenia was observed only in co-infected dogs. This is the first study providing evidence for the presence of Anaplasma spp. and Ehrlichia spp. in dogs and ticks in the Thrace Region of Turkey. Based on the results of the tests used in this study

  18. Detección de Anaplasma spp. en Garrapatas de Myrmecophaga tridactyla de Vida Libre en la Sabana Inundable de Casanare‚ Colombia -resumen-

    Directory of Open Access Journals (Sweden)

    César Rojano-Bolaño

    2014-12-01

    Full Text Available La anaplasmosis es una enfermedad infecciosa causada por rickettsias del género Anaplasma spp. Su relevancia esta principalmente determinada por el grado de afectación endémica en el ganado doméstico. Una amplia variedad de mamíferos silvestres también son susceptibles a la infección. Las bacterias pueden ser intracitoplasmáticas‚ dañando las estructuras de las células pudiendo causar anemia e ictericia. Algunas especies de Anaplasma spp han sido reportadas como microorganismos potencialmente zoonóticos‚ por lo tanto‚ la anaplasmosis‚ como otras enfermedades transmitidas por garrapatas‚ ha tomado una especial relevancia en la salud pública. El objetivo de este estudio fue detectar la presencia de Anaplasma spp.‚ en garrapatas colectadas en nueve osos palmeros (Myrmecophaga tridactyla de vida libre en el municipio de Pore‚ Casanare‚ entre los años 2013 y 2014‚ capturados con el método de búsqueda activa‚ y posteriormente fueron anestesiados utilizando un dardo con Ketamina (12 mg/kg y Xilacina (0‚5 mg/kg por vía intramuscular. Las garrapatas fueron colectadas directamente de los individuos‚ con ayuda de pinzas. En total se obtuvieron 204 ectoparásitos‚ que fueron almacenados en alcohol al 70%‚ y posteriormente fueron identificados como pertenecientes a la especie Amblyomma cajennense. Para este estudio se seleccionaron 55 pool de tres individuos y fueron analizadas por medio de la técnica de PCR en tiempo real. Se detectaron 2 pool de garrapatas positivos a este microorganismo (3‚6 % pertenecientes a dos osos palmeros. Los resultados preliminares de este estudio demuestran que Anaplasma spp. podría estar circulante entre garrapatas A. cajennense de animales silvestres en la sabana inundable del municipio de Pore‚ Casanare. Se hace necesario realizar nuevos muestreos para analizar un mayor número de garrapatas y determinar la especie de Anaplasma spp. presente.

  19. Ehrlichia canis and Anaplasma platys in ticks of dogs in Cuiaba, Mato GrossoEhrlichia canis e Anaplasma platys em carrapatos de cães de Cuiabá, Mato Grosso

    Directory of Open Access Journals (Sweden)

    Valéria Dutra

    2012-06-01

    Full Text Available Diseases transmitted by arthropods such as Rhipicephalus sanguineus, are caused by a spectrum of pathogens. Among these are the canine monocytic ehrlichiosis and cyclical thrombocytopenia with a cosmopolitan distribution. Aiming to verify the presence of DNA of Anaplasma platys and Ehrlichia canis in ticks R. sanguineus collected in the period 2008 to 2009 of 380 infected dogs. Ticks, after maceration, were subjected to DNA extraction and then nested PCR was performed for amplification of A. platys and E. canis. Of these, 81 (29.7% amplified DNA from ehrlichiais agents, where 38 (17.9% amplified in E. canis and 32 (15.7% for A. platys. The observation of two pathogens, combined with worldwide distribution of the tick R. sanguineus, demonstrates the high risk of infection with these pathogens in dogs in the city of Cuiaba. Doenças transmitidas por artrópodes, como o Rhipicephalus sanguineus, são causadas por um espectro de patógenos. Dentre estas, estão a erliquiose monocítica canina e trombocitopenia cíclica com distribuição cosmopolita. Com o objetivo de verificar a presença de DNA de Anaplasma platys e Ehrlichia canis em carrapatos R. sanguineus coletados no período de 2008 a 2009 de 380 cães infestados. Os carrapatos, após a maceração, foram submetidos a extração de DNA e, em seguida, foi realizada a Nested PCR para a amplificação da espécie A. platys e E. canis. Destes, 81 (29.7% amplificaram o DNA dos agentes ehrlichiais, onde 38 (17.9% amplificaram para E. canis e 32 (15.7% para A. platys. A observação dos dois patógenos, combinado com distribuição mundial do carrapato R. sanguineus, demonstra o elevado risco de infecção por esses patógenos de cães na cidade de Cuiabá.

  20. Responsabilidad Social Matriz de indicadores sustentables que refleja el impacto de la forestación en tierras marginales del Partido de Bahía Blanca, Argentina

    Directory of Open Access Journals (Sweden)

    Regina del Carmen Durán Durán

    2009-01-01

    Full Text Available Actualmente, se han empezado a considerar otras obligaciones que tienen las empresas para con su comunidad; se trata de aspectos vinculados con las dimensiones sociales y ambientales. Desde este contexto, nuestro trabajo tiene como punto de partida el concepto de responsabilidad social desde la noción de sustentabilidad. El objetivo es evaluar la forestación como instrumento para mejorar la sostenibilidad de los sistemas productivos tradicionales en tierras marginales del Partido de Bahía Blanca, mitigando los impactos del desarrollo no responsable de la producción primaria. Para ello, se han identificado técnicas de manejo generadoras de externalidades positivas en otras actividades agropecuarias complementarias, donde existen limitantes edafológicas, apoyándose en las tres dimensiones del concepto de sustentabilidad: ecológica, económica, sociopolítica y cultural. De igual forma, se diseñó una matriz de evaluación y ponderación de impactos, que contempla indicadores cuantitativos y cualitativos, de cuya aplicación surge la forestación como una alternativa sustentable

  1. The Prostaglandin E2-EP3 Receptor Axis Regulates Anaplasma phagocytophilum-Mediated NLRC4 Inflammasome Activation.

    Science.gov (United States)

    Wang, Xiaowei; Shaw, Dana K; Hammond, Holly L; Sutterwala, Fayyaz S; Rayamajhi, Manira; Shirey, Kari Ann; Perkins, Darren J; Bonventre, Joseph V; Velayutham, Thangam S; Evans, Sean M; Rodino, Kyle G; VieBrock, Lauren; Scanlon, Karen M; Carbonetti, Nicholas H; Carlyon, Jason A; Miao, Edward A; McBride, Jere W; Kotsyfakis, Michail; Pedra, Joao H F

    2016-08-01

    Rickettsial agents are sensed by pattern recognition receptors but lack pathogen-associated molecular patterns commonly observed in facultative intracellular bacteria. Due to these molecular features, the order Rickettsiales can be used to uncover broader principles of bacterial immunity. Here, we used the bacterium Anaplasma phagocytophilum, the agent of human granulocytic anaplasmosis, to reveal a novel microbial surveillance system. Mechanistically, we discovered that upon A. phagocytophilum infection, cytosolic phospholipase A2 cleaves arachidonic acid from phospholipids, which is converted to the eicosanoid prostaglandin E2 (PGE2) via cyclooxygenase 2 (COX2) and the membrane associated prostaglandin E synthase-1 (mPGES-1). PGE2-EP3 receptor signaling leads to activation of the NLRC4 inflammasome and secretion of interleukin (IL)-1β and IL-18. Importantly, the receptor-interacting serine/threonine-protein kinase 2 (RIPK2) was identified as a major regulator of the immune response against A. phagocytophilum. Accordingly, mice lacking COX2 were more susceptible to A. phagocytophilum, had a defect in IL-18 secretion and exhibited splenomegaly and damage to the splenic architecture. Remarkably, Salmonella-induced NLRC4 inflammasome activation was not affected by either chemical inhibition or genetic ablation of genes associated with PGE2 biosynthesis and signaling. This divergence in immune circuitry was due to reduced levels of the PGE2-EP3 receptor during Salmonella infection when compared to A. phagocytophilum. Collectively, we reveal the existence of a functionally distinct NLRC4 inflammasome illustrated by the rickettsial agent A. phagocytophilum. PMID:27482714

  2. The Prostaglandin E2-EP3 Receptor Axis Regulates Anaplasma phagocytophilum-Mediated NLRC4 Inflammasome Activation

    Science.gov (United States)

    Wang, Xiaowei; Shaw, Dana K.; Hammond, Holly L.; Sutterwala, Fayyaz S.; Rayamajhi, Manira; Shirey, Kari Ann; Perkins, Darren J.; Bonventre, Joseph V.; Velayutham, Thangam S.; Evans, Sean M.; Rodino, Kyle G.; VieBrock, Lauren; Scanlon, Karen M.; Carbonetti, Nicholas H.; Carlyon, Jason A.; Miao, Edward A.; McBride, Jere W.; Kotsyfakis, Michail

    2016-01-01

    Rickettsial agents are sensed by pattern recognition receptors but lack pathogen-associated molecular patterns commonly observed in facultative intracellular bacteria. Due to these molecular features, the order Rickettsiales can be used to uncover broader principles of bacterial immunity. Here, we used the bacterium Anaplasma phagocytophilum, the agent of human granulocytic anaplasmosis, to reveal a novel microbial surveillance system. Mechanistically, we discovered that upon A. phagocytophilum infection, cytosolic phospholipase A2 cleaves arachidonic acid from phospholipids, which is converted to the eicosanoid prostaglandin E2 (PGE2) via cyclooxygenase 2 (COX2) and the membrane associated prostaglandin E synthase-1 (mPGES-1). PGE2-EP3 receptor signaling leads to activation of the NLRC4 inflammasome and secretion of interleukin (IL)-1β and IL-18. Importantly, the receptor-interacting serine/threonine-protein kinase 2 (RIPK2) was identified as a major regulator of the immune response against A. phagocytophilum. Accordingly, mice lacking COX2 were more susceptible to A. phagocytophilum, had a defect in IL-18 secretion and exhibited splenomegaly and damage to the splenic architecture. Remarkably, Salmonella-induced NLRC4 inflammasome activation was not affected by either chemical inhibition or genetic ablation of genes associated with PGE2 biosynthesis and signaling. This divergence in immune circuitry was due to reduced levels of the PGE2-EP3 receptor during Salmonella infection when compared to A. phagocytophilum. Collectively, we reveal the existence of a functionally distinct NLRC4 inflammasome illustrated by the rickettsial agent A. phagocytophilum. PMID:27482714

  3. Molecular characterization and specific detection of Anaplasma species (AP-sd) in sika deer and its first detection in wild brown bears and rodents in Hokkaido, Japan.

    Science.gov (United States)

    Moustafa, Mohamed Abdallah Mohamed; Lee, Kyunglee; Taylor, Kyle; Nakao, Ryo; Sashika, Mariko; Shimozuru, Michito; Tsubota, Toshio

    2015-12-01

    A previously undescribed Anaplasma species (herein referred to as AP-sd) has been detected in sika deer, cattle and ticks in Japan. Despite being highly similar to some strains of A. phagocytophilum, AP-sd has never been detected in humans. Its ambiguous epidemiology and the lack of tools for its specific detection make it difficult to understand and interpret the prevalence of this Anaplasma species. We developed a method for specific detection, and examined AP-sd prevalence in Hokkaido wildlife. Our study included 250 sika deer (Cervus nippon yesoensis), 13 brown bears (Ursus arctos yesoensis) and 252 rodents including 138 (Apodemus speciosus), 45 (Apodemus argenteus), 42 (Myodes rufocanus) and 27 (Myodes rutilus) were collected from Hokkaido island, northern Japan, collected during 2010 to 2015. A 770 bp and 382 bp segment of the 16S rRNA and gltA genes, respectively, were amplified by nested PCR. Results were confirmed by cloning and sequencing of the positive PCR products. A reverse line blot hybridization (RLB) based on the 16S rRNA gene was then developed for the specific detection of AP-sd. The prevalence of AP-sd by nested PCR in sika deer was 51% (128/250). We detected this Anaplasma sp. for the first time in wild brown bears and rodents with a prevalence of 15% (2/13) and 2.4% (6/252), respectively. The sequencing results of the 16S rRNA and gltA gene amplicons were divergent from the selected A. phagocytophilum sequences in GenBank. Using a newly designed AP-sd specific probe for RLB has enabled us to specifically detect this Anaplasma species. Besides sika deer and cattle, wild brown bears and rodents were identified as potential reservoir hosts for AP-sd. This study provided a high throughput molecular method that specifically detects AP-sd, and which can be used to investigate its ecology and its potential as a threat to humans in Japan. PMID:26431688

  4. Occurrence of Ehrlichia canis and Anaplasma platys in household dogs from northern Parana Ocorrência de Ehrlichia canis e Anaplasma platys em cães domiciliados da região norte do Paraná

    Directory of Open Access Journals (Sweden)

    Gislaine Cristina Ferreira da Silva

    2012-12-01

    Full Text Available Canine monocytic ehrlichiosis caused primarily by Ehrlichia canis and canine thrombocytic anaplasmosis induced by Anaplasma platys are important emerging zoonotic tick-borne diseases of dogs. There is evidence that these pathogens can also affect humans. This study evaluated the presence of E. canis and A. platys in blood samples collected from 256 domiciled dogs in the municipality of Jataizinho, located in north region of the State of Parana, Brazil, by PCR assay. The occurrence of E. canis and A. platys was 16.4% (42/256 and 19.4% (49/256, respectively; while 5.47% (14/256 of the dogs evaluated were co-infected by these two organisms. The presence of E. canis and A. platys was not significantly associated with the variables evaluated (sex, age, outdoor access, and presence of ticks during blood collection. Infection of dogs by E. canis was associated with anemia and thrombocytopenia, while infection induced by A. platys was related only to thrombocytopenia. Canine monocytic ehrlichiosis and canine thrombocytic anaplasmosis should be included in the differential diagnoses when these hematological alterations are observed during routine laboratory evaluation of dogs.Erliquiose monocítica canina, causada principalmente por Ehrlichia canis, e anaplasmose trombocítica canina, devida a infecção com Anaplasma platys, são importantes doenças transmitidas por carrapatos que acometem os cães, com evidências que podem também acometer o homem. O presente estudo avaliou a ocorrência desses agentes em amostras de sangue de 256 cães domiciliados na cidade de Jataizinho, na região Norte do Paraná, Brasil, utilizando a técnica da Reação em Cadeia da Polimerase (PCR. A ocorrência de E. canis e A. platys foi de 16,4% (42/256 e 19,4% (49/256, respectivamente, com 5,47% (14/256 dos animais apresentando coinfecção. Não foi observada associação significativa com as variáveis sexo, idade, acesso à rua e presença de carrapatos no momento da

  5. Detecção de Ehrlichia spp./Anaplasma spp., Rickettsia spp., Mycoplasma haemofelis e Leishmania infantum em felinos errantes e sua relação com a presença de retrovírus e com a sintomatologia manifestada

    OpenAIRE

    Martins, Telma Simone Oliveira

    2012-01-01

    ABSTRACT - Detection of Ehrlichia spp./Anaplasma spp., Rickettsia spp., Mycoplasma haemofelis and Leishmania infantum in stray cats, and its relation to the presence of retroviruses and the symptoms manifested - The prevalence of infectious diseases on cats is related with the density and the size of the population indwells. The objective of this work was to determinate the prevalence of the feline immunodeficiency virus (FIV), feline leukemia virus (FeLV), Ehrlichia spp./Anaplasma s...

  6. LA COMPRENSIÓN DE CUENTOS COMO RESOLUCIÓN DE PROBLEMAS EN NIÑOS DE 5 AÑOS DE SECTORES URBANO - MARGINALES

    Directory of Open Access Journals (Sweden)

    MARÍA SOLEDAD MANRIQUE

    2010-01-01

    Full Text Available Para los niños pequeños la comprensión de un texto puede ser considerada un verdadero proceso de resolución de problemas, más que un proceso automático (Kinstch, 1988, 1998. En el presente trabajo se informa acerca de las dificultades específicas que aparecen durante la lectura interactiva de cuentos en niños de poblaciones urbano - marginales, que concurren a jardines de infantes en salas integradas de 4 y 5 años, en Buenos Aires (República Argentina. El análisis de la interacción maestra / niños en 26 situaciones de lectura de cuentos en nueve salas diferentes, que se realizó empleando el método comparativo constante (Glaser & Strauss, 1967; Strauss & Corbin, 1991 dio lugar a la caracterización inductiva de estas dificultades. En el proceso de comprensión, las operaciones cognitivas básicas que se ponen en juego son la activación de conocimiento previo, la realización de inferencias y el procesamiento de cadenas causales y del plano psicológico de la narrativa. Las dificultades que los niños enfrentan en el proceso de comprensión se originan en la relación existente entre las habilidades cognitivas que les permiten llevar a cabo las operaciones mencionadas y las características que asume cada una de las fuentes de información a partir de las cuales los niños construyen la representación mental del texto: el texto mismo, las ilustraciones y el proceso interactivo en torno al texto. Las dificultades encontradas se originan en la relación entre las habilidades del niño y cada una de las fuentes de información. Los resultados son discutidos en función de los aportes de la Psicología Cognitiva con respecto a este tema.

  7. Experimental infection and co-infection of dogs with Anaplasma platys and Ehrlichia canis: hematologic, serologic and molecular findings

    Directory of Open Access Journals (Sweden)

    Diniz PPVP

    2010-04-01

    Full Text Available Abstract Background Rhipicephalus sanguineus is a ubiquitous tick responsible for transmitting Ehrlichia canis and most likely Anaplasma platys to dogs, as either single or co-infections. The objective of this study was to assess the effects of either simultaneous or sequential experimental infections with E. canis and A. platys on hematological and serological parameters, duration of infection, and efficacy of doxycycline therapy in dogs infected with one or both organisms. Six dogs per group were either uninfected, A. platys infected, E. canis infected, A. platys and E. canis co-infected, A. platys infected and E. canis challenged or E. canis infected and A. platys challenged at day 112 post-infection (PI. Doxycycline treatment was initiated at 211 days PI, followed by dexamethasone immunosuppression beginning 410 days PI. Results Initially, transient decreases in hematocrit occurred in all groups infected with E. canis, but the mean hematocrit was significantly lower in the A. platys and E. canis co-infected group. All dogs except the controls developed marked thrombocytopenia after initial infection followed by gradually increased platelet counts by 112 days PI in groups with the single infections, while platelet counts remained significantly lower in the A. platys and E. canis co-infected group. Both sequential and simultaneous infections of A. platys and E. canis produced an enhanced humoral immune response to A. platys when compared to infection with A. platys alone. Likewise, co-infection with E. canis and A. platys resulted in a more persistent A. platys infection compared to dogs infected with A. platys only, but nearly all A. platys infected dogs became A. platys PCR negative prior to doxycycline treatment. E. canis infected dogs, whether single or co-infected, remained thrombocytopenic and E. canis PCR positive in blood for 420 days. When treated with doxycycline, all E. canis infected dogs became E. canis PCR negative and the

  8. System Identification

    NARCIS (Netherlands)

    Keesman, K.J.

    2011-01-01

    Summary System Identification Introduction.- Part I: Data-based Identification.- System Response Methods.- Frequency Response Methods.- Correlation Methods.- Part II: Time-invariant Systems Identification.- Static Systems Identification.- Dynamic Systems Identification.- Part III: Time-varying Syste

  9. Assessment of antibodies against surface and outer membrane proteins of Anaplasma phagocytophilum in Lyme borreliosis and tick-borne encephalitis paediatric patients.

    Science.gov (United States)

    Krbková, L; Homola, L; Hlaváčová, A; Mikolášek, P; Bednářová, J; Čermáková, Z

    2016-09-01

    To examine evidence of positive antibodies against immunogenic proteins of Anaplasma phagocytophilum in patients with other tick-borne infections and to diagnose possible co-infections, 412 serum specimens were tested by immunoblotting using three specific Anaplasma antigens: surface proteins p44 and Asp62 and outer membrane protein A (OmpA). In total, 284 serum samples from children with Lyme borreliosis and 12 serum samples from children with tick-borne encephalitis were tested. Sera from patients with viral aseptic meningitis (n = 47) and from blood donors (n = 69) were used as controls. Among all serum specimens from patients with tick-borne infections submitted for this study, six samples (2·0%) showed positive IgM reactions and seven samples (2·4%) were IgG positive for A. phagocytophilum by immunoblot. Borderline reactivity was found in 30 samples (10·14%) for IgM and 36 samples (12·2%) for IgG. The difference between patients and blood donors was statistically significant for IgM (P = 0·006) and for IgG (P = 0·0007) antibodies. A statistically significant result was obtained for IgG (P = 0·02) but not for IgM between patients and children with aseptic meningitis. Immunoblot using three specific antigens provides novel information about the positivity of antibodies to A. phagocytophilum in children with other tick-borne infections. Taking into account clinical and laboratory findings of children despite antibody positivity, no case of human granulocytic anaplasmosis was demonstrated. PMID:27180603

  10. Efficacy of sarolaner in the prevention of Borrelia burgdorferi and Anaplasma phagocytophilum transmission from infected Ixodes scapularis to dogs.

    Science.gov (United States)

    Honsberger, Nicole A; Six, Robert H; Heinz, Thomas J; Weber, Angela; Mahabir, Sean P; Berg, Thomas C

    2016-05-30

    The efficacy of sarolaner (Simparica™, Zoetis) to prevent transmission primarily of Borrelia burgdorferi and secondarily of Anaplasma phagocytophilum from infected wild-caught Ixodes scapularis to dogs was evaluated in a placebo-controlled laboratory study. Twenty-four purpose-bred laboratory Beagles seronegative for B. burgdorferi and A. phagocytophilum antibodies were allocated randomly to one of three treatment groups: placebo administered orally on Days 0 and 7, or sarolaner at 2mg/kg administered orally on Day 0 (28 days prior to tick infestation) or on Day 7 (21 days prior to tick infestation). On Day 28, each dog was infested with approximately 25 female and 25 male wild caught adult I. scapularis that were determined to have prevalence of 57% for B. burgdorferi and 6.7% for A. phagocytophilum by PCR. In situ tick counts were conducted on Days 29 and 30. On Day 33, all ticks were counted and removed. Acaricidal efficacy was calculated based on the reduction of geometric mean live tick counts in the sarolaner-treated groups compared to the placebo-treated group for each tick count. Blood samples collected from each dog on Days 27, 49, 63, 77, 91 and 104 were tested for the presence of B. burgdorferi and A. phagocytophilum antibodies using the SNAP(®) 4Dx(®) Plus Test, and quantitatively assayed for B. burgdorferi antibodies using an ELISA test. Skin biopsies collected on Day 104 were tested for the presence of B. burgdorferi by bacterial culture and PCR. Geometric mean live tick counts for placebo-treated dogs were 14.8, 12.8, and 19.1 on Days 29, 30, and 33, respectively. The percent reductions in mean live tick counts at 1, 2, and 5 days after infestation were 86.3%, 100%, and 100% for the group treated with sarolaner 21 days prior to infestation, and 90.9%, 97.1%, and 100% for the group treated with sarolaner 28 days prior to infestation. Geometric mean live tick counts for both sarolaner-treated groups were significantly lower than those for the

  11. Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud

    Directory of Open Access Journals (Sweden)

    Élise Prébin

    2009-03-01

    Full Text Available Trouver la bonne distance : étrangère, marginale, ethnologue et parente en Corée du Sud. Cet article a pour sujet ma relation à la société sud-coréenne, non seulement en tant qu’anthropologue mais aussi en tant que personne adoptée d’origine coréenne. Il relate la manière dont plusieurs sortes de relations ont dû être gérées pendant le terrain. Il a fallu d’un côté me rapprocher de mes informateurs pour pouvoir mener un terrain classique dans une société inconnue, comprendre une culture autre et traiter un sujet relevant des sciences sociales : le retour des adoptés étrangers dans leur pays d’origine. De l’autre, il a fallu établir une bonne distance avec ma famille biologique coréenne en m’en éloignant momentanément. Ma relation avec elle était en effet instable du fait qu’elle reposait sur une contradiction : mon statut d’étrangère en dépit de l’intimité que supposaient les liens du sang. Pourtant, cette relation continue entre ma famille biologique et moi-même a éclairé certaines ambiguïtés relatives au statut des adoptés dans la société sud-coréenne que le temps limité du terrain n’avait pas permis de saisir. Cet article ébauche donc une réflexion épistémologique sur la pertinence d’éléments biographiques dans le traitement anthropologique de certains sujets. Je montre en l’occurrence comment le don en mariage d’une fille biologique adoptée conjure de manière satisfaisante un don en adoption toujours problématique.Finding the right distance: stranger, marginal, ethnologist and relative in south Korea. The topic of this article is my relation to the South Korean society, not only as a social anthropologist but also as a Korean adoptee. I relate the way I had to manage contrasted relations while conducting fieldwork. On one hand, I endeavoured to get closer to my informants in order to conduct classic fieldwork in an unknown society, to understand a different culture

  12. A serological survey of tick-borne pathogens in dogs in North America and the Caribbean as assessed by Anaplasma phagocytophilum, A. platys, Ehrlichia canis, E. chaffeensis, E. ewingii, and Borrelia burgdorferi species-specific peptides

    Directory of Open Access Journals (Sweden)

    Barbara A. Qurollo

    2014-10-01

    Full Text Available Introduction: Tick-borne pathogens cause a spectrum of disease manifestations in both dogs and humans. Recognizing regional and temporal shifts in exposure are important as tick distributions change. To better delineate regional exposure to canine tick-borne pathogens, an expanded set of species-specific peptides were used to detect Anaplasma phagocytophilum (Aph, Anaplasma platys (Apl, Ehrlichia canis (Ec, Ehrlichia chaffeensis (Ech, Ehrlichia ewingii (Eew, and Borrelia burgdorferi (Bb antibodies in canine serum. Methods: Archived canine serum samples (n=6,582 collected during 2008–2010 and in 2012 from the US, Canada, and the Caribbean were retrospectively screened for antibodies against Ehrlichia and Anaplasma species-specific peptides. Overall, regional and temporal seroprevalence rates were determined. Results: Overall Bb and Eew were the most seroprevalent pathogens. During 2008–2010, seroprevalence rates increased overall for Aph and Ech, and regionally, Bb and Aph seroprevalence rates increased in the South. Canada had unexpectedly high seroprevalence rates for Ec and Apl. The most common co-exposures were Eew+Ech, followed by Aph+Bb and Eew+Bb. Conclusions: This study demonstrated significant shifts in canine vector-borne disease seroprevalence rates. The use of specific peptides facilitated improved geographic delineation of tick-borne pathogen distributions among dogs, which may enhance epidemiological surveillance of vector-borne pathogens shared by dogs and humans.

  13. Vigilancia Epidemiológica de Rickettsia‚ Ehrlichia y Anaplasma en Fauna Silvestre ex situ e in situ de algunas Regiones de Colombia -resumen-

    Directory of Open Access Journals (Sweden)

    Santiago Monsalve-Buriticá

    2014-12-01

    Full Text Available Las enfermedades causadas por bacterias del orden de los Rickettsiales son trasmitidas por ectoparásitos originados en vida silvestre‚ sin embargo‚ en Colombia no existe una línea base del conocimiento en este sentido. Estos microorganismos intracelulares son causantes de enfermedades transmisibles en pacientes humanos; convirtiéndolas en zoonosis de tipo emergente. Este estudio ha permitido determinar la presencia de microorganismos del orden de los Rickettsiales (Ehrlichia spp.‚ Anaplasma spp.‚ y Rickettsia spp. en ejemplares silvestres de centros de conservación ex situ (Zoológicos‚ CAV y CAVR y en algunas regiones en condiciones in situ del país. De igual manera se identifica la infección de estos microorganismos en ectoparásitos vectores relacionados. Por medio de la técnica PCRrt‚ se detectó la presencia de Rickettsia spp.‚ Anaplasma spp.‚ y Ehrlichia spp.‚ en suero obtenido de mamíferos‚ y garrapatas colectadas de reptiles y mamíferos del Centro de Atención y Valoración de Fauna silvestre de la Corporación Autónoma Regional de los Valles del Sinú y San Jorge CAV-CVS en Montería (Córdoba‚ en osos hormigueros (Myrmecophaga tridactyla en Pore (Casanare‚ y en garrapatas obtenidas en ejemplares de titi gris (Saguinus leucopus y su hábitat en la vereda La Parroquia en Mariquita (Tolima. En Montería‚ los resultados obtenidos en mamíferos demostraron la ausencia de Rickettsia spp. en 72 muestras de suero‚ sin embargo se detectó un pool de garrapatas de la especie Amblyomma ovale positivo a este microorganismo‚ siendo el primer reporte en Colombia de ectoparásitos de Puma concolor positivos a Rickettsia spp.‚ mientras que en reptiles se detectaron 18 pools de garrapatas positivos a Rickettsia spp (90 %. En las garrapatas colectadas de nueve osos palmeros (Myrmecophaga tridactyla de vida libre se detectaron 12 pool de garrapatas positivos a este microorganismo (17‚6 %‚ y en ejemplares de

  14. Prevalence of Babesia canis, Borrelia burgdorferi sensu lato, and Anaplasma phagocytophilum in hard ticks collected from meadows of Lubelskie Voivodship (eastern Poland

    Directory of Open Access Journals (Sweden)

    Dzięgiel Beata

    2014-03-01

    Full Text Available The aim of the study was to assess the distribution of Anaplasma phagocytophilum, Borrelia burgdorferi sensu lato, and Babesia canis in adult females and males of Ixodes ricinus and Dermacentor reticulatus ticks, inhabiting meadows near large forest complexes throughout the Lubelskie Voivodship (eastern region of Poland. Ticks were collected using the flagging method. Among 720 ticks collected, 506 were identified as D. reticulatus, and 214 as I. ricinus. DNA of B. canis and B. burgdorferi s.l. was detected in 21.3% and 0.6% of D. reticulatus ticks, respectively. In I. ricinus ticks, DNA specific to B. burgdorferi s.l. and A. phagocytophilum was detected in 5.6% and 10.3%, respectively. Co-infections of B. burgdorferi s.l. and A. phagocytophilum were found in two I. ricinus ticks. These results indicate that the Lublin region is an area at risk of tick-borne diseases of humans and animals, which must be considered in clinical practice.

  15. Prevalence and first molecular characterization of Anaplasma phagocytophilum, the agent of human granulocytic anaplasmosis, in Rhipicephalus sanguineus ticks attached to dogs from Egypt

    Directory of Open Access Journals (Sweden)

    Mohamed W. Ghafar

    2012-04-01

    Full Text Available PCR targeting 16S rRNA gene integrated with sequence analysis were performed to investigate the prevalence and the molecular identity of Anaplasma phagocytophilum in Egyptian Rhipicephalus sanguineus ticks attached to dogs. A total of 413 adult and nymphal R. sanguineus ticks were collected while attached to 72 free-roaming dogs from four locations (Imbaba, Boulaq, Haram, Monib in Giza Governorate, Egypt. DNA was successfully extracted from 401 specimens (133 nymphs and 268 adults. The overall prevalence rate was 13.7% and adult ticks showed a significantly higher infection rate (16.4% compared to nymphs (8.3%. Sequence comparisons of 218-bp showed that detected organism belongs to A. phagocytophilum. The sequence showed 99.1% similarity (2 nucleotide differences with some strains described as human pathogens and with that detected in the established tick vectors. Phylogenetic analysis placed the bacteria on a separate branch with that found in R. annulatus from Egypt (DQ379972 (99.5% similarity. Our variant strain was designated as A. phagocytophilum-Ghafar-EGY (AB608266. This report is the first molecular characterization of A. phagocytophilum in R. sanguineus in Egypt, suggesting that this tick species may act as a competent vector for a variant strain of human granulocytic anaplasmosis agent.

  16. The prevalence of Ehrlichia canis, Anaplasma platys and Babesia spp. in dogs in Nueva Ecija, Philippines based on multiplex polymerase chain reaction (mPCR) assay.

    Science.gov (United States)

    Corales, Joyce Marielle I; Viloria, Victoria V; Venturina, Virginia M; Mingala, Claro N

    2014-01-01

    The aim of the study was to determine the prevalence of Ehrlichia canis, Anaplasma platys and Babesia spp. in dogs. It describes the practice of veterinarians in detecting tick-borne diseases in Nueva Ecija, Philippines. Seventy blood samples were collected and were subjected to multiplex PCR for the detection of E. canis, Babesia spp. and A. platys. The prevalence of babesiosis is the highest in Cabanatuan City (2/10), while a 10% prevalence (1/10) was observed in Science City of Muñoz, Talavera and Sta. Rosa. E. canis were only detected in Cabanatuan City. However, no anaplasmosis was detected in any area. The prevalence of babesiosis and ehrlichiosis in Nueva Ecija is 7.14% (5/70) and 2.85% (2/70) respectively. In addition, 70% (7/10) of the Nueva Ecija veterinary practitioners encountered cases of suspected ehrlichiosis in their practice. The diagnosis of ehrlichiosis is based primarily on presented clinical signs and complete blood counts, which include a platelet count. Of the 10 respondents, half utilized test kits while 90% interpreted blood samples. Meanwhile, only 60% of the respondents used an ELISA test kit for ehrlichiosis. For some practitioners, the main reason for not utilizing a kit is the high cost. None of the respondents had previously attended cases of suspected anaplasmosis. Only one respondent diagnosed a case of babesiosis by blood smear microscopy. PMID:25706424

  17. Comparative analysis of the infectivity rate of both Borrelia burgdorferi and Anaplasma phagocytophilum in humans and dogs in a New Jersey community

    Directory of Open Access Journals (Sweden)

    Gaito A

    2014-08-01

    Full Text Available Andrea Gaito,1 Vedrana Gjivoje,2 Sebastian Lutz,1 Ben Baxter2 1Private medical practice, Somerset County, NJ, USA; 2Bernardsville Animal Hospital, Somerset County, NJ, USA Abstract: Ticks are important vectors of disease and transmit an extensive array of bacterial, viral and protozoan diseases to both humans and dogs within a community. Borrelia burgdorferi, the causative agent of Lyme disease, has been extensively studied within both the human and veterinary population. Anaplasma phagocytophilum, an intracellular rickettsial pathogen also transmitted by ixodid ticks, has emerged as an important zoonotic infection with significant veterinary and medical implications, and is responsible for both canine granulocytic anaplasmosis and human granulocytic anaplasmosis. Multiple surveys exist in the international literature referencing infectivity rates of both of these diseases separately in both the dog and human populations. This is the first study to simultaneously examine the infectivity rate of both anaplasmosis and Lyme disease in humans and dogs in a community endemic for tick-borne diseases. Keywords: Lyme disease, anaplasmosis, dogs, humans 

  18. Retrospective analysis of clinical and laboratory findings in hunting dogs with serologic reactions to tick-borne pathogens (Anaplasma phagocytophilum, Borrelia burgdorferi, Babesia canis, Ehrlichia canis, Ricketsia conorii

    Directory of Open Access Journals (Sweden)

    Spasojević-Kosić Ljubica

    2015-01-01

    Full Text Available Seroprevalence of tick-borne infections in endemic areas could be high. In this study, we investigated the seroprevalence of tick-borne pathogens (Anaplasma phagocytophilum, Borrelia burgdorferi, Babesia canis, Ehrlichia canis, Rickettsia conorii in hunting dogs, naturally infected with one or more pathogens. Serological test results of the investigated animals were compared to those from clinical examination, as well as from haematological and biochemical analyses. A total of 74.14% dogs were seropositive (R.conorii 44.83%, B. canis 32.76%, B. burgdorferi 25.86%, E. canis 13.79%, A. phagocytophilum 8.47%, with 25.86% of dogs seropositive to two pathogens, 15.52% seropositive to three pathogens, and 1.72% of dogs seropositive to four pathogens. Among all registered clinical signs, only pyrexia (p<0.05 and arrhythmia (p<0.05 were significant in seropositive dogs. There was no significant difference between seropositive and seronegative dogs regarding the majority of haematological and biochemical parameters. Statistically significant difference was registered for particular haematological (number of red blood cells and seroreactivity to B. burgdorferi and biochemical parameters (albumin concentration and seroreactivity to E. canis, and AST and seroreactivity to R. conorii but these values were not clinically significant. The high exposure to tick-borne pathogens suggests that ectoparasitic profilactic treatment is not adequate in examined population of hunting dogs. Clinical finding of pyrexia need to be further investigated and explained etiologically, which means that molecular diagnosis should be used in order to identify larger number of pathogens because of the possibility of coinfection. [Projekat Ministarstva nauke Republike Srbije, br. TR 31084

  19. Allocation of the transmission service cost with base in marginal costs of the transmission network expansion; Asignacion del costo del servicio de transmision con base en costos marginales de expansion de la red de transmision

    Energy Technology Data Exchange (ETDEWEB)

    Ruiz Casillas, Manuel E.; Nieva Gomez, Rolando [Instituto de Investigaciones Electricas, Temixco, Morelos (Mexico)

    2001-07-01

    The transmission charges to the users must be completely defined in those systems where the restructuring has broken up the traditional functions of the companies; in order to introduce competition in the generation and commercialization segments of the electrical energy. The fundamentals of a method used are explained to assure the transmission service cases between their users. The method is based on the marginal expansion costs of the transmission network. Their more known applications have been in competitive markets of energy, in particular, where the energy price is the same one in all the localities. Nevertheless, it can be used under other forms of organization of the electrical industry. In order to illustrate results, the obtained ones from their application to the most important part of the transmission network of the Mexican system that operates interconnected, are presented. [Spanish] Los cargos de transmision a los usuarios deben estar completamente definidos en aquellos sistemas donde la reestructuracion ha desagregado las funciones tradicionales de las empresas; para introducir competencia en los segmentos de generacion y comercializacion de la energia electrica. Se explican los fundamentos de un metodo utilizado para asegurar los casos del servicio de transmision entre sus usuarios. El metodo se basa en los costos marginales de expansion de la red de transmision. Sus aplicaciones mas conocidas han sido en mercados competitivos de energia, en particular, donde el precio de la energia es el mismo en todas las localidades. Sin embargo, puede utilizarse bajo otras formas de organizacion de la industria electrica. Con el proposito de ilustrar resultados, se muestran los obtenidos de su aplicacion a la parte mas importante de la red de transmision del sistema mexicano que opera interconectada.

  20. Emerging perspectives in the research of bovine Babesiosis and Anaplasmosis

    Science.gov (United States)

    The Babesia bovis and B. bigemina apicomplexan protozoa in conjunction with the rickettsia Anaplasma marginale are intraerythrocytic pathogens that are responsible for the most prevalent and costly tick borne diseases (TBD’s) of cattle worldwide. These organisms are historically associated as they c...

  1. Serological survey of Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, and Ehrlichia canis infections in rural and urban dogs in Central Italy

    Directory of Open Access Journals (Sweden)

    Valentina Virginia Ebani

    2014-11-01

    Full Text Available [b]Introduction[i][/i][/b][i]. Borrelia burgdorferi [/i]sensu lato (s.l. and Anaplasma phagocytophilum are well known zoonotic pathogens, whereas[i] Ehrlichia canis[/i] is usually considered to be of veterinary concern, although on the basis of recent reports it also seems to be able to infect humans. [b]objective[/b]. The aim of the study was to determine the seroprevalence of [i]B. burgdorferi [/i]s.l., A. phagocytophilum and [i]E. canis[/i] in an Italian canine population, and to verify if there are differences between dogs living in urban areas and those from a rural environment. [b]materials and method.[/b] Blood sera of 1,965 dogs, 1,235 from cities and 730 from rural areas, were tested by indirect immunofluorescent assay (IFAT. [b]results[/b]. The overall seroprevalence was highest for E. canis (7.07%, followed by [i]A. phagocytophilum[/i] (4.68%, and [i]B. burgdorferi[/i] s.l. (1.47%. Rural dogs showed the highest seroprevalence to [i]B. burgdorferi[/i] s.l. and [i]A. phagocytophilum[/i]. No significant differences were observed between rural and urban [i]E. canis[/i]-positive dogs. A low percentage (1.32% of dogs with dual seropositivity was detected, and no triple positive reactions were observed. No significant differences were detected in the seroprevalence of the three agents in relationship to the age and gender of the dogs. Seroprevalence in the five years considered were not statistically different, except for the lowest rate for [i]E. canis[/i] observed in 2012. [b]conclusions[/b]. The results confirm the presence of [i]B. burgdorferi[/i] s.l., [i]A. phagocytophilum[/i] and [i]E. canis[/i] in Italian dogs in both urban and rural areas. Monitoring pet dogs, which share the same environment with their owners, is useful for identifying the presence of tick-borne disease agents of both veterinary and public health significance

  2. Tissue-Specific Signatures in the Transcriptional Response to Anaplasma phagocytophilum Infection of Ixodes scapularis and Ixodes ricinus Tick Cell Lines

    Science.gov (United States)

    Alberdi, Pilar; Mansfield, Karen L.; Manzano-Román, Raúl; Cook, Charlotte; Ayllón, Nieves; Villar, Margarita; Johnson, Nicholas; Fooks, Anthony R.; de la Fuente, José

    2016-01-01

    Anaplasma phagocytophilum are transmitted by Ixodes spp. ticks and have become one of the most common and relevant tick-borne pathogens due to their impact on human and animal health. Recent results have increased our understanding of the molecular interactions between Ixodes scapularis and A. phagocytophilum through the demonstration of tissue-specific molecular pathways that ensure pathogen infection, development and transmission by ticks. However, little is known about the Ixodes ricinus genes and proteins involved in the response to A. phagocytophilum infection. The tick species I. scapularis and I. ricinus are evolutionarily closely related and therefore similar responses are expected in A. phagocytophilum-infected cells. However, differences may exist between I. scapularis ISE6 and I. ricinus IRE/CTVM20 tick cells associated with tissue-specific signatures of these cell lines. To address this hypothesis, the transcriptional response to A. phagocytophilum infection was characterized by RNA sequencing and compared between I. scapularis ISE6 and I. ricinus IRE/CTVM20 tick cell lines. The transcriptional response to infection of I. scapularis ISE6 cells resembled that of tick hemocytes while the response in I. ricinus IRE/CTVM20 cells was more closely related to that reported previously in infected tick midguts. The inhibition of cell apoptosis by A. phagocytophilum appears to be a key adaptation mechanism to facilitate infection of both vertebrate and tick cells and was used to investigate further the tissue-specific response of tick cell lines to pathogen infection. The results supported a role for the intrinsic pathway in the inhibition of cell apoptosis by A. phagocytophilum infection of I. scapularis ISE6 cells. In contrast, the results in I. ricinus IRE/CTVM20 cells were similar to those obtained in tick midguts and suggested a role for the JAK/STAT pathway in the inhibition of apoptosis in tick cells infected with A. phagocytophilum. Nevertheless, tick

  3. Prevalence of Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi sensu lato, Anaplasma spp. and Leishmania infantum in apparently healthy and CVBD-suspect dogs in Portugal - a national serological study

    Directory of Open Access Journals (Sweden)

    Cardoso Luís

    2012-03-01

    Full Text Available Abstract Background Canine vector-borne diseases (CVBDs are caused by a wide range of pathogens transmitted to dogs by arthropods including ticks and insects. Many CVBD-agents are of zoonotic concern, with dogs potentially serving as reservoirs and sentinels for human infections. The present study aimed at assessing the seroprevalence of infection with or exposure to Dirofilaria immitis, Ehrlichia canis, Borrelia burgdorferi sensu lato, Anaplasma spp. and Leishmania infantum in dogs in Portugal. Methods Based on 120 veterinary medical centres from all the regions of mainland and insular Portugal, 557 apparently healthy and 628 CVBD-suspect dogs were sampled. Serum, plasma or whole blood was tested for qualitative detection of D. immitis antigen and antibodies to E. canis, B. burgdorferi s. l., Anaplasma spp. and L. infantum with two commercial in-clinic enzyme-linked immunosorbent assay kits. Odds ratios (OR were calculated by logistic regression analysis to identify independent risk factors of exposure to the vector-borne agents. Results Total positivity levels to D. immitis, E. canis, B. burgdorferi, Anaplasma spp., L. infantum, one or more agents and mixed agents were 3.6%, 4.1%, 0.2%, 4.5%, 4.3%, 14.0% and 2.0% in the healthy group, and 8.9%, 16.4%, 0.5%, 9.2%, 25.2%, 46.3% and 11.6% in the clinically suspect group, respectively. Non-use of ectoparasiticides was a risk factor for positivity to one or more agents both in the apparently healthy (OR = 2.1 and CVBD-suspect (OR = 1.5 dogs. Seropositivity to L. infantum (OR = 7.6, E. canis (OR = 4.1 and D. immitis (OR = 2.4 were identified as risk factors for the presence of clinical signs compatible with CVBDs. Positivity to mixed agents was not found to be a risk factor for disease. Conclusions Dogs in Portugal are at risk of becoming infected with vector-borne pathogens, some of which are of zoonotic concern. CVBDs should be considered by practitioners and prophylactic measures must be put in

  4. Comparação de nested-PCR com o diagnóstico direto na detecção de Ehrlichia canis e Anaplasma platys em cães Comparison of nested-PCR with blood smear examination in detection of Ehrlichia canis and Anaplasma platys in dogs

    Directory of Open Access Journals (Sweden)

    Carlos A. N. Ramos

    2009-12-01

    Full Text Available Os sinais clínicos das infecções por Ehrlichia canis e Anaplasma platys são similares, e o diagnóstico desses patógenos feito por esfregaços sanguíneos corados é difícil devido à sensibilidade e especificidade. Por outro lado, os diagnósticos moleculares são altamente sensíveis e específicos, e nested-PCRs têm sido otimizadas para o diagnóstico preciso desses patógenos em cães. Em um Hospital Veterinário Escola, amostras de sangue total com EDTA foram obtidas de 100 cães, e esfregaços foram feitos das amostras de sangue para busca dos parasitos intracelulares. Para cada amostra, DNA foi extraído e submetido à nPCR para detecção de E. canis e A. platys. Os resultados dos esfregaços sanguíneos mostraram que 9% dos animais foram positivos para E. canis e 21% para A. platys. Com relação à nPCR, 57 e 55% dos cães foram positivos para E. canis e A. platys, respectivamente. Quando comparados com a nPCR, os esfregaços sanguíneos corados revelaram resultados falso-negativos para E. canis e A. platys. Os resultados indicam que a nPCR é altamente sensível e específica para detecção de ambos os patógenos, e os diagnósticos moleculares podem ser mais úteis nos Hospitais Veterinários.The clinical signs of Ehrlichia canis and Anaplasma platys infection are similar, and the diagnosis of these pathogens made by stained blood smears is poor due sensibility and specificity. On the other hand, the molecular diagnosis is highly sensitive and specific and nested-PCR have been optimized for accurate diagnosis these pathogens in dogs. At the veterinary teaching hospital, whole-blood samples with EDTA were obtained from 100 dogs and smears were made from blood samples for evaluation for intracellular parasites. For each sample, DNA was extracted and submitted to nPCR analysis for detection of E. canis and A. platys. The results of stained blood smears showed 9% of the animals were positive for E. canis and 21% for A. platys

  5. El nivel educativo y socioeconómico del hogar y habilidades pre-lectoras en escuelas urbano y urbano-marginales de la provincia de Mendoza-Argentina

    Directory of Open Access Journals (Sweden)

    Yanina Canales, Jara

    2016-05-01

    Full Text Available En Argentina, las dificultades en la adquisición de la lectura se originan en diferencias lingüísticas asociadas al nivel sociocultural donde se desarrollan los niños. El objetivo de este artículo es analizar, en escolares de 4 y 5 años, la relación entre el nivel educativo y socioeconómico del hogar con habilidades lingüísticas precursoras de la lectura. Esta es una investigación de carácter cuantitativo y de profundidad comparativa. Se evaluaron 120 niños y niñas de salas de 4 y 5 años de Jardín de Infantes de escuelas urbanas (n= 60 y urbano-marginales (n= 60. El nivel socioeconómico del hogar y educativo de los padres se calculó a partir de datos de los registros escolares. En los niños y niñas se evaluó el nivel de vocabulario, conocimiento del nombre y sonido de la letra y conciencia fonológica. Se observó un efecto significativo de la zona sobre el nivel educativo de los padres y el socioeconómico. Se obtuvieron correlaciones positivas del nivel socioeconómico y educativo con el conocimiento del nombre y sonido de la letra. Ambas variables contextuales explicaron parte de la varianza en el conocimiento del nombre y sonido de las letras en niños y niñas de 4 años únicamente: 6% y 13% respectivamente. Los resultados sugieren que las variables contextuales influyen en el conocimiento alfabético pre-escolar que presentan los niños y las niñas y que la intervención pedagógica recibida en la escuela promueve el desarrollo de habilidades lingüísticas. Frente a contextos socioeconómicos heterogéneos, la educación escolar es una variable protectora que regula las desigualdades de orden social promoviendo el desarrollo de habilidades lingüísticas precursoras de la lectura al inicio de la escolaridad.

  6. Particle identification

    International Nuclear Information System (INIS)

    A variety of subjects are addressed within the general context of searching for limitations in capability of particle identification due to high average rates. Topics receiving attention included Cerenkov ring imaging, transition radiation, synchrotron radiation, time-of-flight, high P spectrometer, heavy quark tagging with leptons, general purpose muon and electron detector, and dE/dx. It is concluded that particle identification will probably not represent a primary obstacle at luminosities of 1033cm-2sec-1

  7. Genotypic Identification

    Science.gov (United States)

    In comparison with traditional, phenotype-based procedures for detection and identification of foodborne pathogen Listeria monocytogenes, molecular techniques are superior in terms of sensitivity, specificity and speed. This chapter provides a comprehensive review on the use of molecular methods for...

  8. Aftershock identification

    OpenAIRE

    Zaliapin, Ilya; Gabrielov, Andrei; Keilis-Borok, Vladimir; Wong, Henry

    2007-01-01

    Earthquake aftershock identification is closely related to the question "Are aftershocks different from the rest of earthquakes?" We give a positive answer to this question and introduce a general statistical procedure for clustering analysis of seismicity that can be used, in particular, for aftershock detection. The proposed approach expands the analysis of Baiesi and Paczuski [PRE, 69, 066106 (2004)] based on the space-time-magnitude nearest-neighbor distance $\\eta$ between earthquakes. We...

  9. Whale Identification

    Science.gov (United States)

    1991-01-01

    R:BASE for DOS, a computer program developed under NASA contract, has been adapted by the National Marine Mammal Laboratory and the College of the Atlantic to provide and advanced computerized photo matching technique for identification of humpback whales. The program compares photos with stored digitized descriptions, enabling researchers to track and determine distribution and migration patterns. R:BASE is a spinoff of RIM (Relational Information Manager), which was used to store data for analyzing heat shielding tiles on the Space Shuttle Orbiter. It is now the world's second largest selling line of microcomputer database management software.

  10. Investigação molecular de Ehrlichia spp. e Anaplasma platys em felinos domésticos: alterações clínicas, hematológicas e bioquímicas

    Directory of Open Access Journals (Sweden)

    Elisabete S Correa

    2011-10-01

    Full Text Available Ehrlichia sp. e Anaplasma platys são micro-organismos Gram negativos, parasitos intracelulares obrigatórios, residindo em vacúolos citoplasmáticos de leucócitos e plaquetas, encontrados no sangue periférico ou em tecidos. Poucos relatos têm sido feitos sobre erliquiose e anaplasmose em gatos no Brasil, os quais são baseados na presença de mórulas em leucócitos e plaquetas, ou pela detecção de anticorpos. O objetivo deste trabalho foi investigar a infecção natural por Ehrlichia sp. e A.platys em gatos no Município de Campos dos Goytacazes-RJ, através da hematoscopia e pela detecção do DNA desses agentes. Foram utilizadas amostras de sangue total e de soro de 91 gatos, independente de raça, sexo e idade. Realizaram-se hemograma, bioquímica sérica e PCR, utilizando oligonucleotídes para Ehrlichia sp. e A.platys. Os dados de hematoscopia mostraram que 9,89% dos gatos apresentaram mórulas em macroplaquetas. O DNA de A.platys foi detectado em 13,18% dos 91 animais e em 44,44% das amostras positivas à hematoscopia. O DNA de Ehrlichia sp. não foi detectado em nenhuma amostra. Nenhuma alteração foi observada nos sinais clínicos nem nos resultados laboratoriais nos animais estudados. Os dados sugerem que os felinos domésticos podem atuar como potenciais reservatórios para A. platys, como forma não sintomática das enfermidades relacionadas

  11. Particle identification

    International Nuclear Information System (INIS)

    Particle IDentification (PID) is fundamental to particle physics experiments. This paper reviews PID strategies and methods used by the large LHC experiments, which provide outstanding examples of the state-of-the-art. The first part focuses on the general design of these experiments with respect to PID and the technologies used. Three PID techniques are discussed in more detail: ionization measurements, time-of-flight measurements and Cherenkov imaging. Four examples of the implementation of these techniques at the LHC are given, together with selections of relevant examples from other experiments and short overviews on new developments. Finally, the Alpha Magnetic Spectrometer (AMS 02) experiment is briefly described as an impressive example of a space-based experiment using a number of familiar PID techniques.

  12. Aftershock identification

    CERN Document Server

    Zaliapin, Ilya; Keilis-Borok, Vladimir; Wong, Henry

    2007-01-01

    Earthquake aftershock identification is closely related to the question ``Are aftershocks different from the rest of earthquakes?'' We give a positive answer to this question and introduce a general statistical procedure for clustering analysis of seismicity that can be used, in particular, for aftershock detection. The proposed approach expands the analysis of Baiesi and Paczuski [PRE, 69, 066106 (2004)] based on the space-time-magnitude nearest-neighbor distance $\\eta$ between earthquakes. We show that for a homogeneous Poisson marked point field with exponential marks, the distance $\\eta$ has Weibull distribution, which bridges our results with classical correlation analysis for unmarked point fields. We introduce a 2D distribution of spatial and temporal components of $\\eta$, which allows us to identify the clustered part of a point field. The proposed technique is applied to several synthetic seismicity models and to the observed seismicity of Southern California.

  13. Krankheits- und Produktionsfaktoren in periurbanen Milchrinderherden Ugandas

    OpenAIRE

    Poetzsch, Carsten Jochen

    2010-01-01

    From June 1994 to November 1996 a longitudinal study was carried out to investigate disease and production on 56 randomly selected peri-urban dairy farms in south-eastern Uganda. Relationships between animal-, farm-, production- and environmental variables, prevalence of trypanosome and helminth infections and sero-prevalences of Theileria parva, Anaplasma marginale and Babesia bigemina were investigated. Despite favourable climatic conditions and an emphasis on dairy production, the poten...

  14. Sir Arnold Theiler and the discovery of anaplasmosis : a centennial perspective : tick-borne diseases

    Directory of Open Access Journals (Sweden)

    G.H. Palmer

    2009-09-01

    Full Text Available Sir Arnold Theiler's research in 1908/09 led to the discovery of the first rickettsial pathogen, Anaplasma marginale, and set the stage for his development and implementation of an effective live vaccine based on a less virulent strain, A. marginale ss. centrale. His 1910 report, describing A. marginale, is among the classic monographs in infectious disease research, presenting not only observations in exacting detail but also highlighting the deductive reasoning leading to association of a new pathogen with a specific disease. With a centennial perspective and both conceptual frameworks and molecular tools unimaginable in Theiler's time, the significance of several observations in the original report - cyclic bacteremia, strain superinfection, and taxonomic position - is now clear and highlight the broad applicability of key principles of pathogen biology.

  15. Muon identification in JADE

    Energy Technology Data Exchange (ETDEWEB)

    Allison, J.; Armitage, J.C.M.; Baines, J.T.M.; Ball, A.H.; Bamford, G.; Barlow, R.J.; Bowdery, C.K.; Chrin, J.T.M.; Duerdoth, I.P.; Glendinning, I.; Greenshaw, T.; Hassard, J.F.; Hill, P.; King, B.T.; Loebinger, F.K.; Macbeth, A.A.; McCann, H.; Mercer, D.; Mills, H.E.; Murphy, P.G.; Prosper, H.B.; Rowe, P.; Stephens, K.

    1985-08-01

    The method of identification of high energy muons in the JADE detector is described in detail. The performance of the procedure is discussed in detail for the case of prompt identification in multihadronic final states. (orig.).

  16. Muon identification in JADE

    International Nuclear Information System (INIS)

    The method of identification of high energy muons in the JADE detector is described in detail. The performance of the procedure is discussed in detail for the case of prompt identification in multihadronic final states. (orig.)

  17. Identification Via Quantum Channels

    OpenAIRE

    Winter, Andreas

    2012-01-01

    We review the development of the quantum version of Ahlswede and Dueck's theory of identification via channels. As is often the case in quantum probability, there is not just one but several quantizations: we know at least two different concepts of identification of classical information via quantum channels, and three different identification capacities for quantum information. In the present summary overview we concentrate on conceptual points and open problems, referring the reader to the ...

  18. Infektion mit Anaplasma phagozytophilum beim Hund

    OpenAIRE

    Galke, Daniela

    2010-01-01

    A. phagocytophilum is an obligate intracellular Gram-negative bacterium transmitted by ticks of the genus Ixodes. It mostly afflicts neutrophils. Infections with this pathogen have been described in most domestic mammals and men. A. phagocytophilum is the causative agent of canine granulocytic anaplasmosis (CGA). Objectives of this study were 1) the determination of the prevalence of A. phagocytophilum infections in clinically healthy and sick dogs suspicious for CGA, 2) the evaluation wh...

  19. Anaplasma phagocytophilum: deceptively simple or simply deceptive?

    Czech Academy of Sciences Publication Activity Database

    Severo, M. S.; Stephens, K. D.; Kotsyfakis, Michalis; Pedra, J. H. F.

    2012-01-01

    Roč. 7, č. 6 (2012), s. 719-731. ISSN 1746-0913 Institutional support: RVO:60077344 Keywords : obligate intracellular bacterium * rickettsial agents * ticks * vector - borne disease s Subject RIV: GJ - Animal Vermins ; Disease s, Veterinary Medicine Impact factor: 4.018, year: 2012

  20. Improved Palmprint Identification System

    Directory of Open Access Journals (Sweden)

    Harshala C. Salave

    2015-03-01

    Full Text Available Abstract Generally private information is provided by using passwords or Personal Identification Numbers which is easy to implement but it is very easily stolen or forgotten or hack. In Biometrics for individuals identification uses human physiological which are constant throughout life like palm face DNA iris etc. or behavioral characteristicswhich is not constant in life like voice signature keystroke etc.. But mostly gain more attention to palmprint identification and is becoming more popular technique using for identification and promising alternatives to the traditional password or PIN based authentication techniques. In this paper propose palmprint identification using veins on the palm and fingers. Here use fusion of techniques such as Discrete Wavelet transformDWT Canny Edge Detector Gaussian Filter Principle Component AnalysisPCA.

  1. RECURSIVE SYSTEM IDENTIFICATION

    Institute of Scientific and Technical Information of China (English)

    Han-Fu Chen

    2009-01-01

    Most of existing methods in system identification with possible exception of those for linear systems are off-line in nature, and hence are nonrecursive.This paper demonstrates the recent progress in recursive system identification.The recursive identifi-cation algorithms are presented not only for linear systems (multivariate ARMAX systems) but also for nonlinear systems such as the Hammerstein and Wiener systems, and the non-linear ARX systems.The estimates generated by the algorithms are online updated and converge a.s.to the true values as time tends to infinity.

  2. Identification, Classification and Zooarchaeology

    Directory of Open Access Journals (Sweden)

    Jonathan C. Driver

    2011-08-01

    Full Text Available Identification of preserved biological materials is often regarded as a skill which has little to do with analysis and interpretation. This paper argues that in zooarchaeological studies―here with particular reference to vertebrate remains―identification procedures deserve more detailed consideration, because these procedures have a significant effect on the results of faunal studies. It is suggested that most identifications are made within a system of usually unspecified rules which vary from one analyst to another. Improvements in comparability between faunal studies will result if these rules are considered before beginning an analysis, and if the rules are made explicit in publications.

  3. L’architecture rurale lorraine du XIVe siècle à la première moitié du XVIe siècle : de l’identification aux marqueurs chronologiques

    Directory of Open Access Journals (Sweden)

    Ivan Ferraresso

    2012-04-01

    Full Text Available Part marginale du patrimoine lorrain, la maison rurale médiévale est peu étudiée. Les destructions provoquées par les guerres modernes et contemporaines peuvent en partie expliquer sa faible représentation mais quelques traces sont encore perceptibles. Leur étude systématique permettrait de comprendre la chronologie, les mutations et les permanences de l’habitat rural en Lorraine. Or, ces éléments, parfois très morcelés, rendent difficiles l’identification et l’analyse du bâtiment initial. De plus les critères de datation, dont la fiabilité est variable, imposent une étude fouillée du bâtiment pour exploiter les informations les plus infimes.Rural dwellings of the Middle Ages are not an outstanding feature of the heritage in the Lorraine region and have been little studied. The wars of the nineteenth end twentieth centuries explain this relative lack of interest but some surviving traces can still be analysed. This analysis allows for some conclusions as to the chronology, the changes and the permanent features of the region’s rural dwellings. These elements, sometimes broadly scattered, make the identification and analysis of the original dwelling difficult. Dating criteria, of varying reliability, impose an analytical approach in which the building has to be studied in minute detail in order to identify the slightest detail of informative

  4. Waterfowl identification workshops

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — Summary of waterfowl identification workshops conducted by Upper Souris National Wildlife Refuge and J. Clark Salyer National Wildlife Refuge. Objectives of the...

  5. Identification of congenital deafblindness

    DEFF Research Database (Denmark)

    Dammeyer, Jesper Herup

    2012-01-01

    For many reasons an accurate and straightforward identification of congenital deafblindness can be difficult. This article reports on the assessment procedures and experience in Denmark where medical examinations were combined with functional assessments performed through direct observation. The ...

  6. Margins in Swedish district heating systems; Marginaler i Fjaerrvaermesystem

    Energy Technology Data Exchange (ETDEWEB)

    Selinder, Patrik; Zinko, Heimo [ZW Energiteknik AB, Nykoeping (Sweden)

    2003-03-01

    It can be assumed on good reasons that the Swedish district heating nets are designed with relatively large margins concerning the transportable power. This is done historically to be able to transport the necessary power that can be called for on the coldest winter days but which occur rarely and also due to the former (until 2001) applied recommendations for the dimensioning of hot water flows. The aim of this project was to investigate the possibilities of reducing the connecting power to customers, both from a technical and from the customer point of view. The heating system of a building in Sweden is normally dimensioned according to a certain outdoor air temperature (DUT in Swedish). According to the Swedish Building Code, DUT20 is defined for a given location in such a way that if the heating system is designed for this temperature, the room temperature is allowed to decrease by 3 deg C in the average once in 20 years. That means that for economical reasons, a power deficiency is accounted for in the case of strong cold. The value of DUT is depending on the thermal inertia of the building. Buildings with high thermal inertia can have a higher DUT and vice versa. A reduced system size can in principle mean smaller size of pipes and consumer substations and more power available for additional customers to be connected. In principle, that means a more profitable district heating operation. Besides costs, another problem with oversized capacities are possible operational problems due to slow dynamic system responses, for instance at restarting occasions after a pump stop. A smaller valve size will result in a better system dynamic and may result in a more compliant system operation and increased delivery quality. By choosing just right DUT for every building and abandoning safety margins, it is shown in the report that the connecting power can be reduced in especially medium light to heavy buildings with larger time constants. However, this also means that the occasions with power deficiency will occur more often. The lower limit for the reduction of connection power is depending on the level of comfort the customers are prepared to accept. These questions have been discussed with selected customer representatives. The mentioned practice of oversizing of the heating power deliverable to the buildings presents a relatively large margin for reduction of consumable power without decreasing the level of heating comfort too much. In the report this method is recommended under the name 'stingy' (= adequate) dimensioning; it is still according to the recommendation of the Swedish building code based on DUT20 and following the regulations of the Swedish District Heating Association for the domestic hot water dimensioning. The result will be a decrease of about 30% of the connected power in most buildings, and somewhat more in the heaviest buildings. Further reduction of the connecting power will implicate a more strong impact on the heating comfort. We call this 'deficiency dimensioning' and we cannot really recommend it apart from some special customer groups who might accept this heating quality by receiving some kind of economic compensation.

  7. Einfluss der approximalen Kastenelevationstechnik auf die marginale Adaptation von Keramikinlays

    OpenAIRE

    Hehn, Julia

    2012-01-01

    1. Hintergrund und Ziele Auf Grund der schmelzähnlichen Eigenschaften, einer hohen Biokompatibilität und der ästhetisch anspruchsvollen Optik werden heute bevorzugt vollkeramische Werkstoffe als Inlaymaterial verwendet. Wie Langzeitstudien belegen, können auch weit extendierte Kavitäten erfolgreich mit Keramik versorgt werden. Die indirekte Versorgung tiefreichender Defekte bis apikal der Schmelz-Zement-Grenze gestaltet sich jedoch sehr arbeits- und zeitintensiv. Ziel der vorliegenden Studie ...

  8. Bunch identification module

    International Nuclear Information System (INIS)

    This module provides bunch identification and timing signals for the PEP Interaction areas. Timing information is referenced to the PEP master oscillator, and adjusted in phase as a function of region. Identification signals are generated in a manner that allows observers in all interaction regions to agree on an unambiguous bunch identity. The module provides bunch identification signals via NIM level logic, upon CAMAC command, and through LED indicators. A front panel ''region select'' switch allows the same module to be used in all regions. The module has two modes of operation: a bunch identification mode and a calibration mode. In the identification mode, signals indicate which of the three bunches of electrons and positrons are interacting, and timing information about beam crossing is provided. The calibration mode is provided to assist experimenters making time of flight measurements. In the calibration mode, three distinct gating signals are referenced to a selected bunch, allowing three timing systems to be calibrated against a common standard. Physically, the bunch identifier is constructed as a single width CAMAC module. 2 figs., 1 tab

  9. Identification of physical models

    DEFF Research Database (Denmark)

    Melgaard, Henrik

    1994-01-01

    The problem of identification of physical models is considered within the frame of stochastic differential equations. Methods for estimation of parameters of these continuous time models based on descrete time measurements are discussed. The important algorithms of a computer program for ML or MAP...... design of experiments, which is for instance the design of an input signal that are optimal according to a criterion based on the information provided by the experiment. Also model validation is discussed. An important verification of a physical model is to compare the physical characteristics of the...... model with the available prior knowledge. The methods for identification of physical models have been applied in two different case studies. One case is the identification of thermal dynamics of building components. The work is related to a CEC research project called PASSYS (Passive Solar Components...

  10. Electron Identification in Belle

    CERN Document Server

    Hanagaki, K; Ikeda, H; Iijima, T; Tsukamoto, T

    2002-01-01

    We report on electron identification methods and their performance in the Belle experiment at the KEK-B asymmetric B-Factory $e^{+} e^{-}$ storage ring. Electrons are selected using a likelihood approach that takes information from the electromagnetic calorimeter, the central drift chamber, and the silica aerogel Cherenkov counters as input. We achieve an electron identification efficiency of $(92.4 \\pm 0.4)%$ with a $\\pi^{\\pm}$ fake rate of $(0.25 \\pm 0.02)%$ for the momentum range between 1.0 GeV/$c$ and 3.0 GeV/$c$ in laboratory frame.

  11. Simplified Multimodal Biometric Identification

    Directory of Open Access Journals (Sweden)

    Abhijit Shete

    2014-03-01

    Full Text Available Multibiometric systems are expected to be more reliable than unimodal biometric systems for personal identification due to the presence of multiple, fairly independent pieces of evidence e.g. Unique Identification Project "Aadhaar" of Government of India. In this paper, we present a novel wavelet based technique to perform fusion at the feature level and score level by considering two biometric modalities, face and fingerprint. The results indicate that the proposed technique can lead to substantial improvement in multimodal matching performance. The proposed technique is simple because of no preprocessing of raw biometric traits as well as no feature and score normalization.

  12. Denture identification using unique identification authority of India barcode

    Science.gov (United States)

    Mahoorkar, Sudhindra; Jain, Anoop

    2013-01-01

    Over the years, various denture marking systems have been reported in the literature for personal identification. They have been broadly divided into surface marking and inclusion methods. In this technique, patient's unique identification number and barcode printed in the patient's Aadhaar card issued by Unique Identification Authority of India (UIDAI) are used as denture markers. This article describes a simple, quick, and economical method for identification of individual. PMID:23960418

  13. Denture identification using unique identification authority of India barcode

    Directory of Open Access Journals (Sweden)

    Sudhindra Mahoorkar

    2013-01-01

    Full Text Available Over the years, various denture marking systems have been reported in the literature for personal identification. They have been broadly divided into surface marking and inclusion methods. In this technique, patient′s unique identification number and barcode printed in the patient′s Aadhaar card issued by Unique Identification Authority of India (UIDAI are used as denture markers. This article describes a simple, quick, and economical method for identification of individual.

  14. Denture identification using unique identification authority of India barcode

    OpenAIRE

    Sudhindra Mahoorkar; Anoop Jain

    2013-01-01

    Over the years, various denture marking systems have been reported in the literature for personal identification. They have been broadly divided into surface marking and inclusion methods. In this technique, patient′s unique identification number and barcode printed in the patient′s Aadhaar card issued by Unique Identification Authority of India (UIDAI) are used as denture markers. This article describes a simple, quick, and economical method for identification of individual.

  15. Red Blood Cell Antibody Identification

    Science.gov (United States)

    ... limited. Home Visit Global Sites Search Help? RBC Antibody Identification Share this page: Was this page helpful? Also known as: Alloantibody Identification; Antibody ID, RBC; RBC Ab ID Formal name: Red ...

  16. Embedded System for Biometric Identification

    OpenAIRE

    Rosli, Ahmad Nasir Che

    2010-01-01

    This chapter describes the design and implementation of an Embedded System for Biometric Identification from hardware and software perspectives. The first part of the chapter describes the idea of biometric identification. This includes the definition of

  17. Crack identification in elasticity

    International Nuclear Information System (INIS)

    Crack and defect, e.g. hole, identification in elasticity, is formulated as an output optimization problem, where predictions of a suitably parametrized mechanical model are compared with measured data. For the mechanical part the elastostatic analysis is done by the boundary element method, including hypersingular boundary elements for the cracks. In addition, unilateral contact effects along the crack boundaries, i.e., the possibility of partially closed cracks, are considered. Unilateral crack identification has been studied. The numerical solution of the (ill-posed) inverse problem usually requires the use of specialized algorithms and techniques. Among others, we consider neural networks, filter-driven optimization and genetic algorithms. It seems that classical optimization works only in connection with sensitivity analysis for the accurate calculation of the first derivatives for classical cracks and for unilateral cracks). A short review of recent contributions in this area together with the numerical results of our on-going investigation will be presented in the conference. The effect of unilateral contact on the crack identification will be examined. Multiple-crack and multipleload identification problems will be considered. The effectiveness of various solution algorithms will be discussed. Promising directions of further research in this area will be pointed out. Refs. 7 (author)

  18. Unclonable Group Identification

    DEFF Research Database (Denmark)

    Damgård, Ivan Bjerre; Dupont, Kasper; Pedersen, Michael Østergaard

    We introduce and motivate the concept of unclonable group identification, that provides maximal protection against sharing of identities while still protecting the anonymity of users. We prove that the notion can be realized from any one-way function and suggest a more efficient implementation...

  19. Online identification of viruses.

    Science.gov (United States)

    Kolaskar, A S; Naik, P S

    2000-06-01

    A computerized animal virus information system is developed in the Sequence Retrieval System (SRS) format. This database is available on the Word Wide Web (WWW) at the site http://bioinfo.ernet.in/www/avis/avis++ +.html. The database has been used to generate large number of identification matrices for each family. The software is developed in C. Unix shell scripts and Hypertext Marked-up Language (HTML) to assign the family to an unknown virus deterministically and to identify the virus probabilistically. It has been shown that such web based virus identification approach provides results with high confidence in those cases where identification matrix uses large number of independent characters. Protein sequence data for animal viruses have been analyzed and oligopeptides specific to each virus family and also specific to each virus species are identified for several viruses. These peptides thus could be used to identify the virus and to assign the virus family with high confidence showing the usefulness of sequence data in virus identification. PMID:10917875

  20. Identification markings for gemstones

    International Nuclear Information System (INIS)

    A method is described of providing permanent identification markings to gemstones such as diamond crystals by irradiating the cooled gemstone with protons in the desired pattern. The proton bombardment results in a reaction limited to a defined plane and converting the bombarded area of the plane into a different crystal lattice from that of the preirradiated stone. (author)

  1. The bacterial microbiome of Dermacentor andersoni ticks influences pathogen susceptibility.

    Science.gov (United States)

    Gall, Cory A; Reif, Kathryn E; Scoles, Glen A; Mason, Kathleen L; Mousel, Michelle; Noh, Susan M; Brayton, Kelly A

    2016-08-01

    Ticks are of medical importance owing to their ability to transmit pathogens to humans and animals. The Rocky Mountain wood tick, Dermacentor andersoni, is a vector of a number of pathogens, including Anaplasma marginale, which is the most widespread tick-borne pathogen of livestock. Although ticks host pathogenic bacteria, they also harbor bacterial endosymbionts that have a role in tick physiology, survival, as well as pathogen acquisition and transmission. The goal of this study was to characterize the bacterial microbiome and examine the impact of microbiome disruption on pathogen susceptibility. The bacterial microbiome of two populations of D. andersoni with historically different susceptibilities to A. marginale was characterized. In this study, the microbiome was disrupted and then ticks were exposed to A. marginale or Francisella novicida to determine whether the microbiome correlated with pathogen susceptibility. Our study showed that an increase in proportion and quantity of Rickettsia bellii in the microbiome was negatively correlated to A. marginale levels in ticks. Furthermore, a decrease in Francisella endosymbionts was associated with lower F. novicida infection levels, demonstrating a positive pathogen-endosymbiont relationship. We demonstrate that endosymbionts and pathogens have varying interactions, and suggest that microbiome manipulation may provide a possible method for biocontrol by decreasing pathogen susceptibility of ticks. PMID:26882265

  2. 'Nothing is permanent but change'- antigenic variation in persistent bacterial pathogens.

    Science.gov (United States)

    Palmer, Guy H; Bankhead, Troy; Lukehart, Sheila A

    2009-12-01

    Pathogens persist in immunocompetent mammalian hosts using various strategies, including evasion of immune effectors by antigenic variation. Among highly antigenically variant bacteria, gene conversion is used to generate novel expressed variants from otherwise silent donor sequences. Recombination using oligonucleotide segments from multiple donors is a combinatorial mechanism that tremendously expands the variant repertoire, allowing thousands of variants to be generated from a relatively small donor pool. Three bacterial pathogens, each encoded by a small genome (Treponema pallidum TprK and Anaplasma marginale Msp2 expression sites and donors are chromosomally encoded. Both T. pallidum and A. marginale generate antigenic variants in vivo in individual hosts and studies at the population level reveal marked strain diversity in the variant repertoire that may underlie pathogen strain structure and the capacity for re-infection and heterologous strain superinfection. Here, we review gene conversion in bacterial antigenic variation and discuss the short- and long-term selective pressures that shape the variant repertoire. PMID:19709057

  3. Aplicación de modelos estructurales marginales para estimar los efectos de la terapia antirretroviral en 5 cohortes de seroconvertores al virus de la inmunodeficiencia humana Marginal structural models application to estimate the effects of antiretroviral therapy in 5 cohorts of HIV seroconverters

    Directory of Open Access Journals (Sweden)

    Santiago Pérez-Hoyos

    2007-02-01

    Full Text Available Los métodos convencionales tienen limitaciones para ajustar por factores de confusión dependientes del tiempo para evaluar la efectividad poblacional de tratamientos en estudios observacionales. En este trabajo se muestra un nuevo tipo de metodología, los modelos estructurales marginales (MEM, y se estima la efectividad de la terapia antirretroviral de gran actividad (TARGA sobre la incidencia de sida o muerte. Sujetos y métodos: Se identificaron los sujetos sin TARGA seguidos a partir de 1997 en las cohortes de seroconvertores al virus de la inmunodeficiencia humana (VIH del proyecto GEMES (Grupo de Estudio Multicéntrico Español de Seroconvertores. Para estimar el efecto sobre la incidencia de sida o muerte, se obtuvieron los parámetros de un MEM mediante una regresión logística ponderada por probabilidad inversa. La estimación de los pesos se basó en el recuento de CD4, el tiempo desde la seroconversión, el sexo, la edad, la categoría de trasmisión y el tratamiento previo. Resultados: Los 917 sujetos elegibles se siguieron durante una media de 3,4 años, durante los cuales se observaron 139 desenlaces de interés. El 42,1% de los participantes recibió TARGA durante el estudio. La tasa relativa fue de 1,01 (intervalo de confianza &(IC& del 95%, 0,68-1,49 mediante un modelo de Cox convencional sin covariables, y de 0,90 (IC del 95%, 0,61-1,32 mediante un modelo de Cox convencional con covariables cambiantes en el tiempo. La tasa relativa causal estimada por un MEM fue de 0,74 (IC del 95%, 0,49-1,12. Conclusiones: El efecto beneficioso del TARGA encontrado por los MEM está bien establecido, pero los modelos convencionales no pudieron detectarlo. El uso de un MEM permitió ajustar apropiadamente por la variable CD4, que es a la vez una variable de confusión dependiente del tiempo y está afectada por el uso previo de tratamiento.Objectives: Standard methods to evaluate population effectiveness of treatments in observational

  4. Identification of Rotating Machines

    Directory of Open Access Journals (Sweden)

    T. Kreuzinger-Janik

    2000-01-01

    Full Text Available In this paper a method is proposed for unbalance identification ofelastic rotors. The method is essentially based on the rotordynamic theory combined with experimental modal analysis and allows to identify the unbalance distribution on the complete rotor. A rotor test rig designed for rotordynamic experiments, modal analysis and especially for the unbalance identification has been developed. It allows an arbitrary excitation with a particularly developed noncontact magnetic exciter, as well as measuring vibrations in radial direction with non-contact laser sensors and eddy currents. Special effects of rotordynamic like anisotropic journal bearings and gyroscopic forces can be simulated. Experimental and theoretical results like mode shapes and unbalance parameters for the laboratory model are presented in detail.

  5. Structural Identification Problem

    Directory of Open Access Journals (Sweden)

    Suvorov Aleksei

    2016-01-01

    Full Text Available The identification problem of the existing structures though the Quasi-Newton and its modification, Trust region algorithms is discussed. For the structural problems, which could be represented by means of the mathematical modelling of the finite element code discussed method is extremely useful. The nonlinear minimization problem of the L2 norm for the structures with linear elastic behaviour is solved by using of the Optimization Toolbox of Matlab. The direct and inverse procedures for the composition of the desired function to minimize are illustrated for the spatial 3D truss structure as well as for the problem of plane finite elements. The truss identification problem is solved with 2 and 3 unknown parameters in order to compare the computational efforts and for the graphical purposes. The particular commands of the Matlab codes are present in this paper.

  6. Identification of social interactions

    OpenAIRE

    Blume, Lawrence E.; William A Brock; Durlauf, Steven N.; Ioannides, Yannis M.

    2010-01-01

    Abstract: While interest in social determinants of individual behavior has led to a rich theoretical literature and many efforts to measure these influences, a mature "social econometrics" has yet to emerge. This chapter provides a critical overviewof the identification of social interactions. We consider linear and discrete choice models as well as social networks structures. We also consider experimental and quasi-experimental methods. In addition to describing the state of the identificati...

  7. Automatic sign language identification

    OpenAIRE

    Gebre, B.G.; Wittenburg, P.; Heskes, T.

    2013-01-01

    We propose a Random-Forest based sign language identification system. The system uses low-level visual features and is based on the hypothesis that sign languages have varying distributions of phonemes (hand-shapes, locations and movements). We evaluated the system on two sign languages -- British SL and Greek SL, both taken from a publicly available corpus, called Dicta Sign Corpus. Achieved average F1 scores are about 95% - indicating that sign languages can be identified with high accuracy...

  8. Palmprint identification using FRIT

    Science.gov (United States)

    Kisku, D. R.; Rattani, A.; Gupta, P.; Hwang, C. J.; Sing, J. K.

    2011-06-01

    This paper proposes a palmprint identification system using Finite Ridgelet Transform (FRIT) and Bayesian classifier. FRIT is applied on the ROI (region of interest), which is extracted from palmprint image, to extract a set of distinctive features from palmprint image. These features are used to classify with the help of Bayesian classifier. The proposed system has been tested on CASIA and IIT Kanpur palmprint databases. The experimental results reveal better performance compared to all well known systems.

  9. Method of Fingerprint Identification

    OpenAIRE

    Surachai Panich

    2010-01-01

    Problem statement: The main task of this study was finding out an effective algorithm in order to match two fingerprints taken from database. The fingerprint identification techniques used in a small database in order to find out an effective algorithm to develop the accuracy in matching process. Higher-level application of this proposed algorithm was determined. Approach: The main objectives in this study were the construction of fingerprint database and matching algorithm for comparison of ...

  10. Particle Identification with BELLE

    CERN Document Server

    Satpathy, A

    1999-01-01

    The working principle and performance of the BELLE particle identification device (PID), based on a hybrid system consisting of an array of high precision scintillator Time of Flight and silica Aerogel Counters, is discussed. The performances achieved in the beam tests are satisfactory and Monte Carlo tests of meeting physics objectives of BELLE are promising. Prior to the real experiment which is expected to commence in spring 1999, the BELLE PID is taking cosmic ray data for calibration and fine tuning.

  11. Word Identification in Noise

    OpenAIRE

    Pisoni, David B.

    1996-01-01

    Speech intelligibility has traditionally been measured by presenting words mixed in noise to listeners for identification at several different signal-to-noise ratios. The words are produced in isolation or in sentence contexts where the predictability of specific items can be varied. Psychometric functions are typically obtained relating signal-to-noise ratio to percent correct recognition. Error analyses are often carried out by examining response confusions to construct similarity spaces fo...

  12. PINS Spectrum Identification Guide

    Energy Technology Data Exchange (ETDEWEB)

    A.J. Caffrey

    2012-03-01

    The Portable Isotopic Neutron Spectroscopy—PINS, for short—system identifies the chemicals inside munitions and containers without opening them, a decided safety advantage if the fill chemical is a hazardous substance like a chemical warfare agent or an explosive. The PINS Spectrum Identification Guide is intended as a reference for technical professionals responsible for the interpretation of PINS gamma-ray spectra. The guide is divided into two parts. The three chapters that constitute Part I cover the science and technology of PINS. Neutron activation analysis is the focus of Chapter 1. Chapter 2 explores PINS hardware, software, and related operational issues. Gamma-ray spectral analysis basics are introduced in Chapter 3. The six chapters of Part II cover the identification of PINS spectra in detail. Like the PINS decision tree logic, these chapters are organized by chemical element: phosphorus-based chemicals, chlorine-based chemicals, etc. These descriptions of hazardous, toxic, and/or explosive chemicals conclude with a chapter on the identification of the inert chemicals, e.g. sand, used to fill practice munitions.

  13. Control de Rhipicephalus microplus (Acari: Ixodidae) mediante el uso del hongo entomopatógeno Metarhizium anisopliae (Hypocreales: Clavicipitaceae). Revisión

    OpenAIRE

    Melina Maribel Ojeda-Chi; Roger Ivan Rodríguez-Vivas; Edelmira Galindo-Velasco; Roberto Lezama-Gutiérrez; Carlos Cruz-Vázquez

    2011-01-01

    Las infestaciones de la garrapata del ganado, Rhipicephalus microplus, producen el mayor problema global de ectoparásitos en ganado de regiones tropicales y subtropicales, provocan importantes pérdidas económicas en la producción de carne, leche y pieles, además incrementan los gastos derivados de los programas de control, y son capaces de transmitir Babesia bovis, B. bigemina y Anaplasma marginale. El control de R. microplus se basa principalmente en el uso de ixodicidas, sin embargo, su uso...

  14. Prevalence of parasitic infections in cattle of Ludhiana district, Punjab

    OpenAIRE

    Singh, N. K.; Singh, Harkirat; Jyoti; Haque, M.; Rath, S. S.

    2012-01-01

    A total of 862 cattle were sampled for both haematological (703) and coprological (159) investigations at the Large Animal Clinics, GADVASU, Ludhiana, Punjab, India. Examination of Giemsa-stained peripheral blood smears exhibited that 22.9 % (161/703) of cattle were infected with haematozoa comprising Theileria annulata (14.65 %), Trypanosoma evansi (0.28 %), Babesia bigemina (1.56 %) and Anaplasma marginale (8.53 %) while mixed infection appeared in 2.13 % (15/703) animals. The prevalence of...

  15. HEMOPARASITOSIS EN GANADERÍA DOBLE PROPÓSITO VENEZOLANA, DIAGNÓSTICO Y CONTROL: UNA REVISIÓN

    Directory of Open Access Journals (Sweden)

    Rita Tamasaukas

    2010-01-01

    Full Text Available Este trabajo de revisión de tesis doctoral incluye resultados de investigaciones realizadas en el periodo 1971 a 2009 sobre cuatro hemoparasitosis causados por protozoarios y rickettsiales en Venezuela y otros países, con énfasis en la infección mixta en rebaños bovinos, y su diagnóstico y control. En Venezuela, las afecciones causadas por agentes hemotrópicos parasitarios están distribuidas en todos los estados del país con vocación ganadera, en especial, en rebaños bovinos y bufalinos. Entre aquellos encontramos a especies del género Anaplasma (Anaplasma marginale, Babesia (Babesia bigemina y B. bovis, y Trypanosoma (Trypanosoma vivax, con una frecuencia endémica y con variaciones estacionales.

  16. Tau reconstruction and identification algorithm

    Indian Academy of Sciences (India)

    Raman Khurana

    2012-11-01

    CMS has developed sophisticated tau identification algorithms for tau hadronic decay modes. Production of tau lepton decaying to hadrons are studied at 7 TeV centre-of-mass energy with 2011 collision data collected by CMS detector and has been used to measure the performance of tau identification algorithms by measuring identification efficiency and misidentification rates from electrons, muons and hadronic jets. These algorithms enable extended reach for the searches for MSSM Higgs, and other exotic particles.

  17. Neural crack identification

    International Nuclear Information System (INIS)

    The inverse, crack identification problem in elasticity can be formulated as an output error minimization problem which, nevertheless, can not be solved without difficulties by classical numerical optimization. A review of all these previous results, where we used neural networks, filter-driven optimization and genetic algorithms is presented and in a companion lecture during this conference. The use of neural networks for the solution of the inverse problem makes possible the on-line solution of the problem. In fact, one usually approximates the inverse mapping (measurements versus crack quantities). Most of the effort is spent for the learning of this relation, while a sufficiently trained neural network provides predictions with, practically, zero computational cost. Potential applications include on-line, in-flight health monitoring systems with applications in civil and mechanical engineering and production control. In this paper we present new developments in the design of specialized neural networks for the solution of the crack identification problem. Emphasis is posed on the effective use of the learning data, which are produced by the boundary element method. Several technical data will be discussed. They include thoughts about the effective choice of the neural network architecture, the number of training examples and of the learning algorithms will be provided, together with the results of our recent numerical investigation. A detailed application for one or more elliptical cracks using static analysis results with the use of back-propagation trained neural networks will be provided. The general methodology follows our previously published results. By using more refined algorithms for the numerical solution of the neural network learning problem, which are based on the MERLIN optimization system developed in the department of the second author, we are able to solve complicated tasks. First results based on dynamic investigations (wave propagation driven

  18. Identification for automotive systems

    CERN Document Server

    Hjalmarsson, Håkan; Re, Luigi

    2012-01-01

    Increasing complexity and performance and reliability expectations make modeling of automotive system both more difficult and more urgent. Automotive control has slowly evolved from an add-on to classical engine and vehicle design to a key technology to enforce consumption, pollution and safety limits. Modeling, however, is still mainly based on classical methods, even though much progress has been done in the identification community to speed it up and improve it. This book, the product of a workshop of representatives of different communities, offers an insight on how to close the gap and exploit this progress for the next generations of vehicles.

  19. Topic Identification in Discourse

    OpenAIRE

    Chen, Kuang-hua

    1995-01-01

    This paper proposes a corpus-based language model for topic identification. We analyze the association of noun-noun and noun-verb pairs in LOB Corpus. The word association norms are based on three factors: 1) word importance, 2) pair co-occurrence, and 3) distance. They are trained on the paragraph and sentence levels for noun-noun and noun-verb pairs, respectively. Under the topic coherence postulation, the nouns that have the strongest connectivities with the other nouns and verbs in the di...

  20. Automatic Kurdish Dialects Identification

    Directory of Open Access Journals (Sweden)

    Hossein Hassani

    2016-02-01

    Full Text Available Automatic dialect identification is a necessary Lan guage Technology for processing multi- dialect languages in which the dialects are linguis tically far from each other. Particularly, this becomes crucial where the dialects are mutually uni ntelligible. Therefore, to perform computational activities on these languages, the sy stem needs to identify the dialect that is the subject of the process. Kurdish language encompasse s various dialects. It is written using several different scripts. The language lacks of a standard orthography. This situation makes the Kurdish dialectal identification more interesti ng and required, both form the research and from the application perspectives. In this research , we have applied a classification method, based on supervised machine learning, to identify t he dialects of the Kurdish texts. The research has focused on two widely spoken and most dominant Kurdish dialects, namely, Kurmanji and Sorani. The approach could be applied to the other Kurdish dialects as well. The method is also applicable to the languages which are similar to Ku rdish in their dialectal diversity and differences.

  1. Brightest Cluster Galaxy Identification

    Science.gov (United States)

    Leisman, Luke; Haarsma, D. B.; Sebald, D. A.; ACCEPT Team

    2011-01-01

    Brightest cluster galaxies (BCGs) play an important role in several fields of astronomical research. The literature includes many different methods and criteria for identifying the BCG in the cluster, such as choosing the brightest galaxy, the galaxy nearest the X-ray peak, or the galaxy with the most extended profile. Here we examine a sample of 75 clusters from the Archive of Chandra Cluster Entropy Profile Tables (ACCEPT) and the Sloan Digital Sky Survey (SDSS), measuring masked magnitudes and profiles for BCG candidates in each cluster. We first identified galaxies by hand; in 15% of clusters at least one team member selected a different galaxy than the others.We also applied 6 other identification methods to the ACCEPT sample; in 30% of clusters at least one of these methods selected a different galaxy than the other methods. We then developed an algorithm that weighs brightness, profile, and proximity to the X-ray peak and centroid. This algorithm incorporates the advantages of by-hand identification (weighing multiple properties) and automated selection (repeatable and consistent). The BCG population chosen by the algorithm is more uniform in its properties than populations selected by other methods, particularly in the relation between absolute magnitude (a proxy for galaxy mass) and average gas temperature (a proxy for cluster mass). This work supported by a Barry M. Goldwater Scholarship and a Sid Jansma Summer Research Fellowship.

  2. Extremely secure identification documents

    International Nuclear Information System (INIS)

    The technology developed in this project uses biometric information printed on the document and public key cryptography to ensure that an adversary cannot issue identification documents to unauthorized individuals or alter existing documents to allow their use by unauthorized individuals. This process can be used to produce many types of identification documents with much higher security than any currently in use. The system is demonstrated using a security badge as an example. This project focused on the technologies requiring development in order to make the approach viable with existing badge printing and laminating technologies. By far the most difficult was the image processing required to verify that the picture on the badge had not been altered. Another area that required considerable work was the high density printed data storage required to get sufficient data on the badge for verification of the picture. The image processing process was successfully tested, and recommendations are included to refine the badge system to ensure high reliability. A two dimensional data array suitable for printing the required data on the badge was proposed, but testing of the readability of the array had to be abandoned due to reallocation of the budgeted funds by the LDRD office

  3. Talent identification in Hungary: From identification to investigation

    Directory of Open Access Journals (Sweden)

    Szilvia Péter-Szarka

    2015-03-01

    Full Text Available This article provides an outline of talent identification practices and challenges in Hungary. First, it gives a summary of gifted education in the country; then the general challenges of talent identification are introduced: difficulties of defining talent, talent as potential, environmental factors, the role of perseverance and motivation, and individual variety. Later, recent Hungarian identification practices are shown, followed by a summary and a conclusion about how our identification practice should be developed into an investigation of individual characetristics. We propose stronger focus on the use of cognitive profile tests, investigation of interest-based characteristics, the use of observation and dynamic assessment methods, teacher nomination and emphasizing the need for effort. The focus from identification toward investigation exploring individual needs and characteristics to provide the most appropriate pathway for development in the 21st century seems to be a more effective way of talent support than mere selection.

  4. Chemical identification and its quality assurance

    CERN Document Server

    Milman, Boris L

    2013-01-01

    Chemical Identification and its Quality Assurance shows how to apply the principles of quality assurance for qualitative chemical analysis. The principles of identification and metrological basics are presented, in addition to the reliability and errors involved with chemical identification.

  5. Forsmark - process identification - user's manual

    International Nuclear Information System (INIS)

    Introductory process identifications by gamma-thermometers of Forsmark 1 are described. The identification has been made by means of a parametric (maximum likelihood) method and the program IDPAC. The latter can be used as a powerful tool for analysing various processes. (G.B.)

  6. Automatic Identification of Metaphoric Utterances

    Science.gov (United States)

    Dunn, Jonathan Edwin

    2013-01-01

    This dissertation analyzes the problem of metaphor identification in linguistic and computational semantics, considering both manual and automatic approaches. It describes a manual approach to metaphor identification, the Metaphoricity Measurement Procedure (MMP), and compares this approach with other manual approaches. The dissertation then…

  7. Identification: psychoanalytic and biological perspectives.

    Science.gov (United States)

    Olds, David D

    2006-01-01

    In recent attempts to bring psychoanalysis into greater contact with other sciences, a number of works have explicated neural science concepts and phenomena--affect, memory, consciousness--for the psychoanalyst. These efforts have helped analysts build a more scientific foundation for their theory and practice. A related task remains--namely, to take psychoanalytic concepts and see how they relate to other sciences. The concept of identification has a long history in psychoanalytic theory. It is seen in parent-child interactions, in teaching and mentoring relationships, and in psychoanalysis and psychotherapy. Neuropsychology and evolutionary biology have explored the phylogenetic precursors of identification, while genetics and infant observation provide insights into individual processes of identification. Finally, neuroscience, particularly recent studies of mirror neurons, offers information about the biological mechanisms of imitation and the relationship of imitation to identification. Findings from these sciences are presented in an effort to further the psychoanalytic understanding of identification, especially its biological underpinnings. PMID:16602344

  8. Product identification file

    Energy Technology Data Exchange (ETDEWEB)

    Gray, C.E. (ed.)

    1978-06-01

    This product identification file was compiled as an aid to the industrial hygienist who may encounter the products listed in surveys for and studies of occupational health hazards. It is pointed out that the chemical composition of a product may vary from year to year and some components may be added or deleted without an indication on the label. Some of the data in this file may not be complete depending on the analysis requested. For example, a solvent may be the only component for which the product was analyzed. The file is arranged by listing the chemical manufacturer, followed by the trade name. In cases where no manufacturer is known, the trade name appears in alphabetical order. The log number and the chemist who analyzed the product are listed for reference.

  9. Nuclear weapons identification system

    International Nuclear Information System (INIS)

    A nuclear weapons identification system (NWIS) has been under development at the Oak Ridge Y-12 plant since 1984. NWIS employs active neutron interrogation to obtain a variety of time and frequency analysis signature to identify nuclear weapons in containers. Advantages of NWIS are (1) high sensitivity (small changes in configurations produce large changes in signatures); (2) insensitivity of some signatures to background radiation, (useful for storage configurations or for tracking of secondaries through the first stage of dismantlement since the presence of the primary on the assembled system does not affect some signatures for the secondary); (3) nonintrusive (does not reveal design information, which makes it useful for bilateral treaties or by the International Atomic Energy Agency (IAEA)); and (4) very difficult to deceive

  10. Cluster identification based on correlations

    Science.gov (United States)

    Schulman, L. S.

    2012-04-01

    The problem addressed is the identification of cooperating agents based on correlations created as a result of the joint action of these and other agents. A systematic method for using correlations beyond second moments is developed. The technique is applied to a didactic example, the identification of alphabet letters based on correlations among the pixels used in an image of the letter. As in this example, agents can belong to more than one cluster. Moreover, the identification scheme does not require that the patterns be known ahead of time.

  11. 49 CFR 1542.211 - Identification systems.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 9 2010-10-01 2010-10-01 false Identification systems. 1542.211 Section 1542.211... systems. (a) Personnel identification system. The personnel identification system under §§ 1542.201(b)(3... identification media stock and supplies. (iv) Auditing the system at a minimum of once a year or sooner,...

  12. Identification key to Quivira milkweeds

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document is a key to milkweed identification at Quivira National Wildlife Refuge. It contains a dichotomous key as well as a picture key. Milkweeds found on...

  13. Forensic identification with Bayes’ law

    OpenAIRE

    Andrade, Marina; Ferreira, Manuel Alberto M.

    2011-01-01

    The probabilistic fundaments for the evaluation of DNA evidences, based mainly on Bayes’ Law, are presented emphasizing the famous island problem. Identification problems are considered,in particular the paternity dispute problem and the crime scene analysis.

  14. Liquid identification by Hilbert spectroscopy

    Science.gov (United States)

    Lyatti, M.; Divin, Y.; Poppe, U.; Urban, K.

    2009-11-01

    Fast and reliable identification of liquids is of great importance in, for example, security, biology and the beverage industry. An unambiguous identification of liquids can be made by electromagnetic measurements of their dielectric functions in the frequency range of their main dispersions, but this frequency range, from a few GHz to a few THz, is not covered by any conventional spectroscopy. We have developed a concept of liquid identification based on our new Hilbert spectroscopy and high- Tc Josephson junctions, which can operate at the intermediate range from microwaves to THz frequencies. A demonstration setup has been developed consisting of a polychromatic radiation source and a compact Hilbert spectrometer integrated in a Stirling cryocooler. Reflection polychromatic spectra of various bottled liquids have been measured at the spectral range of 15-300 GHz with total scanning time down to 0.2 s and identification of liquids has been demonstrated.

  15. Liquid identification by Hilbert spectroscopy

    International Nuclear Information System (INIS)

    Fast and reliable identification of liquids is of great importance in, for example, security, biology and the beverage industry. An unambiguous identification of liquids can be made by electromagnetic measurements of their dielectric functions in the frequency range of their main dispersions, but this frequency range, from a few GHz to a few THz, is not covered by any conventional spectroscopy. We have developed a concept of liquid identification based on our new Hilbert spectroscopy and high- Tc Josephson junctions, which can operate at the intermediate range from microwaves to THz frequencies. A demonstration setup has been developed consisting of a polychromatic radiation source and a compact Hilbert spectrometer integrated in a Stirling cryocooler. Reflection polychromatic spectra of various bottled liquids have been measured at the spectral range of 15-300 GHz with total scanning time down to 0.2 s and identification of liquids has been demonstrated.

  16. Liquid identification by Hilbert spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Lyatti, M; Divin, Y; Poppe, U; Urban, K, E-mail: M.Lyatti@fz-juelich.d, E-mail: Y.Divin@fz-juelich.d [Forschungszentrum Juelich, 52425 Juelich (Germany)

    2009-11-15

    Fast and reliable identification of liquids is of great importance in, for example, security, biology and the beverage industry. An unambiguous identification of liquids can be made by electromagnetic measurements of their dielectric functions in the frequency range of their main dispersions, but this frequency range, from a few GHz to a few THz, is not covered by any conventional spectroscopy. We have developed a concept of liquid identification based on our new Hilbert spectroscopy and high- T{sub c} Josephson junctions, which can operate at the intermediate range from microwaves to THz frequencies. A demonstration setup has been developed consisting of a polychromatic radiation source and a compact Hilbert spectrometer integrated in a Stirling cryocooler. Reflection polychromatic spectra of various bottled liquids have been measured at the spectral range of 15-300 GHz with total scanning time down to 0.2 s and identification of liquids has been demonstrated.

  17. Personal and interpersonal risk factors in the consumption of illicit drugs by marginal adolescents and young people from juvenile gangs Factores de riesgo personales e interpersonales en el consumo drogas ilícitas en adolescentes y jóvenes marginales de bandas juveniles Fatores de risco pessoais e interpessoais no consumo de drogas ilícitas em adolescentes e jovens marginais de bandos juvenis

    Directory of Open Access Journals (Sweden)

    Francisco Rafael Guzmán Facundo

    2008-06-01

    Full Text Available Marginal populations are groups which are known to present higher risks of drug consumption. It is possible to identify adolescents and young people from juvenile gangs that constitute this group. The purpose of this study was to analyze the effect of personal and interpersonal risk factors of drug consumption in 175 marginal adolescents and young people who belong to juvenile gangs in Mexico. Results showed a significant effect of personal factors on drug use, with an estimated variation of 26.1%. The factors that presented the highest rates were: gender, age and mental problems. The interpersonal factors (relationships with friends who have maladaptive behaviors and inappropriate relationships with parents showed an effect with an estimated variation of 15%. These results will allow for reflection and, in the future, the elaboration of adequate preventive programs aimed at this group of young people.Grupos reconocidos con mayor riesgo para consumir drogas, son los marginales, dentro de estos podemos localizar a los adolescentes y jóvenes de bandas juveniles. El objetivo del estudio fue analizar el efecto de los factores de riesgo personales e interpersonales sobre el consumo de drogas, en 175 adolescentes y jóvenes margínales de bandas juveniles de México. Los resultados mostraron efecto significativo de los factores personales sobre el consumo de drogas, con una varianza explicada del 26.1%, los factores que mostraron una mayor contribución fueron; el sexo, edad y problemas de salud mental. Los factores interpersonales (relación con amigos con conductas mal adaptadas y relación inapropiada con padres mostraron un efecto sobre el consumo de drogas, con una varianza explicada del 15%. Estos resultados posibilitarán la reflexión y en un futuro diseñar programas adecuados dirigidos a la prevención en este grupo de jóvenes.Grupos reconhecidos com maior risco para o consumo de drogas, são os de populações marginais, e, dentro destas

  18. Individual identification via electrocardiogram analysis

    OpenAIRE

    Fratini, Antonio; Sansone, Mario; Bifulco, Paolo; Cesarelli, Mario

    2015-01-01

    Background During last decade the use of ECG recordings in biometric recognition studies has increased. ECG characteristics made it suitable for subject identification: it is unique, present in all living individuals, and hard to forge. However, in spite of the great number of approaches found in literature, no agreement exists on the most appropriate methodology. This study aimed at providing a survey of the techniques used so far in ECG-based human identification. Specifically, a pattern re...

  19. Combustion Engine Identification and Control

    OpenAIRE

    Blasco Serrano, Daniel

    2013-01-01

    The topic of this thesis is system identification and control of two different internal combustion engines, Partially Premixed Combustion (PPC) engine and a more conventional Combustion Ignited (CI) diesel engine. The control of both engines is aimed to emission reduction and to increase the eficiency. There is an introduction to the internal combustion engine, as well as theory used about system identification and Model Predictive Control (MPC). A physical model of a PPC en...

  20. Bilingualism affects audiovisual phoneme identification

    OpenAIRE

    Burfin, Sabine; Pascalis, Olivier; Ruiz Tada, Elisa; Costa, Albert; Savariaux, Christophe; Kandel, Sonia

    2014-01-01

    We all go through a process of perceptual narrowing for phoneme identification. As we become experts in the languages we hear in our environment we lose the ability to identify phonemes that do not exist in our native phonological inventory. This research examined how linguistic experience—i.e., the exposure to a double phonological code during childhood—affects the visual processes involved in non-native phoneme identification in audiovisual speech perception. We conducted a phoneme identifi...

  1. Identification Techniques in Composite Laminates

    DEFF Research Database (Denmark)

    Pedersen, Pauli

    1999-01-01

    Combined experimental-numerical methods are presented with the goal of obtaining material stiffness for composite materials. The identification is based on eigenfrequencies for a free rectangular plate, because excellent agreement between measured and calculated eigenfrequencies can be obtained....... The numerical identification problem is formulated as an optimization problem and in one experiment we obtain all the involved moduli. The total approach consists of experiment, numerical eigenvalue analysis, eigenvalue sensitivity analysis, optimization, and error estimation. Recent results from...

  2. System Identification with Quantized Observations

    CERN Document Server

    Wang, Le Yi; Zhang, Jifeng; Zhao, Yanlong

    2010-01-01

    This book presents recently developed methodologies that utilize quantized information in system identification and explores their potential in extending control capabilities for systems with limited sensor information or networked systems. The results of these methodologies can be applied to signal processing and control design of communication and computer networks, sensor networks, mobile agents, coordinated data fusion, remote sensing, telemedicine, and other fields in which noise-corrupted quantized data need to be processed. Providing a comprehensive coverage of quantized identification,

  3. Fingerprints identification of radiotherapy patients

    International Nuclear Information System (INIS)

    The identification of patient plays a key role in the quality and safety of radiotherapy. It does impact on all professional staff and on patients. After the regulatory authority approval (Cnil), a pilot study has been performed on 1901 patients. Acceptance has been very high (> 93%) with a low risk of mis-identification (< 0.1%). The next step will be to implement and test a bimodal system in order to improve registration capacity and sensitivity. (authors)

  4. High Performance Fingerprint Identification System

    OpenAIRE

    Dr.R.Seshadri; Yaswanth Kumar.Avulapati

    2010-01-01

    Biometrics is the science of establishing the identity of an individual based on their physical, chemical and behavioral characteristics of the person. Fingerprints are the most widely used biometric feature for person identification and verification in the field of biometric identification .A finger print is the representation of the epidermis of a finger. It consists of a pattern of interleaved ridges and valleys. Fingerprints are graphical flow-like ridges present on human fingers. They ar...

  5. Features of Identification Business Processes

    OpenAIRE

    E. V. Runova; S. D. Vdovina; L. V. Khafizova

    2015-01-01

    This article deals with the peculiarities of identifying business processes. Identification of business processes isthe most important stage in the development of business processes used by business analysts and enterprisearchitects to construct models of business processes. The aim of the study is to identify the problems for properoperation of business processes. The identification of business processes is based on their selection by differentclassification groups. This is due to the fact t...

  6. MODEL IDENTIFICATION AND COMPUTER ALGEBRA.

    Science.gov (United States)

    Bollen, Kenneth A; Bauldry, Shawn

    2010-10-01

    Multiequation models that contain observed or latent variables are common in the social sciences. To determine whether unique parameter values exist for such models, one needs to assess model identification. In practice analysts rely on empirical checks that evaluate the singularity of the information matrix evaluated at sample estimates of parameters. The discrepancy between estimates and population values, the limitations of numerical assessments of ranks, and the difference between local and global identification make this practice less than perfect. In this paper we outline how to use computer algebra systems (CAS) to determine the local and global identification of multiequation models with or without latent variables. We demonstrate a symbolic CAS approach to local identification and develop a CAS approach to obtain explicit algebraic solutions for each of the model parameters. We illustrate the procedures with several examples, including a new proof of the identification of a model for handling missing data using auxiliary variables. We present an identification procedure for Structural Equation Models that makes use of CAS and that is a useful complement to current methods. PMID:21769158

  7. Role of dentist in person identification

    OpenAIRE

    Chandra Shekar. B; CVK Reddy

    2009-01-01

    To reinforce awareness among dentists about their role in person identification and the importance of maintaining dental records of all their patients. The article reviews basic procedures of dental identification and some cases where dental identification played a key role in eventual identification of the person. Forensic odontology is an integral part of forensic sciences. Forensic dental identifications, especially in times of mass disasters, depend mainly on the availability of ante mort...

  8. Printed Identification Key or Web-Based Identification Guide: An Effective Tool for Species Identification?

    OpenAIRE

    THOMAS EDISON E. DELA CRUZ; Pangilinan, Ma. Victoria B.; Rodrigo A. Litao

    2012-01-01

    Species identification is often done with the aid of traditional dichotomous keys. This printed material is based on one’s decision between two alternatives, which is followed by another pair of alternatives until the final species name is reached. With the advent of internet technology, the use of an online database offers an updatable and accumulative approach to species identification. It can also be accessed anytime, and this is very useful for fast-changing groups of organisms. In this p...

  9. Improved autonomous star identification algorithm

    Science.gov (United States)

    Luo, Li-Yan; Xu, Lu-Ping; Zhang, Hua; Sun, Jing-Rong

    2015-06-01

    The log-polar transform (LPT) is introduced into the star identification because of its rotation invariance. An improved autonomous star identification algorithm is proposed in this paper to avoid the circular shift of the feature vector and to reduce the time consumed in the star identification algorithm using LPT. In the proposed algorithm, the star pattern of the same navigation star remains unchanged when the stellar image is rotated, which makes it able to reduce the star identification time. The logarithmic values of the plane distances between the navigation and its neighbor stars are adopted to structure the feature vector of the navigation star, which enhances the robustness of star identification. In addition, some efforts are made to make it able to find the identification result with fewer comparisons, instead of searching the whole feature database. The simulation results demonstrate that the proposed algorithm can effectively accelerate the star identification. Moreover, the recognition rate and robustness by the proposed algorithm are better than those by the LPT algorithm and the modified grid algorithm. Project supported by the National Natural Science Foundation of China (Grant Nos. 61172138 and 61401340), the Open Research Fund of the Academy of Satellite Application, China (Grant No. 2014_CXJJ-DH_12), the Fundamental Research Funds for the Central Universities, China (Grant Nos. JB141303 and 201413B), the Natural Science Basic Research Plan in Shaanxi Province, China (Grant No. 2013JQ8040), the Research Fund for the Doctoral Program of Higher Education of China (Grant No. 20130203120004), and the Xi’an Science and Technology Plan, China (Grant. No CXY1350(4)).

  10. Electron identification capabilities of CBM

    Energy Technology Data Exchange (ETDEWEB)

    Lebedev, Semen [GSI, Darmstadt (Germany)]|[JINR, Dubna (Russian Federation)

    2008-07-01

    The Compressed Baryonic Matter (CBM) experiment at the future FAIR facility at Darmstadt will measure dileptons emitted from the hot and dense phase in heavy-ion collisions. In case of an electron measurement, a high purity of identified electrons is required in order to suppress the background. Electron identification in CBM will be performed by a RICH and TRD detectors. In this contribution we will present routines which have been developed for electron identification in CBM. A RICH ring recognition algorithm based on the Hough Transform has been implemented. An ellipse fitting algorithm has been elaborated because most of the CBM RICH rings have elliptic shapes, moreover, it helps to improve ring-track matching and electron identification procedures. An Artificial Neural Network can be used in order to suppress fake rings. The electron identification in RICH is substantially improved by the use of TRD information for which 3 different algorithms are implemented. Results of primary electron identification are presented. All developed algorithms were tested on large statistics of simulated events and are included into the CBM software framework for common use.

  11. System identification for multivariable control

    Science.gov (United States)

    Vanzee, G. A.

    1981-05-01

    System identification methods and modern control theory are applied to industrial processes. These processes must often be controlled in order to meet certain requirements with respect to the product quality, safety, energy consumption, and environmental load. Modern control system design methods which take the occurring interaction phenomena and stochastic disturbances into account are used. An accurate dynamic mathematical model of the process, by theoretical modelling and/or by system identification is obtained. The computational aspects of two important types of identifications methods, i.e., stochastic realization and prediction error based parameter estimation are studied. The studied computational aspects are the robustness, the accuracy, and the computational costs of the methods. Theoretical analyses and applications to a multivariable pilot scale process, operating under closed loop conditions are investigated.

  12. System Identification and Robust Control

    DEFF Research Database (Denmark)

    Tøffner-Clausen, S.

    uncertainty structures permitted by m is definitely much more flexible than those used in H inifity. Unfortunately m synthesis is a very difficult mathematical problem which is only well developed for purely complex perturbation sets. In order to develop our main result we will unfortunately need to...... these uncertainty ellipses may be represented or, more correct, approximated with a mixed complex and real perturbation set. This is the link needed to combine the results in robust control and system identification into a step-by-step design philosophy for synthesis of robust control systems for scalar......The main purpose of this work is to develop a coherent system identification based robust control design methodology by combining recent results from system identification and robust control. In order to accomplish this task new theoretical results will be given in both fields. Firstly, however, an...

  13. Automatic identification of mass spectra

    International Nuclear Information System (INIS)

    Several approaches to preprocessing and comparison of low resolution mass spectra have been evaluated by various test methods related to library search. It is shown that there is a clear correlation between the nature of any contamination of a spectrum, the basic principle of the transformation or distance measure, and the performance of the identification system. The identification of functionality from low resolution spectra has also been evaluated using several classification methods. It is shown that there is an upper limit to the success of this approach, but also that this can be improved significantly by using a very limited amount of additional information. 10 refs

  14. System identification. [of space structures

    Science.gov (United States)

    Juang, Jer-Nan

    1993-01-01

    Major issues in system identification are summarized and recent advances are reviewed. Modal testing and system identification used in control theory are examined, and the mathematical relationships and conversions of the models appropriate to modal testing and those appropriate to modern control design methods are discussed. The importance of obtaining input and output matrices in modal testing is emphasized, and the changes that may be needed in modal testing procedures to meet the needs of the control system designer are addressed. Directions for future research are considered.

  15. Prevalence of Haemoprotozoan infections in bovines of Shimoga region of Karnataka state.

    Science.gov (United States)

    Krishna Murthy, C M; Ananda, K J; Adeppa, J

    2016-09-01

    A study was conducted to record the prevalence of Haemoprotozoan infections in bovines of Shimoga region for a period of 1 year from April 2012 to March 2013. A total of 300 blood samples were examined for the presence of haemoprotozoan parasites, of which 215 from cattle and 85 from buffaloes were examined by Giemsa staining technique. Out of 300 blood samples examined, 130 (43.3 %) were found positive for Haemoprotozoan infections. Out of 215 cattle blood samples examined, 62 (28.8 %) were positive for Theileria annulata, 27 (12.5 %) were harbored Babesia bigemina, 15 (6.9 %) were found positive for Trypanosoma evansi and 06 (2.7 %) samples showed Anaplasma marginale. Among 85 buffalo samples examined, 11 (12.9 %) were showed Theileria spp, 04 (4.7 %) found positive for B. bigemina, 03 (3.5 %) were found positive for T. evansi and 02 (2.3 %) were positive for A. marginale. Among haemoprotozoan parasites, the highest prevalence was observed with T. annulata followed by B. bigemina and T. evansi infection. The lowest prevalence was observed with A. marginale infection. PMID:27605804

  16. Genetic Diversity of Tick-Borne Rickettsial Pathogens; Insights Gained from Distant Strains

    Directory of Open Access Journals (Sweden)

    Sebastián Aguilar Pierlé

    2014-01-01

    Full Text Available The ability to capture genetic variation with unprecedented resolution improves our understanding of bacterial populations and their ability to cause disease. The goal of the pathogenomics era is to define genetic diversity that results in disease. Despite the economic losses caused by vector-borne bacteria in the Order Rickettsiales, little is known about the genetic variants responsible for observed phenotypes. The tick-transmitted rickettsial pathogen Anaplasma marginale infects cattle in tropical and subtropical regions worldwide, including Australia. Genomic analysis of North American A. marginale strains reveals a closed core genome defined by high levels of Single Nucleotide Polymorphisms (SNPs. Here we report the first genome sequences and comparative analysis for Australian strains that differ in virulence and transmissibility. A list of genetic differences that segregate with phenotype was evaluated for the ability to distinguish the attenuated strain from virulent field strains. Phylogenetic analyses of the Australian strains revealed a marked evolutionary distance from all previously sequenced strains. SNP analysis showed a strikingly reduced genetic diversity between these strains, with the smallest number of SNPs detected between any two A. marginale strains. The low diversity between these phenotypically distinct bacteria presents a unique opportunity to identify the genetic determinants of virulence and transmission.

  17. Automatic handwriting identification on medieval documents

    NARCIS (Netherlands)

    Bulacu, M.L.; Schomaker, L.R.B.

    2007-01-01

    In this paper, we evaluate the performance of text-independent writer identification methods on a handwriting dataset containing medieval English documents. Applicable identification rates are achieved by combining textural features (joint directional probability distributions) with allographic feat

  18. A New Multimodal Biometric for Personal Identification

    OpenAIRE

    Tsai, Pohsiang; Tran, Tich Phuoc; Cao, Longbing

    2010-01-01

    This chapter assessed the possibility of using facial behaviour as another individual trait for personal identification and identification improvement. Facial expression variations were previously thought of as noise that would degrade the classification performance, so

  19. System parameter identification information criteria and algorithms

    CERN Document Server

    Chen, Badong; Hu, Jinchun; Principe, Jose C

    2013-01-01

    Recently, criterion functions based on information theoretic measures (entropy, mutual information, information divergence) have attracted attention and become an emerging area of study in signal processing and system identification domain. This book presents a systematic framework for system identification and information processing, investigating system identification from an information theory point of view. The book is divided into six chapters, which cover the information needed to understand the theory and application of system parameter identification. The authors' research pr

  20. Conditional Moment Models under Weak Identification

    OpenAIRE

    Antoine, Bertille; Lavergne, Pascal

    2011-01-01

    We consider models defined by a set of conditional moment restrictions where weak identification may arise. Weak identification is directly defined through the conditional moments that are allowed to flatten as the sample size increases. We propose a minimum distance estimator of the structural parameters that is robust to potential weak identification and that uses neither instrumental variables nor smoothing. Hence, its properties only depend upon identification weakness, and not on the int...

  1. Weed Identification Field Training Demonstrations.

    Science.gov (United States)

    Murdock, Edward C.; And Others

    1986-01-01

    Reviews efforts undertaken in weed identification field training sessions for agriprofessionals in South Carolina. Data over a four year period (1980-1983) revealed that participants showed significant improvement in their ability to identify weeds. Reaffirms the value of the field demonstration technique. (ML)

  2. Bovine anaplasmosis with emphasis on immune responses and protection

    International Nuclear Information System (INIS)

    Anaplasmosis is an infectious and transmissible disease manifested by progressive anaemia and the appearance of other characteristic disease symptoms. It is a world-wide tick-borne disease of cattle and some wild ruminants caused by the rickettsia Anaplasma marginale. By drawing on information obtained from studies of plasmodial cell cultures, a method has recently been developed for short-term in vitro cultivation of A. marginale. An attenuated Anaplasma organism capable of growth in both ovine and bovine erythrocytes was used to demonstrate that the in vitro system provided the necessary requirements for active transfer of the organism from cell to cell. Organismal antigens are found in the erythrocytes of infected animals, whereas soluble antigens are derived from their erythrocytes and serum. Serums from convalescing animals interact with these antigens in agglutination, complement fixation, fluorescent antibody and precipitation tests. Passive transfer of sera from immune to susceptible cattle, however, does not seem to confer protection against the infection and development of the disease. Studies that employed various tests for measuring cell-mediated immune (CMI) responses (leukocyte migration inhibition, blast transformation and cytotoxicity), in association with information collected simultaneously on antibody activity, have shown that both humoral and cellular immune responses are needed for the development of protective immunity in anaplasmosis. It was further shown that an active replication of Anaplasma is essential for induction of these two types of immune responses. Consequently, live virulent and attenuated immunogens fulfil requirements for induction of protective immunity. With the virulent agent, however, development of protective immunity is preceded by induction of auto-immune responses apparently associated with pathogenesis of anaemia in anaplasmosis. Inactivated immunogens derived from blood of infected cattle and used in combination with

  3. 7 CFR 29.133 - Identification number.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Identification number. 29.133 Section 29.133... REGULATIONS TOBACCO INSPECTION Regulations Miscellaneous § 29.133 Identification number. The Director may require the use of official identification numbers in connection with tobacco certificated or...

  4. 40 CFR 264.11 - Identification number.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Identification number. 264.11 Section... Facility Standards § 264.11 Identification number. Every facility owner or operator must apply to EPA for an EPA identification number in accordance with the EPA notification procedures (45 FR 12746)....

  5. 40 CFR 265.11 - Identification number.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false Identification number. 265.11 Section... FACILITIES General Facility Standards § 265.11 Identification number. Every facility owner or operator must apply to EPA for an EPA identification number in accordance with the EPA notification procedures (45...

  6. 46 CFR 10.207 - Identification number.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Identification number. 10.207 Section 10.207 Shipping... CREDENTIAL General Requirements for All Merchant Mariner Credentials § 10.207 Identification number. For recordkeeping purposes only, a mariner's official MMC identification number is the individual's social...

  7. 14 CFR 47.15 - Identification number.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Identification number. 47.15 Section 47.15... REGISTRATION General § 47.15 Identification number. (a) Number required. An applicant for Aircraft Registration must place a U.S. identification number (registration mark) on his Aircraft Registration...

  8. 7 CFR 75.48 - Identification number.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Identification number. 75.48 Section 75.48 Agriculture... number. The Director may require the use of official identification numbers in connection with seed certificated or sampled under the Act. When identification numbers are required, they shall be specified by...

  9. Identification of Dynamic Stochastic General Equilibrium Models

    OpenAIRE

    Morris, Stephen David

    2014-01-01

    The dissertation "Identification of Dynamic Stochastic General Equilibrium Models" by Stephen David Morris is divided into three chapters. The first chapter considers the statistical implications of common identifying restrictions for DSGE models. The second chapter considers the implications of identification failure for Bayesian estimators. The third chapter considers how identification of nonlinear solutions compares with that of linear solutions

  10. Comparative learning of pitch and loudness identification.

    Science.gov (United States)

    Houtsma, A J; Durlach, N I; Horowitz, D M

    1987-01-01

    This study investigated possible similarities between the ability to identify pitches and the ability to identify loudnesses. Systematic training of musically naive subjects indicated that frequency identification performance improves at about the same rate as intensity identification performance. Examination of frequency and intensity identification behavior of musically trained subjects showed that their ability to code pitch information efficiently does not generalize to an ability to encode loudness information more efficiently than untrained subjects. Intensity identification training curves of musically trained and untrained subjects are similar, but final performance levels are below frequency identification performance levels exhibited by musically trained subjects, especially those with absolute pitch. PMID:3819170

  11. identification with model reduction issues

    Directory of Open Access Journals (Sweden)

    A. Bilbao-Guillerna

    2005-01-01

    with the multiestimation scheme instead of a high-order one. Depending on the frequency spectrum characteristics of the input and on the estimates evolution, the multiestimation scheme selects on-line the most appropriate model and its related estimation scheme in order to improve the identification and control performances. Robust closed-loop stability is proved even in the presence of unmodeled dynamics of sufficiently small sizes as it has been confirmed by simulation results. The scheme chooses in real time the estimator/controller associated with a particular reduced model possessing the best performance according to an identification performance index by implementing a switching rule between estimators. The switching rule is subject to a minimum residence time at each identifier/adaptive controller parameterization for closed-loop stabilization purposes. A conceptually simple higher-level supervisor, based on heuristic updating rules which estimate on-line the weights of the switching rule between estimation schemes, is discussed.

  12. A bimodal biometric identification system

    Science.gov (United States)

    Laghari, Mohammad S.; Khuwaja, Gulzar A.

    2013-03-01

    Biometrics consists of methods for uniquely recognizing humans based upon one or more intrinsic physical or behavioral traits. Physicals are related to the shape of the body. Behavioral are related to the behavior of a person. However, biometric authentication systems suffer from imprecision and difficulty in person recognition due to a number of reasons and no single biometrics is expected to effectively satisfy the requirements of all verification and/or identification applications. Bimodal biometric systems are expected to be more reliable due to the presence of two pieces of evidence and also be able to meet the severe performance requirements imposed by various applications. This paper presents a neural network based bimodal biometric identification system by using human face and handwritten signature features.

  13. Body fluid identification in forensics

    Directory of Open Access Journals (Sweden)

    Ja Hyun An1, Kyoung-Jin Shin1,2, Woo Ick Yang1 & Hwan Young Lee1,2,*

    2012-10-01

    Full Text Available At a crime scene can give important insights into crime scenereconstruction by supporting a link between sample donorsand actual criminal acts. For more than a century, numeroustypes of body fluid identification methods have beendeveloped, such as chemical tests, immunological tests,protein catalytic activity tests, spectroscopic methods andmicroscopy. However, these conventional body fluididentification methods are mostly presumptive, and are carriedout for only one body fluid at a time. Therefore, the use of amolecular genetics-based approach using RNA profiling orDNA methylation detection has been recently proposed tosupplant conventional body fluid identification methods.Several RNA markers and tDMRs (tissue-specific differentiallymethylated regions which are specific to forensically relevantbody fluids have been identified, and their specificities andsensitivities have been tested using various samples. In thisreview, we provide an overview of the present knowledge andthe most recent developments in forensic body fluididentification and discuss its possible practical application toforensic casework.

  14. Seroprevalence and risk factors for cattle anaplasmosis, babesiosis, and trypanosomiasis in a Brazilian semiarid region Soroprevalência e fatores de risco para anaplasmose, babesiose e tripanosomíase bovina em uma região semiárida do Brasil

    Directory of Open Access Journals (Sweden)

    Valéria Medeiros de Mendonça Costa

    Full Text Available The seroprevalence of Anaplasma marginale, Babesia bigemina, Babesia bovis and Trypanosoma vivax and the risk factors for these infections were investigated in 509 cows on 37 farms in the semiarid region of Paraíba, northeastern Brazil. Cow serum samples were tested by means of immunofluorescence assay (IFA against each specific antigen. The mean seroprevalence values per farm were 15.0% (range: 0-75% for A. marginale, 9.5% (range: 0-40% for B. bigemina and 26.9% (range: 0-73.7% for B. bovis. All cows tested negative for T. vivax. Higher prevalence for A. marginale was significantly associated with less frequent acaricide spraying per year and with higher use of injectable antihelminthics. Presence of cows positive for B. bigemina was significantly associated with acaricide use and with presence of horse flies on the farm. Both occurrence and higher prevalence of B. bovis were significantly associated with recent observations of ticks on cattle. Overall, the present results indicate that the region investigated is an enzootically unstable area for A. marginale, B. bigemina and B. bovis, since most animals were seronegative to at least one agent.A soroprevalência de Anaplasma marginale, Babesia bigemina, Babesia bovis e Trypanosoma vivax, assim como os fatores de risco para estas infecções, foram investigadas em 37 fazendas (total de 509 vacas da região semiárida da Paraíba, nordeste do Brasil. A presença de anticorpos nos soros dos animais foi detectada pela técnica de imunofluorescência indireta, utilizando antígenos específicos. Os valores médios de soroprevalência por fazenda foram 15,0% (0-75% para A. marginale, 9,5% (0-40% para B. bigemina, e 26,9% (0-73,7% para B. bovis. Todas as vacas foram soronegativas para T. vivax. As maiores prevalências de A. marginale foram significativamente associadas com menor uso de carrapaticidas por ano e com uso mais frequente de antihelmínticos injetáveis. A soroprevalência de B. bigemina

  15. MODEL IDENTIFICATION AND COMPUTER ALGEBRA

    OpenAIRE

    Bollen, Kenneth A.; Bauldry, Shawn

    2010-01-01

    Multiequation models that contain observed or latent variables are common in the social sciences. To determine whether unique parameter values exist for such models, one needs to assess model identification. In practice analysts rely on empirical checks that evaluate the singularity of the information matrix evaluated at sample estimates of parameters. The discrepancy between estimates and population values, the limitations of numerical assessments of ranks, and the difference between local a...

  16. Body fluid identification in forensics

    OpenAIRE

    Ja Hyun An1, Kyoung-Jin Shin1,2, Woo Ick Yang1 & Hwan Young Lee1,2,*

    2012-01-01

    At a crime scene can give important insights into crime scenereconstruction by supporting a link between sample donorsand actual criminal acts. For more than a century, numeroustypes of body fluid identification methods have beendeveloped, such as chemical tests, immunological tests,protein catalytic activity tests, spectroscopic methods andmicroscopy. However, these conventional body fluididentification methods are mostly presumptive, and are carriedout for only one body fluid at a time. The...

  17. Micrometastases identification in malignant tumors

    Directory of Open Access Journals (Sweden)

    S. A. Kuznetsov

    2016-01-01

    Full Text Available The article reviewed literature data relating to the methods used for detection of single tumor cells in bone marrow, lymph nodes, and peripheral blood. Sensitivity of modern detection methods is analyzed. Despite advances in the development of molecular biology and cytology, until now there is no universal approach to the micrometastases identification, and existing methods optimization are recommended.

  18. LWE-based Identification Schemes

    CERN Document Server

    Silva, Rosemberg; Dahab, Ricardo

    2011-01-01

    Some hard problems from lattices, like LWE (Learning with Errors), are particularly suitable for application in Cryptography due to the possibility of using worst-case to average-case reductions as evidence of strong security properties. In this work, we show two LWE-based constructions of zero-knowledge identification schemes and discuss their performance and security. We also highlight the design choices that make our solution of both theoretical and practical interest.

  19. Identification of Sustainable Architecture Dimensions

    OpenAIRE

    Leila Etminan; Siavash Rashidi Sharif Abad; Mansour Nikpor

    2014-01-01

    The main purpose in this research is identification of sustainable architecture dimensions. Nowadays, one of the most necessary complicated and main specifications of architecture with which architects are face is the issue of sustainability in various types of its interpretations. The issue of sustainability is interpretable and general according to many aspects. Therefore, it is necessary to identify this concept (architecture and its related categories). At the beginning of this discussion...

  20. Anatomie et identification des bois

    OpenAIRE

    Jourez, Benoît

    2010-01-01

    Anatomie des bois Structure anatomique des résineux et des feuillus Structure de la membrane cellulaire structure submicroscopique Anatomie du bois des essences feuillues tropicales Caractères anatomiques servant à l'identification des essences Reconnaissance microscopique du bois des essences résineuses et feuillues Duramen et duraminisation Formations anormales ( bois de compression et bois de tension) Chimie du bois Composition générale Cellulose, hé...

  1. Visual identification by signature tracking

    OpenAIRE

    Munich, Mario E.; Perona, Pietro

    2003-01-01

    We propose a new camera-based biometric: visual signature identification. We discuss the importance of the parameterization of the signatures in order to achieve good classification results, independently of variations in the position of the camera with respect to the writing surface. We show that affine arc-length parameterization performs better than conventional time and Euclidean arc-length ones. We find that the system verification performance is better than 4 percent error on skilled fo...

  2. Identification Techniques in Composite Laminates

    DEFF Research Database (Denmark)

    Pedersen, Pauli

    Combined experimental-numerical methods are presented with the goal of obtaining material stiffness for composite materials. The identification is based on eigenfrequencies for a free rectangular plate, because excellent agreement between measured and calculated eigenfrequencies can be obtained...... these different parts of the approach are commented and the general conclusion is that the method has several significant advantages compared to traditional determination of material moduli. An overview of the state of the art is intended....

  3. The Identification of Postpartum Depression

    OpenAIRE

    Sit, Dorothy K.; WISNER, KATHERINE L.

    2009-01-01

    Postpartum depression (PPD) is the most common medical complication of childbearing. Universal screening maximizes the likelihood of prompt identification of PPD. Obstetrician-gynecologists routinely evaluate postpartum women for a general health examination and review of family planning options at approximately 6 weeks after birth; therefore, they are well-positioned to identify PPD. In this paper, we review the diagnostic criteria for postpartum depressive disorders and clinical risk factor...

  4. Expert software for accident identification

    International Nuclear Information System (INIS)

    Each type of an accident in a Nuclear Power Plant (NPP) causes immediately after the start of the accident variations of physical parameters that are typical for that type of the accident thus enabling its identification. Examples of these parameter are: decrease of reactor coolant system pressure, increase of radiation level in the containment, increase of pressure in the containment. An expert software enabling a fast preliminary identification of the type of the accident in Krsko NPP has been developed. As input data selected typical parameters from Emergency Response Data System (ERDS) of the Krsko NPP are used. Based on these parameters the expert software identifies the type of the accident and also provides the user with appropriate references (past analyses and other documentation of such an accident). The expert software is to be used as a support tool by an expert team that forms in case of an emergency at Slovenian Nuclear Safety Administration (SNSA) with the task to determine the cause of the accident, its most probable scenario and the source term. The expert software should provide initial identification of the event, while the final one is still to be made after appropriate assessment of the event by the expert group considering possibility of non-typical events, multiple causes, initial conditions, influences of operators' actions etc. The expert software can be also used as an educational/training tool and even as a simple database of available accident analyses. (author)

  5. Library correlation nuclide identification algorithm

    International Nuclear Information System (INIS)

    A novel nuclide identification algorithm, Library Correlation Nuclide Identification (LibCorNID), is proposed. In addition to the spectrum, LibCorNID requires the standard energy, peak shape and peak efficiency calibrations. Input parameters include tolerances for some expected variations in the calibrations, a minimum relative nuclide peak area threshold, and a correlation threshold. Initially, the measured peak spectrum is obtained as the residual after baseline estimation via peak erosion, removing the continuum. Library nuclides are filtered by examining the possible nuclide peak areas in terms of the measured peak spectrum and applying the specified relative area threshold. Remaining candidates are used to create a set of theoretical peak spectra based on the calibrations and library entries. These candidate spectra are then simultaneously fit to the measured peak spectrum while also optimizing the calibrations within the bounds of the specified tolerances. Each candidate with optimized area still exceeding the area threshold undergoes a correlation test. The normalized Pearson's correlation value is calculated as a comparison of the optimized nuclide peak spectrum to the measured peak spectrum with the other optimized peak spectra subtracted. Those candidates with correlation values that exceed the specified threshold are identified and their optimized activities are output. An evaluation of LibCorNID was conducted to verify identification performance in terms of detection probability and false alarm rate. LibCorNID has been shown to perform well compared to standard peak-based analyses

  6. BIOMETRIC IDENTIFICATION OF THE PERSON

    Directory of Open Access Journals (Sweden)

    Klipko E. P.

    2015-05-01

    Full Text Available Test of cardiorespiratory synchronism is offered as a way of biometric identification of the person. The way represents registration, transformation and fixing on electronic carriers of parameters physiological is intimate - respiratory synchronism, such as the minimal and maximal borders of a range of synchronization in synchronous cardiorespiratory cycles in one minute, width of a range of synchronization in synchronous cardiorespiratory cycles in minute, duration of development of cardiorespiratory synchronism on the minimal border of a range from the beginning of test before steady formation of cardiorespiratory synchronism on the minimal border and duration of development of cardiorespiratory synchronism from the beginning of test before steady formation of cardiorespiratory synchronism on the maximal border of synchronization in intimate cycles at objects of identification as the schedules displaying electrophysiological characteristics of work of heart and respiratory activity of the person at the moment of reception of cardiorespiratory synchronism. Further, the received schedules compare to available schedules and judge that, they belong to the same person whether or not. Advantages of this way are high reliability of identification, simplicity and speed of performance, exception of trainings in advance

  7. Identification based on facial parts

    Directory of Open Access Journals (Sweden)

    Stevanov Zorica

    2007-01-01

    Full Text Available Two opposing views dominate face identification literature, one suggesting that the face is processed as a whole and another suggesting analysis based on parts. Our research tried to establish which of these two is the dominant strategy and our results fell in the direction of analysis based on parts. The faces were covered with a mask and the participants were uncovering different parts, one at the time, in an attempt to identify a person. Already at the level of a single facial feature, such as mouth or eye and top of the nose, some observers were capable to establish the identity of a familiar face. Identification is exceptionally successful when a small assembly of facial parts is visible, such as eye, eyebrow and the top of the nose. Some facial parts are not very informative on their own but do enhance recognition when given as a part of such an assembly. Novel finding here is importance of the top of the nose for the face identification. Additionally observers have a preference toward the left side of the face. Typically subjects view the elements in the following order: left eye, left eyebrow, right eye, lips, region between the eyes, right eyebrow, region between the eyebrows, left check, right cheek. When observers are not in a position to see eyes, eyebrows or top of the nose, they go for lips first and then region between the eyebrows, region between the eyes, left check, right cheek and finally chin.

  8. Comparative genomics and transcriptomics of trait-gene association

    Directory of Open Access Journals (Sweden)

    Pierlé Sebastián

    2012-11-01

    Full Text Available Abstract Background The Order Rickettsiales includes important tick-borne pathogens, from Rickettsia rickettsii, which causes Rocky Mountain spotted fever, to Anaplasma marginale, the most prevalent vector-borne pathogen of cattle. Although most pathogens in this Order are transmitted by arthropod vectors, little is known about the microbial determinants of transmission. A. marginale provides unique tools for studying the determinants of transmission, with multiple strain sequences available that display distinct and reproducible transmission phenotypes. The closed core A. marginale genome suggests that any phenotypic differences are due to single nucleotide polymorphisms (SNPs. We combined DNA/RNA comparative genomic approaches using strains with different tick transmission phenotypes and identified genes that segregate with transmissibility. Results Comparison of seven strains with different transmission phenotypes generated a list of SNPs affecting 18 genes and nine promoters. Transcriptional analysis found two candidate genes downstream from promoter SNPs that were differentially transcribed. To corroborate the comparative genomics approach we used three RNA-seq platforms to analyze the transcriptomes from two A. marginale strains with different transmission phenotypes. RNA-seq analysis confirmed the comparative genomics data and found 10 additional genes whose transcription between strains with distinct transmission efficiencies was significantly different. Six regions of the genome that contained no annotation were found to be transcriptionally active, and two of these newly identified transcripts were differentially transcribed. Conclusions This approach identified 30 genes and two novel transcripts potentially involved in tick transmission. We describe the transcriptome of an obligate intracellular bacterium in depth, while employing massive parallel sequencing to dissect an important trait in bacterial pathogenesis.

  9. Babesiosis and anaplasmosis in dairy cattle in Northeastern Brazil

    Directory of Open Access Journals (Sweden)

    Francisco de A.L. Souza

    2013-09-01

    Full Text Available The goal of this study was to characterize the epidemiological situation and the factors involved in the prevalence of babesiosis and anaplasmosis in cattle in the dairy basin of Parnaíba, Piauí, Brazil. The study was conducted in 22 farms, and collected blood samples from 202 cattle to study serological, molecular and determination of the packed cell volume (PCV. On the farms were applied surveys involving epidemiological aspects. Seroprevalence rates were: Babesia bigemina 52.5%, B. bovis 68.8%, and Anaplasma marginale 89.1%. Of the samples analyzed, 73.3% were reactive for Babesia spp. and A. marginale, showing co-infection. In PCR, B. bigemina and B. bovis were positive in 52.0% and 33.2% respectively, and A. marginale in 76.2%. Of these, 51.5% amplified DNA of Babesia spp. and A. marginale. The semi-intensive management predominated in 68.0% of the farms studied. The clinical history of babesiosis and anaplasmosis, was reported from 73% of the farms. There was no significant difference (p>0.05 between age groups and for the PCV of positive compared with negative animals. The study indicates that in this region is enzootic instability for babesiosis and enzootic stability for anaplasmosis, reinforcing the fact that in Brazil there are areas of enzootic instability, even in tropical regions of the country. The PCR technique was a valuable tool for the diagnosis of these diseases and may be used to characterize a geographic region.

  10. Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa

    Science.gov (United States)

    Beckley, Carl S.; Shaban, Salisu; Palmer, Guy H.; Hudak, Andrew T.; Noh, Susan M.; Futse, James E.

    2016-01-01

    Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc) were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B. bigemina prevalence

  11. Disaggregating Tropical Disease Prevalence by Climatic and Vegetative Zones within Tropical West Africa.

    Directory of Open Access Journals (Sweden)

    Carl S Beckley

    Full Text Available Tropical infectious disease prevalence is dependent on many socio-cultural determinants. However, rainfall and temperature frequently underlie overall prevalence, particularly for vector-borne diseases. As a result these diseases have increased prevalence in tropical as compared to temperate regions. Specific to tropical Africa, the tendency to incorrectly infer that tropical diseases are uniformly prevalent has been partially overcome with solid epidemiologic data. This finer resolution data is important in multiple contexts, including understanding risk, predictive value in disease diagnosis, and population immunity. We hypothesized that within the context of a tropical climate, vector-borne pathogen prevalence would significantly differ according to zonal differences in rainfall, temperature, relative humidity and vegetation condition. We then determined if these environmental data were predictive of pathogen prevalence. First we determined the prevalence of three major pathogens of cattle, Anaplasma marginale, Babesia bigemina and Theileria spp, in the three vegetation zones where cattle are predominantly raised in Ghana: Guinea savannah, semi-deciduous forest, and coastal savannah. The prevalence of A. marginale was 63%, 26% for Theileria spp and 2% for B. bigemina. A. marginale and Theileria spp. were significantly more prevalent in the coastal savannah as compared to either the Guinea savanna or the semi-deciduous forest, supporting acceptance of the first hypothesis. To test the predictive power of environmental variables, the data over a three year period were considered in best subsets multiple linear regression models predicting prevalence of each pathogen. Corrected Akaike Information Criteria (AICc were assigned to the alternative models to compare their utility. Competitive models for each response were averaged using AICc weights. Rainfall was most predictive of pathogen prevalence, and EVI also contributed to A. marginale and B

  12. Printed Identification Key or Web-Based Identification Guide: An Effective Tool for Species Identification?

    Directory of Open Access Journals (Sweden)

    Thomas Edison E. dela Cruz

    2012-09-01

    Full Text Available Species identification is often done with the aid of traditional dichotomous keys. This printed material is based on one’s decision between two alternatives, which is followed by another pair of alternatives until the final species name is reached. With the advent of internet technology, the use of an online database offers an updatable and accumulative approach to species identification. It can also be accessed anytime, and this is very useful for fast-changing groups of organisms. In this paper, we report the preference of sophomore Bachelor of Science (B.Sc. in Microbiology students to two identification guides as a tool in taxonomy. We wish to test our hypothesis that today’s students will prefer to use web-based ID guides over printed dichotomous keys. We also describe how these printed dichotomous key and web-based ID guides were used by the students as one of their laboratory activities in the course Biology of Algae and Fungi.  

  13. Identification and Modelling of Linear Dynamic Systems

    Directory of Open Access Journals (Sweden)

    Stanislav Kocur

    2006-01-01

    Full Text Available System identification and modelling are very important parts of system control theory. System control is only as good as good is created model of system. So this article deals with identification and modelling problems. There are simple classification and evolution of identification methods, and then the modelling problem is described. Rest of paper is devoted to two most known and used models of linear dynamic systems.

  14. Pride, Shame, and Group Identification.

    Science.gov (United States)

    Salice, Alessandro; Montes Sánchez, Alba

    2016-01-01

    Self-conscious emotions such as shame and pride are emotions that typically focus on the self of the person who feels them. In other words, the intentional object of these emotions is assumed to be the subject that experiences them. Many reasons speak in its favor and yet this account seems to leave a question open: how to cash out those cases in which one genuinely feels ashamed or proud of what someone else does? This paper contends that such cases do not necessarily challenge the idea that shame and pride are about the emoting subject. Rather, we claim that some of the most paradigmatic scenarios of shame and pride induced by others can be accommodated by taking seriously the consideration that, in such cases, the subject "group-identifies" with the other. This is the idea that, in feeling these forms of shame or pride, the subject is conceiving of herself as a member of the same group as the subject acting shamefully or in an admirable way. In other words, these peculiar emotive responses are elicited in the subject insofar as, and to the extent that, she is (or sees herself as being) a member of a group - the group to which those who act shamefully or admirably also belong. By looking into the way in which the notion of group identification can allow for an account of hetero-induced shame and pride, this paper attempts to achieve a sort of mutual enlightenment that brings to light not only an important and generally neglected form of self-conscious emotions, but also relevant features of group identification. In particular, it generates evidence for the idea that group identification is a psychological process that the subject does not have to carry out intentionally in the sense that it is not necessarily triggered by the subject's conative states like desires or intentions. PMID:27199797

  15. Model Updating Nonlinear System Identification Toolbox Project

    Data.gov (United States)

    National Aeronautics and Space Administration — ZONA Technology proposes to develop an enhanced model updating nonlinear system identification (MUNSID) methodology by adopting the flight data with...

  16. Unique Physician Identification Number (UPIN) Directory

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Unique Physician Identification Number (UPIN) Directory contains selected information on physicians, doctors of Osteopathy, limited licensed practitioners and...

  17. Advanced 3D Object Identification System Project

    Data.gov (United States)

    National Aeronautics and Space Administration — During the Phase I effort, OPTRA developed object detection, tracking, and identification algorithms and successfully tested these algorithms on computer-generated...

  18. Trends and progress in system identification

    CERN Document Server

    Eykhoff, Pieter

    1981-01-01

    Trends and Progress in System Identification is a three-part book that focuses on model considerations, identification methods, and experimental conditions involved in system identification. Organized into 10 chapters, this book begins with a discussion of model method in system identification, citing four examples differing on the nature of the models involved, the nature of the fields, and their goals. Subsequent chapters describe the most important aspects of model theory; the """"classical"""" methods and time series estimation; application of least squares and related techniques for the e

  19. Model Updating Nonlinear System Identification Toolbox Project

    Data.gov (United States)

    National Aeronautics and Space Administration — ZONA Technology (ZONA) proposes to develop an enhanced model updating nonlinear system identification (MUNSID) methodology that utilizes flight data with...

  20. Social Group Identification and Clustering

    Czech Academy of Sciences Publication Activity Database

    Húsek, Dušan; Řezanková, H.; Dvorský, J.

    Los Alamitos: IEEE Computer Society, 2009 - (Abraham, A.; Snášel, V.; Wegrzyn-Wolska, K.), s. 73-79 ISBN 978-0-7695-3740-5. [CASoN 2009. International Conference on Computational Aspects of Social Networks. Fontainbleu (FR), 24.07.2009-27.07.2009] R&D Projects: GA ČR GA205/09/1079 Institutional research plan: CEZ:AV0Z10300504 Keywords : social group identification * cluster analysis * Boolean factor analysis * cluster number determination Subject RIV: BB - Applied Statistics, Operational Research

  1. Author Gender Identification from Text

    OpenAIRE

    Rezaei, Atoosa Mohammad

    2014-01-01

    ABSTRACT: The identification of an author's gender from a text has become a popular research area within the scope of text categorization. The number of users of social network applications based on text, such as Twitter, Facebook and text messaging services, has grown rapidly over the past few decades. As a result, text has become one of the most important and prevalent media types on the Internet. This thesis aims to determine the gender of an author from an arbitrary piece of text such as,...

  2. Identification numbers for chemical structures

    International Nuclear Information System (INIS)

    Several identification (ID) numbers for chemical structures (connectivity ID number, prime ID number, weighted ID number) are analyzed and tested until a counterexample (a pair of structures with the same ID number) is found. The analysis is carried out for acyclic structures with up to 20 atoms, trees with up to 20 points, benzenoid graphs and polyhexes with up to 10 hexagons, and all connected graphs with up to 6 points. Although all the (chemical) ID numbers studied are highly selective for many families of (molecular) graphs, none of them are unique; in all three cases the counterexamples are found. However, the greatest discriminative power is shown by the weighted ID number

  3. Antipatterns identification, refactoring, and management

    CERN Document Server

    Neill, Colin J

    2005-01-01

    AntiPatterns: Identification, Refactoring, and Management catalogs 48 bad management practices and environments common to software development, IT, and other organizations. The authors cover antipatterns of management, along with environmental/cultural antipatterns and personality antipatterns/phenotypes. Through the classification of these harmful practices, you will be able to correctly identify problems in your own work environment, and take action to correct them. The authors apply their extensive work and consultative experience, as well as the experience of the many professionals that t

  4. The identification of critical groups

    International Nuclear Information System (INIS)

    The criteria for critical group identification are summarized and the extent to which they are satisfied by possible numerical methods are examined, drawing on UK experience in dose estimation within a system for setting controls on liquid radioactive waste discharges from major nuclear installations. The nature of the exposure pathway is an important factor in identifying an appropriate method. It is held that there is a greater uncertainty in estimating individual exposure from internal exposure than that from external exposure due to the greater relevance of metabolic variations. Accordingly different methods are proposed for numerical treatment of data associated with internal exposure pathways compared with external exposure pathways. (H.K.)

  5. Towards an accurate bioimpedance identification

    Science.gov (United States)

    Sanchez, B.; Louarroudi, E.; Bragos, R.; Pintelon, R.

    2013-04-01

    This paper describes the local polynomial method (LPM) for estimating the time-invariant bioimpedance frequency response function (FRF) considering both the output-error (OE) and the errors-in-variables (EIV) identification framework and compare it with the traditional cross— and autocorrelation spectral analysis techniques. The bioimpedance FRF is measured with the multisine electrical impedance spectroscopy (EIS) technique. To show the overwhelming accuracy of the LPM approach, both the LPM and the classical cross— and autocorrelation spectral analysis technique are evaluated through the same experimental data coming from a nonsteady-state measurement of time-varying in vivo myocardial tissue. The estimated error sources at the measurement frequencies due to noise, σnZ, and the stochastic nonlinear distortions, σZNL, have been converted to Ω and plotted over the bioimpedance spectrum for each framework. Ultimately, the impedance spectra have been fitted to a Cole impedance model using both an unweighted and a weighted complex nonlinear least square (CNLS) algorithm. A table is provided with the relative standard errors on the estimated parameters to reveal the importance of which system identification frameworks should be used.

  6. Towards an accurate bioimpedance identification

    International Nuclear Information System (INIS)

    This paper describes the local polynomial method (LPM) for estimating the time-invariant bioimpedance frequency response function (FRF) considering both the output-error (OE) and the errors-in-variables (EIV) identification framework and compare it with the traditional cross— and autocorrelation spectral analysis techniques. The bioimpedance FRF is measured with the multisine electrical impedance spectroscopy (EIS) technique. To show the overwhelming accuracy of the LPM approach, both the LPM and the classical cross— and autocorrelation spectral analysis technique are evaluated through the same experimental data coming from a nonsteady-state measurement of time-varying in vivo myocardial tissue. The estimated error sources at the measurement frequencies due to noise, σnZ, and the stochastic nonlinear distortions, σZNL, have been converted to Ω and plotted over the bioimpedance spectrum for each framework. Ultimately, the impedance spectra have been fitted to a Cole impedance model using both an unweighted and a weighted complex nonlinear least square (CNLS) algorithm. A table is provided with the relative standard errors on the estimated parameters to reveal the importance of which system identification frameworks should be used.

  7. Fieldable Nuclear Material Identification System

    International Nuclear Information System (INIS)

    The Fieldable Nuclear Material Identification System (FNMIS), funded by the NA-241 Office of Dismantlement and Transparency, provides information to determine the material attributes and identity of heavily shielded nuclear objects. This information will provide future treaty participants with verifiable information required by the treaty regime. The neutron interrogation technology uses a combination of information from induced fission neutron radiation and transmitted neutron imaging information to provide high confidence that the shielded item is consistent with the host's declaration. The combination of material identification information and the shape and configuration of the item are very difficult to spoof. When used at various points in the warhead dismantlement sequence, the information complimented by tags and seals can be used to track subassembly and piece part information as the disassembly occurs. The neutron transmission imaging has been developed during the last seven years and the signature analysis over the last several decades. The FNMIS is the culmination of the effort to put the technology in a usable configuration for potential treaty verification purposes.

  8. Identification methods for irradiated wheat

    International Nuclear Information System (INIS)

    The effect of irradiation on wheat seeds was examined using various kinds of analytical methods for the identification of irradiated seeds. In germination test, the growth of sprouts was markedly inhibited at 500Gy, which was not affected by storage. The decrease in germination percentage was detected at 3300Gy. The results of enzymatic activity change in the germ measured by Vita-Scope germinator showed that the seeds irradiated at 10kGy could be identified. The content of amino acids in ungerminated and germinated seeds were analyzed. Irradiation at 10kGy caused the decrease of lysine content but the change was small which need very careful operation to detect it. The chemiluminescence intensity increased with radiation dose and decreased during storage. The wheat irradiated at 10kGy could be identified even after 3 months storage. In the electron spin resonance (ESR) spectrum analysis, the signal intensity with the g value f 2.0055 of skinned wheat seeds increased with radiation dose. Among these methods, germination test was the most sensitive and effective for identification of irradiated wheat. (author)

  9. Identification and Control of a Cylindrical Tank Based on System Identification Models

    Directory of Open Access Journals (Sweden)

    Mary Mol Paul

    2013-06-01

    Full Text Available Advancements in the process control industry has made difficulties in controlling processes which are highly complex in nature. System identification provides a better solution for this problem with the help of identification models. In this paper ARX,ARMAX,BJ and OE models were used for the identification of a cylindrical tank and Ziegler Nichols tuning method to develop the controller for controlling the level of the tank. The proposed method provides simple and accurate models and thereby improving the efficency of identification process. MATLAB and LABView softwares were used here for identification and controlling.

  10. CRITERIA OF PARAMETRIC IDENTIFICATION FOR CONTROLLED OBJECT WITH CHAOTIC DYNAMICS

    Directory of Open Access Journals (Sweden)

    A. Mikhaylev

    2009-01-01

    Full Text Available The matter concerning special criteria definition for nonlinear dynamic systems identification problem solving are considered. The method of identification criteria creation, suitable for chaotic dynamics systems identification is offered.

  11. 7 CFR 29.32 - Identification number.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 2 2010-01-01 2010-01-01 false Identification number. 29.32 Section 29.32 Agriculture... INSPECTION Regulations Definitions § 29.32 Identification number. A number or a combination of letters and numbers in a design or mark approved by the Director, stamped, printed, or stenciled on a lot of...

  12. Support Vector Machines for System Identification

    OpenAIRE

    Marconato, Anna; Gubian, Michele; Boni, Andrea; Petri, Dario

    2007-01-01

    In this document we propose the use of a widely known learning-from-examples paradigm, namely the Support Vector Machines for Regression (SVRs), for system identification problems. We start off with the identification of a simple linear system taken from the literature, and proceed with the non-linear case as a second step.

  13. Fundamental problems in fault detection and identification

    DEFF Research Database (Denmark)

    Saberi, A.; Stoorvogel, A. A.; Sannuti, P.;

    2000-01-01

    A number of different fundamental problems in fault detection and fault identification are formulated in this paper. The fundamental problems include exact, almost, generic and class-wise fault detection and identification. Necessary and sufficient conditions for the solvability of the fundamental...

  14. 50 CFR 665.128 - Gear identification.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Gear identification. 665.128 Section 665.128 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... § 665.128 Gear identification. (a) The vessel number must be affixed to all fish and crab traps on...

  15. 50 CFR 665.246 - Gear identification.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Gear identification. 665.246 Section 665.246 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... Gear identification. In Permit Area 1, the vessel's official number must be marked legibly on all...

  16. 50 CFR 665.228 - Gear identification.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Gear identification. 665.228 Section 665.228 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... Gear identification. (a) The vessel number must be affixed to all fish and crab traps on board...

  17. 50 CFR 665.428 - Gear identification.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 9 2010-10-01 2010-10-01 false Gear identification. 665.428 Section 665.428 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC... § 665.428 Gear identification. (a) The vessel number must be affixed to all fish and crab traps on...

  18. Maori Identification, Drinking Motivation and Mental Health

    Science.gov (United States)

    Clarke, Dave; Ebbett, Erin

    2010-01-01

    Research examining the relationships among Maori cultural identification, drinking behaviour, drinking motivation and mental health is almost non-existent. A review of literature suggests that stronger Maori identification could be associated with lower alcohol consumption on a typical occasion, less frequent drinking, drinking to enhance mood or…

  19. Site identification presentation: Basalt Waste Isolation Project

    International Nuclear Information System (INIS)

    The final step in the site identification process for the Basalt Waste Isolation Project is described. The candidate sites are identified. The site identification methodology is presented. The general objectives which must be met in selecting the final site are listed. Considerations used in the screening process are also listed. Summary tables of the guidelines used are included

  20. Projective Identification in Common Couple Dances.

    Science.gov (United States)

    Middelberg, Carol V.

    2001-01-01

    Integrates the object relations concept of projective identification and the systemic concept of marital dances to develop a more powerful model for working with more difficult and distressed couples. Suggests how object relations techniques can be used to interrupt projective identifications and resolve conflict on intrapsychic level so the…

  1. System identification for robust control design

    Energy Technology Data Exchange (ETDEWEB)

    Dohner, J.L.

    1995-04-01

    System identification for the purpose of robust control design involves estimating a nominal model of a physical system and the uncertainty bounds of that nominal model via the use of experimentally measured input/output data. Although many algorithms have been developed to identify nominal models, little effort has been directed towards identifying uncertainty bounds. Therefore, in this document, a discussion of both nominal model identification and bounded output multiplicative uncertainty identification will be presented. This document is divided into several sections. Background information relevant to system identification and control design will be presented. A derivation of eigensystem realization type algorithms will be presented. An algorithm will be developed for calculating the maximum singular value of output multiplicative uncertainty from measured data. An application will be given involving the identification of a complex system with aliased dynamics, feedback control, and exogenous noise disturbances. And, finally, a short discussion of results will be presented.

  2. The Parametric Identification Of A Stationary Process

    Directory of Open Access Journals (Sweden)

    Radu BELEA

    2003-12-01

    Full Text Available In the problems of identification it is supposed that the process has at least one measurable input size and at least one measurable output size. The identification of a process has three stages: the obtaining of a registration of process measurable sizes; the choice of a proper mathematical model for the process; the extract of the parameter values of the mathematical models from registered data. The parametric identification problem is an optimization problem, in which the best combination of values for the model parameters set is searched. In the paper is presented the parametric identification of a water flow process in a laboratory stand. The identification had the following dims: detailed understanding of how the stand works, finding a new illustrative experiment for the stand, the application of advanced techniques of automat control, and the development of a project of new stand, meant to allow a large variety of experiments.

  3. System Identification for Indoor Climate Control

    CERN Document Server

    M., A W; H., P W M; Steskens,

    2012-01-01

    The study focuses on the applicability of system identification to identify building and system dynamics for climate control design. The main problem regarding the simulation of the dynamic response of a building using building simulation software is that (1) the simulation of a large complex building is time consuming, and (2) simulation results often lack information regarding fast dynamic behaviour (in the order of seconds), since most software uses a discrete time step, usually fixed to one hour. The first objective is to study the applicability of system identification to reduce computing time for the simulation of large complex buildings. The second objective is to research the applicability of system identification to identify building dynamics based on discrete time data (one hour) for climate control design. The study illustrates that system identification is applicable for the identification of building dynamics with a frequency that is smaller as the maximum sample frequency as used for identificat...

  4. Infecção natural por hemoparasitos em bezerros submetidos à quimio-profilaxia aos 30 dias de idade Natural infection by hemoparasites in calves submitted to chemo -prophylaxis wonder 30 days of age

    Directory of Open Access Journals (Sweden)

    Rosângela A. Da Silva

    2007-09-01

    Full Text Available O complexo Tristeza Parasitária acarreta grandes prejuízos à pecuária bovina nacional. Os principais agentes etiológicos são Babesia bigemina, B. bovis e Anaplasma marginale, sendo o carrapato Boophilus microplus o principal vetor. Este trabalho relata a ocorrência de infecção natural por hemoparasitos da tristeza parasitária bovina em 36 bezerros com alta infestação natural por carrapatos e submetidos à quimioprofilaxia aos 30 dias de idade. Babesia bigemina (33,3%, B. bovis (11,1% e A. marginale (13,9% foram detectados em esfregaços sangüíneos de 16 animais (44,4% de diferentes idades. Seis bezerros apresentaram sintomas (16,7% e um morreu (2,8%. O número de casos clínicos foi decorrente de uma associação de fatores, destacando-se a alta infestação precoce por carrapatos e a baixa imunidade passiva em período em que os bezerros ainda não haviam desenvolvido imunidade ativa suficiente.The tick-borne disease (TBD brings great damages to cattle breeding. The most important etiologic agents are Babesia bigemina, B. bovis and Anaplasma marginale, being the tick Boophilus microplus the main vector. This work reports the occurrence of natural infection by hemoparasites of TBD in 36 calves with high ticks natural infestation submitted to chemoprophylaxis with 30 days year-old. The blood smears from animals of different ages were analized and were found B. bigemina (33.3%, B. bovis (11.1% and A. marginale (13.9%. Six animals had clinical symptoms (16.7% and one dead (2.8%. The number of clinical cases ocurred in consequence of an association of factors as high infestation of ticks and low passive immunity in period that calves had not developed enough active immunity.

  5. The identification of irradiated onions

    International Nuclear Information System (INIS)

    The aim of this study was to work out a suitable chemical technique for the irradiated onions identification and for the determination of the gamma radiation dose applied. As the average annual 0.30 x 10-4%, it is therefore possible to identify irradiated onions from their higher deoxysaccharide content (0.66 x 10-4%). The deoxysaccharide content (c) in the irradiated onions depends linearly on the applied dose (D) in the range of 0 to 250 Gy according to the equation: D[Gy] = 1.7 x 106 xc[%] - 50. The accuracy of this equation is ± 10%. The detected amount of deoxysaccharides was found to be proportional to the sum of the contents of glucose, saccharose and raffinose. (author)

  6. Particle identification for beauty physics

    Energy Technology Data Exchange (ETDEWEB)

    Ludlam, T.

    1987-01-01

    We look briefly at the requirements for particle identification for possible beauty experiments at the Tevatron, both in the fixed target and the collider mode. Techniques presently in use in high energy physics experiments, and under development, should make sensitive experiments feasible. However, in all cases the present state of the art must be advanced to meet the necessary requirements for segmentation andor rate capability. The most fundamentally difficult challenges appear to be the efficient tagging of soft electrons (for the collider experiment) and the need to handle interaction rates up to /approximately/ 10/sub 9/ HZ in the fixed target mode. In both cases we can find ''in principle'' demonstrations that the requirements can be met. We have considered only the most basic prooperties of detectors, however, and the real answers will come from careful studies of details. 20 refs., 10 figs.

  7. Thermal response based item identification.

    Energy Technology Data Exchange (ETDEWEB)

    Smith, M. K. (Morag K.); Hypes, P. A. (Philip A.); Bracken, D. S. (David S.)

    2001-01-01

    One of the most difficult problems in NDA of nuclear materials is identifying the chemical form of the nuclear material and the surrounding matrix. Recent work analyzing the calorimeter response of sources embedded in a variety of matrices has led to a possible solution to this problem. The wide range of thermal time constants exhibited by typical matrix materials lends itself to permitting the differentiation between materials, based on time constants extracted from the measured response. Potential applications include simple item identification, item fingerprinting as part of shipper-receiver measurements, and distinguishing between Pu metal and Pu oxide as required under certain proposed attribute measurements. The results of applying this technique to a variety of items will be presented and discussed.

  8. Thermal response based item identification

    International Nuclear Information System (INIS)

    One of the most difficult problems in NDA of nuclear materials is identifying the chemical form of the nuclear material and the surrounding matrix. Recent work analyzing the calorimeter response of sources embedded in a variety of matrices has led to a possible solution to this problem. The wide range of thermal time constants exhibited by typical matrix materials lends itself to permitting the differentiation between materials, based on time constants extracted from the measured response. Potential applications include simple item identification, item fingerprinting as part of shipper-receiver measurements, and distinguishing between Pu metal and Pu oxide as required under certain proposed attribute measurements. The results of applying this technique to a variety of items will be presented and discussed.

  9. Identification of noisy response latency

    DEFF Research Database (Denmark)

    Tamborrino, Massimiliano; Ditlevsen, Susanne; Lansky, Petr

    2012-01-01

    In many physical systems there is a time delay before an applied input (stimulation) has an impact on the output (response), and the quantification of this delay is of paramount interest. If the response can only be observed on top of an indistinguishable background signal, the estimation can...... be highly unreliable, unless the background signal is accounted for in the analysis. In fact, if the background signal is ignored, however small it is compared to the response and however large the delay is, the estimate of the time delay will go to zero for any reasonable estimator when increasing...... the number of observations. Here we propose a unified concept of response latency identification in event data corrupted by a background signal. It is done in the context of information transfer within a neural system, more specifically on spike trains from single neurons. The estimators are compared...

  10. Effective Deffect Identifications in Honeycombs

    Directory of Open Access Journals (Sweden)

    Jarmila Dedkova

    2008-01-01

    Full Text Available The image reconstruction problem based on Electrical Impedance Tomography (EIT is an ill-posed inverse problem of finding such conductivity distribution that minimizes some optimisation criterion, which can be given by a suitable primal objective function. This paper describes new algorithms for the reconstruction of the surface conductivity distribution, which are based on stochastic methods to be used for the acquirement of more accurate reconstruction results and stable solution. The proposed methods are expected to non-destructive test of materials. There are shown examples of the identification of voids or cracks in special structures called honeycombs. Instead of the experimental data we used the phantom evaluated voltage values based on the application of finite element method. The results obtained by this new approach are compared with results from the known deterministic approach to the same image reconstruction

  11. Multivariate methods for particle identification

    CERN Document Server

    Visan, Cosmin

    2013-01-01

    The purpose of this project was to evaluate several MultiVariate methods in order to determine which one, if any, offers better results in Particle Identification (PID) than a simple n$\\sigma$ cut on the response of the ALICE PID detectors. The particles considered in the analysis were Pions, Kaons and Protons and the detectors used were TPC and TOF. When used with the same input n$\\sigma$ variables, the results show similar perfoance between the Rectangular Cuts Optimization method and the simple n$\\sigma$ cuts. The method MLP and BDT show poor results for certain ranges of momentum. The KNN method is the best performing, showing similar results for Pions and Protons as the Cuts method, and better results for Kaons. The extension of the methods to include additional input variables leads to poor results, related to instabilities still to be investigated.

  12. Expert system based radionuclide identification

    International Nuclear Information System (INIS)

    An expert system coupled with the gamma spectrum analysis system SAMPO has been developed for automating the qualitative identification of radionuclides as well as for determining the quantitative parameters of the spectrum components. The program is written in C-language and runs in various environments ranging from PCs to UNIX workstations. The expert system utilizes a complete gamma library with over 2600 nuclides and 80,000 lines, and a rule base of about fifty criteria including energies, relative peak intensities, genesis modes, half lives, parent-daughter relationships, etc. The rule base is furthermore extensible by the user. This is not an original contribution but a somewhat updated version of papers and reports previously published elsewhere. (author)

  13. Enhancer Identification through Comparative Genomics

    Energy Technology Data Exchange (ETDEWEB)

    Visel, Axel; Bristow, James; Pennacchio, Len A.

    2006-10-01

    With the availability of genomic sequence from numerousvertebrates, a paradigm shift has occurred in the identification ofdistant-acting gene regulatory elements. In contrast to traditionalgene-centric studies in which investigators randomly scanned genomicfragments that flank genes of interest in functional assays, the modernapproach begins electronically with publicly available comparativesequence datasets that provide investigators with prioritized lists ofputative functional sequences based on their evolutionary conservation.However, although a large number of tools and resources are nowavailable, application of comparative genomic approaches remains far fromtrivial. In particular, it requires users to dynamically consider thespecies and methods for comparison depending on the specific biologicalquestion under investigation. While there is currently no single generalrule to this end, it is clear that when applied appropriately,comparative genomic approaches exponentially increase our power ingenerating biological hypotheses for subsequent experimentaltesting.

  14. Filament Identification through Mathematical Morphology

    CERN Document Server

    Koch, Eric W

    2015-01-01

    We present a new algorithm for detecting filamentary structure FilFinder. The algorithm uses the techniques of mathematical morphology for filament identification, presenting a complementary approach to current algorithms which use matched filtering or critical manifolds. Unlike other methods, FilFinder identifies filaments over a wide dynamic range in brightness. We apply the new algorithm to far infrared imaging data of dust emission released by the Herschel Gould Belt Survey team. Our preliminary analysis characterizes both filaments and fainter striations. We find a typical filament width of 0.09 pc across the sample, but the brightness varies from cloud to cloud. Several regions show a bimodal filament brightness distribution, with the bright mode (filaments) being an order of magnitude brighter than the faint mode (striations). Using the Rolling Hough Transform, we characterize the orientations of the striations in the data, finding preferred directions that agree with magnetic field direction where dat...

  15. First Principles Identification of New Aircraft Materials Project

    Data.gov (United States)

    National Aeronautics and Space Administration — The identification of new, structurally sound, thermally stable materials for aviation applications will enable a wide range of technologies. The identification of...

  16. Forensic identification of gasoline samples

    Energy Technology Data Exchange (ETDEWEB)

    Birkholz, D.A.; Langdeau, M.; Kulmatycki, P. [Enviro-Test Labs., Edmonton, AB (Canada)

    2005-07-01

    The remediation of hydrocarbon contaminated sites is sometimes complicated by the fact that sources of contamination can often be attributed to several different suppliers of fuel. Determining the refining source of weathered gasoline can be very difficult. Details of an investigation to determine sources of gasoline through the use of forensic methods were presented. Gasoline samples were obtained from 5 western Canadian refineries and analyzed using high resolution gas chromatography and mass spectrometry. Reference compounds containing n-paraffins, isoparaffins, naphthenes, olefins and aromatics were analyzed to facilitate the identification of compounds. A weathered sample was prepared by adding 2 ml of gasoline to 10 ml of tap water. The mixture was subjected to vortex/sonication and an aliquot of the water phase was removed. Data from both weathered and unweathered gasoline samples were reviewed and pairs of compounds were chosen based on their similar boiling points, complex chromatographic resolution from interfering compounds, and presence in all grades of gasoline. Chromatographic peaks representative of the chosen compounds were integrated and the areas were then ratioed. The resulting ratios were plotted using an Excel radar plot to generate shapes. The shapes were then adjusted with multiplication factors and compared to determine whether weathered and unweathered sources of gasoline could be distinguished from the shape obtained with the radar plot. The analysis resulted in unique plots for gasoline obtained from the 5 refineries, and free product was referenced to its refinery source. Weathered gasoline gave rise to distinctive radar plots which revealed that environmental samples could be delineated as similar or different. Although some differences in radar plots were observed relative to fresh gasoline, profiles were generally similar and allowed for product source identification. 2 refs., 2 figs.

  17. Neural networks for damage identification

    Energy Technology Data Exchange (ETDEWEB)

    Paez, T.L.; Klenke, S.E.

    1997-11-01

    Efforts to optimize the design of mechanical systems for preestablished use environments and to extend the durations of use cycles establish a need for in-service health monitoring. Numerous studies have proposed measures of structural response for the identification of structural damage, but few have suggested systematic techniques to guide the decision as to whether or not damage has occurred based on real data. Such techniques are necessary because in field applications the environments in which systems operate and the measurements that characterize system behavior are random. This paper investigates the use of artificial neural networks (ANNs) to identify damage in mechanical systems. Two probabilistic neural networks (PNNs) are developed and used to judge whether or not damage has occurred in a specific mechanical system, based on experimental measurements. The first PNN is a classical type that casts Bayesian decision analysis into an ANN framework; it uses exemplars measured from the undamaged and damaged system to establish whether system response measurements of unknown origin come from the former class (undamaged) or the latter class (damaged). The second PNN establishes the character of the undamaged system in terms of a kernel density estimator of measures of system response; when presented with system response measures of unknown origin, it makes a probabilistic judgment whether or not the data come from the undamaged population. The physical system used to carry out the experiments is an aerospace system component, and the environment used to excite the system is a stationary random vibration. The results of damage identification experiments are presented along with conclusions rating the effectiveness of the approaches.

  18. New omega vortex identification method

    Science.gov (United States)

    Liu, ChaoQun; Wang, YiQian; Yang, Yong; Duan, ZhiWei

    2016-08-01

    A new vortex identification criterion called Ω-method is proposed based on the ideas that vorticity overtakes deformation in vortex. The comparison with other vortex identification methods like Q-criterion and λ 2-method is conducted and the advantages of the new method can be summarized as follows: (1) the method is able to capture vortex well and very easy to perform; (2) the physical meaning of Ω is clear while the interpretations of iso-surface values of Q and λ 2 chosen to visualize vortices are obscure; (3) being different from Q and λ 2 iso-surface visualization which requires wildly various thresholds to capture the vortex structure properly, Ω is pretty universal and does not need much adjustment in different cases and the iso-surfaces of Ω=0.52 can always capture the vortices properly in all the cases at different time steps, which we investigated; (4) both strong and weak vortices can be captured well simultaneously while improper Q and λ 2 threshold may lead to strong vortex capture while weak vortices are lost or weak vortices are captured but strong vortices are smeared; (5) Ω=0.52 is a quantity to approximately define the vortex boundary. Note that, to calculate Ω, the length and velocity must be used in the non-dimensional form. From our direct numerical simulation, it is found that the vorticity direction is very different from the vortex rotation direction in general 3-D vortical flow, the Helmholtz velocity decomposition is reviewed and vorticity is proposed to be further decomposed to vortical vorticity and non-vortical vorticity.

  19. Dynamic hierarchical algorithm for accelerated microfossil identification

    Science.gov (United States)

    Wong, Cindy M.; Joseph, Dileepan

    2015-02-01

    Marine microfossils provide a useful record of the Earth's resources and prehistory via biostratigraphy. To study Hydrocarbon reservoirs and prehistoric climate, geoscientists visually identify the species of microfossils found in core samples. Because microfossil identification is labour intensive, automation has been investigated since the 1980s. With the initial rule-based systems, users still had to examine each specimen under a microscope. While artificial neural network systems showed more promise for reducing expert labour, they also did not displace manual identification for a variety of reasons, which we aim to overcome. In our human-based computation approach, the most difficult step, namely taxon identification is outsourced via a frontend website to human volunteers. A backend algorithm, called dynamic hierarchical identification, uses unsupervised, supervised, and dynamic learning to accelerate microfossil identification. Unsupervised learning clusters specimens so that volunteers need not identify every specimen during supervised learning. Dynamic learning means interim computation outputs prioritize subsequent human inputs. Using a dataset of microfossils identified by an expert, we evaluated correct and incorrect genus and species rates versus simulated time, where each specimen identification defines a moment. The proposed algorithm accelerated microfossil identification effectively, especially compared to benchmark results obtained using a k-nearest neighbour method.

  20. Electro-optical fuel pin identification system

    International Nuclear Information System (INIS)

    A prototype Electro-Optical Fuel Pin Identification System referred to as the Fuel Pin Identification System (FPIS) has been developed by the Hanford Engineering Development Laboratory (HEDL) in support of the Fast Flux Test Facility (FFTF) presently under construction at HEDL. The system is designed to remotely read an alpha-numeric identification number that is roll stamped on the top of the fuel pin end cap. The prototype FPIS consists of four major subassemblies: optical read head, digital compression electronics, video display, and line printer

  1. Paraphrase Identification using Semantic Heuristic Features

    Directory of Open Access Journals (Sweden)

    Zia Ul-Qayyum

    2012-11-01

    Full Text Available Paraphrase Identification (PI problem is to classify that whether or not two sentences are close enough in meaning to be termed as paraphrases. PI is an important research dimension with practical applications in Information Extraction (IE, Machine Translation, Information Retrieval, Automatic Identification of Copyright Infringement, Question Answering Systems and Intelligent Tutoring Systems, to name a few. This study presents a novel approach of paraphrase identification using semantic heuristic features envisaging improving the accuracy compared to state-of-the-art PI systems. Finally, a comprehensive critical analysis of misclassifications is carried out to provide insightful evidence about the proposed approach and the corpora used in the experiments.

  2. Identification of Nonlinear Systems Using Neurofuzzy Networks

    Institute of Scientific and Technical Information of China (English)

    LI Ying; JIAO Licheng

    2001-01-01

    This paper presents a compound neu-ral network model, I.e., adaptive neurofuzzy network(ANFN), which can be used for identifying the com-plicated nonlinear system. The proposed ANFN has asimple structure and exploits a hybrid algorithm com-bining supervised learning and unsupervised learning.In addition, ANFN is capable of overcoming the errorof system identification due to the existence of somechanging points and improving the accuracy of identi-fication of the whole system. The effectiveness of themodel and its algorithm are tested on the identifica-tion results of missile attacking area.

  3. Model Identification of a Micro Air Vehicle

    Institute of Scientific and Technical Information of China (English)

    Jorge Ni(n)o; Flavius Mitrache; Peter Cosyn; Robin De Keyser

    2007-01-01

    This paper is focused on the model identification of a Micro Air Vehicle (MAV) in straight steady flight condition. The identification is based on input-output data collected from flight tests using both frequency and time dontain techniques. The vehicle is an in-house 40 cm wingspan airplane. Because of the complex coupled, multivariable and nonlinear dynamics of the aircraft, linear SISO structures for both the lateral and longitudinal models around a reference state were derived. The aim of the identification is to provide models that can be used in future development of control techniques for the MAV.

  4. Rapid Cellular Identification by Dynamic Electromechanical Response

    Energy Technology Data Exchange (ETDEWEB)

    Nikiforov, Maxim [ORNL; Jesse, Stephen [ORNL; Kalinin, Sergei V [ORNL; Reukov, Vladimir V [ORNL; Vertegel, Alexey [ORNL; Thompson, Gary L [ORNL

    2009-01-01

    Coupling between electrical and mechanical phenomena is ubiquitous in living systems. Here, we demonstrate rapid identification of cellular organisms using difference in electromechanical activity in a broad frequency range. Principal component analysis of the dynamic electromechanical response spectra bundled with neural network based recognition provides a robust identification algorithm based on their electromechanical signature, and allows unambiguous differentiation of model Micrococcus Lysodeikticus and Pseudomonas Fluorescens system. This methodology provides a universal pathway for biological identification obviating the need for well-defined analytical models of Scanning Probe Microscopy response.

  5. Modeling, system identification, and control of ASTREX

    Science.gov (United States)

    Abhyankar, Nandu S.; Ramakrishnan, J.; Byun, K. W.; Das, A.; Cossey, Derek F.; Berg, J.

    1993-02-01

    The modeling, system identification and controller design aspects of the ASTREX precision space structure are presented in this work. Modeling of ASTREX is performed using NASTRAN, TREETOPS and I-DEAS. The models generated range from simple linear time-invariant models to nonlinear models used for large angle simulations. Identification in both the time and frequency domains are presented. The experimental set up and the results from the identification experiments are included. Finally, controller design for ASTREX is presented. Simulation results using this optimal controller demonstrate the controller performance. Finally the future directions and plans for the facility are addressed.

  6. NASA Technologies for Product Identification

    Science.gov (United States)

    Schramm, Fred, Jr.

    2006-01-01

    Since 1975 bar codes on products at the retail counter have been accepted as the standard for entering product identity for price determination. Since the beginning of the 21st century, the Data Matrix symbol has become accepted as the bar code format that is marked directly on a part, assembly or product that is durable enough to identify that item for its lifetime. NASA began the studies for direct part marking Data Matrix symbols on parts during the Return to Flight activities after the Challenger Accident. Over the 20 year period that has elapsed since Challenger, a mountain of studies, analyses and focused problem solutions developed by and for NASA have brought about world changing results. NASA Technical Standard 6002 and NASA Handbook 6003 for Direct Part Marking Data Matrix Symbols on Aerospace Parts have formed the basis for most other standards on part marking internationally. NASA and its commercial partners have developed numerous products and methods that addressed the difficulties of collecting part identification in aerospace operations. These products enabled the marking of Data Matrix symbols in virtually every situation and the reading of symbols at great distances, severe angles, under paint and in the dark without a light. Even unmarkable delicate parts now have a process to apply a chemical mixture called NanocodesTM that can be converted to a Data Matrix. The accompanying intellectual property is protected by 10 patents, several of which are licensed. Direct marking Data Matrix on NASA parts virtually eliminates data entry errors and the number of parts that go through their life cycle unmarked, two major threats to sound configuration management and flight safety. NASA is said to only have people and stuff with information connecting them. Data Matrix is one of the most significant improvements since Challenger to the safety and reliability of that connection. This presentation highlights the accomplishments of NASA in its efforts to develop

  7. A New Paradigm for Known Metabolite Identification in Metabonomics/Metabolomics: Metabolite Identification Efficiency

    Directory of Open Access Journals (Sweden)

    Jeremy R. Everett

    2015-01-01

    Full Text Available A new paradigm is proposed for assessing confidence in the identification of known metabolites in metabonomics studies using NMR spectroscopy approaches. This new paradigm is based upon the analysis of the amount of metabolite identification information retrieved from NMR spectra relative to the molecular size of the metabolite. Several new indices are proposed including: metabolite identification efficiency (MIE and metabolite identification carbon efficiency (MICE, both of which can be easily calculated. These indices, together with some guidelines, can be used to provide a better indication of known metabolite identification confidence in metabonomics studies than existing methods. Since known metabolite identification in untargeted metabonomics studies is one of the key bottlenecks facing the science currently, it is hoped that these concepts based on molecular spectroscopic informatics, will find utility in the field.

  8. In silico identification software (ISIS): a machine learning approach to tandem mass spectral identification of lipids

    OpenAIRE

    Kangas, Lars J.; Metz, Thomas O.; Isaac, Giorgis; Schrom, Brian T.; Ginovska-Pangovska, Bojana; Wang, Luning; Tan, Li; Lewis, Robert R.; John H Miller

    2012-01-01

    Motivation: Liquid chromatography–mass spectrometry-based metabolomics has gained importance in the life sciences, yet it is not supported by software tools for high throughput identification of metabolites based on their fragmentation spectra. An algorithm (ISIS: in silico identification software) and its implementation are presented and show great promise in generating in silico spectra of lipids for the purpose of structural identification. Instead of using chemical reaction rate equations...

  9. OPTICAL correlation identification technology applied in underwater laser imaging target identification

    Science.gov (United States)

    Yao, Guang-tao; Zhang, Xiao-hui; Ge, Wei-long

    2012-01-01

    The underwater laser imaging detection is an effective method of detecting short distance target underwater as an important complement of sonar detection. With the development of underwater laser imaging technology and underwater vehicle technology, the underwater automatic target identification has gotten more and more attention, and is a research difficulty in the area of underwater optical imaging information processing. Today, underwater automatic target identification based on optical imaging is usually realized with the method of digital circuit software programming. The algorithm realization and control of this method is very flexible. However, the optical imaging information is 2D image even 3D image, the amount of imaging processing information is abundant, so the electronic hardware with pure digital algorithm will need long identification time and is hard to meet the demands of real-time identification. If adopt computer parallel processing, the identification speed can be improved, but it will increase complexity, size and power consumption. This paper attempts to apply optical correlation identification technology to realize underwater automatic target identification. The optics correlation identification technology utilizes the Fourier transform characteristic of Fourier lens which can accomplish Fourier transform of image information in the level of nanosecond, and optical space interconnection calculation has the features of parallel, high speed, large capacity and high resolution, combines the flexibility of calculation and control of digital circuit method to realize optoelectronic hybrid identification mode. We reduce theoretical formulation of correlation identification and analyze the principle of optical correlation identification, and write MATLAB simulation program. We adopt single frame image obtained in underwater range gating laser imaging to identify, and through identifying and locating the different positions of target, we can improve

  10. 27 CFR 25.168 - Employer identification number.

    Science.gov (United States)

    2010-04-01

    ... § 25.168 Employer identification number. The employer identification number (defined at 26 CFR 301.7701... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Employer identification..., filed under this part. Failure of the taxpayer to include the employer identification number on...

  11. 19 CFR 112.43 - Form of identification card.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Form of identification card. 112.43 Section 112.43 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARRIERS, CARTMEN, AND LIGHTERMEN Identification Cards § 112.43 Form of identification card. The identification card shall be issued...

  12. HMSRP Hawaiian Monk Seal Photo Identification Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This photo collection contains identification and other images and video of Hawaiian monk seals taken by PSD personnel and cooperating scientists as part of the...

  13. Summary of tracking and identification methods

    Science.gov (United States)

    Blasch, Erik; Yang, Chun; Kadar, Ivan

    2014-06-01

    Over the last two decades, many solutions have arisen to combine target tracking estimation with classification methods. Target tracking includes developments from linear to non-linear and Gaussian to non-Gaussian processing. Pattern recognition includes detection, classification, recognition, and identification methods. Integrating tracking and pattern recognition has resulted in numerous approaches and this paper seeks to organize the various approaches. We discuss the terminology so as to have a common framework for various standards such as the NATO STANAG 4162 - Identification Data Combining Process. In a use case, we provide a comparative example highlighting that location information (as an example) with additional mission objectives from geographical, human, social, cultural, and behavioral modeling is needed to determine identification as classification alone does not allow determining identification or intent.

  14. Isolation and Identification of Concrete Environment Bacteria

    Science.gov (United States)

    Irwan, J. M.; Anneza, L. H.; Othman, N.; Husnul, T.; Alshalif, A. F.

    2016-07-01

    This paper presents the isolation and molecular method for bacteria identification through PCR and DNA sequencing. Identification of the bacteria species is required in order to fully utilize the bacterium capability for precipitation of calcium carbonate in concrete. This process is to enable the addition of suitable catalyst according to the bacterium enzymatic pathway that is known through the bacteria species used. The objective of this study is to isolate, enriched and identify the bacteria species. The bacteria in this study was isolated from fresh urine and acid mine drainage water, Kota Tinggi, Johor. Enrichment of the isolated bacteria was conducted to ensure the bacteria survivability in concrete. The identification of bacteria species was done through polymerase chain reaction (PCR) and rRDNA sequencing. The isolation and enrichment of the bacteria was done successfully. Whereas, the results for bacteria identification showed that the isolated bacteria strains are Bacillus sp and Enterococus faecalis.

  15. Term identification in the biomedical literature.

    Science.gov (United States)

    Krauthammer, Michael; Nenadic, Goran

    2004-12-01

    Sophisticated information technologies are needed for effective data acquisition and integration from a growing body of the biomedical literature. Successful term identification is key to getting access to the stored literature information, as it is the terms (and their relationships) that convey knowledge across scientific articles. Due to the complexities of a dynamically changing biomedical terminology, term identification has been recognized as the current bottleneck in text mining, and--as a consequence--has become an important research topic both in natural language processing and biomedical communities. This article overviews state-of-the-art approaches in term identification. The process of identifying terms is analysed through three steps: term recognition, term classification, and term mapping. For each step, main approaches and general trends, along with the major problems, are discussed. By assessing previous work in context of the overall term identification process, the review also tries to delineate needs for future work in the field. PMID:15542023

  16. 2010 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2010 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  17. Image segmentation for automated dental identification

    Science.gov (United States)

    Haj Said, Eyad; Nassar, Diaa Eldin M.; Ammar, Hany H.

    2006-02-01

    Dental features are one of few biometric identifiers that qualify for postmortem identification; therefore, creation of an Automated Dental Identification System (ADIS) with goals and objectives similar to the Automated Fingerprint Identification System (AFIS) has received increased attention. As a part of ADIS, teeth segmentation from dental radiographs films is an essential step in the identification process. In this paper, we introduce a fully automated approach for teeth segmentation with goal to extract at least one tooth from the dental radiograph film. We evaluate our approach based on theoretical and empirical basis, and we compare its performance with the performance of other approaches introduced in the literature. The results show that our approach exhibits the lowest failure rate and the highest optimality among all full automated approaches introduced in the literature.

  18. Frontal sinus recognition for human identification

    Science.gov (United States)

    Falguera, Juan Rogelio; Falguera, Fernanda Pereira Sartori; Marana, Aparecido Nilceu

    2008-03-01

    Many methods based on biometrics such as fingerprint, face, iris, and retina have been proposed for person identification. However, for deceased individuals, such biometric measurements are not available. In such cases, parts of the human skeleton can be used for identification, such as dental records, thorax, vertebrae, shoulder, and frontal sinus. It has been established in prior investigations that the radiographic pattern of frontal sinus is highly variable and unique for every individual. This has stimulated the proposition of measurements of the frontal sinus pattern, obtained from x-ray films, for skeletal identification. This paper presents a frontal sinus recognition method for human identification based on Image Foresting Transform and shape context. Experimental results (ERR = 5,82%) have shown the effectiveness of the proposed method.

  19. 2012 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2012 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  20. Advanced 3D Object Identification System Project

    Data.gov (United States)

    National Aeronautics and Space Administration — Optra will build an Advanced 3D Object Identification System utilizing three or more high resolution imagers spaced around a launch platform. Data from each imager...

  1. 25 CFR 249.3 - Identification cards.

    Science.gov (United States)

    2010-04-01

    ... the issuance of an appropriate identification card to any Indian entitled thereto as prima facie... any Federal, State, or tribal enforcement officer shall be prima facie evidence that the person is...

  2. 2014 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2014 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  3. 2009 United States Automatic Identification System Database

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The 2009 United States Automatic Identification System Database contains vessel traffic data for planning purposes within the U.S. coastal waters. The database is...

  4. Raman and Photoluminescence Spectroscopy in Mineral Identification

    Science.gov (United States)

    Kuehn, J. W.

    2014-06-01

    Raman spectroscopy is particularly useful for rapid identification of minerals and gemstones. Raman spectrometers also allow PL studies for authentication of samples and geological provenance, diamond type screening and detection of HPHT treatments.

  5. Opinion Polarity Identification through Adjectives

    CERN Document Server

    Moghaddam, Samaneh

    2010-01-01

    "What other people think" has always been an important piece of information during various decision-making processes. Today people frequently make their opinions available via the Internet, and as a result, the Web has become an excellent source for gathering consumer opinions. There are now numerous Web resources containing such opinions, e.g., product reviews forums, discussion groups, and Blogs. But, due to the large amount of information and the wide range of sources, it is essentially impossible for a customer to read all of the reviews and make an informed decision on whether to purchase the product. It is also difficult for the manufacturer or seller of a product to accurately monitor customer opinions. For this reason, mining customer reviews, or opinion mining, has become an important issue for research in Web information extraction. One of the important topics in this research area is the identification of opinion polarity. The opinion polarity of a review is usually expressed with values 'positive'...

  6. Digital Image Mechanical Identification (DIMI)

    CERN Document Server

    Hild, François

    2007-01-01

    A continuous pathway from digital images acquired during a mechanical test to quantitative identification of a constitutive law is presented herein based on displacement field analysis. From images, displacement fields are directly estimated within a finite element framework. From the latter, the application of the equilibrium gap method provides the means for rigidity field evaluation. In the present case, a reconditioned formulation is proposed for a better stability. Last, postulating a specific form of a damage law, a linear system is formed that gives a direct access to the (non-linear) damage growth law in one step. The two last procedures are presented, validated on an artificial case, and applied to the case of a biaxial tension of a composite sample driven up to failure. A quantitative estimate of the quality of the determination is proposed, and in the last application, it is shown that no more than 7% of the displacement field fluctuations are not accounted for by the determined damage law.

  7. Identification of Sustainable Architecture Dimensions

    Directory of Open Access Journals (Sweden)

    Leila Etminan

    2014-02-01

    Full Text Available The main purpose in this research is identification of sustainable architecture dimensions. Nowadays, one of the most necessary complicated and main specifications of architecture with which architects are face is the issue of sustainability in various types of its interpretations. The issue of sustainability is interpretable and general according to many aspects. Therefore, it is necessary to identify this concept (architecture and its related categories. At the beginning of this discussion, we were faced with titles such as Green architecture2, Sustainable development3, etc. However, the purpose of this study is to study of nature and identify the circumstances and essence of sustainability in all fields in which the architecture is involved. The innovation of this study is to identify and feel the fact of sustainability dimensions that is studied in procedure of library research, a case sample and proposal of common but insufficient ideas related to this discussion. This study studies 3 approaches including main environmental, cultural (value and technical views and it tries to take the proposed topics under the subjection of this 3 factors respectively (presenting a modern model; furthermore, the minor factors are studied under the subjection of these 3 main factors.

  8. Ligand Identification Scoring Algorithm (LISA)

    Science.gov (United States)

    Zheng, Zheng; Merz, Kenneth M.

    2011-01-01

    A central problem in de novo drug design is determining the binding affinity of a ligand with a receptor. A new scoring algorithm is presented that estimates the binding affinity of a protein-ligand complex given a three-dimensional structure. The method, LISA (Ligand Identification Scoring Algorithm), uses an empirical scoring function to describe the binding free energy. Interaction terms have been designed to account for van der Waals (VDW) contacts, hydrogen bonding, desolvation effects and metal chelation to model the dissociation equilibrium constants using a linear model. Atom types have been introduced to differentiate the parameters for VDW, H-bonding interactions and metal chelation between different atom pairs. A training set of 492 protein-ligand complexes was selected for the fitting process. Different test sets have been examined to evaluate its ability to predict experimentally measured binding affinities. By comparing with other well known scoring functions, the results show that LISA has advantages over many existing scoring functions in simulating protein-ligand binding affinity, especially metalloprotein-ligand binding affinity. Artificial Neural Network (ANN) was also used in order to demonstrate that the energy terms in LISA are well designed and do not require extra cross terms. PMID:21561101

  9. Olfactory identification ability in anorexia nervosa.

    OpenAIRE

    Kopala, L C; Good, K; Goldner, E M; Birmingham, C L

    1995-01-01

    OBJECTIVE: The hypothesis tested was that patients with severe eating disorders would demonstrate olfactory identification deficits as a result of zinc deficiency or malnutrition. METHOD: The University of Pennsylvania Smell Identification Test (UPSIT) was administered to 27 hospitalized female patients with anorexia nervosa and 50 normal control female subjects. For a subgroup of patients, serum zinc levels and body mass indices were obtained at pre- and post-nutritional repletion phases. RE...

  10. Human Identification by Gait Using Corner Points

    OpenAIRE

    Mridul Ghosh; Debotosh Bhattacharjee

    2012-01-01

    Recently human gait has become a promising and very important biometric for identification. Current research on gait recognition is usually based on an average gait image or a silhouette sequence, or a motion structure model. In this paper, the information about gait is obtained from the disparity on time and space of the different parts of the silhouette. This paper proposes a gait recognition method using edge detection, identification of corner points from edges, and selection of control p...

  11. IDENTIFICATION OF RIVER WATER EXCESSIVE POLLUTION SOURCES

    OpenAIRE

    K. J. KACHIASHVILI; D. I. MELIKDZHANIAN

    2006-01-01

    The program package for identification of river water excessive pollution sources located between two controlled cross-sections of the river is described in this paper. The software has been developed by the authors on the basis of mathematical models of pollutant transport in the rivers and statistical hypotheses checking methods. The identification algorithms were elaborated with the supposition that the pollution sources discharge different compositions of pollutants or (at the identical c...

  12. An overview of system modeling and identification

    OpenAIRE

    Favier, Gérard

    2010-01-01

    International audience System identification consists in building mathematical models of dynamical systems from experimental data. Such a methodology was mainly developed for designing model-based control systems. More generally, parameter estimation is at the heart of many signal processing applications aiming to extract information from signals, like radar, sonar, seismic, speech, communication, or biomedical (EEG, ECG, EMG) signals. Nowadays, dynamical models and identification methods ...

  13. Combat Identification and Fratricide: A Human Affair

    OpenAIRE

    Spaans, M.; Vermeulen, J.F.J.; Petiet, P.J.; Dean, V.; Jackson, J.; Clites, L.

    2008-01-01

    Over the past two years TNO and Dstl developed an Agent Based Combat ID Model to support the research on factors influencing the success and failure of Combat Identification processes. During the International Data farming Workshop (IDFW) 15 in Singapore, we evaluated this model by conducting the first data farming experiments. The model represents Situation Awareness (SA) and the cognitive processes to combine new sensor input with SA in order to make identification decisions. A description ...

  14. Identification of hadronic tau decays in CMS

    OpenAIRE

    Khurana, Raman; CMS Collaboration

    2014-01-01

    The algorithm used for reconstruction and identification of hadronic tau decays by the CMS experiment at the LHC is presented. The tau reconstruction in CMS takes advantage of the particle-flow algorithm which allows to reconstruct individual hadronic decay modes. The performance of the algorithm in terms of tau identification efficiency and rates for jets to be misidentified as hadronic tau decays is measured in $pp$ collision data recorded in 2012 at a center-of-mass energy ($\\sqrt{s}$) of ...

  15. False discovery rates in spectral identification

    OpenAIRE

    Jeong Kyowon; Kim Sangtae; Bandeira Nuno

    2012-01-01

    Abstract Automated database search engines are one of the fundamental engines of high-throughput proteomics enabling daily identifications of hundreds of thousands of peptides and proteins from tandem mass (MS/MS) spectrometry data. Nevertheless, this automation also makes it humanly impossible to manually validate the vast lists of resulting identifications from such high-throughput searches. This challenge is usually addressed by using a Target-Decoy Approach (TDA) to impose an empirical Fa...

  16. False discovery rates in spectral identification

    OpenAIRE

    Jeong, Kyowon; Kim, Sangtae; Bandeira, Nuno

    2012-01-01

    Abstract Automated database search engines are one of the fundamental engines of high-throughput proteomics enabling daily identifications of hundreds of thousands of peptides and proteins from tandem mass (MS/MS) spectrometry data. Nevertheless, this automation also makes it humanly impossible to manually validate the vast lists of resulting identifications from such high-throughput searches. This challenge is usually addressed by using a Target-Decoy Approach (TDA) to impose an empirica...

  17. Online identification of linear loudspeakers parameters

    DEFF Research Database (Denmark)

    Pedersen, Bo Rohde; Rubak, Per

    2007-01-01

    Feed forward nonlinear error correction of loudspeakers can improve sound quality. For creating a realistic feed forward strategy identification of the loudspeaker parameters is needed. The strategy of the compensator is that the nonlinear behaviour of the loudspeakers has relatively small drift...... algorithms. Two different identification techniques (ARMA and FIR) are compared. The stability of the nonlinearities and linear loudspeaker parameters are tested in a measurement series....

  18. Damage identification from power spectrum density transmissibility

    OpenAIRE

    Zhou, Yun Lai; Perera Velamazan, Ricardo; Sevillano Bravo, Enrique

    2012-01-01

    Damage identification under real operating conditions of the structure during its daily use would be suitable and attractive to civil engineers due to the difficulty and problems of carrying out controlled forced excitation tests on this kind of structures. In this case, output-only response measurements would be available, and an output-only damage identification procedure should be implemented. Transmissibility, defined on an output-to-output relationship, is getting increased attention in ...

  19. Multifinger Feature Level Fusion Based Fingerprint Identification

    OpenAIRE

    Praveen N; Tessamma Thomas

    2012-01-01

    Fingerprint based authentication systems are one of the cost-effective biometric authentication techniques employed for personal identification. As the data base population increases, fast identification/recognition algorithms are required with high accuracy. Accuracy can be increased using multimodal evidences collected by multiple biometric traits. In this work, consecutive fingerprint images are taken, global singularities are located using directional field strength and their local orient...

  20. TOOTH-BASED IDENTIFICATION OF INDIVIDUALS

    OpenAIRE

    Charbel Fares; Mireille Feghali

    2013-01-01

    The use of automated biometrics-based personal identification systems is an omnipresent procedure. Many technologies are no more secure, and they have certain limitations such as in cases when bodies are decomposed or burned. Dental enamel is one of the most mineralized tissues of an organism that have a post-mortem degradation resistance. In this article we describe the dental biometrics which utilizes dental radiographs for human identification. The dental radiographs provide information ab...

  1. Identification of treatment response with social interactions

    OpenAIRE

    Manski, Charles F.

    2010-01-01

    This paper develops a formal language for study of treatment response with social interactions, and uses it to obtain new findings on identification of potential outcome distributions. Defining a person's treatment response to be a function of the entire vector of treatments received by the population, I study identification when shape restrictions and distributional assumptions are placed on response functions. An early key result is that the traditional assumption of individualistic treatme...

  2. Identification of SPV using a Blended Method

    International Nuclear Information System (INIS)

    A Single Point Vulnerability (SPV) may cause plant transients like reactor trip, turbine/ generator trip, orderated power to 50% or more. In order to improve plant reliability and performance by preventing unexpected plant transients, we, KEPCO-ENC and KHNP, are developing SPV monitoring program. To have a better result of the SPV identification and monitoring, we used a blended method which was comprised of qualitative and quantitative approaches. This method is described herein, representative results of SPV identification are presented

  3. Identification of SPV using a Blended Method

    Energy Technology Data Exchange (ETDEWEB)

    Han, Jin Kyu; Lee, Kwang Nam [KEPCO-ENC, Daejeon (Korea, Republic of); Chi, Moon Goo; Lee, Eun Chan [KHNP, Daejeon (Korea, Republic of)

    2010-10-15

    A Single Point Vulnerability (SPV) may cause plant transients like reactor trip, turbine/ generator trip, orderated power to 50% or more. In order to improve plant reliability and performance by preventing unexpected plant transients, we, KEPCO-ENC and KHNP, are developing SPV monitoring program. To have a better result of the SPV identification and monitoring, we used a blended method which was comprised of qualitative and quantitative approaches. This method is described herein, representative results of SPV identification are presented

  4. Cost Optimal System Identification Experiment Design

    DEFF Research Database (Denmark)

    Kirkegaard, Poul Henning

    A structural system identification experiment design method is formulated in the light of decision theory, structural reliability theory and optimization theory. The experiment design is based on a preposterior analysis, well-known from the classical decision theory. I.e. the decisions concerning...... reflecting the cost of the experiment and the value of obtained additional information. An example concerning design of an experiment for parametric identification of a single degree of freedom structural system shows the applicability of the experiment design method....

  5. On-line Bayesian System Identification

    OpenAIRE

    Romeres, Diego; Prando, Giulia; Pillonetto, Gianluigi; Chiuso, Alessandro

    2016-01-01

    We consider an on-line system identification setting, in which new data become available at given time steps. In order to meet real-time estimation requirements, we propose a tailored Bayesian system identification procedure, in which the hyper-parameters are still updated through Marginal Likelihood maximization, but after only one iteration of a suitable iterative optimization algorithm. Both gradient methods and the EM algorithm are considered for the Marginal Likelihood optimization. We c...

  6. CEAI: CCM based Email Authorship Identification Model

    OpenAIRE

    Nizamani, Sarwat; Memon, Nasrullah

    2013-01-01

    In this paper we present a model for email authorship identification (EAI) by employing a Cluster-based Classification (CCM) technique. Traditionally, stylometric features have been successfully employed in various authorship analysis tasks; we extend the traditional feature-set to include some more interesting and effective features for email authorship identification (e.g. the last punctuation mark used in an email, the tendency of an author to use capitalization at the start of an email, o...

  7. Cheiloscopy: An aid for personal identification

    OpenAIRE

    Rashmi Venkatesh; Maria Priscilla David

    2011-01-01

    Aim: Cheiloscopy is a forensic investigation technique that deals with identification of humans based on lips traces. The aim of this study is to establish the uniqueness of lip prints which aids in personal identification. Materials and Methods: The study group comprised of 200 subjects. The materials used were dark-colored lipstick, paper, cellophane tape, a brush, and a magnifying lens. Results: This study shows that lip prints are unique and permanent for each individual, and the lip prin...

  8. Iris Identification Technology Based on Multiwavelets

    Institute of Scientific and Technical Information of China (English)

    Wei Lian-xin; Ma Fu-ming; Xu Tao; Li Zhi-hui; Wu Deng-feng

    2005-01-01

    A new method for iris identification based on multiwavelets is proposed. By means of the properties of multiwavelets,such as orthogonality, symmetry, vanishing moments and approximation order, the iris texture can be simply presented. A brief overview of muhiwavelets is presented at first. Iris identification system and iris texture feature presentation and recognition based on multiwavelets are introduced subsequently. And the experiment indicates the validity of this method finally.

  9. Nódulos opalinos en facies marginales del salar Olaroz (Puna Argentina

    Directory of Open Access Journals (Sweden)

    Alonso, R.

    1989-04-01

    Full Text Available This article reports the results of a petrological and geochemical study of silica nodules from Quaternary alluvial fallS of the Olaroz Salar. The nodules are mainly constituted by C-T opal, d. (101 spacing to 4,11 A, implying a high-disorder; this is commonly observed in opa! rocks formed in near surface environments, without burial and heating. The chemical composition of the nodules is anomalous when compared with other typical silica-rocks formed in arid continental closed basin, without any eruptive environments (for instance the Cuenca del Tajo in Spain. The siliceous nodules do not have the characteristics of the silcretes and are not associated to the evaporitic facies of the salar. Their genesis is probably related to contamination of groundwater of the alluvial fan with high-silica thermal water. The C-T opal would thus precipitate by either displacing tbe terrigenous host-rock or replacing previous ulexite nodules.Se realiza un estudio petrológico y geoquímico de los nódulos silíceos que se encuentran incluidos en sedimentos terrígenos cuaternarios de la Cuenca de Olaroz (La Puna, Argentina. Estos nódulos se localizan en abanicos aluviales que aparecen encajados, debido a los cambios en el nivel de base que se produce desde el Pleistoceno a la actualidad, durante la evolución de los cuerpos lacustres a salares. Un estudio mediante DRX revela que son rocas constituidas por ópalo C-T, con un espaciado (101 a 4,11 A, que implica un grado de desorden alto, típico de las rocas silíceas formadas en superficie y que no han sufrido enterramiento ni influencia térmica. Su composición química es anómala si se compara con rocas silíceas continentales formadas en ambiente endorreico y fuera de un marco volcánico (Mioceno de la Cuenca del Tajo. No poseyendo características de silcretas y no estando asociadas a la sedimentación evaporítica de los salares, se considera la influencia de aguas termales. La contaminación local y en un momento dado de las aguas freáticas de los abanicos aluviales por aguas termales ricas en sílice, propiciaría junto con la evaporización la precipitación de la silíceo Los nódulos silíceos crecerían desplazando el sedimento terrígeno que constituye la roca caja o reemplazando nódulos previa de ulexita.

  10. El documental musical y la audiovisualización de estéticas marginales

    OpenAIRE

    Rueda Pinilla, Natalia

    2012-01-01

    Entre las diferentes narrativas y estéticas del documental, existe una creciente tendencia a registrar universos musicales. Estos documentales abordan, ocasionalmente, temas que trascienden la música en sí misma, y conforman un complejo ejercicio de representación de sociedades que son habitadas y narradas por determinadas estéticas visuales y sonoras. A partir del análisis de los documentales brasileños Sou feia mas tô na moda y Faço de mim o que quero, este artículo analizará la forma e...

  11. Maras y barras : Pandillas y violencia juvenil en los barrios marginales de Centroamérica

    NARCIS (Netherlands)

    Savenije, W.

    2009-01-01

    Street gangs -especially ‘Mara Salvatrucha’ [MS] and 18th Street Gang [18]- and student gangs are feared throughout Central America. This study looks at the violent and criminal acts they engage in, the attraction they hold over other young people, the solidarity among their members, and the physica

  12. Maras y barras : Pandillas y violencia juvenil en los barrios marginales de Centroamérica

    OpenAIRE

    Savenije, W.

    2009-01-01

    Street gangs -especially ‘Mara Salvatrucha’ [MS] and 18th Street Gang [18]- and student gangs are feared throughout Central America. This study looks at the violent and criminal acts they engage in, the attraction they hold over other young people, the solidarity among their members, and the physical and social risks they face. It sheds light on an even more alarming phenomena: the dynamics of social exclusion and self exclusion faced by large groups of young Central Americans. The reproducti...

  13. Optimization of fuel cycles: marginal loss values; Optimisation des cycles de combustibles: valeurs marginales des pertes

    Energy Technology Data Exchange (ETDEWEB)

    Gaussens, J. [Commissariat a l' Energie Atomique, 75 - Paris (France); Lasteyrie, B. de; Doumerc, J. [Compagnie pour l' Etude et la Realisation de Combustibles Atomiques, 75 - Paris (France)

    1965-07-01

    Uranium processing from the pit to the fuel element rod entails metal losses at every step. These losses become more and more expensive with the elaboration of the metal. Some of the uranium must be accepted as definitely lost whilst the rest could be recovered and recycled. The high cost of these losses, whether they are recycled or not, and the fact that the higher the enrichment is the higher their costs are, make it necessary to take them into account when optimizing fuel cycles. It is therefore felt important to determine their most desirable level from an economic point of view at the various nuclear fuel processing stages. However, in France as in some other countries, fissile material production is a state concern, whilst fuel element fabrication is carried out by private enterprise. Optimization criteria and the economic value of losses are therefore different for each of the two links in the fabrication chain. One can try in spite of this to reach an optimum which would conform to public interest, without interfering with the firm's sales policy. This entails using the fact that for a given output marginal costs are equal at the optimum. One can therefore adjust the level of the losses to attain this equation of marginal costs, as these are easier to obtain from the firm than a justification of the actual prices. One notices moreover that, although mainly concerned with losses, this global analysis can bring both the state and the firm to a better use of other production factors. An account is given of the theory of this economic optimization method and practical applications in the field of natural uranium-graphite moderated and CO{sub 2} cooled reactor fuel element fabrication are offered. (authors) [French] L'elaboration de l'uranium, de la mine a la cartouche d'element combustible, s'accompagne, a tous les stades, de pertes, de plus en plus onereuses, a mesure que le metal devient plus elabore. Une certaine proportion de l'uranium doit etre consideree comme definitivement perdue, alors que le reste pourrait etre recupere et recycle. Le cout eleve des pertes, recyclees ou non, d'autant plus eleve que l'uranium est plus enrichi, exige qu'il en soit tenu compte dans l'optimisation generale des cycles de combustible. Il importe donc de determiner leur niveau le plus souhaitable economiquement, aux diverses etapes d'elaboration du combustible nucleaire. Mais en France et dans d'autres pays, la production de matieres fissiles est geree par l'Etat, tandis que la fabrication de l'element combustible est effectuee par l'industrie privee. Les criteres d'optimisation et l'interet economique accorde aux pertes sont donc differents pour les deux parties de la chaine de fabrication. Pour tenter neanmoins d'atteindre un optimum conforme a l'interet collectif sans intervenir dans la politique de prix de l'entreprise, on peut utiliser la propriete des couts marginaux d'etre egaux entre eux a l'optimum, pour un volume de production donne. On peut donc ajuster le niveau des pertes pour realiser cette egalite des couts marginaux dont le calcul est plus facile a obtenir de la firme que la justification des prix eux-memes. On s'apercoit d'ailleurs que, bien qu'axee essentiellement sur les pertes, cette analyse globale peut conduire a une meilleure utilisation d'autres facteurs de production. On donne un expose theorique et des exemples pratiques de cette methode d'optimisation economique dans le cadre de la fabrication d'elements combustibles destines a des reacteurs du type: uranium naturel, moderes au graphite et refroidis par le gaz carbonique. (auteurs)

  14. Unsupervised Identification of Isotope-Labeled Peptides.

    Science.gov (United States)

    Goldford, Joshua E; Libourel, Igor G L

    2016-06-01

    In vivo isotopic labeling coupled with high-resolution proteomics is used to investigate primary metabolism in techniques such as stable isotope probing (protein-SIP) and peptide-based metabolic flux analysis (PMFA). Isotopic enrichment of carbon substrates and intracellular metabolism determine the distribution of isotopes within amino acids. The resulting amino acid mass distributions (AMDs) are convoluted into peptide mass distributions (PMDs) during protein synthesis. With no a priori knowledge on metabolic fluxes, the PMDs are therefore unknown. This complicates labeled peptide identification because prior knowledge on PMDs is used in all available peptide identification software. An automated framework for the identification and quantification of PMDs for nonuniformly labeled samples is therefore lacking. To unlock the potential of peptide labeling experiments for high-throughput flux analysis and other complex labeling experiments, an unsupervised peptide identification and quantification method was developed that uses discrete deconvolution of mass distributions of identified peptides to inform on the mass distributions of otherwise unidentifiable peptides. Uniformly (13)C-labeled Escherichia coli protein was used to test the developed feature reconstruction and deconvolution algorithms. The peptide identification was validated by comparing MS(2)-identified peptides to peptides identified from PMDs using unlabeled E. coli protein. Nonuniformly labeled Glycine max protein was used to demonstrate the technology on a representative sample suitable for flux analysis. Overall, automatic peptide identification and quantification were comparable or superior to manual extraction, enabling proteomics-based technology for high-throughput flux analysis studies. PMID:27145348

  15. Forensic odontology, Part 1. Dental identification.

    Science.gov (United States)

    Hinchliffe, J

    2011-03-12

    This series is based upon fact, experience, and some personal views of the author and gives a brief glimpse of forensic odontological issues with regard to the identification of human remains (to include mass fatality incidents), biting injuries and child abuse. The aim of the first paper is to give the reader greater understanding of the role of the forensic odontologist in the identification of human remains, and emphasise the importance of keeping good quality, accurate and comprehensive dental records. Identification of the deceased greatly assists families and friends at this difficult time, as well as aiding law enforcement agencies; getting it wrong is devastating to families and unacceptable. The dental identification process must be carefully undertaken and relies upon the comparison of information from the antemortem record with findings from the postmortem examination, and the efficiency of this process is dependent on the quality and availability of the dental record. As dental team members it is our responsibility to keep and maintain accurate records of our patients. The resilience of the dental structures to postmortem assault, denture labelling, and teeth as a source of DNA, all contribute to making identification successful. Dental identification is widely used, not only in the single fatality situation, but also in mass fatality incidents and cases of missing persons. PMID:21394152

  16. Pitch Correlogram Clustering for Fast Speaker Identification

    Directory of Open Access Journals (Sweden)

    Nitin Jhanwar

    2004-12-01

    Full Text Available Gaussian mixture models (GMMs are commonly used in text-independent speaker identification systems. However, for large speaker databases, their high computational run-time limits their use in online or real-time speaker identification situations. Two-stage identification systems, in which the database is partitioned into clusters based on some proximity criteria and only a single-cluster GMM is run in every test, have been suggested in literature to speed up the identification process. However, most clustering algorithms used have shown limited success, apparently because the clustering and GMM feature spaces used are derived from similar speech characteristics. This paper presents a new clustering approach based on the concept of a pitch correlogram that captures frame-to-frame pitch variations of a speaker rather than short-time spectral characteristics like cepstral coefficient, spectral slopes, and so forth. The effectiveness of this two-stage identification process is demonstrated on the IVIE corpus of 110 speakers. The overall system achieves a run-time advantage of 500% as well as a 10% reduction of error in overall speaker identification.

  17. Identification of veterinary pathogens by use of commercial identification systems and new trends in antimicrobial susceptibility testing of veterinary pathogens.

    OpenAIRE

    Watts, J. L.; Yancey, R J

    1994-01-01

    Veterinary diagnostic microbiology is a unique specialty within microbiology. Although isolation and identification techniques are similar to those used for human pathogens, many veterinary pathogens require unique cultivation or identification procedures. Commercial identification systems provide rapid, accurate identification of human pathogens. However, the accuracy of these systems with veterinary pathogens varies widely depending on the bacterial species and the host animal from which it...

  18. Direction Identification System of Garlic Clove Based on Machine Vision

    OpenAIRE

    Gao Chi; Gao Hui

    2013-01-01

    In order to fulfill the requirements of seeding direction of garlic cloves, the paper proposed a research method of garlic clove direction identification based on machine vision, it expounded the theory of garlic clove direction identification, stated the arithmetic of it, designed the direction identification device of it, then developed the control system of garlic clove direction identification based on machine vision, at last tested the garlic clove direction identification, and the resul...

  19. Modal and wave load identification by ARMA calibration

    Energy Technology Data Exchange (ETDEWEB)

    Jensen, J.L.; Kirkegaard, P.H.; Brincker, R.

    1990-10-01

    In this paper modal parameter as well as wave load identification by calibration of ARMA models is considered for a simple offshore structure. The theory of modal identification by ARMA calibration is presented as an identification technique which also can be applied for non-white excitation. Furthermore, an approach for identification of the wave load process is proposed. The presented identification approach is illustrated and confirmed by an experimental example of a mono pile model excited by random waves. (au) 14 refs.

  20. Metabolismo oxidativo dos neutrófilos de bezerros das raças Nelore e Limousin nos primeiros quatro meses de vida Neutrophil oxidative burst in Nelore and Limousin calves in the first four months of life

    Directory of Open Access Journals (Sweden)

    Márcio Carvalho da Costa

    2008-09-01

    Full Text Available Com o objetivo de investigar alguns mecanismos de defesa em bezerros de raças de corte criadas a campo, foram utilizados 90 animais recém-nascidos aparentemente sadios, 45 da raça Nelore e 45 da raça Limousin. Amostras de sangue foram colhidas de cada bezerro entre 24 e 36 horas de vida e aos 15, 30, 60, 90 e 120 dias. Determinaram-se o leucograma e o metabolismo oxidativo dos neutrófilos por meio do teste da redução do tetrazólio de nitroazul (NBT, provas não estimulada (NBT-NE e estimulada (NBT-E. Investigou-se a taxa de parasitemia determinada por Anaplasma marginale, Babesia bigemina e B. bovis. Utilizou-se a análise de variância de medidas repetidas para estudar o comportamento das variáveis hematológicas com o avançar da idade. O teste de Krushkal-Wallis foi empregado para caracterizar a variação da porcentagem de neutrófilos reativos relacionada à idade. Comparações entre as raças foram realizadas em cada idade por meio do teste de Mann-Whithney. A contagem total de leucócitos aumentou com a idade nas duas raças estudadas. Observou-se diminuição do número de neutrófilos e aumento do de linfócitos, ocorrendo sua inversão antes dos 15 dias de idade. A capacidade oxidativa dos neutrófilos foi menor nos bezerros recém-nascidos e aumentou com o avançar da idade. Os neutrófilos dos bezerros Limousin apresentaram maior capacidade de redução do NBT do que os dos bezerros Nelore, notadamente após o segundo mês de vida. Essa diferença não provocou reflexos sobre a saúde dos animais e pode ser resultado da infecção natural e assintomática com o Anaplasma marginale.To study some defence mechanisms of beef calves kept on range conditions, 90 healthy calves, 45 Nelore and 45 Limousin, were bled at 24 to 36 hours of life, 15, 30, 60, 90 and, 120 days. Leukogram and neutrophil oxidative burst through the non-stimulated and the stimulated NBT tests were determined. The parasitemia with Anaplasma marginale

  1. Problem of ticks and tick-borne diseases in India with special emphasis on progress in tick control research: A review

    Directory of Open Access Journals (Sweden)

    Srikant Ghosh

    2014-12-01

    Full Text Available Ticks, as vectors of several zoonotic diseases, are ranked second only to mosquitoes as vectors. The diseases spread by ticks are a major constraint to animal productivity while causing morbidity and mortality in both animals and humans. A number of tick species have been recognised since long as vectors of lethal pathogens, viz. Crimean-Congo haemorrhagic fever virus (CCHFV, Kyasanur forest disease virus (KFDV, Babesia spp, Theileria, Rickettsia conorii, Anaplasma marginale, etc. and the damages caused by them are well-recognised. There is a need to reassess the renewed threat posed by the tick vectors and to prioritize the tick control research programme. This review is focused on the major tick-borne human and animal diseases in India and the progress in vector control research with emphasis on acaricide resistance, tick vaccine and the development of potential phytoacaricides as an integral part of integrated tick control programme.

  2. Problem of ticks and tick-borne diseases in India with special emphasis on progress in tick control research: a review.

    Science.gov (United States)

    Ghosh, Srikant; Nagar, Gaurav

    2014-12-01

    Ticks, as vectors of several zoonotic diseases, are ranked second only to mosquitoes as vectors. The diseases spread by ticks are a major constraint to animal productivity while causing morbidity and mortality in both animals and humans. A number of tick species have been recognised since long as vectors of lethal pathogens, viz. Crimean-Congo haemorrhagic fever virus (CCHFV), Kyasanur forest disease virus (KFDV), Babesia spp, Theileria, Rickettsia conorii, Anaplasma marginale, etc. and the damages caused by them are well-recognised. There is a need to reassess the renewed threat posed by the tick vectors and to prioritize the tick control research programme. This review is focused on the major tick-borne human and animal diseases in India and the progress in vector control research with emphasis on acaricide resistance, tick vaccine and the development of potential phytoacaricides as an integral part of integrated tick control programme. PMID:25540956

  3. Dicty_cDB: Contig-U16018-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available mutS; &CP000... 206 2e-51 CU466930_904( CU466930 |pid:none) Candidatus Cloacamonas acidamin... 0.003 4 ( EJ949244 ) 1093018932931 Global-Ocean-Sampling_GS-30-02-01-1... 34 0.004 4 ( CP000409 ) Rickettsia canad...00... 225 3e-57 CP001079_272( CP001079 |pid:none) Anaplasma marginale str. Florida... 225 3e-57 (Q3Z767) RecName: Full=DNA mi...bacterial Mu... 196 1e-48 AF220055_1( AF220055 |pid:none) Pseudomonas aeruginosa mismatch re... 196 1e-48 (A1V5I2) RecNam...KNLDETPHIKCYCLAIQEDEDEILFTHKIVPGM SNKSYGIFCAKMAGIPNTVLERSKSILFEFESNNKLNFNKNKIKKN*kk Translated Amino Acid sequence (All Frames) Fram

  4. Fatal parasitosis in blackbucks (Antilope cervicapra: a possible factor risk in hunting units

    Directory of Open Access Journals (Sweden)

    Ned de la Cruz-Hernández

    2015-11-01

    Full Text Available In February 2012, a reproductive group of 60 adult blackbucks (Antilope cervicapra from Veracruz, Mexico was relocated to hunting units in eastern and northeastern Mexico. Seven individuals died due to hemorrhagic parasitic, abomasitis and enteritis caused by Haemonchus spp., Setaria spp., and Trichostrongylids. Deaths were associated with hepatic necrosis, bilateral congestive distention of heart and fibrinonecrotic bronchopneumonia. Also Anaplasma marginale was identified. The blackbucks’ population displayed a general mortality rate of 11.67%, where 25% of total male and 9.62% of total female died. The mortality was controlled by segregation of all remaining blackbucks and the treatment for internal and external parasites (biting flies and ticks. After the treatment, no fatality cases related to parasitosis were recorded. The results presented here exhibit the high relevance of parasitosis as possible factor risk in the survival of tis specie.

  5. Influence of dipping practices on the seroprevalence of babesiosis and anaplasmosis in the foot-and-mouth disease buffer zone adjoining the Kruger National Park in South Africa

    Directory of Open Access Journals (Sweden)

    K.B. Stevens

    2007-09-01

    Full Text Available A serological survey of bovine babesiosis and anaplasmosis was conducted in the foot-and-mouth disease buffer zone surrounding the Kruger National Park in South Africa between 2001 and 2003 to determine whether the withdrawal of government-subsidized dipping in certain regions had affected the seroprevalence of these tick-borne diseases. Seroprevalence of Anaplasma marginale and Babesia bovis increased during the study period. This increase was greater in Limpopo Province where farmers had to supply their own acaricide than in Mpumalanga Province where dipping materials were provided by the local Veterinary Services. The number of animals testing positive for B. bigemina decreased in both provinces during the study period, which was attributed to possible vector displacement rather than more effective tick control measures. Responses to a questionnaire on ticks and tick-borne diseases revealed local knowledge on the subject to be highly variable and sometimes incorrect.

  6. Applications of surface metrology in firearm identification

    International Nuclear Information System (INIS)

    Surface metrology is commonly used to characterize functional engineering surfaces. The technologies developed offer opportunities to improve forensic toolmark identification. Toolmarks are created when a hard surface, the tool, comes into contact with a softer surface and causes plastic deformation. Toolmarks are commonly found on fired bullets and cartridge cases. Trained firearms examiners use these toolmarks to link an evidence bullet or cartridge case to a specific firearm, which can lead to a criminal conviction. Currently, identification is typically based on qualitative visual comparison by a trained examiner using a comparison microscope. In 2009, a report by the National Academies called this method into question. Amongst other issues, they questioned the objectivity of visual toolmark identification by firearms examiners. The National Academies recommended the development of objective toolmark identification criteria and confidence limits. The National Institute of Standards and Technology (NIST) have applied its experience in surface metrology to develop objective identification criteria, measurement methods, and reference artefacts for toolmark identification. NIST developed the Standard Reference Material SRM 2460 standard bullet and SRM 2461 standard cartridge case to facilitate quality control and traceability of identifications performed in crime laboratories. Objectivity is improved through measurement of surface topography and application of unambiguous surface similarity metrics, such as the maximum value (ACCFMAX) of the areal cross correlation function. Case studies were performed on consecutively manufactured tools, such as gun barrels and breech faces, to demonstrate that, even in this worst case scenario, all the tested tools imparted unique surface topographies that were identifiable. These studies provide scientific support for toolmark evidence admissibility in criminal court cases. (paper)

  7. Applications of surface metrology in firearm identification

    Science.gov (United States)

    Zheng, X.; Soons, J.; Vorburger, T. V.; Song, J.; Renegar, T.; Thompson, R.

    2014-01-01

    Surface metrology is commonly used to characterize functional engineering surfaces. The technologies developed offer opportunities to improve forensic toolmark identification. Toolmarks are created when a hard surface, the tool, comes into contact with a softer surface and causes plastic deformation. Toolmarks are commonly found on fired bullets and cartridge cases. Trained firearms examiners use these toolmarks to link an evidence bullet or cartridge case to a specific firearm, which can lead to a criminal conviction. Currently, identification is typically based on qualitative visual comparison by a trained examiner using a comparison microscope. In 2009, a report by the National Academies called this method into question. Amongst other issues, they questioned the objectivity of visual toolmark identification by firearms examiners. The National Academies recommended the development of objective toolmark identification criteria and confidence limits. The National Institute of Standards and Technology (NIST) have applied its experience in surface metrology to develop objective identification criteria, measurement methods, and reference artefacts for toolmark identification. NIST developed the Standard Reference Material SRM 2460 standard bullet and SRM 2461 standard cartridge case to facilitate quality control and traceability of identifications performed in crime laboratories. Objectivity is improved through measurement of surface topography and application of unambiguous surface similarity metrics, such as the maximum value (ACCFMAX) of the areal cross correlation function. Case studies were performed on consecutively manufactured tools, such as gun barrels and breech faces, to demonstrate that, even in this worst case scenario, all the tested tools imparted unique surface topographies that were identifiable. These studies provide scientific support for toolmark evidence admissibility in criminal court cases.

  8. Multimodal Person Re-identification Using RGB-D Sensors and a Transient Identification Database

    DEFF Research Database (Denmark)

    Møgelmose, Andreas; Moeslund, Thomas B.; Nasrollahi, Kamal

    2013-01-01

    This paper describes a system for person re-identification using RGB-D sensors. The system covers the full flow, from detection of subjects, over contour extraction, to re-identification using soft biometrics. The biometrics in question are part-based color histograms and the subjects height...

  9. Perceived Justice and Group Identification The Moderating Role of Previous Identification

    NARCIS (Netherlands)

    Lipponen, Jukka; Wisse, Barbara; Perala, Janne

    2011-01-01

    Temporal dynamics have hardly been considered in the fields of organizational justice and group identification, yet addressing intra-individual change trajectories over time may lead to a fuller understanding of the relationship between justice and identification. Therefore, this study investigated

  10. Application of mass spectrometry for metabolite identification.

    Science.gov (United States)

    Ma, Shuguang; Chowdhury, Swapan K; Alton, Kevin B

    2006-06-01

    Metabolism studies play a pivotal role in drug discovery and development. Characterization of metabolic "hot-spots" as well as reactive and pharmacologically active metabolites is critical to designing new drug candidates with improved metabolic stability, toxicological profile and efficacy. Metabolite identification in the preclinical species used for safety evaluation is required in order to determine whether human metabolites have been adequately tested during non-clinical safety assessment. From an instrumental standpoint, high performance liquid chromatography (HPLC) coupled with mass spectrometry (MS) dominates all analytical tools used for metabolite identification. The general strategies employed for metabolite identification in both drug discovery and drug development settings together with sample preparation techniques are reviewed herein. These include a discussion of the various ionization methods, mass analyzers, and tandem mass spectrometry (MS/MS) techniques that are used for structural characterization in a modern drug metabolism laboratory. Mass spectrometry-based techniques, such as stable isotope labeling, on-line H/D exchange, accurate mass measurement to enhance metabolite identification and recent improvements in data acquisition and processing for accelerating metabolite identification are also described. Rounding out this review, we offer additional thoughts about the potential of alternative and less frequently used techniques such as LC-NMR/MS, CRIMS and ICPMS. PMID:16787159

  11. Radioisotopes Identification Algorithm Based on Generic Database

    International Nuclear Information System (INIS)

    The homeland security market is seeking for advanced radiation detectors with improved isotope identification capability. This need is increasing due to the operational difficulties derived by the high probability of innocent alarm shielding and masking scenarios. The identification algorithm should focus on discrimination between Naturally Occurring radioactive Material (NORM) and medical isotopes from industrial sources or Special Nuclear Materials (SNM) following the standards for HLS. The SpecIdentifier software application developed to provide spectrum analysis and identification solutions for various types of detectors. The key requirement is identification of radio-isotopes included in standards for spectroscopic radiation detectors (SPRD).The process of isotope identification is based on spectrum analysis leaning on multi-parametric tests. The parameters include Peak-to-Compton ratio, FWHM (resolution), gain and other values. However, many obstacles are in the way to the proper determination of each parameter: Peak-to-Compton ratio varies with scintillator’s geometry; spectrum shape and resolution vary with scintillator’s physical properties; temperature dependency of scintillation light yield result in gain instability; non-proportionality in light yield as function of incident gamma energy; high count rates results in shift the calibration relation (gain)(4,5). These and other obstacles are considered by the proposed approach to the spectrum analysis and are implemented in the SpecIdentifier software

  12. Nosewitness identification: effects of negative emotion.

    Science.gov (United States)

    Alho, Laura; Soares, Sandra C; Ferreira, Jacqueline; Rocha, Marta; Silva, Carlos F; Olsson, Mats J

    2015-01-01

    Every individual has a unique body odor (BO), similar to a fingerprint. In forensic research, identification of culprit BOs has been performed by trained dogs, but not by humans. We introduce the concept of nosewitness identification and present the first experimental results on BO memory in witness situations involving violent crimes. Two experiments indicated that BO associated with male characters in authentic videos could later be identified in BO lineup tests well above chance. Moreover, culprit BO in emotional crime videos could be identified considerably better than the BO of a male person in neutral videos. This indicates that nosewitness identification benefits from emotional encoding. Altogether, the study testifies to the virtue of body odor as a cue to identify individuals observed under negative emotion. PMID:25612211

  13. Modal Indicators for Operational Modal Identification

    DEFF Research Database (Denmark)

    Zhang, L.; Brincker, Rune; Andersen, P.

    2001-01-01

    Modal validation is of paramount importance for all two-stage time domain modal identification algorithms. However, due to a higher noise/signal ratio in operational/ambient modal analysis, being able to determine the right model order and to distinguish between structural modes and computational...... Realization Algorithm (ERA). The three identification algorithms are implemented from a unified point-of-view with the modal indicators. Numerical simulations are conducted on a two-story building structure and on an aircraft model and it is investigated how the modal indicators work to distinguish the...... modes become more significant than in traditional modal analysis. The two major modal indicators, i.e. Modal Confidence Factor (MCF) and Modal Amplitude Coherence (MAmC) are extended to two-stage time domain modal identification algorithms, together with a newly developed indicator, named as Modal...

  14. Modeling and Identification of Multirate Systems

    Institute of Scientific and Technical Information of China (English)

    Feng DING; Tongwen CHEN

    2005-01-01

    Multirate systems are abundant in industry; for example, many soft-sensor design problems are related to modeling, parameter identification, or state estimation involving multirate systems. The study of multirate systems goes back to the early 1950's, and has become an active research area in systems and control. This paper briefly surveys the history of development in the area of multirate systems, and introduces some basic concepts and latest results on multirate systems, including a polynomial transformation technique and the lifting technique as tools for handling multirate systems, lifted state space models, parameter identification of dual-rate systems, how to determine fast single-rate models from dual-rate models and directly from dual-rate data, and a hierarchical identification method for general multirate systems. Finally, some further research topics for multirate systems are given.

  15. Structural damage identification using mathematical optimization techniques

    Science.gov (United States)

    Shen, Mo-How Herman

    1991-01-01

    An identification procedure is proposed to identify damage characteristics (location and size of the damage) from dynamic measurements. This procedure was based on minimization of the mean-square measure of difference between measurement data (natural frequencies and mode shapes) and the corresponding predictions obtained from the computational model. The procedure is tested for simulated damage in the form of stiffness changes in a simple fixed free spring mass system and symmetric cracks in a simply supported Bernoulli Euler beam. It is shown that when all the mode information is used in the identification procedure it is possible to uniquely determine the damage properties. Without knowing the complete set of modal information, a restricted region in the initial data space has been found for realistic and convergent solution from the identification process.

  16. An efficient automatic firearm identification system

    Science.gov (United States)

    Chuan, Zun Liang; Liong, Choong-Yeun; Jemain, Abdul Aziz; Ghani, Nor Azura Md.

    2014-06-01

    Automatic firearm identification system (AFIS) is highly demanded in forensic ballistics to replace the traditional approach which uses comparison microscope and is relatively complex and time consuming. Thus, several AFIS have been developed for commercial and testing purposes. However, those AFIS are still unable to overcome some of the drawbacks of the traditional firearm identification approach. The goal of this study is to introduce another efficient and effective AFIS. A total of 747 firing pin impression images captured from five different pistols of same make and model are used to evaluate the proposed AFIS. It was demonstrated that the proposed AFIS is capable of producing firearm identification accuracy rate of over 95.0% with an execution time of less than 0.35 seconds per image.

  17. Semantic Identification: Balancing between Complexity and Validity

    Directory of Open Access Journals (Sweden)

    Falelakis M

    2006-01-01

    Full Text Available An efficient scheme for identifying semantic entities within data sets such as multimedia documents, scenes, signals, and so forth, is proposed in this work. Expression of semantic entities in terms of syntactic properties is modelled with appropriately defined finite automata, which also model the identification procedure. Based on the structure and properties of these automata, formal definitions of attained validity and certainty and also required complexity are defined as metrics of identification efficiency. The main contribution of the paper relies on organizing the identification and search procedure in a way that maximizes its validity for bounded complexity budgets and reversely minimizes computational complexity for a given required validity threshold. The associated optimization problem is solved by using dynamic programming. Finally, a set of experiments provides insight to the introduced theoretical framework.

  18. Identification methods for structural health monitoring

    CERN Document Server

    Papadimitriou, Costas

    2016-01-01

    The papers in this volume provide an introduction to well known and established system identification methods for structural health monitoring and to more advanced, state-of-the-art tools, able to tackle the challenges associated with actual implementation. Starting with an overview on fundamental methods, introductory concepts are provided on the general framework of time and frequency domain, parametric and non-parametric methods, input-output or output only techniques. Cutting edge tools are introduced including, nonlinear system identification methods; Bayesian tools; and advanced modal identification techniques (such as the Kalman and particle filters, the fast Bayesian FFT method). Advanced computational tools for uncertainty quantification are discussed to provide a link between monitoring and structural integrity assessment. In addition, full scale applications and field deployments that illustrate the workings and effectiveness of the introduced monitoring schemes are demonstrated.

  19. Space station configuration and flight dynamics identification

    Science.gov (United States)

    Metter, E.; Milman, M. H.

    1985-01-01

    The Space Station will be assembled in low earth orbit by a combination of deployable and space erectable modules that are progressively integrated during successive flights of the Shuttle. The crew assisted space construction will result in a configuration which is a large scale composite of structural elements having connectivity with a wide range of possible end conditions and imprecisely known dynamic characteristics. The generic applications of Flight Dynamics Identification to the candidate Space Station configurations currently under consideration are described. Identification functions are categorized, and the various methods for extracting parameter estimates are correlated with the sensing of parameter estimates are correlated with the sensing of specific characteristics of interest to both engineering subsystems and users of the Station's commercial and scientific facilities. Onboard implementation architecture and constraints are discussed from the viewpoint of maximizing integration of the Identification process with the flight subsystem's data and signal flow.

  20. Language identification using spectral and prosodic features

    CERN Document Server

    Rao, K Sreenivasa; Maity, Sudhamay

    2015-01-01

    This book discusses the impact of spectral features extracted from frame level, glottal closure regions, and pitch-synchronous analysis on the performance of language identification systems. In addition to spectral features, the authors explore prosodic features such as intonation, rhythm, and stress features for discriminating the languages. They present how the proposed spectral and prosodic features capture the language specific information from two complementary aspects, showing how the development of language identification (LID) system using the combination of spectral and prosodic features will enhance the accuracy of identification as well as improve the robustness of the system. This book provides the methods to extract the spectral and prosodic features at various levels, and also suggests the appropriate models for developing robust LID systems according to specific spectral and prosodic features. Finally, the book discuss about various combinations of spectral and prosodic features, and the desire...

  1. Stimulus probability effects in absolute identification.

    Science.gov (United States)

    Kent, Christopher; Lamberts, Koen

    2016-05-01

    This study investigated the effect of stimulus presentation probability on accuracy and response times in an absolute identification task. Three schedules of presentation were used to investigate the interaction between presentation probability and stimulus position within the set. Data from individual participants indicated strong effects of presentation probability on both proportion correct and response times. The effects were moderated by the ubiquitous stimulus position effect. The accuracy and response time data were predicted by an exemplar-based model of perceptual cognition (Kent & Lamberts, 2005). The bow in discriminability was also attenuated when presentation probability for middle items was relatively high, an effect that will constrain future model development. The study provides evidence for item-specific learning in absolute identification. Implications for other theories of absolute identification are discussed. (PsycINFO Database Record PMID:26478959

  2. TIPP: taxonomic identification and phylogenetic profiling

    Science.gov (United States)

    Nguyen, Nam-phuong; Mirarab, Siavash; Liu, Bo; Pop, Mihai; Warnow, Tandy

    2014-01-01

    Motivation: Abundance profiling (also called ‘phylogenetic profiling’) is a crucial step in understanding the diversity of a metagenomic sample, and one of the basic techniques used for this is taxonomic identification of the metagenomic reads. Results: We present taxon identification and phylogenetic profiling (TIPP), a new marker-based taxon identification and abundance profiling method. TIPP combines SAT\\'e-enabled phylogenetic placement a phylogenetic placement method, with statistical techniques to control the classification precision and recall, and results in improved abundance profiles. TIPP is highly accurate even in the presence of high indel errors and novel genomes, and matches or improves on previous approaches, including NBC, mOTU, PhymmBL, MetaPhyler and MetaPhlAn. Availability and implementation: Software and supplementary materials are available at http://www.cs.utexas.edu/users/phylo/software/sepp/tipp-submission/. Contact: warnow@illinois.edu Supplementary information: Supplementary data are available at Bioinformatics online. PMID:25359891

  3. NP Animacy Identification for Anaphora Resolution

    CERN Document Server

    Evans, R J; 10.1613/jair.2179

    2011-01-01

    In anaphora resolution for English, animacy identification can play an integral role in the application of agreement restrictions between pronouns and candidates, and as a result, can improve the accuracy of anaphora resolution systems. In this paper, two methods for animacy identification are proposed and evaluated using intrinsic and extrinsic measures. The first method is a rule-based one which uses information about the unique beginners in WordNet to classify NPs on the basis of their animacy. The second method relies on a machine learning algorithm which exploits a WordNet enriched with animacy information for each sense. The effect of word sense disambiguation on the two methods is also assessed. The intrinsic evaluation reveals that the machine learning method reaches human levels of performance. The extrinsic evaluation demonstrates that animacy identification can be beneficial in anaphora resolution, especially in the cases where animate entities are identified with high precision.

  4. Cheiloscopy : An aid for personal identification

    Directory of Open Access Journals (Sweden)

    Rashmi Venkatesh

    2011-01-01

    Full Text Available Aim: Cheiloscopy is a forensic investigation technique that deals with identification of humans based on lips traces. The aim of this study is to establish the uniqueness of lip prints which aids in personal identification. Materials and Methods: The study group comprised of 200 subjects.The materials used were dark-colored lipstick, paper, cellophane tape, a brush, and a magnifying lens. Results: This study shows that lip prints are unique and permanent for each individual, and the lip prints among family members and between twins revealed different patterns on the whole with few similar grooves suggesting the existence of heredity in the lip prints. Conclusion: Our study showed that lip prints are unique to each individual and can be used for personal identification.

  5. Enhancing Privacy for Biometric Identification Cards

    CERN Document Server

    Balanoiu, Paul

    2010-01-01

    Most developed countries have started the implementation of biometric electronic identification cards, especially passports. The European Union and the United States of America struggle to introduce and standardize these electronic documents. Due to the personal nature of the biometric elements used for the generation of these cards, privacy issues were raised on both sides of the Atlantic Ocean, leading to civilian protests and concerns. The lack of transparency from the public authorities responsible with the implementation of such identification systems, and the poor technological approaches chosen by these authorities, are the main reasons for the negative popularity of the new identification methods. The following article shows an approach that provides all the benefits of modern technological advances in the fields of biometrics and cryptography, without sacrificing the privacy of those that will be the beneficiaries of the new system.

  6. Forensic Identification Based on Tooth Material

    Directory of Open Access Journals (Sweden)

    Elza Ibrahim Auerkari

    2015-10-01

    Full Text Available Human teeth are the most robust and stable parts of the body, providing biological clue material for forensic purposes even when most of the oter means of identifcation have been seriously affected by adverse environmental conditions. In particular blood grouping, isozymes, serum proteins and DNA polymorhphisms can be detected from teeth that protect these identification markers in addition to the traditional dental records. While in general the value of traditional dental records in the forensic work is decreasing eg due to mproved dental care, the newer means of identification from tooth material provide considerable promise for effective identification in difficult cases.The DNA analysis from tooth material has been shown to ba a viable route in forensic analysis, when other material for such an analysis is unusable. However in most cases useful biologic material other than teeth is abailable, and then DNA analysis can be made from other tissue with less effort than by using teeth. Also, in cases with lacking other tissue, blood grouping, isozymes and serum proteins may provide cheaper inherited combinations of blood grouping, isozymes and serum proteins can be treated similary to polymorphic DNA loci as independent markers, their identification can be managed if the false positives and negatives in analysis can be minimmised, and the corresponding frequencies of occurrence are known.It was the purpose of the present work to review the methods of forensic identification from tooth material, based on analysis of blood grouping, isozymes and serum proteins. It appears that such a combined analysis provides a robust method for forensic purposes. Nevertheless, for efficient identification it is recommended that as many (multiple forensic methods as possible are combined, so that faster and cheaper methods such as imminent medical forensics are used first, and more thorough analysis is used to support and complement these methods.

  7. Oil pollution identification and dating

    International Nuclear Information System (INIS)

    different samples with the relative abundance of these compounds. The next figure shows the decision chart of this method. Relative age determination is an important element to determine the pollution flow through the soil. The age of an organic pollution is determined through its biodegradation. In order to make a relative age determination of the pollution, Gallia Sana calculates the rates of Pristane/C17 and Phytane/C18 in different samples. If rates are similar, the age is the same. Gallia Sana's conclusions are summarized in 3 observations: - Chromatographic analysis showed that the pollution was due to heating fuel. - The identification using the NTCHEM001 method proved that the heating fuel was the same everywhere in the soil. So it comes from 1 source. - The relative age determination indicates that the pollution originated at 1 specific moment in time (1 incident). So, the soil pollution is due to an accidental flow from the fuel tank next to the zone

  8. Agency, Simulation and Self-identification

    OpenAIRE

    Jeannerod, Marc; Pacherie, Elisabeth

    2004-01-01

    This paper is concerned with the problem of self-identification in the domain of action. We claim that this problem can arise not just for the self as object, but also for the self as subject in the ascription of agency. We discuss and evaluate some proposals concerning the mechanisms involved in self-identification and in agency-ascription, and their possible impairments in pathological cases. We argue in favor of a simulation hypothesis that claims that actions, whether overt or covert, are...

  9. Improved System Identification Approach Using Wavelet Networks

    Institute of Scientific and Technical Information of China (English)

    石宏理; 蔡远利; 邱祖廉

    2005-01-01

    A new approach is proposed to improve the general identification algorithm of multidimensional systems using wavelet networks. The general algorithm involves mapping vector input into its norm to avoid problem of dimensionality in construction multidimensional wavelet basis functions. Thus, the basis functions are spherically symmetric without direction selectivity. In order to restore the direction selectivity, the improved approach weights the input variables before mapping it into a scalar form. The weights can be obtained using universal optimization algorithms. Generally, only local optimal weights are obtained. Even so, performance of identification can be improved.

  10. On System Identification of Wind Turbines

    DEFF Research Database (Denmark)

    Kirkegaard, Poul Henning; Perisic, Nevena; Pedersen, B.J.

    operational model analysis (OMA) methodology can provide accurate estimates of the natural frequencies, damping ratios and mode shapes of the systems as long as the measurements have a low noise to signal ratio. However, in order to take information about the wind turbine into account a grey...... case of black-box identification no "physical" model structure is assumed and a large number of parameters have to be defined by the identification techniques. For the identified black-box models, it is difficult to perform model analysis since the internal states are not known to the user. The...

  11. Identification of hadronic tau decays in CMS

    Science.gov (United States)

    Venditti, Rosamaria

    2015-05-01

    The algorithm used for reconstruction and identification of hadronic tau decays by the CMS experiment at the LHC is presented. The tau reconstruction in CMS takes advantage of the particle-flow algorithm which allows to reconstruct individual hadronic decay modes. The performance of the algorithm in terms of tau identification efficiency and rates for jets to be misidentified as hadronic tau decays is measured in pp collision data recorded in 2012 at a center-of-mass energy of 8 TeV, corresponding to an integrated luminosity of 19.7 fb-1

  12. Identification of hadronic tau decays in CMS

    Directory of Open Access Journals (Sweden)

    Venditti Rosamaria

    2015-01-01

    Full Text Available The algorithm used for reconstruction and identification of hadronic tau decays by the CMS experiment at the LHC is presented. The tau reconstruction in CMS takes advantage of the particle-flow algorithm which allows to reconstruct individual hadronic decay modes. The performance of the algorithm in terms of tau identification efficiency and rates for jets to be misidentified as hadronic tau decays is measured in pp collision data recorded in 2012 at a center-of-mass energy of 8 TeV, corresponding to an integrated luminosity of 19.7 fb−1

  13. Identification of hadronic tau decays in CMS

    OpenAIRE

    Venditti Rosamaria

    2015-01-01

    The algorithm used for reconstruction and identification of hadronic tau decays by the CMS experiment at the LHC is presented. The tau reconstruction in CMS takes advantage of the particle-flow algorithm which allows to reconstruct individual hadronic decay modes. The performance of the algorithm in terms of tau identification efficiency and rates for jets to be misidentified as hadronic tau decays is measured in pp collision data recorded in 2012 at a center-of-mass energy of 8 TeV, correspo...

  14. Particle Identification between Kaon and Pion

    CERN Document Server

    Nakamura, Kazuhiro

    2016-01-01

    Particle identification (PID) is important in LHCb as it enables to distinguish among several par- ticles. Hadronic particle identification is achieved using the information coming from the two Ring Imaging Cherenkov Detectors (RICH) and the tracking system. In this project, to tune the Monte Carlo (MC) to the real data, comparing between the real data and MC was conducted. And also as the first step for the tuning, three part of cut was applied for the number of tracks and then other quantities were compared between real data and MC.

  15. Nuclear fuel assembly identification using computer vision

    International Nuclear Information System (INIS)

    A new method of identifying fuel assemblies has been developed. The method uses existing in-cell TV cameras to read the notch-coded handling sockets of Fast Flux Test Facility (FFTF) assemblies. A computer looks at the TV image, locates the notches, decodes the notch pattern, and produces the identification number. A TV camera is the only in-cell equipment required, thus avoiding complex mechanisms in the hot cell. Assemblies can be identified in any location where the handling socket is visible from the camera. Other advantages include low cost, rapid identification, low maintenance, and ease of use

  16. False discovery rates in spectral identification

    Directory of Open Access Journals (Sweden)

    Jeong Kyowon

    2012-11-01

    Full Text Available Abstract Automated database search engines are one of the fundamental engines of high-throughput proteomics enabling daily identifications of hundreds of thousands of peptides and proteins from tandem mass (MS/MS spectrometry data. Nevertheless, this automation also makes it humanly impossible to manually validate the vast lists of resulting identifications from such high-throughput searches. This challenge is usually addressed by using a Target-Decoy Approach (TDA to impose an empirical False Discovery Rate (FDR at a pre-determined threshold x% with the expectation that at most x% of the returned identifications would be false positives. But despite the fundamental importance of FDR estimates in ensuring the utility of large lists of identifications, there is surprisingly little consensus on exactly how TDA should be applied to minimize the chances of biased FDR estimates. In fact, since less rigorous TDA/FDR estimates tend to result in more identifications (at higher 'true' FDR, there is often little incentive to enforce strict TDA/FDR procedures in studies where the major metric of success is the size of the list of identifications and there are no follow up studies imposing hard cost constraints on the number of reported false positives. Here we address the problem of the accuracy of TDA estimates of empirical FDR. Using MS/MS spectra from samples where we were able to define a factual FDR estimator of 'true' FDR we evaluate several popular variants of the TDA procedure in a variety of database search contexts. We show that the fraction of false identifications can sometimes be over 10× higher than reported and may be unavoidably high for certain types of searches. In addition, we further report that the two-pass search strategy seems the most promising database search strategy. While unavoidably constrained by the particulars of any specific evaluation dataset, our observations support a series of recommendations towards maximizing the

  17. Structural damage assessment as an identification problem

    Science.gov (United States)

    Hajela, Prabhat; Soeiro, F. J.

    1989-01-01

    Damage assessment of structural assemblies is treated as an identification problem. A brief review of identification methods is first presented with particular focus on the output error approach. The use of numerical optimization methods in identifying the location and extent of damage in structures is studied. The influence of damage on eigenmode shapes and static displacements is explored as a means of formulating a measure of damage in the structure. Preliminary results obtained in this study are presented and special attention is directed at the shortcomings associated with the nonlinear programming approach to solving the optimization problem.

  18. Tau Lepton Reconstruction and Identification at ATLAS

    Directory of Open Access Journals (Sweden)

    Friedrich Felix

    2012-07-01

    Full Text Available Tau leptons play an important role in the physics program at the LHC. They are used in searches for new phenomena like the Higgs boson or Supersymmetry and in electroweak measurements. Identifying hadronically decaying tau leptons with good performance is an essential part of these analyses. We present the current status of the tau reconstruction and identification at the LHC with the ATLAS detector. The tau identification efficiencies and their systematic uncertainties are measured using W → τv and Z → ττ events, and compared with the predictions from Monte Carlo simulations.

  19. Identification of constitutive parameters for fractional viscoelasticity

    Science.gov (United States)

    Xiao, Zhao; Haitian, Yang; Yiqian, He

    2014-01-01

    This paper develops a numerical model to identify constitutive parameters in the fractional viscoelastic field. An explicit semi-analytical numerical model and a finite difference (FD) method based numerical model are derived for solving the direct homogenous and regionally inhomogeneous fractional viscoelastic problems, respectively. A continuous ant colony optimization (ACO) algorithm is employed to solve the inverse problem of identification. The feasibility of the proposed approach is illustrated via the numerical verification of a two-dimensional identification problem formulated by the fractional Kelvin-Voigt model, and the noisy data and regional inhomogeneity etc. are taken into account.

  20. Optimized Experiment Design for Marine Systems Identification

    DEFF Research Database (Denmark)

    Blanke, M.; Knudsen, Morten

    1999-01-01

    Simulation of maneuvring and design of motion controls for marine systems require non-linear mathematical models, which often have more than one-hundred parameters. Model identification is hence an extremely difficult task. This paper discusses experiment design for marine systems identification...... and proposes a sensitivity approach to solve the practical experiment design problem. The applicability of the sensitivity approach is demonstrated on a large non-linear model of surge, sway, roll and yaw of a ship. The use of the method is illustrated for a container-ship where both model and full...

  1. Signal trend identification with fuzzy methods

    International Nuclear Information System (INIS)

    A fuzzy-logic-based methodology for on-line signal trend identification is introduced. Although signal trend identification is complicated by the presence of noise, fuzzy logic can help capture important features of on-line signals and classify incoming power plant signals into increasing, decreasing and steady-state trend categories. In order to verify the methodology, a code named PROTREN is developed and tested using plant data. The results indicate that the code is capable of detecting transients accurately, identifying trends reliably, and not misinterpreting a steady-state signal as a transient one

  2. System Identification A Frequency Domain Approach

    CERN Document Server

    Pintelon, Rik

    2012-01-01

    System identification is a general term used to describe mathematical tools and algorithms that build dynamical models from measured data. Used for prediction, control, physical interpretation, and the designing of any electrical systems, they are vital in the fields of electrical, mechanical, civil, and chemical engineering. Focusing mainly on frequency domain techniques, System Identification: A Frequency Domain Approach, Second Edition also studies in detail the similarities and differences with the classical time domain approach. It high??lights many of the important steps in the identi

  3. [Identification of a body from dental findings].

    Science.gov (United States)

    Spyropoulos, N

    1989-01-01

    The author starts by briefly reviewing the meaning and applications of Forensic Dentistry emphasizing the ethical and legal responsibility of the dentist who is called upon by the police and the Service of Forensic Medicine to contribute to the identification of a dead person. Next, the author describes an interesting case where the identification was possible by documenting more than ten points coinciding between the dental record of the person suspected to be the dead and the findings from the examination of the oral cavity of the body. PMID:2519155

  4. DNA Bar-Coding for Phytoplasma Identification

    DEFF Research Database (Denmark)

    Makarova, Olga; Contaldo, Nicoletta; Paltrinieri, Samanta;

    2013-01-01

    Phytoplasma identi fi cation has proved dif fi cult due to their inability to be maintained in vitro. DNA barcoding is an identi fi cation method based on comparison of a short DNA sequence with known sequences from a database. A DNA barcoding tool has been developed for phytoplasma identi fi...... cation. While other sequencebased methods may be well adapted to identification of particular strains of phytoplasmas, often they cannot be used for the simultaneous identification of phytoplasmas from different groups. The phytoplasma DNA barcoding protocol in this chapter, based on the tuf and 16Sr...

  5. Access control and personal identification systems

    CERN Document Server

    Bowers, Dan M

    1988-01-01

    Access Control and Personal Identification Systems provides an education in the field of access control and personal identification systems, which is essential in selecting the appropriate equipment, dealing intelligently with vendors in purchases of the equipment, and integrating the equipment into a total effective system. Access control devices and systems comprise an important part of almost every security system, but are seldom the sole source of security. In order for the goals of the total system to be met, the other portions of the security system must also be well planned and executed

  6. On Markov parameters in system identification

    Science.gov (United States)

    Phan, Minh; Juang, Jer-Nan; Longman, Richard W.

    1991-01-01

    A detailed discussion of Markov parameters in system identification is given. Different forms of input-output representation of linear discrete-time systems are reviewed and discussed. Interpretation of sampled response data as Markov parameters is presented. Relations between the state-space model and particular linear difference models via the Markov parameters are formulated. A generalization of Markov parameters to observer and Kalman filter Markov parameters for system identification is explained. These extended Markov parameters play an important role in providing not only a state-space realization, but also an observer/Kalman filter for the system of interest.

  7. Proposing national identification number on dental prostheses as universal personal identification code - A revolution in forensic odontology.

    Science.gov (United States)

    Baad, Rajendra K; Belgaumi, Uzma; Vibhute, Nupura; Kadashetti, Vidya; Chandrappa, Pramod Redder; Gugwad, Sushma

    2015-01-01

    The proper identification of a decedent is not only important for humanitarian and emotional reasons, but also for legal and administrative purposes. During the reconstructive identification process, all necessary information is gathered from the unknown body of the victim and hence that an objective reconstructed profile can be established. Denture marking systems are being used in various situations, and a number of direct and indirect methods are reported. We propose that national identification numbers be incorporated in all removable and fixed prostheses, so as to adopt a single and definitive universal personal identification code with the aim of achieving a uniform, standardized, easy, and fast identification method worldwide for forensic identification. PMID:26005294

  8. Incorporation of radio frequency identification tag in dentures to facilitate recognition and forensic human identification.

    OpenAIRE

    Nuzzolese, E; Marcario, V; Di Vella, G

    2010-01-01

    Forensic identification using odontology is based on the comparison of ante-mortem and post mortem dental records. The insertion of a radio frequency identification (RFId) tag into dentures could be used as an aid to identify decomposed bodies, by storing personal identification data in a small transponder that can be radio-transmitted to a reader connected to a computer. A small passive, 12 x 2,1 mm, read-only RFId-tag was incorporated into the manufacture of three trial complete upper dentu...

  9. Evaluation of an indirect ELISA for the diagnosis of Babesia bovis in Uruguay

    International Nuclear Information System (INIS)

    In initially establishing the FAO/IAEA indirect ELISA for the detection of antibodies to Babesia bovis, the optical density (OD) values of sera from known positive or negative local cattle were compared to the OD values obtained from the negative and positive reference sera provided with the ELISA kit. The percentage of false positive and negative sera were 2.53% and 2.97% respectively. The cut-off values for the negative reference serum in the kit were compared with those of a local negative population. These values were found to be similar. The specificity of the test was evaluated by testing 30 sera from animals experimentally infected with Anaplasma marginale and 30 sera from animals infected with Babesia bigemina. These were no cross-reaction either between A. marginale and B. bovis or between B. bigemina and B. bovis. A serological survey using this ELISA kit was carried out on animals from an enzootic area and an area free from the vecot Boophilus microplus. 53 out of 282 animals (18.8%) in the enzootic area were positive whilst all the animals (113) from the free area were negative. This study would indicate that the FAO/IAEA ELISA kit has a sensitivity of around 98% and specificity of 97%. (author). 8 refs, 2 figs, 2 tabs

  10. Prevalence survey of selected bovine pathogens in water buffaloes in the north region of Brazil.

    Science.gov (United States)

    da Silva, Jenevaldo Barbosa; Dos Santos, Priscilla Nunes; de Santana Castro, Gustavo Nunes; da Fonseca, Adivaldo Henrique; Barbosa, José Diomedes

    2014-01-01

    Although the largest buffalo herd in the occident is in the north region of Brazil, few studies have been conducted to assess the prevalence of selected parasitic diseases in buffalo herd. The present study was therefore conducted to investigate the epidemiological of Toxoplasma gondii, Neospora caninum, Anaplasma marginale, Babesia bigemina, and Babesia bovis in water buffaloes in the north region of Brazil. A total of 4796 buffalo blood samples were randomly collected from five provinces and simultaneously analyzed by the IFAT and ELISA. The serological prevalence of T. gondii and N. caninum was 41.3% and 55.5% in ELISA and 35.7% and 48.8% in IFAT, respectively. The overall prevalence of A. marginale, B. bovis, and B. bigemina was 63%, 25%, and 21% by ELISA and 50.0%, 22.5%, and 18.8% by IFAT, respectively. This study shows valuable information regarding the serological survey of selected bovine pathogens in water buffaloes in the north region of Brazil which will likely be very beneficial for the management and control programs of this disease. PMID:24563780

  11. Eyewitness Identification Reform: Data, Theory, and Due Process.

    Science.gov (United States)

    Clark, Steven E

    2012-05-01

    Some commentators view my analyses (Clark, 2012, this issue) as an important step forward in assessing the costs and benefits of eyewitness identification reform. Others suggest that the trade-off between correct identifications lost and false identifications avoided is well-known; that the expected utility model is misspecified; and that the loss of correct identifications due to the use of reformed eyewitness identification procedures is irrelevant to policy decisions, as those correct identifications are the illegitimate product of suggestion and lucky guesses. Contrary to these criticisms, the loss of correct identifications has not been adequately considered in theoretical or policy matters, criticisms regarding the various utilities do not substantively change the nature of the trade-off, and the dismissal of lost correct identifications is based not on data but on an outdated theory of recognition memory. PMID:26168466

  12. Comments on particle identification at the B factory

    International Nuclear Information System (INIS)

    The importance of particle identification at an asymmetric B factory is discussed and the general status of a number of particle identification technologies which might be included in B factory detectors is briefly reviewed

  13. VEHICLE IDENTIFICATION TASK SOLUTION BY WINDSCREEN MARKING WITH A BARCODE

    Directory of Open Access Journals (Sweden)

    A. Levterov

    2012-01-01

    Full Text Available The vehicle identification means are considered and the present-day traffic requirements are set. The vehicle automatic identification method concerned with barcode use is proposed and described.

  14. Efficient Identification of Timed Automata: Theory and practice

    NARCIS (Netherlands)

    Verwer, S.E.

    2010-01-01

    This thesis contains a study in a subfield of artificial intelligence, learning theory, machine learning, and statistics, known as system (or language) identification. System identification is concerned with constructing (mathematical) models from observations. Such a model is an intuitive descripti

  15. 78 FR 34020 - Federal Acquisition Regulation; Uniform Procurement Identification

    Science.gov (United States)

    2013-06-06

    ... procurement transactions. A number of public comments received during the rulemaking process expressed... 9000-AM60 Federal Acquisition Regulation; Uniform Procurement Identification AGENCY: Department of... Acquisition Regulation (FAR) to implement a uniform Procurement Instrument Identification (PIID)...

  16. MULTISPECTRAL IDENTIFICATION OF CHLORINE DIOXIDE DISINFECTION BYPRODUCTS IN DRINKING WATER

    Science.gov (United States)

    This paper discusses the identification of organic disinfection byproducts (DBPs) at a pilot plant in Evansville, IN, which uses chlorine dioxide as a primary disinfectant. Unconventional multispectral identification techniques (gas chromatography combined with high- and low reso...

  17. MULTISPECTRAL IDENTIFICATION OF CHLORINE DIOXIDE BYPRODUCTS IN DRINKING WATER

    Science.gov (United States)

    This paper discusses the identification of organic disinfectant byproducts (DNPS) at a pilot plant in Evansville, IN, that uses chlorine dioxide as a primary disinfectant. nconventional multispectral identification techniques (gas chromatography combined with high- and low-resolu...

  18. Transplacental transmission of bovine tick-borne pathogens: Frequency, co-infections and fatal neonatal anaplasmosis in a region of enzootic stability in the northeast of Brazil.

    Science.gov (United States)

    Costa, Sonia Carmen Lopo; de Magalhães, Vanessa Carvalho Sampaio; de Oliveira, Uillians Volkart; Carvalho, Fábio Santos; de Almeida, Clebson Pereira; Machado, Rosangela Zacarias; Munhoz, Alexandre Dias

    2016-03-01

    Bovine tick-borne disease (TBD) constitutes a worldwide group of diseases that result in great losses for dairy and beef cattle. With regard to the epidemiological profile of the diseases, the importance of transplacental transmission is still not very well understood. The aim of this study was to determine the transplacental transmission of TBD agents (Anaplasma marginale, Babesia bovis and B. bigemina) in a herd of dairy cattle that had been naturally infected in an area of enzootic stability in northeastern Brazil. Blood for serology of the three agents was collected from cows within 120 days of gestation and serology, haemogram and nPCR assays were performed after birth. Blood was collected from the calves within 3h of birth, and haemogram and nPCR assays were performed in all animals. Pre-colostrum serology was achieved in 34 animals. The Student's t-test was used to compare the haemogram results between animals that were positive and negative for the haemoparasites. The cows were seropositive for all agents in at least one of the examinations. We detected 15 cases of vertical transmission of A. marginale, 4 of B. bovis and 2 of B. bigemina in the 60 cows. In infected animals, co-infection was detected for A. marginale and B. bovis in 1 of 60 calves, and a triple infection was detected in one other calf. Fatal neonatal anaplasmosis was observed in 1 of 15 calves, in which death occurred within 24h of birth. From the results, we concluded that transplacental transmission of TBD agents occurs, including in cases of co- and triple-infection. Such transplacental transmission can cause neonatal death, increasing the importance of this form of epidemiological transmission and suggesting its role as a cause of undiagnosed neonatal death. PMID:26613663

  19. Sparse Matrix for ECG Identification with Two-Lead Features

    OpenAIRE

    Kuo-Kun Tseng; Jiao Luo; Robert Hegarty; Wenmin Wang; Dong Haiting

    2015-01-01

    Electrocardiograph (ECG) human identification has the potential to improve biometric security. However, improvements in ECG identification and feature extraction are required. Previous work has focused on single lead ECG signals. Our work proposes a new algorithm for human identification by mapping two-lead ECG signals onto a two-dimensional matrix then employing a sparse matrix method to process the matrix. And that is the first application of sparse matrix techniques for ECG identification....

  20. Development of Metallic Coil Identification System Based on RFID

    OpenAIRE

    Kim, Myunsik; Song, Beobsung; Ju, Daegeun; Choi, Eunjung; Cho, Byunglok

    2010-01-01

    This paper describes RFID based metal products identification technique for SCM of iron and steel industry. Specially, the coil identification system is developed. To cope with the falling off the tag identification performance affected by neighbouring metallic objects, the tag attachment method based on flagtag is proposed and the reader antenna packaging technique is developed to improve the performance of target coil identification. A Crane equipped with the developed system can detect the...

  1. Host National Identification of Immigrants in the Netherlands

    OpenAIRE

    de Vroome, Thomas; Verkuyten, Maykel; Martinovic, Borja

    2014-01-01

    This study examines immigrants' identification with the host country. We use survey data of more than 1,700 Turkish and Moroccan immigrants and more than 2,200 natives in the Netherlands. We answer four main questions in this study. First, do immigrants have lower national identification than natives? Second, does the level of national identification differ between immigrant groups? Third, do economic and social integration similarly affect national identification among immigrants and natives...

  2. Applications of graph theory in protein structure identification

    OpenAIRE

    Zhang Shenggui; Yan Yan; Wu Fang-Xiang

    2011-01-01

    Abstract There is a growing interest in the identification of proteins on the proteome wide scale. Among different kinds of protein structure identification methods, graph-theoretic methods are very sharp ones. Due to their lower costs, higher effectiveness and many other advantages, they have drawn more and more researchers’ attention nowadays. Specifically, graph-theoretic methods have been widely used in homology identification, side-chain cluster identification, peptide sequencing and so ...

  3. Identification of Hammerstein Model Based on Quantum Genetic Algorithm

    OpenAIRE

    Zhang Hai Li

    2013-01-01

    Nonlinear system identification is a main topic of modern identification. A new method for nonlinear system identification is presented by using Quantum Genetic Algorithm(QGA).The problems of nonlinear system identification are cast as function optimization overprameter space,and the Quantum Genetic Algorithm is adopted to solve the optimization problem. Simulation experiments show that: compared with the genetic algorithm, quantum genetic algorithm is an effective swarm intelligence algorith...

  4. The Role of Prosthetic Dentistry in Mass Disaster Identification

    OpenAIRE

    Vermylen, Y.

    2002-01-01

    Dentistry plays a very important role in the identification of the victims in mass disasters. More than 50% of the identification work is concluded by dental means and investigation. Prosthetic work, and especially full rehabilitations with dental implants, crowns and bridges, is very valuable for dental identification. The biggest problems, however, are full upper and lower dentures. Marking of dentures would be a very valuable aid in identification procedures and very easy to do at a law...

  5. Progress of DNA-based Methods for Species Identification

    Institute of Scientific and Technical Information of China (English)

    HU Zhen; ZHANG Su-hua; WANG Zheng; BIAN Ying-nan; LI Cheng-tao

    2015-01-01

    Species identification of biological samples is widely used in such fields as forensic science and food industry. A variety of accurate and reliable methods have been developed in recent years. The cur-rent reviewshows common target genes and screening criteria suitable for species identification, and de-scribed various DNA-based molecular biology methods about species identification. Additionally, it dis-cusses the future development of species identification combined with real-time PCR and sequencing technologies.

  6. ATM Security Using Fingerprint Biometric Identifer: An Investigative Study

    OpenAIRE

    Moses Okechukwu Onyesolu; Ignatius Majesty Ezeani

    2012-01-01

    The growth in electronic transactions has resulted in a greater demand for fast and accurate user identification and authentication. Access codes for buildings, banks accounts and computer systems often use personal identification numbers (PIN's) for identification and security clearances. Conventional method of identification based on possession of ID cards or exclusive knowledge like a social security number or a password are not all together reliable. An embedded fingerprint biometric auth...

  7. Acoustic identification of a poroelastic cylinder

    CERN Document Server

    Fellah, Z; Ogam, E; Scotti, T; Wirgin, A; Fellah, Zine; Groby, Jean-Philippe; Ogam, Erick; Scotti, Thierry; Wirgin, Armand

    2005-01-01

    We show how to cope with the acoustic identification of poroelastic materials when the specimen is in the form of a cylinder. We apply our formulation, based on the Biot model, approximated by the equivalent elastic solid model, to a long bone-like or borehole sample specimen probed by low frequency sound.

  8. Lead user identification in online communities

    DEFF Research Database (Denmark)

    Ormrod, Robert P.; Søndergaard, Helle Alsted

    Presents results of an exploratory study into the online identification of Lead Users (LU). Integrates three approaches to identifying LU and specifically aims to provide managers with a straightforward method of detecting this group. Four theoretically-derived clusters are investigated, based on...

  9. CEAI: CCM based Email Authorship Identification Model

    DEFF Research Database (Denmark)

    Nizamani, Sarwat; Memon, Nasrullah

    2013-01-01

    reveal that the proposed CCM-based email authorship identification model, along with the proposed feature set, outperforms the state-of-the-art support vector machine (SVM)-based models, as well as the models proposed by Iqbal et al. [1, 2]. The proposed model attains an accuracy rate of 94% for 10...

  10. Particle Identification for Physics beyond the LHC

    OpenAIRE

    Battaglia, Marco

    2003-01-01

    Accelerator physics beyond the LHC is expected to provide precision in the study of new physics processes which the LHC may have already unveiled and to extend the high energy frontier beyond its reach, in the multi-TeV domain. In this paper I review the anticipated needs in terms of particle identification of this physics program in relation to the experimental conditions.

  11. 47 CFR 76.1615 - Sponsorship identification.

    Science.gov (United States)

    2010-10-01

    ... for an identification of any person, product, service, trademark, or brand name beyond an..., paid for or furnished, fully and fairly disclose the true identity of the person or persons, or... announcement shall disclose the identity of the person or persons or entity on whose behalf such agent...

  12. Early Identification of Cushing's Syndrome in Children

    Science.gov (United States)

    ... Testing Pediatric Cushing’s Adrenal Cancer Early Identification of Cushing’s Syndrome in Children Meg Keil, MS, CNP, Dalia Batista, ... NICHD, The National Institutes of Health, Bethesda, MD Cushing’s Syndrome in Children The incidence of endogenous Cushing’s syndrome ...

  13. DIRC, the particle identification system for BABAR

    International Nuclear Information System (INIS)

    The DIRC, a novel type of Cherenkov ring imaging device, is the primary hadronic particle identification system for the BABAR detector at the asymmetric B-factory, PEP-II at SLAC. BABAR began taking data with colliding beams mode in late spring 1999. This paper describes the performance of the DIRC during the first 16 months of operation. (author)

  14. Technologies on the Horizon for Product Identification

    Science.gov (United States)

    Schramm, Harry Fred, Jr.

    2005-01-01

    Contents include the following: Configuration management. Component/system to report. Unique item identifier (UID). Aftemarket undocumented configuration change. Revolutionary new brake system. Traceability of critical parts. Automatic identification used at many levels. Product ID problems that inhibited traceability. Direct part marking enables life cycle tracking.

  15. 7 CFR 58.2827 - Official identification.

    Science.gov (United States)

    2010-01-01

    ... Department of Agriculture Standard for Ice Cream § 58.2827 Official identification. (a) The official symbol to be used to identify product meeting the USDA standard for ice cream shall be as follows: EC25SE91.017 (b) Ice cream manufacturing plants using this symbol shall be USDA approved as set forth...

  16. Particle identification at an asymmetric B Factory

    International Nuclear Information System (INIS)

    Particle identification systems are an important component of any detector at a high-luminosity, asymmetric B Factory. In particular, excellent hadron identification is required to probe CP violation in B0 decays to CP eigenstates. The particle identification systems discussed below also provide help in separating leptons from hadrons at low momenta. We begin this chapter with a discussion of the physics motivation for providing particle identification, the inherent limitations due to interactions and decays in flight, and the requirements for hermiticity and angular coverage. A special feature of an asymmetric B Factory is the resulting asymmetry in the momentum distribution as a function of polar angle; this will also be quantified and discussed. In the next section the three primary candidates, time-of-flight (TOF), energy loss (dE/dx), and Cerenkov counters, both ring-imaging and threshold, will be briefly described and evaluated. Following this, one of the candidates, a long-drift Cerenkov ring-imaging device, is described in detail to provide a reference design. Design considerations for a fast RICH are then described. A detailed discussion of aerogel threshold counter designs and associated R ampersand D conclude the chapter. 56 refs., 64 figs., 13 tabs

  17. Genre Identification of Very Brief Musical Excerpts

    Science.gov (United States)

    Mace, Sandra T.; Wagoner, Cynthia L.; Teachout, David J.; Hodges, Donald A.

    2012-01-01

    The purpose of this study was to examine how well individuals were able to identify different music genres from very brief excerpts and whether musical training, gender and preference played a role in genre identification. Listeners were asked to identify genre from classical, jazz, country, metal, and rap/hip hop excerpts that were 125, 250, 500,…

  18. Pedagogical Source Data Identification and Updating Alternatives.

    Science.gov (United States)

    McManus, John F.

    The automated identification of students as they progress through an instructional program is described as an essential capability of the Southwest Regional Laboratory's (SWRL) Instructional Management System (IMS). Performance characteristics of procedures for linking data to individual students (whose records are maintained by IMS) are…

  19. Identification of Fungi by Machine Vision

    DEFF Research Database (Denmark)

    Dørge, Thorsten Carlheim; Carstensen, Jens Michael

    1999-01-01

    This paper presents some methods for identification and classification of fungal colonies into species solely by means of digital image analysis without any additinal chemical analysis needed. The methods described are completly automated hence objective once a digital image of the fungus has bee...

  20. Prehospital identification of stroke - room for improvement

    DEFF Research Database (Denmark)

    Fischer, C.E.; Barnung, S.; Nielsen, S.L.;

    2008-01-01

    INTRODUCTION: Rapid recognition of stroke is important because it allows early brain imaging and management such as thrombolytic therapy. We evaluated the identification of the diagnosis acute cerebrovascular incident in a physician-based prehospital emergency medical system. METHODS: From the...

  1. Identification of a Semiparametric Item Response Model

    Science.gov (United States)

    Peress, Michael

    2012-01-01

    We consider the identification of a semiparametric multidimensional fixed effects item response model. Item response models are typically estimated under parametric assumptions about the shape of the item characteristic curves (ICCs), and existing results suggest difficulties in recovering the distribution of individual characteristics under…

  2. Identifications of Einstein Slew Survey sources

    Science.gov (United States)

    Schachter, Jonathan F.; Elvis, Martin S.; Plummer, David; Fabbiano, G.

    1992-01-01

    The status of identifications of the Einstien Slew Survey, a bright soft x-ray catalog with 550 new x-ray sources, is discussed. Possible counterparts were found for greater than 95 percent of the Slew Survey based on positional coincidences and color-color diagnostics. The survey will be fully identified via upcoming radio and optical observations.

  3. Identification of irradiated potatoes by impedance measurements

    International Nuclear Information System (INIS)

    A variety of parameters drawn from impedance measurements are tested to distinguish between irradiated and non-irradiated potatoes. Some of these parameters are able to identify the irradiated potatoes. The identification is still possible after a storage time of 3 months. (author)

  4. Work Identification - Inhibition or Resource for Learning?

    DEFF Research Database (Denmark)

    Olesen, Henning Salling

    2006-01-01

    This chapter discusses ways in which the subjective identification with work influences one's motivation to engage in learning. The chapter argues that a life history approach, which takes into account the subjective as well as the objective aspects of work can help us to understand the life tran...

  5. 31 CFR 103.28 - Identification required.

    Science.gov (United States)

    2010-07-01

    ... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Identification required. 103.28 Section 103.28 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL... Office of Management and Budget under control number 1505-0063)...

  6. Stimulus Probability Effects in Absolute Identification

    Science.gov (United States)

    Kent, Christopher; Lamberts, Koen

    2016-01-01

    This study investigated the effect of stimulus presentation probability on accuracy and response times in an absolute identification task. Three schedules of presentation were used to investigate the interaction between presentation probability and stimulus position within the set. Data from individual participants indicated strong effects of…

  7. Identification of Progressive Cocaine Abuse among Adolescents.

    Science.gov (United States)

    Fortuna, Jeffrey L.

    1983-01-01

    Primary symptoms of cocaine use and behavioral characteristics of chronic users are pointed out. Ways that school health services can help identify and assist students who abuse the substance are suggested. Approaches such as peer identification, self-diagnosis, and use of a school ombudsman are discussed. (PP)

  8. 50 CFR 648.75 - Cage identification.

    Science.gov (United States)

    2010-10-01

    ... are issued, or if rendered null and void in accordance with 15 CFR part 904. (d) Return. Tags that... Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... Clam and Ocean Quahog Fisheries § 648.75 Cage identification. Except as provided in § 648.76,...

  9. 50 CFR 648.8 - Vessel identification.

    Science.gov (United States)

    2010-10-01

    ... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Vessel identification. 648.8 Section 648.8 Wildlife and Fisheries FISHERY CONSERVATION AND MANAGEMENT, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION... surf clam or ocean quahog vessels. Instead of complying with paragraph (a) of this section, surf...

  10. Silicon vertex detector for superheavy elements identification

    Directory of Open Access Journals (Sweden)

    Bednarek A.

    2012-07-01

    Full Text Available Silicon vertex detector for superheavy elements (SHE identification has been proposed. It will be constructed using very thin silicon detectors about 5 μm thickness. Results of test of 7.3 μm four inch silicon strip detector (SSD with fission fragments and α particles emitted by 252Cf source are presented

  11. Standoff Human Identification Using Body Shape

    Energy Technology Data Exchange (ETDEWEB)

    Matzner, Shari; Heredia-Langner, Alejandro; Amidan, Brett G.; Boettcher, Evelyn J.; Lochtefeld, Darrell; Webb, Timothy

    2015-09-01

    The ability to identify individuals is a key component of maintaining safety and security in public spaces and around critical infrastructure. Monitoring an open space is challenging because individuals must be identified and re-identified from a standoff distance nonintrusively, making methods like fingerprinting and even facial recognition impractical. We propose using body shape features as a means for identification from standoff sensing, either complementing other identifiers or as an alternative. An important challenge in monitoring open spaces is reconstructing identifying features when only a partial observation is available, because of the view-angle limitations and occlusion or subject pose changes. To address this challenge, we investigated the minimum number of features required for a high probability of correct identification, and we developed models for predicting a key body feature—height—from a limited set of observed features. We found that any set of nine randomly selected body measurements was sufficient to correctly identify an individual in a dataset of 4426 subjects. For predicting height, anthropometric measures were investigated for correlation with height. Their correlation coefficients and associated linear models were reported. These results—a sufficient number of features for identification and height prediction from a single feature—contribute to developing systems for standoff identification when views of a subject are limited.

  12. Nuclear Materials Identification System Operational Manual

    Energy Technology Data Exchange (ETDEWEB)

    Chiang, L.G.

    2001-04-10

    This report describes the operation and setup of the Nuclear Materials Identification System (NMIS) with a {sup 252}Cf neutron source at the Oak Ridge Y-12 Plant. The components of the system are described with a description of the setup of the system along with an overview of the NMIS measurements for scanning, calibration, and confirmation of inventory items.

  13. Vortex-shear interaction and vortex identification

    Czech Academy of Sciences Publication Activity Database

    Kolář, Václav

    Jalan : Institution of Engineers, 2006, s. 1015-1020. ISBN 983-42965-0-9. [Asian Congress of Fluid Mechanics /11./. Kuala Lumpur (MY), 22.05.2006-25.05.2006] R&D Projects: GA AV ČR IAA2060302 Institutional research plan: CEZ:AV0Z20600510 Keywords : vortex identification * vortex-shear interaction Subject RIV: BK - Fluid Dynamics

  14. Weed Identification and Control in Vegetable Crops.

    Science.gov (United States)

    Ferretti, Peter A., Comp.

    This agriculture extension service publication from Pennsylvania State University examines weed control and identification in vegetable crops. Contents include: (1) Types of weeds; (2) Reducing losses caused by weeds, general control methods and home garden weed control; (3) How herbicides are used; (4) Specific weeds in vegetable plantings; and…

  15. Parameter identification in the logistic STAR model

    DEFF Research Database (Denmark)

    Ekner, Line Elvstrøm; Nejstgaard, Emil

    We propose a new and simple parametrization of the so-called speed of transition parameter of the logistic smooth transition autoregressive (LSTAR) model. The new parametrization highlights that a consequence of the well-known identification problem of the speed of transition parameter is that the...

  16. Identification and optimization problems in plasma physics

    International Nuclear Information System (INIS)

    Parameter identification of the current in a tokamak plasma is studied. Plasma equilibrium in a vacuum container with a diaphragm is analyzed. A variable metric method with reduced optimization with nonlinear equality constraints; and a quasi-Newton reduced optimization method with constraints giving priority to restoration are presented

  17. Identification and Treatment of Borderline Personality Disorder.

    Science.gov (United States)

    Eckrich, Sherry

    1985-01-01

    Suggests that early identification, through psychosocial assessment and intake interviews, of clients who have borderline personality disorder aids in planning an effective multidisciplinary team approach for the particular problems these clients present. Describes characteristics of this population and recommends interventions. (Author)

  18. Progress toward identification of gluonic states

    International Nuclear Information System (INIS)

    Progress in the last two years toward identification of gluonic states is reviewed. Discovery of additional pseudoscalars tends to confirm the glueball interpretation of iota(1460). A variety of evidence indicates new physics in the J = 1 channel in the E mass region. 65 refs., 1 tab

  19. Identification of bacteria using mass spectrometry techniques

    Czech Academy of Sciences Publication Activity Database

    Krásný, Lukáš; Hynek, R.; Hochel, I.

    2013-01-01

    Roč. 353, NOV 2013 (2013), s. 67-79. ISSN 1387-3806 R&D Projects: GA ČR GAP503/10/0664 Institutional support: RVO:61388971 Keywords : Mass spectrometry * Bacteria * Identification Subject RIV: EE - Microbiology, Virology Impact factor: 2.227, year: 2013

  20. On Identification of Internet of Things

    OpenAIRE

    Mustafa A. Salman

    2014-01-01

    In this paper, Identification Challenge of the Internet of Things has been studied, in particular, the recent Identity Protocols IPv4 and IPv6. Remarks based on mathematical reasoning raised on the latest Identity Protocol IPv6 concerning the possibility of redundancy in the length of the 128-bit binary sequence of IPv6 and some algorithms implemented on data portion of the sequence.

  1. Gait correlation analysis based human identification.

    Science.gov (United States)

    Chen, Jinyan

    2014-01-01

    Human gait identification aims to identify people by a sequence of walking images. Comparing with fingerprint or iris based identification, the most important advantage of gait identification is that it can be done at a distance. In this paper, silhouette correlation analysis based human identification approach is proposed. By background subtracting algorithm, the moving silhouette figure can be extracted from the walking images sequence. Every pixel in the silhouette has three dimensions: horizontal axis (x), vertical axis (y), and temporal axis (t). By moving every pixel in the silhouette image along these three dimensions, we can get a new silhouette. The correlation result between the original silhouette and the new one can be used as the raw feature of human gait. Discrete Fourier transform is used to extract features from this correlation result. Then, these features are normalized to minimize the affection of noise. Primary component analysis method is used to reduce the features' dimensions. Experiment based on CASIA database shows that this method has an encouraging recognition performance. PMID:24592144

  2. Gait Correlation Analysis Based Human Identification

    Directory of Open Access Journals (Sweden)

    Jinyan Chen

    2014-01-01

    Full Text Available Human gait identification aims to identify people by a sequence of walking images. Comparing with fingerprint or iris based identification, the most important advantage of gait identification is that it can be done at a distance. In this paper, silhouette correlation analysis based human identification approach is proposed. By background subtracting algorithm, the moving silhouette figure can be extracted from the walking images sequence. Every pixel in the silhouette has three dimensions: horizontal axis (x, vertical axis (y, and temporal axis (t. By moving every pixel in the silhouette image along these three dimensions, we can get a new silhouette. The correlation result between the original silhouette and the new one can be used as the raw feature of human gait. Discrete Fourier transform is used to extract features from this correlation result. Then, these features are normalized to minimize the affection of noise. Primary component analysis method is used to reduce the features’ dimensions. Experiment based on CASIA database shows that this method has an encouraging recognition performance.

  3. Implant - Identification Tool for Forensic Dentistry

    Czech Academy of Sciences Publication Activity Database

    Dostálová, T.; Eliášová, H.; Seydlová, M.; Zvárová, Jana

    2008-01-01

    Roč. 19, č. 9 (2008), s. 926-926. ISSN 0905-7161. [EAO Annual Scientific Meeting /17./. 18.09.2008-20.09.2008, Warsaw] R&D Projects: GA MŠk(CZ) 1M06014 Institutional research plan: CEZ:AV0Z10300504 Keywords : forensic dentistry * identification * electronic health record Subject RIV: IN - Informatics, Computer Science

  4. Entrepreneurial Idea Identification through Online Social Networks

    Science.gov (United States)

    Lang, Matthew C.

    2010-01-01

    The increasing use of social network websites may signal a change in the way the next generation of entrepreneurs identify entrepreneurial ideas. An important part of the entrepreneurship literature emphasizes how vital the use of social networks is to entrepreneurial idea identification, opportunity recognition, and ultimately new venture…

  5. Method for genetic identification of unknown organisms

    Energy Technology Data Exchange (ETDEWEB)

    Colston, Jr., Billy W.; Fitch, Joseph P.; Hindson, Benjamin J.; Carter, Chance J.; Beer, Neil Reginald

    2016-08-23

    A method of rapid, genome and proteome based identification of unknown pathogenic or non-pathogenic organisms in a complex sample. The entire sample is analyzed by creating millions of emulsion encapsulated microdroplets, each containing a single pathogenic or non-pathogenic organism sized particle and appropriate reagents for amplification. Following amplification, the amplified product is analyzed.

  6. Model Identification of Integrated ARMA Processes

    Science.gov (United States)

    Stadnytska, Tetiana; Braun, Simone; Werner, Joachim

    2008-01-01

    This article evaluates the Smallest Canonical Correlation Method (SCAN) and the Extended Sample Autocorrelation Function (ESACF), automated methods for the Autoregressive Integrated Moving-Average (ARIMA) model selection commonly available in current versions of SAS for Windows, as identification tools for integrated processes. SCAN and ESACF can…

  7. Model Identification and Validation for a Heating System using MATLAB System Identification Toolbox

    International Nuclear Information System (INIS)

    This paper proposed a systematic approach to select a mathematical model for an industrial heating system by adopting system identification techniques with the aim of fulfilling the design requirement for the controller. The model identification process will begin by collecting real measurement data samples with the aid of MATLAB system identification toolbox. The criteria for selecting the model that could validate model output with actual data will based upon: parametric identification technique, picking the best model structure with low order among ARX, ARMAX and BJ, and then applying model estimation and validation tests. Simulated results have shown that the BJ model has been best in providing good estimation and validation based upon performance criteria such as: final prediction error, loss function, best percentage of model fit, and co-relation analysis of residual for output

  8. 30 CFR 77.904 - Identification of circuit breakers.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Identification of circuit breakers. 77.904... COAL MINES Low- and Medium-Voltage Alternating Current Circuits § 77.904 Identification of circuit breakers. Circuit breakers shall be labeled to show which circuits they control unless identification...

  9. 40 CFR 263.11 - EPA identification number.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 25 2010-07-01 2010-07-01 false EPA identification number. 263.11... number. (a) A transporter must not transport hazardous wastes without having received an EPA identification number from the Administrator. (b) A transporter who has not received an EPA identification...

  10. 27 CFR 53.22 - Employer identification number.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false Employer identification... AMMUNITION Administrative and Miscellaneous Provisions § 53.22 Employer identification number. (a... earlier been assigned an employer identification number or has not applied for one, shall make...

  11. 26 CFR 301.7701-12 - Employer identification number.

    Science.gov (United States)

    2010-04-01

    ... 26 Internal Revenue 18 2010-04-01 2010-04-01 false Employer identification number. 301.7701-12...) PROCEDURE AND ADMINISTRATION PROCEDURE AND ADMINISTRATION Definitions § 301.7701-12 Employer identification number. For purposes of this chapter, the term employer identification number means the...

  12. 27 CFR 17.22 - Employer identification number.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Employer identification... NONBEVERAGE PRODUCTS Registration § 17.22 Employer identification number. Every person who claims drawback..., and Firearms Taxes, the employer identification number (EIN) assigned by the Internal Revenue...

  13. Books and Balls: Antecedents and Outcomes of College Identification

    Science.gov (United States)

    Porter, Thomas; Hartman, Katherine; Johnson, John Seth

    2011-01-01

    Identification plays a central role in models of giving to an organization. This study presents and tests a general model of giving that highlights status based and affect based drivers of identification. The model was tested using a sample of 114 alumni from 74 different colleges participated in an online survey. Identification was found to…

  14. 32 CFR 707.7 - Submarine identification light.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 5 2010-07-01 2010-07-01 false Submarine identification light. 707.7 Section... RULES WITH RESPECT TO ADDITIONAL STATION AND SIGNAL LIGHTS § 707.7 Submarine identification light. Submarines may display, as a distinctive means of identification, an intermittent flashing amber beacon...

  15. On flexible CAD of adaptive control and identification algorithms

    DEFF Research Database (Denmark)

    Christensen, Anders; Ravn, Ole

    SLLAB is a MATLAB-family software package for solving control and identification problems. This paper concerns the planning of a general-purpose subroutine structure for solving identification and adaptive control problems. A general-purpose identification algorithm is suggested, which allows a t...

  16. Measuring word identification skills and related variables in Dutch children

    NARCIS (Netherlands)

    VandenBos, KP; Spelberg, HCL; Leong, CK; Joshi, RM

    1997-01-01

    In this chapter a simple definition of dyslexia is adopted: Ward identification ability below a certain performance criterion on a suitable word identification test. In Study 1, the research focus is on two word identification tests, a real-word test (RWT) and a pseudoword test (PWT). The question i

  17. 19 CFR 112.42 - Application for identification card.

    Science.gov (United States)

    2010-04-01

    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Application for identification card. 112.42 Section 112.42 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CARRIERS, CARTMEN, AND LIGHTERMEN Identification Cards § 112.42 Application for identification card. An application for...

  18. 9 CFR 2.50 - Time and method of identification.

    Science.gov (United States)

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Time and method of identification. 2... AGRICULTURE ANIMAL WELFARE REGULATIONS Identification of Animals § 2.50 Time and method of identification. (a... by any dealer or exhibitor shall be identified by the dealer or exhibitor at the time of delivery...

  19. Consistency of the Performance and Nonperformance Methods in Gifted Identification

    Science.gov (United States)

    Acar, Selcuk; Sen, Sedat; Cayirdag, Nur

    2016-01-01

    Current approaches to gifted identification suggest collecting multiple sources of evidence. Some gifted identification guidelines allow for the interchangeable use of "performance" and "nonperformance" identification methods. This multiple criteria approach lacks a strong overlap between the assessment tools; however,…

  20. Rice seed identification by computerized AFLP-DNA fingerprinting

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    @@ We developed a computerized seed identification system. Fifteen rice varieties that were widely used in China were analyzed by AFLP fingerprinting. 12 primer pairs were screened. In order to simplify the procedure and cut down the cost in seed identification, the least number of primer pairs for practical seed identification should be selected. In this study, 3 primer pairs were selected.