WorldWideScience

Sample records for analiza dlya opredeleniya

  1. Avtomatizirovannyy elektrokhemilyuminestsentnyy metod opredeleniya kortizola v slyune dlya diagnostiki endogennogo giperkortitsizma sredi patsientov s ozhireniem

    Directory of Open Access Journals (Sweden)

    Zhanna Evgenyevna Belaya

    2011-06-01

    Full Text Available Nighttime salivary cortisol (NSC has been suggested to be a useful diagnostic test for Cushings syndrome (CS. However, the reference range and cut-off value are assay-specific and discordant. The goal of this study was to assess the analytical performance of automated elecrochemiluminiscence immunoassay method (ECLIA in CS. Ninety eight healthy volunteers and 123 obese patients including 45 proved to be CS provided salivary samples collected by them at 23:00 using Sallivette. Two hundred and five subjects collected salivary samples for two consecutive days and samples from 197 subjects were frozen to perform Enzyme-linked immunosorbent assay (ELISA. Obese patients underwent the 1-mg overnight dexamethasone suppression test (1-DST. CS was confirmed by the histologic diagnosis after surgical treatment or autopsy. The reference range for healthy volunteer has been set 0,5-9,4 nmol/l. Reproducibility was assessed in all subjects by a day-to-day variability and reflected by an intraclass correlation coefficient of 0,785. The cut-off value of 9,4 nmol/l has been suggested to differentiate CS among obese patients to achieve sensitivity of 84,4% (95%confidence interval 71,2-92,2%; specificity of 92,3% (95%CI 84,2-96,4% and diagnostic odds ratio 65,1 (95% CI 20,4-207,6. Likelihood ratio positive was 11,0 (95% CI 5,0-23,9, with a likelihood ratio negative of 0,17 (95%CI 0,08-0,33. The comparison of the total areas under the ROC-curve for the measurement of NSC once, twice with mean level by ECLIA, the same samples by ELISA and 1-DST have not shown any statistically significant difference among the tests performance. Conclusion: Based on its remarkable reproducibility, easy noninvasive nature, automated assay and at least similar diagnostic performance, NSC measured by ECLIA on Cobas e601 is a preferable first-line screening test for CS.

  2. Data of evolutionary structure change: 1DLYA-1RTEA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DLYA-1RTEA 1DLY 1RTE A A ------------SLFAKLGGREAVEAAVDKFYNKIVADP...TVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ ...index>0 1RTE A 1RTE

  3. Data of evolutionary structure change: 1DLYA-1RTEB [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DLYA-1RTEB 1DLY 1RTE A B ------------SLFAKLGGREAVEAAVDKFYNKIVADP...TVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQQ ...ndex>0 1RTE B 1RTE

  4. Data of evolutionary structure change: 1DLWA-1DLYA [Confc[Archive

    Lifescience Database Archive (English)

    Full Text Available 1DLWA-1DLYA 1DLW 1DLY A A SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMP...EAAVDKFYNKIVADPTVSTYFSNTDMKVQRSKQFAFLAYALGGASEWKGKDMRTAHKDLVPHLSDVHFQAVARHLSDTLTELGVPPEDITDAMAVVASTRTEVLNMPQ...HHGGGHHHH 0 1DLW A 1DLWA HANMG--VSN...Chain> 1DLY A 1DLY

  5. Analiza izpustov dizelskih motorjev

    OpenAIRE

    MURN, GREGA

    2016-01-01

    V svojem diplomskem delu z naslovom »Analiza izpustov dizelskih motorjev«, sem bralcu skušal približati današnjo problematiko v zvezi z onesnaževanjem okolja, predvsem zaradi dizelskih izpuhov, ki jih prinaša industrija v vseh oblikah. Največji onesnaževalec okolja je absolutno promet, saj izpuhi avtomobilov vsebujejo obsežen skupek škodljivih snovi (ogljikovodiki HC, ogljikov monoksid CO, dušikovi oksidi NOx, žveplovi oksidi, trdni delci, itd.). Namen Evropskih in Ameriških standardov je ...

  6. Analiza panoge in SWOT analiza na primeru podjetja Golte

    OpenAIRE

    Kolar, Rebeka

    2012-01-01

    Za uspešnost podjetja je pomembno, da dobro poznamo svojo panogo, v kateri delujemo, dobro moramo poznati svojo konkurenco in biti vedno korak pred njo. Podrobno poznavanje panoge same pripomore k boljšemu in kvalitetnejšemu vrednotenju podjetja. SWOT analiza je pomembna za ugotavljanje konkurenčne prednosti podjetja in je ena najpogostejših in najpopularnejših analiz. Lahko jo izvajajo posamezniki ali skupina

  7. ANALIZA VIDEZA OTROŠKE OBLEKE

    OpenAIRE

    Brinjevec, Renata

    2010-01-01

    V diplomski nalogi je podrobneje predstavljen celoten proces izdelave treh po dizajnu in konstrukciji enake otroške-dekliške obleke, ki se razlikujejo po različnih vrstah uporabljenih tkanin. Cilj naloge je analiza izdelave oblačila, tj. tehnoloških postopkov izdelave, ki so konstrukcijsko enaka, vendar zaradi vrste uporabljenega materiala različno tehnološko izvedena. Za model svojega izbranega modela sem vzela Asjo, svojo štiri letno hčerko. Vpliv lastnosti materiala na končni videz oblačil...

  8. Analiza comparativa intre sinergia in comunicarea integrata de marketing si sinergia la nivelul fuziunii si achizitiilor

    OpenAIRE

    Ana Roxana Matei

    2010-01-01

    Acest articol ilustreaza o analiza comparativa intre sinergia in comunicarea integrata de marketing (CIM) si sinergia la nivelul fuziunilor. Pana in prezent s-a discutat despre acesti termeni ca fiind diferiti dar aceasta abordare isi propune sa demonstreze ca exista o legatura si chiar o suprapunere intre acestia. Sinergia la nivelul fuziunilor si achizitiilor a fost un concept care a precedat sinergia in CIM dar nu a beneficiat de atentia acordata celei din urma. Articolul isi propune sa id...

  9. Analiza pouzdanosti rada uređaja daljinskog upravljanja SPEV-a

    Directory of Open Access Journals (Sweden)

    Tomislav Mlinarić

    2012-10-01

    Full Text Available Na temelju prikupljenih podataka o kvarovima i smetnjama na uređajima daljinskog upravljanjastabilnih postrojenja električne vuče urazdoblju od 1971. do 1988. godine načinjena je analiza, primjenom adekvatnih metoda, iz čega su proizašli odgovarajući zaključci. Posebno je važan zaključak koji upućuje na veliku korisnost.

  10. Analiza rezultata detekcije pokreta na slici / Performance evaluation of change detection

    Directory of Open Access Journals (Sweden)

    Boban Bondžulić

    2007-01-01

    Full Text Available U radu je izvršeno poređenje pet metoda za određivanje praga detekcije pokreta na slici scene. Metodi su testirani na sintetičkim i realnim slikama a rezultati detekcije pokreta izraženi su kvantitativno ili su dati vizuelno. Kvantitativna analiza izvršena je na nivou piksela, a zasnovana je na procentu ispravno klasifikovanih piksela, Jaccardovom i Yuleovom koeficijentu. Kroz analizu sprovedenu u četiri eksperimenta zaključeno je da su najbolji rezultati detekcije postignuti ukoliko se koristi Kapurov metod određivanja praga. / This paper studies five different methods proposed for change detection thresholding. Methods were tested on synthetic and real pictures and results are quantitatively and qualitatively presented. Quantitative analysis is performed at pixel level and the following measures were used: the percentage of correct classification, the Jaccard coefficient and the Yule coefficient. We test the performance of thesholding methods in four experiments and Kapur was the best performing method both quantitatively and qualitatively.

  11. Powieść historyczna pod czujnym okiem cenzora – analiza tekstów

    Directory of Open Access Journals (Sweden)

    Thibault Deleixhe

    2015-12-01

    Full Text Available The historic novel under the vigilance of the censor – analysis of texts This article focuses on the relation that Jacek Bochenski’s historical novel entitled The poet Naso published in 1969 presents towards the concept of censorship. In the article the author aims at proving that the understanding of censorship by Bochenski is similar to the observations of the Hungarian essayist Mikos Haraszti. Tracking the allegoric references scattered through the novel, the author of the article reconstructs Bochenski’s reflection about this internalized censorship and checks its convergence with Haraszti’s remarks. From this exercise emerges a definition of the role of the artist that seems to be inherited from the romantic period: an artist as a person that subordinates himself unconditionally to art, and not to the temporal power. The author of the article then interrogates the respect which Bochenski has been showing to his definition in his literary work. It appears that the writer has been prone to make bigger concessions in order to soften the reception of his book by the censors than he advises his writing colleagues. However, the literary strategies deployed by Bochenski operate on two levels: creating an overall ambiguity about the guilt of its main protagonist, they tend to soften its reception by the censorship; while at the same time, rendering this overall atmosphere of ambiguity, they give a literary form to the spectral character of the guilt of the artist, who – as in Ovidius’ case – is permanently accountable for what he has not yet done in the building of communism.   Powieść historyczna pod czujnym okiem cenzora – analiza tekstów Artykuł poświęcony jest  powieści historycznej Jacka Bocheńskiego pt. Nazo poeta z roku 1969 i jego rozumieniu pojęcia cenzury uwewnętrznionej. Autor artkułu udowadnia, że ujęcie problemu cenzury przez Bocheńskiego jest zbliżone do konstatacji węgierskiego eseisty Mikl

  12. Analiza kvalitativnog materijala

    OpenAIRE

    Cartwright, Dorwin P.

    1988-01-01

    Osnovni je cilj svake analize sadržaja pretvoriti pojavu (simbolično ponašanje ljudi) u znanstvenu činjenicu (podatak). Autor navodi četiri karakteristike koje mora imati znanstvena činjenica: 1) objektivnost i reproduktibilnost, 2) prikladnost za mjerenje i kvantifikaciju, 3) značaj za sistematsku teoriju, bilo »čistu« ili »primjenjenu«, i 4) svojstvo da se može generalizirati. U konstruiranju nacrta istraživanja poželjno je slijediti šest faza, od kojih je, svaka niz međuzavisnih odluka....

  13. Analiza kontinualnih frekvencijski modulisanih radarskih signala primenom vremensko-frekvencijskih transformacija i korelacionih tehnika / FMCW radar signal analysis by time-frequency representations and correlation techniques

    OpenAIRE

    Slobodan Simić

    2007-01-01

    U radu su analizirana dva metoda za detekciju i procenu parametara radarskih signala s malom verovatnoćom presretanja, pri čemu ne postoji saradnja između prijemnika i predajnika. Prvi algoritam čini analiza signala pomoću vremensko-frekvencijskih transformacija zajedno sa tehnikama za prepoznavanje oblika. U osnovi drugog algoritma detekcije je procena periodične autokorelacione funkcije. Analizirani su kontinualni frekvencijski modulisani radarski signali (FMCW), često primenjivani u radari...

  14. Se analiza la teoría de Jorge Juan sobre la resistencia fluídica, tal como la expone en el Examen

    Directory of Open Access Journals (Sweden)

    Simón Calero, Julián

    2001-12-01

    Full Text Available The Jorge Juan theory on fluid resistance is analysed as stated in the Examen Marítimo. The theoretical basis and applications are studied, these range from flat plates to ship hull and sails. The article concludes with a revision of what Juan considers to be its experimental basis and possible forerunners of his theory are traced.

    Se analiza la teoría de Jorge Juan sobre la resistencia fluídica, tal como la expone en el Examen Marítimo. Se estudian las bases teóricas y sus aplicaciones, desde placas planas hasta cacos y velas de buques. Se concluye con una revisión de lo que Juan considera sus fundamentos experimentales y se rastrean los posibles antecedentes de su teoría.

  15. Optimal methods for identifying the pollution level of liquid mediums. Opticheskiye metody opredeleniya zagryaznennosti zhidkikh sred

    Energy Technology Data Exchange (ETDEWEB)

    Bolshakov, G.F.; Novichkov, M.N.; Timofeyev, V.F.

    1984-01-01

    The results are cited of experimental studies performed between 1964 and 1982, the nature and dispersion composition of pollutants are examined and the contemporary specifications on the purity and methods for testing fuel are presented. Practical recommendations are given for developing new high speed methods for evaluating the contamination of fuels and oils. These data are important for studies of the processes of transformation of homogeneous liquid mediums into heterogeneous ones.

  16. Analiza kontinualnih frekvencijski modulisanih radarskih signala primenom vremensko-frekvencijskih transformacija i korelacionih tehnika / FMCW radar signal analysis by time-frequency representations and correlation techniques

    Directory of Open Access Journals (Sweden)

    Slobodan Simić

    2007-10-01

    Full Text Available U radu su analizirana dva metoda za detekciju i procenu parametara radarskih signala s malom verovatnoćom presretanja, pri čemu ne postoji saradnja između prijemnika i predajnika. Prvi algoritam čini analiza signala pomoću vremensko-frekvencijskih transformacija zajedno sa tehnikama za prepoznavanje oblika. U osnovi drugog algoritma detekcije je procena periodične autokorelacione funkcije. Analizirani su kontinualni frekvencijski modulisani radarski signali (FMCW, često primenjivani u radarima s malom verovatnoćom presretanja. Korišćeni su test-signali, dobijeni eksperimentalnim putem. Realizovan je eksperiment s realnim predajnikom i prijemnikom FMCW signala, a rezultati obrade primljenih signala prikazani su u radu. / Two LPI signal detection and parameter estimation methods are analyzed in a non-cooperative context. The first method is based on the time-frequency signal analysis along with pattern recognition techniques. The second one is based on the estimation of a periodic autocorrelation function. Frequency modulation continuous wave (FMCW signals are analyzed as a class of waveforms often used in LPI radars. Experimentally obtained signals are used in tests. An experiment with a real FMCW signal transceiver and a receiver is carried out and the obtained signal analysis results are presented.

  17. Analiza metodologije za ispitivanje kemijske stabilnosti baruta i raketnih goriva / The analysis of methodology for investigation of chemical stability of propellants

    Directory of Open Access Journals (Sweden)

    Radun Jeremić

    2006-10-01

    Full Text Available Kao i sve energetske supstance, baruti i raketna goriva su termodinamički nestabilni, zbog čega, tokom skladištenja, dolazi do njihove kemijske dekompozicije (starenja. Proces starenja dovodi do promene njihovih funkcionalnih karakteristika, i do smanjenja sigurnosti u toku skladištenja zbog potencijalne opasnosti od samozapaljenja. U raduje objašnjen mehanizam dekonpozicije nitroestara i fenomen kemijske stabilnosti baruta i raketnih goriva. Izvršena je komparativna analiza naše i NATO metodologije za kontrolu kemijske stabilnosti, a posebno su navedeni uočeni nedostaci u dosadašnjoj primeni standarda SNO 8069/91. Kao optimalno rešenje ovog problema predloženo je prihvatanje odgovarajućih STANAG standarda koji regulišu ovu problematiku. / As the other energetic substances, propellants are thermodynamically unstable. Thereby, during storing, they undergo chemical decomposition process (aging. Aging process are cause changing their functional properties and decreasing safe during storage because of potential hazard from self ignition. The decomposition mechanism of nitro esters and chemical stability phenomena of propellants are shortly discussed in these papers. The compared analysis of domestic and NATO methodology for investigation of chemical stability is realized. The observed deficiencies in up to now application of standard SNO 8069/91 are specially mentioned. As optimal solution of this problem it is supposed to accept corresponding STANAG standards that regulate this problematic.

  18. Analiza primene IMM algoritma za praćenje manevrišućih ciljeva / Analysis of IMM algorithm for maneuvering target tracking

    Directory of Open Access Journals (Sweden)

    Zvonko Radosavljević

    2005-05-01

    Full Text Available U radu je analizirana primena IMM algoritma sa tri modela Kalmanovih filtara, za praćenje cilja pomoću osmatračkog radara. Prvi Kalmanov filtar podešen je da prati ciljeve koji se kreću po pravolinijskoj trajektoriji bez ubrzanja, drugi prati ciljeve koji se kreću ubrzano i vrše blag manevar, a treći je namenjen za praćenje ciljeva koji se kreću ubrzano i vrše oštar manevar. Dat je opis algoritma kao i vrednosti odgovarajućih parametara i matrica prelaza za Kalmanove filtre, kao i uporedna analiza algoritma u odnosu na standardan Kalmanov filtar šestog reda. Prikazani rezultati srednje kvadratne greške praćenja po x i у koordinati pokazuju opravdanost izbora predložene metode praćenja. / This paper considers comparative analysis the problem of maneuvering target tracking to IMM algorithm with 3 standard Kalman filters and same standard Kalman filter 6. order, using data from TWS radar. The first Kalman filter from IMM algorithms is tuned for tracking of target moving along the rectilinear trajectory -without acceleration, the second tracks the targets with acceleration and gentle maneuver, and the third Kalman filter tracks the target with acceleration and sharp maneuver. The mathematical model of algorithm and values of appropriate parameters and Kalman filter matrices, are presented. The results of RMSE of tracking in x and у coordinates, show the validity of the proposed method.

  19. Analiza stanu gleb w raportach o oddziaływaniu na środowisko wybranych obiektów gospodarki odpadami

    Directory of Open Access Journals (Sweden)

    KUŚMIERZ AGNIESZKA

    2014-12-01

    Full Text Available Gleba jest jednym z elementów środowiska przyrodniczego, który często bywa narażony na zanieczyszczenia i degradację. Jednym z głównych źródeł zanieczyszczeń są obiekty gospodarki odpadami, wśród których dominują składowiska odpadów. W Polsce obiekty gospodarki odpadami są zaliczane do przedsięwzięć mogących potencjalnie znacząco oddziaływać na środowisko. Dla większości takich obiektów przeprowadzana jest ocena oddziaływania na środowisko, w ramach której sporządzany jest raport o oddziaływaniu na środowisko. Problematyka ochrony gleb jest jednak często w nim marginalizowana. Celem pracy była analiza jakości wybranych raportów o oddziaływaniu na środowisko obiektów gospodarki odpadami, ze szczególnym uwzględnieniem przeprowadzonej w nich analizy stanu gleb, a także przedstawienie propozycji zakresu prac, niezbędnych do rzetelnej analizy oddziaływania obiektów gospodarki odpadami na gleby. Wyniki przeprowadzonej oceny wskazują na zróżnicowany poziom wykonania w zakresie przedstawienia oddziaływania inwestycji na gleby. Przeważają opracowania ocenione negatywnie jako niezadowalające.

  20. A comparative analysis of Serbian phonemes: Linear and non-linear models/Uporedna analiza fonema srpskog jezika: linearni i nelinearni modeli

    Directory of Open Access Journals (Sweden)

    Danijela D. Protić

    2014-10-01

    Full Text Available This paper presents the results of a comparative analysis of Serbian phonemes. The characteristics of vowels are quasi-periodicity and clearly visible formants. Non-vowels are short-term quasi-periodical signals having a low power excitation signal. For the purpose of this work, speech production systems were modelled with linear AR models and the corresponding non-linear models, based feed-forward neural networks with one hidden-layer. Sum squared error minimization as well as the back-propagation algorithm were used to train models. The selection of the optimal model was based on two stopping criteria: the normalized mean squares test error and the final prediction error. The Levenberg-Marquart method was used for the Hessian matrix calculation. The Optimal Brain Surgeon method was used for pruning. The generalization properties, based on the time-domain and signal spectra of outputs at hidden-layer neurons, are presented. / U radu je prikazana analiza karakteristika vokala i nevokala srpskog jezika. Vokale karakteriše kvaziperiodičnost i spektar snage signala sa dobro uočljivim formantima. Nevokale karakteriše kratkotrajna kvaziperiodičnost i mala snaga pobudnog signala. Vokali i nevokali modelovani su linearnim AR modelima i odgovarajućim nelinearnim modelima koji su generisani kao feed-forward neuronska mreža sa jednim skrivenim slojem. U procesu modelovanja korišćena je minimizacija srednje kvadratne greške sa propagacijom unazad, a kriterijum izbora optimalnog modela jeste zaustavljanje obučavanja, kada normalizovana srednja kvadratna test greška ili finalna greška predikcije dostignu minimalnu vrednost. LM metod korišćen je za proračun inverzne Hessianove matrice, a za pruning je upotrebljen Optimal Brain Surgeon. Prikazana su generalizaciona svojstva signala u vremenskom i frekvencijskom domenu, a kroskorelacionom analizom utvrđen je odnos signala na izlazima neurona skrivenog sloja.

  1. DEFINIŢIA LEGISLATIVĂ A NOŢIUNII „PERSOANĂ CU FUNCŢIE DE DEMNITATE PUBLICĂ”: ANALIZA EVOLUŢIEI

    Directory of Open Access Journals (Sweden)

    Sergiu BRÎNZA

    2017-01-01

    Full Text Available Scopul investigaţiei de faţă rezidă în analiza evoluţiei pe care a parcurs-o definiţia legislativă a noţiunii „persoană cu funcţie de răspundere”. Se relevă că dispoziţia de la alin.(3 art.123 CP RM a fost supusă unor amendamente prin Legea nr.318/2013 şi prin Legea nr.152/2016. Se stabileşte că în rezultatul acestor amendamente: din respectiva dispoziţie a fost exclus textul „consilierul local; deputatul în Adunarea Populară a Găgăuziei;”; în dispoziţia alin.(3 art.123 CP RM, cu­vin­tele „în condiţiile legii” au fost substituite cu cuvintele „altă persoană cu funcţie de demnitate publică stabilită prin lege”. Se demonstrează că consilierul local şi deputatul în Adunarea Populară a Găgăuziei nu sunt persoane cu funcţii de demnitate publică nici în sensul Legii nr.199/2010, nici în sensul alin.(3 art.123 CP RM. Se ajunge la concluzia că, în rezultatul adoptării Legii nr.152/2016, definiţia noţiunii „persoană cu funcţie de demnitate publică” s-a transformat din definiţie exhaustivă în definiţie exemplificativă. Se argumentează că sintagma „altă persoană cu funcţie de demnitate publică stabilită prin lege” din alin.(3 art.123 CP RM arată că această normă constituie o normă divizată de referire. Se explică de ce este falsă impresia că ar exista persoane cu funcţie de demnitate publică, care nu sunt specificate în anexa la Legeanr.199/2010 şi cărora nu li se aplică prevederile acestei legi. Se conchide că alin.(3 art.123 CP RM, complinit de anexa la Legeanr.199/2010, sunt singurele norme care stabilesc conţinutul noţiunii „persoană cu funcţie de demnitate publică”. Alte norme pot doar să dezvolte prevederile acestora, fără a le lărgi sfera de incidenţă. Printre astfel de norme dezvoltătoare se numără: alin.(3 art.17 din Codul electoral; alin.(51 art.42 al Legii cu privire la energetică; art.131 al Legii privind Comisia Na

  2. Nasilje v družini - analiza stanja v Republiki Sloveniji od leta 2004 do leta 2010 : diplomsko delo visokošolskega strokovnega študija Varnost in notranje zadeve

    OpenAIRE

    Kern-Pandev, Vesna

    2012-01-01

    V diplomski nalogi z naslovom Nasilje v družini – analiza stanja v Republiki Sloveniji od leta 2004 do leta 2010 bomo proučevali nasilje v družini s teoretičnega in praktičnega vidika v navedenem sedemletnem obdobju. Posamezne vsebine, ki so pomembno vplivale na obravnavano obdobje in tematiko, se bodo nanašale tudi na čas pred tem obdobjem in po njem. Prvi del bo namenjen pravnim značilnostim oziroma formalni ureditvi tega področja, teoretičnim spoznanjem o nasilju v družini, storilcih ...

  3. EKSPERIMENTALNA ANALIZA VIBRACIJ NA PRALNI GRUPI

    OpenAIRE

    Kozel, Rok

    2012-01-01

    Diplomsko delo se ukvarja z vibracijami pralnega stroja. Eksperimentalno analizo smo opravili na laboratorijskem preizkuševališču, kjer je pralna grupa obešena na namenskem ogrodju. Na pralni grupi sta nameščena pospeškomera ADXL345, ki sta s serijsko SPI komunikacijo povezana z NI PXI-7841R karto. NI PXI-7841R karta je v ohišju NI PXI 1003 in je povezana z računalnikom. Pralna grupa je opremljena tudi z BLAC motorjem, s katerim operira razvojna plošča NEXYS 2. Vse skupaj nadziramo preko raču...

  4. Vremja emotsii i vremja analiza / Boris Tuch

    Index Scriptorium Estoniae

    Tuch, Boris, 1946-

    2008-01-01

    2007. aasta aprillisündmustele pühendatud V Kodurahu foorumile oli seekord kutsutud mitmeid väliskülalisi. Mõtteid Saksa politoloogi Alexander Rahri ja raadioajakirjaniku Andreas Brenneri, Vene sotsioloogi Vladimir Mukomeli, majandusekspertide akadeemik Mihhail Bronshteini ja Heido Vitsuri esinemistest

  5. ANALIZA NIESTANDARDOWA W MECHANICE NEWTONOWSKIEJ PUNKTU MATERIALNEGO

    OpenAIRE

    Wozniak, Czesław

    1981-01-01

    International audience; The aim of the present paper is to apply and to investigate the non-standard analysis as the mathematical tool of Newtonian mechanics. Such approach introduces into mechanics non-Archimedean ordered fields and makes it possible to describe explicitly also infinite and infinitesimal values of the physical quantities. Generally speaking, the methods of the non-standard analysis in Newtonian mechanics of mass-point systems lead to the wider class of mathematical models of...

  6. ANALIZA RADIJSKEGA OGLAŠEVANJA V SLOVENIJI

    OpenAIRE

    Huzjan, Jelena

    2015-01-01

    Večina radijskih postaj glavnino finančnih sredstev, potrebnih za preživetje in uspešno poslovanje, pridobiva s prodajo radijskega oglasnega prostora. To zahteva proaktivno delovanje radijske postaje in aktivno trženje oglasnega prostora. Da bi bil lahko proces trženja kar se da uspešen, je nujno poznavanje razmer na področju medijev, aktualnega stanja na trgu ter upoštevanje velikega števila vplivnih dejavnikov. Zaradi tega je bil cilj magistrskega dela raziskati globalne trende na podro...

  7. UNELE ASPECTE PRIVIND ANALIZA JURIDICO-PENALĂ COMPARATIVĂ A INFRACŢIUNILOR INFORMATICE ÎN LEGEA PENALĂ A REPUBLICII MOLDOVA ŞI ÎN CEA A ROMÂNIEI

    Directory of Open Access Journals (Sweden)

    Sergiu CRIJANOVSCHI

    2016-11-01

    Full Text Available Scopul propus în acest articol ştiinţific rezidă în soluţionarea unor aspecte discutabile legate de analiza juridico-penală a infracţiunilor săvârşite în domeniul informaticii. În el sunt elucidate anumite aspecte problematice, fiind înaintate soluţii relevante ale acestora şi formulate propuneri de lege ferenda cu scopul perfecţionării legislaţiei penale în vigoare. Pentru a atinge scopul trasat autorul a analizat doctrina din domeniul dreptului penal şi cibernetic, precum şi a efectuat analiza comparativă a legislaţiei penale interne a Republicii Moldova şi a celei a României, pe de o parte, a actelor inter­naţionale în sfera informaticii, pe de altă parte. Au fost aduse definiţii relevante ale infracţiunilor informatice. Autorul a clarificat natura unor termeni pur cibernetici, adaptându-i la realitatea juridică.some aspects concerning the comparative analysis of the cyber crimes in the criminal law of the republic of moldova and romania The main purpose of this scientific article consists in solving of some disputable aspects which are linked to the analysis of cyber crimes from the criminal law perspective. By means of this message there have been elucidated some questions which didn’t found the relevant solution before the research, as well as there have been formulated some proposals for reform in order to improve criminal legislation in force. In order to obtain this purpose the author has analyzed the domain of the Substantive Criminal law and cybernetics, as well as has performed the comparative research of the criminal law provisions from the Republic of Moldova and Romania, on the one side, and international acts in the cybernetics, on the other. There have been formulated several definitions suitable for cyber crimes. The author has clarified the nature of some cybernetic terms, they being adapted to the juridical reality.

  8. Dinamička analiza modela podloge minobacača primenom softverskog paketa Pro/Engineer / Dynamic analysis of a model of the mortar base plate applying the Proengineer software

    Directory of Open Access Journals (Sweden)

    Zoran Ristić

    2009-01-01

    Full Text Available Mehanički modela podloge minobacača kalibra 120 mm modeliran je primenom paketa Pro/Engineer Wildfire. Izrađeni model podloge potpuno je funkcionalan i realan. Takođe, izvršena je strukturna analiza naprezanja podloge minobacača usled opterećenja koja se javljaju u toku opaljenja. Dobijeni rezultati simulacije naprezanja upoređeni su sa eksperimentalnim podacima i rezultatima proračuna dobijenih klasičnim metodama. Na taj način utvrđene su veličine odstupanja i izvršena ocena kvaliteta modela. / A mechanical model of the mortar base plate is modeled using the Pro/Engineer Wildfire software. The manufactured model of the plate is fully functional and real. The structural stress and strain analysis of the mortar plate during firing has also been carried out. The obtained results of the simulation have been compared with the experimental data and the calculation results obtained by classical methods. The deviation values are thus established and the model quality assessed.

  9. Comments on "Determination and Analysis of the Theoretical Production of a Bucket Wheel Excavator" / Uwagi I Komentarze Do Pracy: "Określanie I Analiza Teoretycznej Wydajności Pracy Koparki Wielonaczyniowej Kołowej"

    Science.gov (United States)

    Bošnjak, Srđan M.

    2015-03-01

    żne przeoczenie. Che i Chen (2014) kwestionują prawidłowość równania (6), lecz przedstawione w niniejszej pracy analizy i uwagi prowadzą do następujących wniosków: • Stwierdzenie w pracy (Che i Chen 2014) że równanie (6) nie uwzględnia wpływu tmax i h nie jest prawdziwe. Dowód: Równanie (6'). • Stwierdzenie że równanie (6) nie uwzględnia wpływu R_s^' - "...czyli obrotowego promienia działania..." (Che i Chen 2014) jest prawdziwe, w przeciwnym razie równanie (6) byłoby nieprawdziwe. Równanie (6) uwzględnia odpowiedni promień zdefiniowany w równaniu (i), które jest prawdziwe. Dowód: Równanie (6'). W rozdziale 2 pracy (Che i Chen 2014) zatytułowanym: "Analiza teoretycznej wydajności koparki kołowej wielonaczyniowej" kierując się błędnymi wnioskami odnośnie niedokładności równania (6) autorzy podjęli próbę skorygowania powyższej niedokładności, by w ten sposób poprawić istniejącą teorię, W trakcie realizacji koncepcji wykorzystania równania (11) do zdefiniowania zasad rządzących zmianą prędkości kątowej wysięgnika Che i Chen (2014) popełnili błąd. Przyjęli oni mianowicie, że wyrażenie (14), otrzymane dla górnego przekroju wykopu e odnosić się będzie także do wszystkich przekrojów, dla całej wysokości wrębu. Pominęli w ten sposób fakt iż prędkość w ruchu łukowym wysięgnika nie jest wielkością stałą, patrz: równania (f) i (f'), i przyjęli jej wartość maksymalną, równanie (f'). Dlatego też równania (15), (16), (18) i (19) nie są prawidłowe. Wszystkie wejściowe dane obliczeniowe a także sposób ich zapisu (Tabela 1) zostały zaczerpnięte z pracy (Che i Chen 2014). Ponadto, zaprezentowane dane o pracy koparki wielonaczyniowej SchRs wykorzystywanej w kopalni "Zukunft" w Reńskim Zagłębiu Węglowym, zaczerpnięto z pracy (Durst i Vogt 1988). Osiągnięcia badań teoretycznych Che i Chen (2014, strona 289) przedstawione dla konkretnej koparki wielonaczyniowej kołowej eksploatowanej w

  10. The Essence Of The Emerging Markets’ Investment Risk. Comparative Analysis Of American And Central European Convertible Bond Issuers / Istota Ryzyka Inwestycyjnego Rynków Wschodzących. Analiza Porównawcza Amerykańskich I Środkowoeuropejskich Emitentów Obligacji Zamiennych

    Directory of Open Access Journals (Sweden)

    Marszałek Jakub

    2015-08-01

    Full Text Available W niniejszym artykule podjęto próbę identyfikacji czynników determinujących rating kredytowy emitentów instrumentów dłużnych na rynkach wschodzących. Padaniu poddano grupę emitentów obligacji zamiennych z lat 2001-2012, z czego połowa pochodziła z Europy Środkowej i Wschodniej, natomiast druga część to podmioty amerykańskie. Analiza dotyczyła wyłącznie par obligacji o tym samym ratingu, nadanym przez brytyjską agencje Fitch, która specjalizuje się w analizie rynków wschodniej i centralnej Europy. Przeprowadzona analiza pozwala zauważyć, że istotnym czynnikiem różnicującym obie grupy obligacji jest ryzyko wypłacalności rozumiane przez poziom zadłużenia, stopień dźwigni finansowej oraz płynność bieżącą. Zmiany wartości zadłużenia, a więc posiadanych przez inwestorów zagranicznych aktywów wydają się główną przyczyną wyższych wymagań wobec emitentów z rynków wchodzących.

  11. Analiza toplotnih izgub pri različnih okenskih sistemih

    OpenAIRE

    Movrin, Miran

    2014-01-01

    Ob vseobsegajočih razvojnih trendih tudi okna niso bila izvzeta, njihov razvoj je med drugim šel tudi v smeri zmanjševanja toplotnih izgub. Raziskovali smo, kolikšne so toplotne izgube pri okenskih sistemih z različno okvirno konstrukcijo, s steklom in z distančno letvijo. Ugotovili smo, da imajo lesena, aluminijasta in PVC-okna z novimi PVC-distančniki manjše toplotne izgube od dosedanjih izdelanih s klasičnimi, aluminijastimi distančniki. Ugotovitev pa je tudi razultat primerjave velikosti ...

  12. ANALIZA UGLEDA ZAVAROVALNE DRUŽBE ADRIATIC SLOVENICA

    OpenAIRE

    Breznik, Uroš

    2015-01-01

    V diplomskem projektu sem v teoretičnem delu definiral ugled ter pojasnil njegov pomen v podjetju. Nadaljeval sem z opisovanjem dejavnikov, ki sestavljajo ugled ter raziskal razlike v pojmovanju ugleda, identitete ter podobe. V zaključku teoretičnega dela sem se še nato osredotočil na potek merjenja ugleda. V empiričnem delu sem najprej opredelil zavarovalništvo kot storitev ter nadaljeval z predstavitvijo slovenskega zavarovalniškega trga. V raziskovalnem delu naloge sem pojasnil metode ...

  13. ANALIZA KALJENIH MATERIALOV S POMOČJO FRAKTALNE GEOMETRIJE

    OpenAIRE

    Babič, Matej

    2014-01-01

    V disertaciji proučujemo inteligentne sisteme in iskanje znanja, račcunalniške paradigme, ki so uporabni in koristni pri toplotni obdelavi materiala. Za razpoznavanje kompleksnosti različcno toplotno obdelanih vzorcev smo uporabili metodo fraktalne geometrije. Oblikovali smo inteligentni sistem s pomočjo katerega bomo napovedali topografske lastnosti materiala po toplotni obdelavi. Razvili smo nov algoritem 3D grafov vidljivosti. S pomočjo topološke lastnosti povezanost 3D g...

  14. Diagnoza organizațională (Analiza diagnostic

    Directory of Open Access Journals (Sweden)

    Marius DODU

    2004-10-01

    Full Text Available Organizational diagnosis is a step (some authors say the first in a change process, having as primary goals identifying strengths and weaknesses, their causes and finding solutions intended to lead towards an improvement of the organization. The paper tries to present some of the models of organizational diagnosis that were proposed: three level model, Weisbord Six Box model, Burke-Litwin and the congruence model, discussing their advantages and disadvantages. The last part of the paper presents the requirement for a successful diagnosis, with emphasis on the specificity of the public sector.

  15. Analysis of Network Traffic Filtering / Analiza Filtracji Ruchu Sieciowego

    Directory of Open Access Journals (Sweden)

    Kabala Piotr

    2015-09-01

    Full Text Available Artykuł przedstawia badania koncepcji Platformy Sieciowej z zaporą Linux PLD wykorzystującą dostępne narzędzia analizy ruchu, implementację wybranego mechanizmu bezpieczeństwa oraz analizę efektywności przygotowanej Zapory Sieciowej (FW. Badania oparto na architekturze ekranowanych podsieci. Testowanie skuteczności zapory wykonano w dwóch etapach. W pierwszej części sprawdzono bezpieczeństwo poprzez testowanie odporności na próby skanowania portów i najczęstsze typy ataku. Druga część badań miała na celu pokazanie wpływu zapory na czas i opóźnienie realizacji transakcji dla ruchu HTTP w zależności od poziomu bezpieczeństwa i natężenia ruchu generowanego przez użytkowników sieci wewnętrznej. Sprawdzenie skuteczność FW zostało zweryfikowane przez badania odporności w próbie skanowania portów i ataków odmowy usługi (tj. SYN Flood i ICMP zapewniając bazę rozproszonych ataków typu DDoS. Ta część badań miała jeden cel, którym było pokazanie wpływu FW na czas i opóźnienia realizacji transakcji dla ruchu HTTP, w zależności od poziomu bezpieczeństwa i intensywności ruchu generowanego przez użytkowników sieci.

  16. Analiza preiskovalnih metod na primeru igre Scotland Yard

    OpenAIRE

    BELEJ, NEŽA

    2015-01-01

    V diplomskem delu se seznanimo s področjem umetne inteligence, ki se ukvarja z raziskovanjem namiznih iger in iskanjem njihovih programskih rešitev. Preučimo algoritem drevesnega preiskovanja Monte-Carlo in ga poskušamo čim bolj spretno prenesti na znano namizno igro Scotland Yard, pri čemer upoštevamo nasvete Nijssena in Winandsa. Osredotočimo se predvsem na tretjo fazo algoritma, simulacijo, katero se odločimo implementirati na tri različne načine (od manj naprednih do bolj naprednih), te n...

  17. Analiza prekidača startera solenoida automobila

    OpenAIRE

    Murugesan, V. M.; G. Chandramohan; Senthil kumar, M; Rudramoorthy, R.; Ashok Kumar, L.; Palla, Rambabu

    2015-01-01

    U ovom članku namjera je prikazati jednostavnu eksperimentalnu analizu električnog kontakta u automobilskim kontaktima kada vode struju. Sustav za paljenje je dizajniran je kako bi osigurao vozaču praktičan, učinkovit i pouzdan način paljenja motora s unutarnjim izgaranjem. Sustav za paljenje sastoji se od dva odvojena kruga, krug s jakom strujom (150 A - 530 A) i slabom stujom (< 20A). Kako spomenuti krug podrazumijeva krug s jakim stujama i niskim naponom, kontakt solenoida će na krajevi...

  18. Jezična analiza lista Naš glas

    OpenAIRE

    2015-01-01

    U radu se analizira jezik Našega glasa (list „Riviere“ – radne organizacije za ugostiteljstvo, turizam, trgovinu i proizvodnju) koji je izlazio u Poreču od 1969. do 1982. godine. Nakon kratkoga osvrta na strukturu, sadržaj i ulogu toga lista te njegov značaj za stanovništvo lokalne zajednice, slijedi prikaz jezičnih zbivanja u vrijeme njegova izlaženja. U žarištu su istraživanja pravopisne, morfološke, sintaktičke, tvorbene, leksičke i stilske karakteristike lista. Rezultati istraživanja poka...

  19. Modelowa analiza rynkow pracy o roznej strukturze instytucjonalnej

    OpenAIRE

    Maciej Bukowski; Piotr Lewandowski; Pawel Kowal

    2011-01-01

    Przedmiotem analiz empirycznych i teoretycznych zawartych w niniejszej pracy sa makroekonomiczne i instytucjonalne determinanty zmian na rynkach pracy panstw OECD, analizowane przez pryzmat modelu poszukiwan i dynamicznego ujêcia rynku pracy. Rozdzial 1 poswiecony zostal analizie porownawczej rynkow pracy UE-15 i USA, a takze umiejscowieniu na tym tle zjawisk charakterystycznych dla transformujacej sie gospodarki Polski. Autorzy stawiaja teze, ze przestrzen roznic w zachowaniu sie zatrudnieni...

  20. ANALIZA INVESTITIILOR NETE SI IMOBILIZĂRILOR CORPORALE DIN TURISM

    Directory of Open Access Journals (Sweden)

    Daniela Aurelia Duma

    2011-01-01

    Full Text Available Net investment is the actual expenditure for works of construction activity, installation andassembly of tourism, taking into account the industry, to purchase equipment, vehicles andother expenditure for the creation of new assets, development, modernization,reconstruction of existing ones, and the value of services related to transfer of ownership ofexisting fixed assets and land.

  1. SAVREMENE METODE PROCENE INOVACIONOG POTENCIJALA REGIONA : ANALIZA I KLASIFIKACIJA

    Directory of Open Access Journals (Sweden)

    Viktorija Rjapuhina

    2014-07-01

    Full Text Available Inovacije umnogome određuju razvoj ekonomije a inovaciona delatnost je zalog za obezbeđivanje konkurentnosti. U savremenom svetu resursi, kapital i vreme su ograničeni, te je zbog toga aktuelan problem procene inovacionog potencijala u cilju njegove efikasne realizacije. Predložena je klasifikaciju postojećih metoda procene inovacionog potencijala i to: prema objektu izdvajaju se resursni, rezultatativni i vredonosni; u zavisnosti od kategorije - rezultativni, potrošni i uporedni; u zavisnosti od vrste sistema parametara - integralni ili sintetički, privatni i kompleksni; proizilazeći iz kriterijuma - detaljan i dijagnostički pristup; prema karakteru – modalni i metod za rangiranje. Proces procene deli se na stadijume u zavisnosti od principa strukturisanja potencijala.

  2. ANALIZA IN UPORABA ORODIJ CAAT ZA REVIZIJO INFORMACIJSKIH SISTEMOV

    OpenAIRE

    2010-01-01

    V diplomski nalogi smo predstavili in uporabili orodja CAAT, ki služijo kot pomoč pri revidiranju informacijskih sistemov. Predstavili smo tri orodja, to so IDEA, TopCAATs in ACL. Povzeli smo njihove temeljne funkcije, ki so uporabne pri revidiranju. V nadaljevanju smo sestavili testni primer na katerem smo preizkusili vsako izmed omenjenih orodij. Tako smo ugotovili prednosti in slabosti teh orodij na sploh, ter za vsakega posebej.

  3. FRANCUSKA I POLSKA NOMENKLATURA CHEMII ORGANICZNEJ. ANALIZA PORÓWNAWCZA

    OpenAIRE

    2012-01-01

    Wydział Neofilologii: Instytut Filologii Romańskiej Rozprawa dotyczy porównania francuskiej i polskiej nomenklatury w dziedzinie chemii organicznej. Pierwszy rozdział opisuje podstawowe terminy, jak: język techniczny, słownictwo specjalistyczne, nomenklatury, terminologia, oraz podstawowe pojęcia nazewnictwa chemii organicznej i typy zapisów nazw w chemii. Przeanalizowano elementy wzorów chemicznych, znaczenie i rolę liter, cyfr, prefiksów i sufiksów grecko-łacińskich, innych znaków...

  4. ANALIZA OBSTOJEČIH RAZŠIRITEV V SISTEMU JOOMLA

    OpenAIRE

    Šalamun, Zmagoslav

    2012-01-01

    V diplomskem delu ocenjujemo in opisujemo obstoječe razširitve za odprtokodni sistem za upravljanje vsebin Joomla. Uporabili smo samo obstoječe in brezplačne razširitve, ki smo jih naložili z uradne spletne strani Joomla Extensions Directory. Razširitve smo ocenili s pomočjo večparametrskega odločitvenega modela. Obstajajo številni brezplačni sistemi za upravljanje vsebin

  5. Microsoft a ekonomiczna analiza prawa (Law and Economics)

    NARCIS (Netherlands)

    Janczuk, Agnieszka; Gorywoda, Lukasz

    2005-01-01

    On March 24, 2004, the European Commission adopted a decision in the Microsoft case. This decision is likely to have a significant impact on the design of the computer programs market. The objective of this paper is to analyze economic consequences of the decision.

  6. ANALIZA UČINKA ZONE SLOBODNE TRGOVINE CEFTA 2006

    Directory of Open Access Journals (Sweden)

    Dijana Grahovac

    2013-01-01

    Full Text Available Regional cooperation has been a general trend in the development of international economic relations in the second half of the twentieth century. This process included all continents and is the result of the globalization process. CEFTA 2006 (Central European Free Trade Association was formed at the initiative of the EU, with economic links to member countries, creating a favorable investment environment and strengthens the competitive position of the region. Taking advantage of the opportunities provided by CEFTA 2006, member states will be competitive on the EU market. CEFTA 2006 is the subject of much discussion and debate in scientific circles, political entities and Government of member countries. This is particularly true with regard to perception of positive and negative effects for the Member States and consideration of the effects of implementation of the CEFTA agreement as a potential precondition on the road to EU countries in the region. Analysis of economic indicators of the countries of the Visegrad Group, which has successfully implemented the original CEFTA agreement, provides the framework guidelines for the conduct of foreign policy of the current CEFTA countries. On the other hand, the analysis of macroeconomic indicators of the current CEFTA countries, provides the guideline and determines necessary courses of action in the further implementation of the Agreement. These analyzes provide a chance to reflect the perspective of the process. Research of recent results of regional cooperation allows the assessment of the impact on the economic development of the region and the prospect of integrating these countries into the EU, by strengthening regional cooperation.

  7. Spatial Diversification Of Living Standards In The Former Communist Countries Of Central And Eastern Europe And The Balkans / Analiza Zróżnicowania Przestrzennego Poziomu Życia w Krajach Postkomunistycznych Europy Środkowo- Wschodniej I Na Bałkanach

    Directory of Open Access Journals (Sweden)

    Karmowska Grażyna

    2015-12-01

    Full Text Available Celem artykułu jest przedstawienie wyników badań dotyczących zróżnicowania poziomu i jakości życia mieszkańców krajów postkomunistycznych Europy Środkowo- Wschodniej i krajów bałkańskich. Z grupy państw postkomunistycznych, do badań szczegółowych wybrano 19 krajów, w tym: 7 z grupy państw postsocjalistycznych, 7 poradzieckich i 5 z byłej Jugosławii. Przyjęta procedura badawcza pozwoliła na analizę zagadnienia zarówno w ujęciu statycznym (analiza porównawcza rankingów wskaźników jakości życia - Quality of Life Index (QLI i Human Development Index (HDI, jak i dynamicznym (ocena poziomu życia na podstawie taksonomicznych mierników syntetycznych za lata 2007 i 2012. Wyniki przeprowadzonych badań wskazują na znaczne zróżnicowanie poziomu życia mieszkańców w krajach postkomunistycznych. W zależności od zakresu i stopnia szczegółowości użytych wskaźników jakości życia pozycje rankingowe badanych krajów nieznacznie się różnią, ale we wszystkich zauważalne były te same tendencje. Najwyżej oceniono warunki życia panujące w krajach byłej Czechosłowacji (Czech i Słowacji oraz Słowenii. Na stosunkowo wysokich pozycjach sklasyfikowano także pozostałe kraje należące do UE. Natomiast najsłabiej wypadły kraje bałkańskie takie jak: Albania, Mołdawia i Bośnia i Hercegowina. Wyniki analizy wielowymiarowej potwierdziły te oceny i ponadto, pozwoliły na określenie kierunków zmian w warunkach życia mieszkańców poszczególnych krajów. W 2007 roku poziom życia określony jako wyższy od przeciętnego stwierdzono w 9 krajach, a w 2012 roku było już 10 takich krajów. W porównaniu do 2007 roku wzrost GDP per capita odnotowano w przypadku 16 państw, poprawiła się sytuacja w ochronie zdrowia (wzrost wydatków na ochronę zdrowia oraz wzrosła liczba użytkowników Internetu. Odnotowano również niepokojące zjawiska- wzrost bezrobocia (16 krajów, spadek przyrostu naturalnego (9 kraj

  8. Analiza komparatystyczna wizerunku Beaty Szydło i Ewy Kopacz w debatach przedwyborczych

    Directory of Open Access Journals (Sweden)

    Barbara Mazurkiewicz-Białęcka

    2016-06-01

    Full Text Available Presented article is an attempt to comparative analysis the images of Szydło Beata and Ewa Kopacz in the election campaign preceding the general elections in 2015. The analysis refers, both to the image of the candidates, as well as to the role of women in politics in general, including the problem of stereotyping. The article also raised the issue of language, communication skills, mediatisation and trends within a run political campaigns.

  9. Analiza tehnika upravljanja prenosom podataka / Analysis techniques for flow data transmission

    Directory of Open Access Journals (Sweden)

    Milojko Jevtović

    2006-01-01

    Full Text Available U članku su predstavljene ARQ tehnike za upravljanje prenosom i kontrolu na nivou veze: "Stani i čekaj", " Vrati se unazad za N" i "Selektivno odbacivanje ". Zatim je definisan važan parametar, kojim su analizirane osobine prenosa podataka na nivou veze i uprošćen prikaz karakteristika tehnika "Vrati se unazad za N" i "Selektivno odbacivanje". Osnovni cilj rada odnosi se na definisanje kriterijuma za izbor odgovarajućeg protokola upravljanja na nivou veze koji će zadovoljiti zahteve korisnika (gubici, kašnjenje, varijacija kašnjenja, propusna moć. Na osnovu urađene simulacije, korišćenjem programa MATLAB 7.0, izvršeno je upoređenje vrednosti parametara karakterističnih za navedene tehnike i izvedeni zaključci o prednostima i manama pojedinih tehnika. / This article presents ARQ techniques for flow and control at the link level: Stop-and-Wait, Go-back-N, and Selective-reject. Then it is defined an important parameter, necessary for analyzing characteristics of data transmission at the link level and simplified performances of the Go-back-N, and Selective-reject techniques. Main goal of this article refers to defining criteria for choosing proper protocol link control. By this criterion it is necessary to satisfy customer requirements like losses, delays, capacity, etc. By performing simulation (using MATLAB 7.0, comparison of the values of the techniques parameters is done and conclusions about advantages and disadvantages of certain techniques are given.

  10. ANALIZA UČBENIKOV ZA NARAVOSLOVJE V ŠESTEM RAZREDU DEVETLETNE OSNOVNE ŠOLE

    OpenAIRE

    Stajnko, Maja

    2011-01-01

    Vsako leto so učitelji postavljeni pred težko odločitev, kateri učbenik izbrati za predmet, katerega poučujejo. Izbirajo pa lahko med učbeniki različnih avtorjev in različnih založb. Prav tako pa je pomembno, da je te učbenike potrdil Strokovni svet Republike Slovenije za tekoče šolsko leto, kajti le-ti učbeniki po predpisih zadoščajo osnovnim kriterijem — pokrivajo učne cilje in so strokovno vsebinsko ustrezni. V tem diplomskem smo želeli analizirati in primerjati učbenike za naravoslovje v ...

  11. ANALIZA SECVENŢIALĂ A COMPORTAMENTULUI DE HRĂNIRE LA ŞOBOLANUL DE LABORATOR

    OpenAIRE

    Alina Rusu; I. M. Benta

    1999-01-01

    The aim of our paper was to realise a sequential analysis of laboratory rat feeding behavior. We reconsider the behavioral classification in term of the goal perception. Four individual behavioral counts were used in this study: the behavioral activity, the behavioral complexity, the status of each sequence, and the relative enthropy. Our data shown that the enthropy modification could be used as behavioral index for learning processus, and for the sexual dimorphism at different individual fe...

  12. Analiza polityki publicznej w zakresie zatrudnienia oraz wynagrodzenia w polskiej administracji w latach 2002–2011

    Directory of Open Access Journals (Sweden)

    Tomasz Strąk

    2013-06-01

    Full Text Available Purpose: The article presents the results of the analysis of the employment and salary policy in Polish public administration in the period of 2002-2011 in terms of public administration management in times of the financial crisis and the competitiveness of employment in government administration. The authors of the article examine the effectiveness of the subsequent government efforts to institute “a cheap state”. They have assumed that in the examined period the effectiveness of government administration did not change considerably.Originality: The presented analysis covers such issues as: identifying the determinants of changes in salary and employment rates in government administration; an analysis of the relevant major legal institutions; a study of the main changes in the salary and employment policy in government administration; an analysis of the employment and remuneration budget in public administration; an assessment of the changes in the effectiveness of the functioning of government administration.Methodology: In their studies the authors conduct inductive and deductive reasoning by means of the following research techniques: an analysis of legal acts, strategic government documents and reports of the Supreme Audit Office (NIK; a statistical dynamics and structure analysis; a comparative analysis and a one-dimensional analysis of public expenditure efficiency.

  13. PRIMERJALNA ANALIZA RAČUNALNIŠKIH REŠITEV Z PODPORO RAČUNOVODSKIH SERVISOV

    OpenAIRE

    Korez, Tatjana

    2011-01-01

    Računovodstvo je posebna celota delov informacijskih dejavnosti, znotraj katerih se zbirajo, urejajo, obdelujejo, prikazujejo in shranjujejo podatki. Računovodstvo zasebnikov in družb je pomembno zaradi državnih oz. davčnih potreb, kot tudi zaradi interesov odločanja o poslovanju. Informacijski sistem in poslovanje podjetja morata biti usmerjena v doseganje ciljev in prilagodljiva. Pri predvidevanju spremenjenih potreb strank in pravočasnem odzivanju na nove zahteve igrajo najpomembnejšo...

  14. ANALIZA OGLAŠEVANJA V PODJETJU POMARANČA D.O.O.

    OpenAIRE

    Jurkovič, Aleksandra

    2012-01-01

    Diplomsko delo obsega oglaševanje v podjetju Pomaranča d.o.o. Podjetje Pomaranča ima po vsej Sloveniji odprtih več lokalov, ki ponujajo gostinske storitve. Kljub veliki prisotnosti številnih gostinskih lokalov na tržišču, se Pomaranča dobro spopada s konkurenco. V prednosti pred konkurenco je zaradi dobro oblikovanega tržno-komunikacijskega spleta, prav tako pa goste privablja njena gostoljubnost, ambient in dobra ponudba. V diplomskem delu smo se osredotočili na lokal Pomaranča (Ob Dravi 3a)...

  15. ANALIZA MARKETINŠKEGA SPLETA PAKETNIH STORITEV POŠTE SLOVENIJE D.O.O.

    OpenAIRE

    Jurančič, Primož

    2011-01-01

    Diplomski seminar obravnava marketinški splet storitev (7P). V seminarju so zajete oz. prikazane najpomembnejše teoretične osnove obravnavane tematike in na primeru organizacije prikazan, ter glede na kakovost analiziran oz. raziskovan njihov marketinški splet storitev. V teoretičnem delu seminarja je v celoti predstavljen marketinški splet storitev (7P), saj so v ločenih poglavjih prikazane vse sestavine marketinškega spleta (7P): izdelek, cena, prostor, promocija oz. marketinško komunic...

  16. Strukturna analiza složenih planetarnih prenosnika snage / Structural analysis of compound planetary gear trains

    Directory of Open Access Journals (Sweden)

    Slavko Muždeka

    2005-03-01

    Full Text Available Određivanje osnovnih kinematičkih i dinamičkih karakteristika složenih planetarnih prenosnika je složen proces za koji je razvijeno više analitičkih, grafičkih i grafoanalitičkih metoda. U radu je prikazan način određivanja prenosnog odnosa, opterećenja elemenata i tokova snage za planetarni red sa spoljašnjim i unutrašnjim ozubljenjem preko polužne analogije i primene strukturnog (Wolfovog simbola. Polužna analogija definisana je i za planetarni red sa spoljašnjim ozubljenjem, za koji je, takođe, definisan strukturni simbol. Definisani strukturni simboli iskorišćeni su za definisanje strukture prenosnika tipa Ravigneaux. Primena strukturne šeme za analizu karakteristika složenih planetarnih prenosnika ilustrovana je kroz analizu određenih funkcionalnih stanja planetarnih menjačkih prenosnika. Posebno je definisana mogućnost analize blokiranih stanja planetarnih menjačkih prenosnika. / Determination of basic cinematic and dynamic characteristics of compound planetary gear trains is complex process. Therefore there are many analytical, graphical and graphic-analytical methods. This paper presents method of determination gear ratios, loads and power flows for planetary gear set with the sun and ring gear by lever analogy with the application of Wolfs structural symbol. The lever analogy and structural symbols are also defined for the planetary gear set with two sun gears. Defined structural symbols are employed for definition of Ravigneaux gear structure. Application of structural schemes for an analysis of compound planetary gear trains is illustrated through analysis of certain planetary gearboxes functional state. The possibility of analysis of blocked compound planetary gear train is defined too.

  17. Strukturna analiza složenih planetarnih prenosnika snage / Structural analysis of compound planetary gear trains

    OpenAIRE

    Slavko Muždeka

    2005-01-01

    Određivanje osnovnih kinematičkih i dinamičkih karakteristika složenih planetarnih prenosnika je složen proces za koji je razvijeno više analitičkih, grafičkih i grafoanalitičkih metoda. U radu je prikazan način određivanja prenosnog odnosa, opterećenja elemenata i tokova snage za planetarni red sa spoljašnjim i unutrašnjim ozubljenjem preko polužne analogije i primene strukturnog (Wolfovog) simbola. Polužna analogija definisana je i za planetarni red sa spoljašnjim ozubljenjem, za koji je, t...

  18. ANALIZA ZVUČNOG POLJA OKO VIBRIRAJUĆE PLOČE

    OpenAIRE

    Skoblar, Ante

    2006-01-01

    U radu su prikazani analitički, numerički i eksperimentalni pristup u rješavanju problema stvaranja zvučnog polja oko vibrirajuće ploče. Analitički su određene vlastite vrijednosti vibracija ukliještene pravokutne ploče. Numeričkom metodom konačnih elemenata izračunate su vlastite vrijednosti ploče te odziv ploče pri zadanom opterećenju jednakom eksperimentu te vlastite vrijednosti te odziv zvučnog polja oko ploče. Strukturni valovi približno su određeni pomoću pomaka dok su valovi u okolnom ...

  19. CÂTEVA ASPECTE PRIVIND ANALIZA ECHILIBRELOR ÎN OPTICA FINANCIARĂ

    Directory of Open Access Journals (Sweden)

    Cristian Huminiuc

    2007-05-01

    Full Text Available At the level of any enterprise the financial equilibrium is determined starting from thefinancial balance. The drawing up of the financial balance is based upon the accounts balance, beginning with aretreat and a re-classification of the assets and liabilities positions respecting the liquidity- exigibility criteria.The main indicators taken into analysis according to this balance are: the net situation, the working capital, thenecessary for the working capital and the net treasure.

  20. Sdelki s zarubezhnõmi materinskimi predprijatijami trebujut nalogovogo analiza / Rolan Jankelevitsh

    Index Scriptorium Estoniae

    Jankelevitsh, Rolan

    2005-01-01

    Tehingud välismaise emaettevõtjaga vajavad maksuanalüüsi. Eesti residendist juriidilise isiku ja temaga seotud mitteresidendi või füüsilise isikuga tehtud tehingu (siirdetehing) maksustamisest. Lisatud loetelu: siirdehindade regulatsioon Eestis

  1. Multifractal analysis of satellite images. (Polish Title: Multifraktalna analiza zobrazowan satelitarnych)

    Science.gov (United States)

    Wawrzaszek, A.; Krupiński, M.; Drzewiecki, W.; Aleksandrowicz, S.

    2015-12-01

    Research presented in this paper is focused on the efficiency assessment of multifractal description as a tool for Image Information Mining. Large datasets of very high spatial resolution satellite images (WorldView-2 and EROS-A) have been analysed. The results have confirmed the superiority of multifractals as global image descriptors in comparison to monofractals. Moreover, their usefulness in image classification by using decision trees classifiers was confirmed, also in comparison with textural features. Filtration process preceding fractal and multifractal features estimations was also proved to improve classification results. Additionally, airborne hyperspectral data have been initially analysed. Fractal dimension shows high potential for the description of hyperspectral data. To summarise all conducted tests indicate the usefulness of multifractal formalism in various aspects of remote sensing. Prepared methodology can be further developed and used for more specific tasks, for example in change detection or in the description of hyperspectal data complexity.

  2. KINETIČKA, RAVNOTEŽNA I STATISTIČKA ANALIZA ADSORPCIJSKOG ODSUMPORAVANJA DIZELSKIH GORIVA

    OpenAIRE

    2009-01-01

    Odsumporavanje ugljikovodičnih goriva u posljednje vrijeme jedan je od najvažnijih procesa u rafinerijskoj preradi nafte. Sve stroži propisi o zaštiti okoliša zahtijevaju od proizvođača motornih goriva da poboljšaju postojeće procese i razmišljaju o alternativnim načinima uklanjanja sumpora iz motornih goriva. Obradom dizelskih goriva primjenjujući trenutačno dostupne tehnologije teško se postiže sadržaj manji od 10 mg kg-1 sumpora, jer sumporovi spojevi koji zaostanu u frakcijama s 500 mg kg...

  3. ANALIZA ŞI EVALUAREA PROIECTELOR DE INVESTIŢII ALE FIRMELOR DIN TURISM

    Directory of Open Access Journals (Sweden)

    Mihai POPESCU

    2007-06-01

    Full Text Available The investments represent the primordial factor for the strategy of the national economy development, of all branches and fields of activity, for the increase of the incomes, and a condition to arise the living standard. The directions and targets of economic research, in the existing stage give a special attention to the field of investment. The most frequent meaning for defining investments is that of expense or disposal of money sums at an initial moment in order to obtain subsequent effects, and numerous economists, from different countries, sought to render as many aspects as possible related to the content and mechanism of investment.

  4. Analiza niskofrekventnog spektra vibracija na elementima strukture helikoptera „gazela“

    OpenAIRE

    Jovanović M. Miroslav

    2010-01-01

    U radu je prikazan postupak i metodologija ispitivanja vibracija na helikopteru „gazela“ radi definisanja efikasnosti prigušenja vibracija na vezi struktura – sedište pilota. Posebna pažnja posvećena je teorijskim osnovama vibracija na helikopteru, određivanju radnih frekvencija, definisanju režima rada i profila leta helikoptera u toku ispitivanja. Na kraju rada prikazani su rezultati merenja vibracija u frekventnom domenu.

  5. Studiu comparativ privind analiza competitivității orașelor europene

    Directory of Open Access Journals (Sweden)

    Irina POPESCU

    2006-06-01

    Full Text Available When all the attention is focused on the city, the competitiveness issue must be modified/shaped in a way that should reflect the urban economic reality and its action ability. Most of its elements obviously important for a country – payment balance or trade flows, exchange rate, global demand management, anti-trust legislation – have no relevance for the city. Certain cities simply try to back up any type of hiring for those whose work contract had been interrupted by the unable companies to competitively cope with the newer and more efficient producers. Other cities enviably try to re-engineer the economic activity in order to improve the citizens’ living standard. The main subject of this article consists in examining the competitiveness indicators. The first subchapter of this article proposes to achieve a quantitative analyze centered upon a large range of indicators considered to be potentially important, regarding the city competitiveness. First of all, arguments have been registered for three key competitiveness features identified within specialty literature and surveys regarding decisional parameters – innovation, connectivity and qualified work force. Afterwards, other arguments have been proffered regarding connectivity, social cohesion and private sector opinions on the relative attractiveness within various European cities. Second part of the article explains the differences between European cities taking into consideration the cities’ economic performances, national achievements, the junction between successful cities and regions, the correlation between cities and sub-urban regions, the economic competitiveness and the exclusion and social cohesion, the national and regional administration issues, as well as the decentralization and fiscal capacity items.

  6. Analiza međunarodnih spajanja i preuzimanja u farmaceutskoj industriji

    OpenAIRE

    Matić, Božo; Bilas, Vlatka; Bači, Vedran

    2011-01-01

    Brojna su istraživanja koja analiziraju spajanja i preuzimanja, no većina ih se ne fokusira na neku određenu industriju, već uzorak obuhvaća poduzeća iz različitih industrija. Ovaj se rad fokusira na spajanja i preuzimanja u farmaceutskoj industriji. Pretpostavke su da farmaceutska poduzeća neiskusna u spajanju i preuzimanju postižu bolje rezultate u relativno malim, domaćim spajanjima i preuzimanjima, dok su farmaceutska poduzeća s većim iskustvom u spajanjima i preuzimanjima usp...

  7. Drevnerusskij pamflet na Mihaila VIII Paleologa v svete germenevtičeskogo analiza

    Directory of Open Access Journals (Sweden)

    Demincev Mihail

    2015-01-01

    Full Text Available In the article the perception of the image of Michael VIII Palaeologus by literate citizens of Tsardom of Russia is considered. The study is based on analysis of writings that date back to XVII century. The study focuses on identifying the symbols and latent ideas, that point to a semantic connection of the studied writings with The Old Testament, Apocalypse and some antique texts. In the end of the article the authjr makes a conclusion, that the perception of the image of Michael VIII Palaeologus in Tsardom of Russia was negative.

  8. Analiza fondurilor europene în proiecte PC7 prin participarea României

    Directory of Open Access Journals (Sweden)

    Margareta FLORESCU

    2010-10-01

    Full Text Available The research potential is a matter closely related to the resources of an organization. Thus, it is necessary to define these resources and to highlight those which play an important role in reference to research potential. The evaluation of the research potential and the design of actions meant to enhance it in order to successfully participate in FP7 programs, represent strategic activities for every type of organization operating in the field of research. Therefore, participation in FP7 programs does not represent an end in itself but rather an important stage in accomplishing the most important strategic component – namely the accomplishment of the sustainable competitive advantage (SCA; all the other components of the strategy are subordinated to this. The achievement of the system for determining the research potential is built on the transfer of know-how from various fields of the management – general management, strategic management, management of quality.

  9. Izbrannye voprosy matematičeskoj fiziki i p-adičeskogo analiza

    OpenAIRE

    2015-01-01

    This volume presents papers on modern trends in mathematical physics, including equations of mathematical physics, mathematical problems of quantum theory, and ▫$p$▫-adic mathematical physics. The volume also contains selected contributions to The Third International Conference on ▫$p$▫-adic Mathematical Physics: From Planck Scale Physics to Complex Systems and Biology (October 1-6, 2007, Moscow, Steklov Institute of Mathematics, Russian Academy of Sciences). The volume is addressed to scient...

  10. Koncept osrbne verige: analiza slovenskih podjetij = Supply Chain Concept: A Case Study

    Directory of Open Access Journals (Sweden)

    Klemen Kavčič

    2008-06-01

    Full Text Available Supply chain management knowledge has been dramatically growing in the past few years. The traditional concept of management with the aim to maximize profits and minimize cost of a company’s functions, is being replaced by the concept of supply chain management (SCM. The principal idea of a supply chain builds on companies partnering together to create mutual confidence and in addition to this to synchronize the performance of a single partner with the whole chain. The empirical study we present in this paper shows that Slovenian companies have theoretical knowledge of supply chains, however, they rarely apply it to their benefit. The research also shows that there are significant differences between service and production companies as well as big and small companies. The key to faster growth and bigger competitive advantage is to find and understand the obstacles that prevent a company to apply the concept of supply chain management. SCM thus represents an important field of academic research with the aim of implementing the global networking process.

  11. Domaća nafta prije 30 godina i danas (analiza i destilacija)

    OpenAIRE

    2010-01-01

    U radu su analizirani uzorci domaće nafte Slavonija i Moslavina te uzorak plinskog kondenzata koji se koriste u preradi u RN Sisak. Određene su fizikalno-kemijske karakteristike uzorkovanih nafti, plinskog kondenzata i njihovih frakcija te je načinjena atmosferska i vakuum destilacija pri čemu su korištene ASTM D 2892 i ASTM D 5236 metode. Dobiveni podaci predstavljaju fizikalno-kemijsku evaluaciju nafti u laboratorijskim uvjetima iz kojih proizlaze baze podataka o naftama (eng. crude oil ...

  12. Aktemra - pervyy i edinstvennyy biologicheskiy preparat, demonstriruyushchiy prevoskhodstvo nad sushchestvuyushchimi standartami terapii revmatoidnogo artrita

    Directory of Open Access Journals (Sweden)

    - -

    2008-01-01

    ostro neobkhodimy novye varianty terapii RA. Uil'yam M. Berns - glava podrazdeleniya Farma kompanii «Rosh»: «Dannye poslednikh issledovaniy yavlyayutsya obnadezhivayushchey novost'yu dlya patsientov, stradayushchikh ot razrushitel'nykh effektov RA. My verim, chto Aktemra - pervyy i edinstvennyy biologicheskiy preparat, demonstriruyushchiy preimushchestvo pered sushchestvuyushchimi standartami lecheniya RA, - oblegchit sostoyanie mnogikh bol'nykh. Krome togo, Aktemra predostavlyaet bol'she shansov dlya dostizheniya ranney i prodolzhitel'noy remissii».

  13. Aktemra - pervyy i edinstvennyy biologicheskiy preparat, demonstriruyushchiy prevoskhodstvo nad sushchestvuyushchimi standartami terapii revmatoidnogo artrita

    Directory of Open Access Journals (Sweden)

    - -

    2008-09-01

    ostro neobkhodimy novye varianty terapii RA. Uil'yam M. Berns - glava podrazdeleniya Farma kompanii «Rosh»: «Dannye poslednikh issledovaniy yavlyayutsya obnadezhivayushchey novost'yu dlya patsientov, stradayushchikh ot razrushitel'nykh effektov RA. My verim, chto Aktemra - pervyy i edinstvennyy biologicheskiy preparat, demonstriruyushchiy preimushchestvo pered sushchestvuyushchimi standartami lecheniya RA, - oblegchit sostoyanie mnogikh bol'nykh. Krome togo, Aktemra predostavlyaet bol'she shansov dlya dostizheniya ranney i prodolzhitel'noy remissii».

  14. Analiza mogućnosti smanjenja emisija čađe i NOx na suvremenim sporohodnim dizelskim dvotaktnim motorima

    OpenAIRE

    Senčić, Tomislav

    2010-01-01

    Smanjenje emisija dušikovih oksida i čađe uz povećanje stupnja djelovanja glavni su ciljevi kod razvoja suvremenih dizelskih motora. Proizvođači velikih brodskih motora razvijaju sustave koji omogućuju veliku fleksibilnost u radu i različite strategije koje omogućuju postizanje spomenutih ciljeva. U tu svrhu se osim mjerenja koriste kompjutorske simulacije. Za proračun tvorbe štetnih tvari najprikladnije su 3D numeričke simulacije. Veliki brodski motor specifičan je zbog svo...

  15. Analiza parametra translucencije staklokeramike izrađene različitim tehnološkim postupcima

    OpenAIRE

    Ledić, Karla; Majnarić, Igor; MILARDOVIĆ ORTOLAN, Slađana; Špalj, Stjepan; Štefančić, Sanja; Mehulić, Ketij

    2015-01-01

    Svrha: Analizirati parametar translucencije (TP vrijednosti) staklokeramika izrađenih različitim tehnološkim postupcima te ispitati kako na TP vrijednosti utječu korozivna sredstva. Materijali i metode: Izrađena su po tri uzorka IPS e.max keramike (Ivoclar Vivadent, Schaan, Lihtenštajn) u trima bojama (A2, C2 i B3) s trima različitim tehnologijama izrade (slojevanje – e.max Ceram Dentin; toplo-tlačna tehnika – e.max Press; strojno – e.max CAD). Uzorci su bili u obliku pločica dimenzija 10 mm ...

  16. ANALIZA BUGETULUI UNIUNII EUROPENE ÎN 2006 ŞI PERSPECTIVA ACESTUIA ÎN PERIOADA 2007 – 2013

    Directory of Open Access Journals (Sweden)

    Romeo Victor Ionescu

    2006-05-01

    Full Text Available European Union budget takes into consideration the transformations of European policy priorities. This paper reveals the EU budget for 2006, which represents a major step for redirecting the use of European expenses towards a knowledge-based economy. This paper also presents the allocation of the EU budget for the unsolved problems and the contradictions that still persist in an enlarged Community. The EU 2007-2013 financial perspective was adopted by the European Council on December 15th, 2005 and mainly refers to: the long-lasting development; preservation and management of natural resources; citizenship, freedom, security and justice; EU as a global partner; administration and compensations.

  17. Analiza stilului de leadership în administrația publică din România

    Directory of Open Access Journals (Sweden)

    Adina FILIP

    2015-06-01

    Full Text Available The theme of this article is leadership in the pu-blic sector. The study presented here aims to improve the performance of public institutions by studying and analyzing the leadership style of leaders because le-adership has a major role when it comes to organiza-tional performance. This research was based on the theory of transformational leadership. Basically, lea-dership styles were analyzed by MLQ questionnaire and the three types of behaviors analyzed through it, namely the transformational, transactional and passive behavior. The leadership style in 167 public institutions from all counties of Romania was studied. This study revealed that we cannot say that there is a predominant type of leadership in public institutions in Romania, but rather a mix of the three behaviors with a slight pre-valence of the transformational and transactional, and also it should be mentioned that organizational perfor-mance can be improved through leadership because subordinates believe that the current leaders helped develop the organization and increase their effciency.

  18. Cum descriu oamenii experienta schimbarii locului de munca din mediul public in cel privat? O analiza interpretativ fenomenologica

    Directory of Open Access Journals (Sweden)

    Mateiana, Roxana

    2012-12-01

    Full Text Available The current research aims to present a detailed idiographic analysis regarding the experience of changing jobs from public service to private sector. The study was conducted on a sample consisting of five participants, ages between 24 and 46 years old. Each participant was interviewed based on semi-structured interviews and their transcripts were further analyzed using the interpretative phenomenological analysis. This specific method implied analyzing the experiential responses and their respective meanings line by line, retaining the first impressions followed by identifying the emergent topics from the experiential material, with focus on similarities and discrepancies within each case, as well as between all cases. Five themes emerged from the experiential material provided by the participants: the job characteristics in the public sector, the causes that lead to changing the workplace, the job characteristics in the private sector, barriers in adapting to the new work settings, changes regarding the relationship work – family life. Based on the “verbatim” content obtained, there could be outlined a certain “portrait” of the public sector as a product of a specific cultural, economic, social and even political environment, presented mainly as opposed to the private sector. The propensity to the “family” type work group, the institutional disorganization, the chaos represented by the bureaucracy, the lack of motivation and the routine are among the issues that matter, but „lack” to the participants in the new workplace. We consider that this kind of approach provides new insights regarding the experience of changing the workplace from public to private sector, based on first-hand information from people who went trough the experience.

  19. Kritična analiza diskurza pri tolmačenju za skupnost v Sloveniji: doktorska disertacija:

    OpenAIRE

    2015-01-01

    The thesis explores community interpreting in Slovenia with special regard to the specifics of interpreter-mediated interaction and the role of interpreting in institutional settings. The doctoral project aims to present the field and show the significance of interpreters' work, their professional competence and the understanding of this process in facilitating successful communication. The study argues that: a) interpreting and institutional discourse influence each other reciprocally; b) in...

  20. Analiza diagnostic a sectorului construcţiilor din România în perioada 2008-2010

    Directory of Open Access Journals (Sweden)

    Victor Radu

    2012-09-01

    Full Text Available Diagnostic analysis is a tool used especially in strategic management. Diagnostic analysis of the construction sector is focused on: value of construction works by manner of performing and by type of ownership; new construction works; capital repair works; current maintenance and repair works; construction under contract by category of objects and construction under own management; situation of construction firms; human resources analysis.

  1. Toplinska analiza procesa - I. Sinteza mreže izmjenjivača topline pinch-postupkom

    Directory of Open Access Journals (Sweden)

    Matijašević, Lj.

    2006-10-01

    Full Text Available In the last twenty-five years in the chemical process industry an important point of interest has been, how to minimize total costs, i.e. capital and operating costs expressed as annual charges.Pinch method is thermodynamically oriented method for the synthesis of heat exchanger networks with extended to combined heat and power system, separation schemes, integrated distillation columns and general process design. There have been two schools of the heat exchanger network synthesis. One relies on thermodynamic principles where the designer manually or interactively if software is available, synthesizes the network.The heat exchanger network of a nitric acid plant has been studied and it was found that it is possible to reduce requirements for cooling water and medium pressure steam. In order to enable these savings, three heat exchangers should be replaced with new ones. Energy consumption insteam power system increases slightly. However, the final result is a reduction of energy costs and a payback time of 14.5 months.The other approach relies on mathematical methods like linear and nonlinear programming. In this work thermodynamically oriented method is presented for the synthesis of heat exchanger network.

  2. ZASNOVA IN RAČUNSKA ANALIZA DVONADSTROPNE INDUSTRIJSKE JEKLENE HALE TLORISA 22,5 M X 60 M

    OpenAIRE

    Šenveter, Primož

    2013-01-01

    Namen diplomskega dela je izvedba zasnove in računske analize dvonadstropne industrijske jeklene hale. Hala je zasnovana v tlorisni obliki črke L, dimenzij 12,5 x 40 m za večji vzdolžni del hale ter 22,5 x 20 m za manjši del hale. Na manjšem delu hale je tudi nadstropje, kjer se nahajajo prostori za »režijo«. Uporabili smo vroče valjane profile iz konstrukcijskega jekla S 355. Izbrali smo profile s čim večjo izkoriščenostjo prereza, saj bo le tako poraba jeklenega materiala za celoten objekt ...

  3. Analiza systemu motywowania personelu medycznego w podmiocie leczniczym na przykładzie Szpitala Twoje Zdrowie w Opatowie

    OpenAIRE

    Hebda, Halina

    2013-01-01

    Niniejsza praca ma na celu identyfikację systemu motywowania w podmiocie leczniczym oraz diagnozę głównych czynników motywujących personel medyczny. Cel ten został zrealizowany poprzez dokonanie charakterystyki najważniejszych pojęć i definicji odnoszących się do motywowania pracowników jak również w oparciu o wyniki badań przeprowadzonych w wybranym podmiocie leczniczym, zlokalizowanym w Opatowie. Badania te pozwoliły na potwierdzenie głównej hipotezy badawczej sformułowanej na potrzeby n...

  4. Analiza otoczenia przedsiębiorstwa w szkołach i koncepcjach zarządzania

    OpenAIRE

    Wach, Krzysztof

    2010-01-01

    In the history of management thought the conceptions of environment have very often changed. In different periods of history and different scientific schools of organization and management scientists has ascribed to the business environment different role and importance. The paper is a kind of synthetic review of opinions on the importance and essence of the business environment. The author chose a couple of selected outlooks and schools, which have had and even still have the crucial impact ...

  5. Analiza semantyczna przewisk staroobrzędowców z okolic Augustowa i Suwałk

    Directory of Open Access Journals (Sweden)

    Magdalena Ziółkowska

    2015-07-01

    Full Text Available The semantic analysis of nicknames of Old Believers’ from Augustów and Suwalki regions The Old Believers settled down in North-Eastern Poland in the second half of the 18th century. They were living in hermetic, homogenous communities. This protected their culture from strong exterior influence. Nowadays, after a number of civilizing transformations, the isolation practically disappeared making the Old Believers’ culture defenceless against influence of dominant Polish culture. Together with all that changes the Old Believers’ anthroponymy has been transformed. Nicknames used to be were very popular in Old Believers’ community. Giving nicknames is still a living only in villages Gabowe Grądy and Bór. The most numerous group are nicknames motivated by appellatives that define external inner features, temperament and habits. These names reflect the objective knowledge of the nickname makers and they are expressed by concrete vocabulary.   Семантический анализ прозвищ у старообрядцев из окрестностей городов Августов и Сувалки Староверы появились на территории современной Польши в конце XVIII столетия. Они прибыли сюда из окрестностей Великие Луки и принесли с собой часть культурного наследия той территории, также язык и антропонимическую систему. Прозвища староверов представляют собой интерес с точки зрения их происхождения. Некоторые из них образованы от диалектных слов. Многие имеют свои эквиваленты как в русском, так и в польском языках, что является доказательством параллельного функционирования в их группе двух языков и двух культур в их обществе. До второй мировой войны прозвища были распространены среди старообрядцев, проживающих в разных местах их проживания в Польше. В настоящее время они популярны лишь в деревнях Габове Гронды и Бур, поскольку только здесь старообрядцы проживают в компактной среде. В речи старообрядцев встречаем несколько видов прозвищ: прозвища, образованные от аппелятивов, прозвища – цитаты, прозвища, образованные от имён собственных.

  6. Usporedna analiza sustava za 3D digitalizaciju u području stomatološke protetike

    OpenAIRE

    Budak, Igor; Trifkovic, Branka; Puskar, Tatjana; Vukelic, Djordje; Vucaj-Cirilovic, Viktorija; Hodolic, Janko; Todorovic, Aleksandar

    2013-01-01

    Među modernim inženjerskim tehnologijama koje su pronašle široku primjenu u području stomatologije, jedna od najčešće korištenih je 3D digitalizacija. Ovaj se rad bavi primjenom sustava za 3D digitalizaciju u području stomatološke protetike i pokušava doprinijeti u tom području kroz usporednu analizu ove vrste sustava. Posebna pažnja je usmjerena na ekstra-oralne sustave 3D digitalizacije i među njima na ne-specijalizirane stomatološke sustave 3D digitalizacije. Osim općeg pregleda i analize ...

  7. ANALIZA ODNOSA IZMEĐU POSJETITELJA I ZAŠTIĆENIH PODRUČJA PRIRODE U ZADARSKOJ ŽUPANIJI

    OpenAIRE

    KRPINA, Vesna

    2015-01-01

    Zaštićena područja prirode glavni su način očuvanja biološke raznolikosti. Budući da se pod zaštitu stavljaju ekološki vrijedna, a prirodno atraktivnija područja, dijelovi ili fenomeni prirode, svakako je da oni čine vrlo tražene turističke motive. Cilj ovog istraživanja je dobivanje uvida u sastavne komponente modela ljudi-ekosustav (Human ecosystem model) na specifičnom primjeru zaštićenih područja prirode u Zadarskoj županiji, u svrhu očuvanja izvornosti prirode s jedne strane te promocije...

  8. Rodzinne i społeczno-kulturowe uwarunkowania zaburzeń psychicznych. Analiza z perspektywy płci społeczno-kulturoioej

    OpenAIRE

    Frąckowiak - Sochańska, Monika

    2010-01-01

    This article deals with social, cultural and family context of mental disorders. The author carries out her research from the perspective of gender studies, which is crucial regarding epidemiological statistical data and clinical observation. According to these two sources of information, there are several disorders "typical" for women (like: depression, anorexia, bulimia, anxiety disorders, histrionic personality disorder, dependent personality disorder and anxiety personality...

  9. TECHNICAL ANALYSIS BY THE JAPANESE CANDLES METHOD ON THE EXAMPLE OF AGRICULTURAL MARKETS ANALIZA TECHNICZNA METODA SWIEC JAPONSKICH NA PRZYKLADZIE RYNK ROLNYCH

    Directory of Open Access Journals (Sweden)

    ANNA JAKUBCZAK

    2013-03-01

    Full Text Available The key goal of work was to study of basic information possibilities of the Japanese Candles method and to present its usefulness to make decisions on agricultural markets. The method is a result of the evolution of methods of technical analysis, which lasted for centuries. The usefulness of this method to make decisions is high, but significantly affect have the ability to interpret the observed signals and taking into account the specificities of agricultural markets.Celem opracowania bylo zbadanie podstawowych mozliwosci informacyjnych metody swiec japonskich oraz przedstawienie jej przydatnosci do podejmowania decyzji na rynkach rolnych. Zaprezentowano zwiezla ewolucje metod analizy technicznej oraz scharakteryzowano podstawowe narzedzia metody swiec japonskich, takie jak objecie bessy i hossy, pojedyncze swiece i ich formacje dajace sygnal do wycofania z rynku, doji , luki oraz formacje kontynuacji trendu.

  10. Clinical analysis of safety and effectiveness of electroconvulsive therapy [Analiza kliniczna skuteczności i bezpieczeństwa leczenia elektrowstrząsowego

    Directory of Open Access Journals (Sweden)

    Dąbrowski, Marek

    2012-06-01

    Full Text Available Aim. The aim of the study was to assess efficacy and safety of electroconvulsive therapy. Methods. 43 patients included into the study were hospitalised in The Institute of Psychiatry and Neurology and received all together over 400 bilateral electroconvulsive procedures. Most of the patients (N=25 were qualified for electroconvulsive therapy due to treatment resistant depression (58.1%. Six patients: 2 with catatonia and 4 with depression had life saving indications for electroconvulsive therapy. Three patients (7% were excluded from electroconvulsive therapy, following 1 or 2 electroconvulsive procedures. Forty patients continued electroconvulsive therapy. Results. There were no complications and serious adverse events in patients who continued electroconvulsive therapy. Generally, electroconvulsive therapy was well tolerated and treatment had been cut down in only one case due to adverse events and high risk related to the procedure. Transient cardiac arrhythmias (10% of patients were the most often occurring adverse events and patients (35% mostly reported headaches. We observed remission in 22 patients (58% and improvement in 14 patients (35% following electroconvulsive treatment. Only 4 patients (10% had no benefit after a series of electroconvulsive procedures. Electroconvulsive treatment was most effective in patients with catatonia (80% patients had full recovery and in depressive patients with bipolar disorder (73% patients had full recovery. Conclusion. Electroconvulsive procedures were safe and effective. Electroconvulsive treatment was most effective in catatonic patients with schizophrenia and in depressive patients with bipolar disorder.

  11. Modelling and Analysis of Phase Transformations and Stresses in Laser Welding Process / Modelowanie I Analiza Przemian Fazowych I Naprężeń W Procesie Spawania Laserowego

    Directory of Open Access Journals (Sweden)

    Piekarska W.

    2015-12-01

    Full Text Available The work concerns the numerical modelling of structural composition and stress state in steel elements welded by a laser beam. The temperature field in butt welded joint is obtained from the solution of heat transfer equation with convective term. The heat source model is developed. Latent heat of solid-liquid and liquid-gas transformations as well as latent heats of phase transformations in solid state are taken into account in the algorithm of thermal phenomena. The kinetics of phase transformations in the solid state and volume fractions of formed structures are determined using classical formulas as well as Continuous-Heating-Transformation (CHT diagram and Continuous-Cooling-Transformation (CCT diagram during welding. Models of phase transformations take into account the influence of thermal cycle parameters on the kinetics of phase transformations during welding. Temporary and residual stress is obtained on the basis of the solution of mechanical equilibrium equations in a rate form. Plastic strain is determined using non-isothermal plastic flow with isotropic reinforcement, obeying Huber-Misses plasticity condition. In addition to thermal and plastic strains, the model takes into account structural strain and transformation plasticity. Changing with temperature and structural composition thermophysical parameters are included into constitutive relations. Results of the prediction of structural composition and stress state in laser butt weld joint are presented.

  12. Analiza uticaja armiranobetonskog rama od sopstvenog opterećenja i spoljašnjih sila/Structural analysis of a prestressed concrete

    Directory of Open Access Journals (Sweden)

    Miloš Z. Petrović

    2014-10-01

    Full Text Available U radu je prikazano delovanje sile prednaprezanja na armiranobetonski ram (u daljem tekstu AB ram. Posmatrani sistem je statički neodređen sa dva ukleštenja. Na njega deluje opterećenje prednaprezanje kablom silom Nk=600 kN, kao i sopstveno opterećenje. Visina rama je 6.00 m, a osovinski razmak 20.00 m. Opterećenje od sopstvene težine elemenata je od rigle i stuba. Opterećenje konstrukcije usled prednaprezanja spada u unutrašnja opterećenja, koja zamenjujemo ekvivalentnim opterećenjem koje predstavlja spoljašnje opterećenje. Proračun je izvršen metodom sila i metodom deformacija, kao i u softverskom programu 'Tower'. Metodom sila se uklanja ukleštenje i preseku se omogućava obrtanje. Statički neodređena veličina tada je moment ukleštenja. Kod metode deformacije sve statičke i deformacijske veličine izražavaju se putem izvesnog broja međusobno nezavisnih deformacijskih veličina, koje su određene iz uslova ravnoteže sistema. Broj nezavisnih deformacijskih neodređenih veličina predstavlja deformacijsku neodređenost nosača. Sve deformacijski neodređene veličine mogu se svrstati u dve grupe: prvu grupu čine uglovi obrtanja na krajevima kruto vezanih štapova, a drugu grupu komponente pomeranja čvorova. / The effects of prestressing forces on a reinforced concrete frame are shown in the paper. The structure is a statically indeterminate frame with two fixed supports. The load is due to tendon prestressing with Nk = 600 kN and due to self-weight of columns and beam. The columns height is 6.00 m and the beam span is 20.00 m. Effects of prestressing can be replaced by an external equivalent load. Calculations are performed by the force method, by the direct stiffness method and using the 'Tower' software. The rotational restraints are released at fixed supports and the restraint moments are calculated by the force method. The direct stiffness method uses the members' stiffness relations for computing member forces and displacements in structures. The unknown nodal rotations and translations are obtained by solving a system of equations. The considered tendon profile is without eccentricity above the columns. 'Tower 7' is software for static and dynamic structural analysis and for design of concrete elements. It enables overall structural analysis of plane and three-dimensional structures. Automated, integrated tools allow fast and reliable design or the verification of the results obtained by standard methods. Version 7 is a professional tool with high performance. Three different calculation methods have given close results, with minor differences.

  13. Analiza łańcucha dostaw produktów mlecznych w kontekście zanieczyszczenia środowiska

    OpenAIRE

    Jarzębowski, Sebastian

    2013-01-01

    Within the framework of the paper, primary production and dairy farm stages were identified and analyzed with regard to their impact on the environment. Four aspects were taken into consideration, mainly: global warming, energy use, water use and waste management. Out of all impact categories, the farm phase is localized as the hot spot for environmental degradation. / Synopsis. W artykule zidentyfikowano ogniwa łańcucha dostaw produktów mlecznych oraz przeanalizowano je pod względem oddziały...

  14. CFD analysis and flow model reduction for surfactant production in helix reactor = CFD analiza i redukcija modela strujanja za proizvodnju surfaktanta u helix reaktoru

    NARCIS (Netherlands)

    Nikačević, N.M.; Thielen, L.; Twerda, A.; Hof, P.M.J. van den

    2015-01-01

    Flow pattern analysis in a spiral Helix reactor is conducted, for the application in commercial surfactant production. Step change response curves (SCR) were obtained from numerical tracer experiments by three-dimensional computational fluid dynamics (CFD) simulations. Non-reactive flow is simulated

  15. Pedagoške mjere u sustavu intervencija prema učenicima rizična ponašanja: kritička analiza

    OpenAIRE

    Bouillet, Dejana

    2010-01-01

    Zakonom o odgoju i obrazovanju u osnovnoj i srednjoj školi (Narodne novine, 87/2008.) poremećaji u ponašanju definirani su kao posebna potreba učenika. To znači da učenici takva ponašanja u školskim sredinama ostvaruju pravo na primjerene programe školovanja i oblike pomoći. U postojećem sustavu školskih ustanova učenici s poremećajima u ponašanju, međutim, rijetko primaju odgovarajuću stručnu pomoć, što dugoročno umanjuje njihove obrazovne mogućnosti. Istodobno, učenici u suvremenim socijaln...

  16. Analiza primene tečnog naftnog gasa kao pogonskog energenta motora SUS / Analysis of application of liquefied petroleum gas as an IC engine fuel

    Directory of Open Access Journals (Sweden)

    Slavko Rakić

    2008-01-01

    Full Text Available U svetu su izražene tendencije razvoja motornih vozila koja koriste ekološki čista i dovoljno raspoloživa goriva. Jedan od načina rešavanja aktuelnih zadataka automobilske industrije jeste korišćenje alternativnih goriva, odnosno alternativnih energetskih potencijala. U radu je analiziran tečni naftni gas (TNG kao alternativno gorivo za pogon motornih vozila. Nakon iznošenja osnovnih fizičko -kemijskih karakteristika TNG-a i analize upotrebe gasa kao pogonskog goriva motora SUS, prikazane su i komponente sistema za pogon motora na TNG. Navedeni su i primeri razvijenih zemalja koje pokušavaju da povećaju procenat primene alternativnih goriva u drumskom saobraćaju. Analizirani su, takođe, osnovni pokazatelji motora (snaga, ekonomičnost i ekološke karakteristike pri pogonu na TNG, koji potvrđuju daje ovo gorivo ekonomičnije i ekološki čistije od benzina i dizel goriva. / Global trends in automotive industry worldwide include development of environment-friendly vehicles which use 'clean' and attainable fuels. Alternative fuels and alternative energy sources represent one solution to the problem. In this paper Liquefied Petroleum Gas (LPG is analyzed as an alternative fuel for motor vehicle engines. After bringing up basic physical and chemical properties of LPG and the analysis of gas usage as a fuel for internal combustion engines, the general picture of the system components for LPG engine fuels is given. The paper also presents examples of how developed countries try to increase the percentage of alternative fuel usage in the road transportation. Finally, the analysis of the main LPG-powered engine indicators (power, economical and environmental properties confirms that LPG is more economical and more environment-friendly than standard engine fuels.

  17. Analiza rezultata određivanja sadržaja stabilizatora u prirodno starenim barutima / Content of stabilizer determination results analysis of naturally aged gun propellants

    Directory of Open Access Journals (Sweden)

    Luka Grbović

    2006-04-01

    Full Text Available Praćenje sadržaja stabilizatora jedna je od suvremenih i pouzdanih metoda koja se u svetu, a i kod nas, primenjuje za kontrolu kemijske stabilnosti i prognoziranje veka upotrebljivosti baruta. Radi ocene kemijske stabilnosti baruta domaće proizvodnje u radu su analizirani rezultati određivanja sadržaja stabilizatora u prirodno starenim jednobaznim barutima tipa NC i NCD i dvobaznim barutima tipa NGB i NGH. Pri tome su uporedno analizirani rezultati uzoraka iz kolekcija baruta iz Kragujevca (KB-1 i Zelenike (KB-2. Dobijeni rezultati ukazuju na znatno brži pad stabilnosti uzoraka baruta iz kolekcije KB-2, što se može objasniti značajnim uticajem klimatskih uslova. Osim toga, dobijeni rezultati potvrđuju uticaj mnogih faktora na kemijsku stabilnost baruta, kao što su: sastav, kvalitet sirovina, tehnološki postupak, oblik i dimenzije barutnog zrna i sl. / Monitoring of the stabilizer content is one of the modern and reliable methods in the world, and here also, which is used to control chemical stability and to predict the usage time of gun propellants. For the purpose of evaluation of gun propellants' chemical stability manufactured in our country, in this paper -we analyzed results from the content of stabilizer determination in naturally aged single base, NC and NCD type, and double base, NGB and NGH type of gun propellants. At the same time -we analyzed results from both collections of gun propellant samples, one from Kragujevac factory (KB-1 and the other from Zelenika factory (KB-2. Obtained results point that the stability decays faster for KB-2 collection samples, -which can be explained due to climate factors. Beside this influence, obtained results prove the influence of many factors on chemical stability of gun propellants: used components, quality of the ingredients, procedures of manufacture, shape and dimensions of gun propellant grains, etc.

  18. Egzystencja oraz analiza. Nowa Fenomenologia jako trzecia droga filozofii europejskiej (Existence and Analysis. The New Phenomenology as the Third Way of the European Philosophy

    Directory of Open Access Journals (Sweden)

    Andrzej Przyłębski

    2011-09-01

    Full Text Available The article presents the New Phenomenology of Hermann Schmitz as a third way of doing philosophy today: between the Scylla of analytical analysis of language and science and the Harybdis of quasi-metaphysical description of the reality (structuralism,new ontologies, being a kind of continuation of the speculative idealism. Based on the general idea of the descriptiv phenomenology by Edmund Husserl and critisizing the mistakes done by its initiator Hermann Schmitz proposes an attractive form of the philosophical research that situates itself far from summerizing theresults of the scientific inquiry on one side and from critisizing the sciences from a “higher, metaphysical” standpoint on the other. In a kind of friendly challenge to the Fundamental Ontology Heidegger’s the New Phenomenelogy proposes an analysisof humans’s primordial experiences of the reality we are in, sharing it partially with animals. Schmitz seems to succeed in showing the point where the human experience transcendents the reality experience of the higher animals, which is an interesting challange to a similar attempt done by John Searle.

  19. Ahalazija požiralnika: Esophageal achalasia: retrospective analysis of treatment during 2000-2010: retrospektivna analiza zdravljenja v letih 2000-2010:

    OpenAIRE

    Adamič, Katja; Štupnik, Tomaž

    2011-01-01

    Background: Esophageal achalasia (EA) is a primary esophageal motility disorder of unclear aetiology. Standard treatments of EA are: pneumatic balloon dilation (PBD) of the lower esophageal sphyncter (LES) and surgical cleaving of the muscle by Heller myotomy. Although the treatment effectively cures dysphagia, the symptoms recur in about a half of the patients. Our pointof interest was long-term effectiveness of EA treatment at our department. Methods: We made a retrospective analysis of EA ...

  20. ANALIZA STATISTICĂ PRIVIND EVOLUŢIA DISTRIBUŢIEI SERVICIILOR TURISTICE ÎN SPAŢIUL EUROPEAN, PRIN INTERMEDIUL INTERNETULUI

    Directory of Open Access Journals (Sweden)

    Iulian CONDRATOV

    2007-06-01

    Full Text Available Travel and Tourism as one of the world’s highest priority industries have an important economic impact on the global as well as on the local level. Information is the crucial factor for tourists while planning, booking and being on vacation as well as sometimes after their trip. The nature of tourism and its products makes tourism an intensive information business. These issues lead to the insight that tourism belongs to the industries most affected by the rapid changes in technology during the last two decades. The important role of information explains the importance of Information Technology (IT applications in tourism. The Internet can be seen as one of the most influential technologies that change traveller’s behaviour. While the number of Internet users increases and is reported to have reached 957 Mio. (IWS, 2005, the diffusion of information technology has improved travel service supply in efficiency, quality and flexibility. As a result, the ability to accurately online measure consumer’s satisfaction and experiences in order to constantly meet consumer’s needs and to develop customized online marketing strategies will be essential for improving online service quality

  1. Analiza deformacije i otvrđivanje plastičnom deformacijom oblikovanih dijelova proizvedenih višeslojnim utiskivanjem metala

    OpenAIRE

    Šugár, Peter; Šugárová, Jana; Zemko, Peter

    2012-01-01

    U članku se daju rezultati eksperimentalnog istraživanja usmjerenog na analizu radijalne i tangencijalne raspodjele deformacije i utjecaja otvrđivanja plastičnom deformacijom površinskih slojeva šupljih dijelova od metalnog lima proizvedenih višeslojnim utiskivanjem (rotacijskim oblikovanjem) metala. Korišteni su tanki limovi od čelika EN 10025-94 (ISO 630-80), debljine 1 mm. Rezultati istraživanja potvrđuju minimalni utjecaj anizotropije materijala na radijalnu i tangencijalnu raspodjelu def...

  2. Analiza niskofrekventnog spektra vibracija na elementima strukture helikoptera 'Gazela' / Analysis of low frequency vibrations on the structural connection elements of the Gazelle helicopter

    OpenAIRE

    Jovanović, Miroslav M.

    2010-01-01

    U radu je prikazan postupak i metodologija ispitivanja vibracija na helikopteru 'gazela' radi definisanja efikasnosti prigušenja vibracija na vezi struktura - sedište pilota. Posebna pažnja posvećena je teorijskim osnovama vibracija na helikopteru, određivanju radnih frekvencija, definisanju režima rada i profila leta helikoptera u toku ispitivanja. Na kraju rada prikazani su rezultati merenja vibracija u frekventnom domenu. / In this paper the procedure and methodology of vibration testing o...

  3. Analiza niskofrekventnog spektra vibracija na elementima strukture helikoptera 'Gazela' / Analysis of low frequency vibrations on the structural connection elements of the Gazelle helicopter

    Directory of Open Access Journals (Sweden)

    Miroslav M. Jovanović

    2010-10-01

    Full Text Available U radu je prikazan postupak i metodologija ispitivanja vibracija na helikopteru 'gazela' radi definisanja efikasnosti prigušenja vibracija na vezi struktura - sedište pilota. Posebna pažnja posvećena je teorijskim osnovama vibracija na helikopteru, određivanju radnih frekvencija, definisanju režima rada i profila leta helikoptera u toku ispitivanja. Na kraju rada prikazani su rezultati merenja vibracija u frekventnom domenu. / In this paper the procedure and methodology of vibration testing on a Gazelle helicopter are presented with the aim to define efficiency of vibration damping at the structure-pilot seat connection. A particular attention is paid to the theoretical basis of helicopter vibrations, definition of working frequency, regime and profile of flight during the test. The results of the vibration measurement are shown in the frequency domain. Introduction Nowadays, possibility of defining loads and vibrations is one of the most important requests in the design and modification of processes on helicopters. The loads occuring on the main rotor during flight are the basic source of vibrations on the helicopter. Possibilities to satisfy international standards in the area of structural and human vibrations are based on continuous and adequate measurement and analysis of the vibration levels on all elements of helicopters. This paper shows the procedures of vibration measuring and analyzing in order to define efficiency of vibration damping using a modern acquisition system NetdB 12 and its software dBFA Suite. Theoretical analysis of vibration sources on the helicopter main rotor The helicopter rotor operates in a complex aerodynamic flow field. The aerodynamic loads on the rotor blade vary considerably as it moves around the rotor disc, and in steady flight these loads are periodic. A particular attention is paid to a theoretical basis of vibration sources on a helicopter. A complex aerodynamic field in the plane of the helicopter main rotor during different profiles of flight is shown and explained. This part of the paper gives the equations of force and moments on the main rotor with the aim to define basic working frequencies. Sources of vibrations and the determination of working frequencies on the gazelle helicopter The sources of vibrations on the Gazelle helicopter (main rotor, tail rotor and engine are described as well as the vibration transfer from the sources to the structure through the helicopter transmission and the structure as a receiver of vibrations. The working frequencies of the Gazelle helicopter are defined and the causes for avoiding the low vibration frequency range are explained. Methodology and procedure of vibration testing on the gazelle helicopter The procedure of vibration testing has a few steps (pre-test, test and post test step, given in Fig. 5. After the determination of working frequencies and the testing point, the next step is selecting test equipment and installment of the accelerometers and other probes. After these preparations, the last step in the pre-test procedure is choosing the flight profiles in which the vibrations are measured. The results of testing and analysis of vibration damping at the structure - pilot seat connecting point The testing results are collected in the test phase. The results of the vibration measurement are shown in the time and frequency domain for the chosen flight conditions of the Gazelle helicopter. The results are given for two profiles of flight (for acceleration and for the left and right turn. The analysis must give an answer about the efficiency of vibration damping at the structure - pilot seat connecting point. The conclusions must not be ambiguous and must give enough elements for making a decision about subsequent actions. Vibration levels of in the acceleration phase For this phase of flight, all helicopter flight parameters are recorded and given as a function of time (velocity, altitude, drift of commands, loads und angular velocity while the vibrations are given in the frequency domain. The vibrations at the tested connecting point are analyzed in the function of velocity, followed by the conclusions and comments about the level of vibrations in the phase of acceleration. Level of vibrations during the left and the right turn For this profile of flight, the frequency spectrum for both turns is given and the fundamental difference in that spectrum is explained. The analysis of these two turns reveals the increase of the vibration level at the test point at a particular frequency. Conclusion The illustrated methodology and the procedures of measuring and analyzing the low-frequency vibration range on the Gazelle helicopter can be applied for all types of aircraft which are in operational use in the Serbian Air Forces. The shown procedure can be used for measuring and analyzing vibrations on all elements of helicopter systems, aiming at meeting international standards, continuous system developing, modifying technical systems and detecting potential failure elements in the systems in operational service.

  4. Analiza štetnog uticaja vibracija na posadu u transportnim sredstvima vojske Srbije / Analysis of risks from crew exposure to vibrations in military transport

    Directory of Open Access Journals (Sweden)

    Snežana B. Jovanović

    2009-10-01

    Full Text Available U radu je prikazana metoda za procenu rizika nastalog usled izloženosti čoveka vibracijama. Merenja vibracija koje se prenose na celo telo i na sistem šaka-ruka izvršena su za posadu helikoptera, rečnog broda i terenskog vozila. Izmerene vibracije ocenjene su prema kriterijumima 'štetnosti po zdravlje' i 'kvaliteta komfora'. / This paper presents test methods for assessing risks arising from human exposure to vibrations. The measuring of vibrations transmitted to the 'whole-body' and human 'hand-arm' system is carried out for helicopter, river boat and off-road vehicle crews. The measured vibrations are assessed according to the criteria of the 'health quality' level and the 'comfort quality' level.

  5. Analysis of Continuous Induction Hardening of Steel Cylinder Element Made of Steel 38Mn6 / Analiza Przelotowego Hartowania Indukcyjnego Walca Ze Stali 38Mn6

    Directory of Open Access Journals (Sweden)

    Barglik J.

    2015-12-01

    Full Text Available The paper presents analysis of surface induction hardening of a cylindrical element made of steel 38Mn6. The mathematical model of the non-stationary process is elaborated. Calculations of coupled electromagnetic and temperature fields are provided by means of the Flux 2D software. Computations are compared with the measurements realized at the laboratory stand located in the Silesian University of Technology. The expected hardness distribution within the surface layer is noticed.

  6. Męskość i kobiecość w lekturach szkolnych – opis i analiza projektu „Równia Literacka” Fundacji Punkt Widzenia

    Directory of Open Access Journals (Sweden)

    Ewelina Seklecka

    2016-11-01

    Full Text Available "Masculinity and femininity in school readings – project “Równia Literacka” by Punkt Widzenia (“Point of View” Foundation" The basis for the article is a report on the research “Masculinity and femininity in school readings. Analysis of reading material in primary and middle school from the perspective of equality of sexes”. The report was created and published within the project “Równia Literacka”, which was realized by “Point of View” Foundation as part of the program Obywatele dla Demokracji (Citizens for Democracy, financed by EOG Founds. The Report is freely available at: http://www.punktwidzenia.org.pl/wp-content/uploads/2014/09/Raport-M%C4%99sko%C5%9B%C4%87-i-Kobieco%C5%9B%C4%87-w-lekturach-szkolnych1.pdf

  7. ANALYSIS OF MILK AND REPRODUCTIVE PERFORMANCE OF THE ACTIVE POPULATION OF COWS IN POLAND ANALIZA UZYTKOWOSCI MLECZNEJ I ROZPLODOWEJ KRW KRAJOWEJ POPULACJI AKTYWNEJ

    Directory of Open Access Journals (Sweden)

    Wojciech NEJA

    2013-03-01

    Full Text Available Changes in the genotypic structure of cows, yield of milk, fat and protein, fat and protein content of milk, relationships between milk components, i.e. the protein to fat ratio (PFR and the difference between fat and protein content (DFP were examined using data from the Polish Federation of Cattle Breeders and Dairy Farmers for 20012009. In addition, analysis was made of changes in the length of calving interval and age at first calving. Average yield of milk and its components was found to increase in all milk recorded cows. Changes in the relationship between basic milk components differed between the breeds. A decrease in fat content was found in the milk from Polish Black-and-White Holstein-Friesian, Jersey, Montbeliarde and Polish Red-and-White cows, and an increase in protein content was recorded in the milk from Polish Black-and-White Holstein-Friesian, Polish Red-and-White, Simmental and Montbeliarde cows. These changes had a favourable effect on the PFR ratio in Polish Holstein-Friesian cows, especially those of the Black-and-White variety. Calving interval and age at first calving were found to increase in all the cows except the Montbeliarde breed.

  8. Analiza, structura şi direcţii de dezvoltare ale pieţei imobiliare. Studiu de caz Municipiul Galaţi

    Directory of Open Access Journals (Sweden)

    Lucean Mihalcea

    2012-12-01

    Full Text Available This paper has proposed to analyze the main elements underlying the evaluation of a municipality-related real estate development pole passing through a slowdown. Its purpose is to provide those interested, public administration, companies and citizens, not least that municipality, relevant information on the structure of the housing market and its trends, closely related to the potential economic and social development of the municipality concerned. Based on the analysis performed, it can complete development strategies related to the city studied, encompassing social and urban studies marketing. In the case study were processed and valued elements of economic documentation made by the author for PUG Galati. The main chapters of the paper analyzes the structure of the real estate market, forecasting its economic-development binomial real estate development. The two planes are the main complex housing the city of Galaţi.

  9. Retrospective analysis of the course of psychotic episodes in adolescent inpatients [Retrospektywna analiza przebiegu epizodów psychotycznych u hospitalizowanej młodzieży

    Directory of Open Access Journals (Sweden)

    Remberk, Barbara

    2012-08-01

    Full Text Available Aim. Analysis of clinical presentations and course of psychotic episodes in adolescent inpatients. Method. A retrospective analysis of charts of all (n=300 hospitalised patients diagnosed with of one of the schizophrenia-spectrum disorders (F20 – F29 over a 10-year span period (1998–2008 was conducted at the Child and Adolescent Department of Institute of Psychiatry and Neurology. The distribution of diagnoses was compared with a sample of 200 adult hospitalisations. Also, the demographic and clinical data, percentage of rehospitalisations and stability of the diagnosis was analysed. Results. The distribution of diagnoses in the schizophrenia spectrum of psychotic episodes was found to be different in adolescent patients than in adults. In further analysis of schizophrenia (F20, schizotypal disorder (F21, acute and transient psychotic disorder (F23 and schizoaffective disorder (F25 significant differences in the length of hospitalisation, gender distribution, frequency of rehospitalisation and stability of the diagnosis were observed. Stability of the diagnosis in the whole group was 52%. Schizophrenia was the most stable diagnosis. Conclusion. Distribution of schizophrenia spectrum diagnoses is different in adolescent and adult inpatients. In adolescents psychotic episodes other then schizophrenia are frequent. Diagnostic difficulties seemed to be confirmed by not very high diagnostic stability. However for F20, F21, F23 and F25 diagnoses different clinical and demographic profiles were observed, what may confirm that these disorders are separate nosological entities.

  10. Russia and the Iranian Nuclear Program: Replay or Breakthrough? (Strategic Perspectives, no. 9)

    Science.gov (United States)

    2012-03-01

    president, See Parker, Russia’s Revival, 5–8. 254 Yevgeniya Pismennaya, “Putinu predlozheny neudobnyye dlya nego reformy,” Vedo - mosti.ru, December 30...Online, October 14, 2011, CEP20111014964155. 260 Natalya Kostenko, “Rokirovka vo vlasti polozhila konets modernizatsii,” Vedo - mosti.ru, December 30, 2011

  11. Alcohol and the clinical picture of gout

    OpenAIRE

    M S Eliseev; Nasonov, E L; V G Barskova; M S Yeliseyev; V A Nasonova; Ye L Nasonov

    2007-01-01

    Tsel' issledovaniya. Izuchenie vliyaniya alkogolya na klinicheskie proyavleniya u bol'nykh podagricheskim artritom. Material i metody. V issledovanie vklyucheny 280 muzhchin, bol'nykh podagroy (kriterii S.L. Wallace). Dlya vyyavleniya skrytoy tyagi k alkogolyu ispol'zovalsya voprosnik CAGE, putem oprosa vyyavlyalos' kolichestvo prinimaemogo alkogolya v nedelyu. U vsekh bol'nykh otsenivali antropometricheskie pokazateli, syvorotochnye urovni pechenochnykh fermentov, bilirubina, kreatinina, moc...

  12. Hygiene Condition of Water Use and Sanitation Facilities at Urban Slums: Analysis of Port City Chittagong, Bangladesh / Wyposażenie Sanitarne W Slamsach Miejskich - Analiza Na Podstawie Miasta Portowego Chittagong, Bangladesh

    Directory of Open Access Journals (Sweden)

    Muhit I. B.

    2015-03-01

    Full Text Available Obszary takie jak rozwój gospodarczy, bariery społeczne, standard życia i zdrowie, ściśle związane są ze stanem wyposażenia sanitarnego. W artykule dokonano analizy warunków sanitarnych związanych z zaopatrzeniem w wodę i odprowadzeniem ścieków dla społeczności o niskich dochodach w obszarze Chittagong City Corporation. Dane zostały zebrane podczas ankietowych badań terenowych, rozmów z mieszkańcami, z bazy Chittagong City Corporation, Power Development Board i WASA.

  13. Hygiene Condition of Water Use and Sanitation Facilities at Urban Slums: Analysis of Port City Chittagong, Bangladesh / Wyposażenie Sanitarne W Slamsach Miejskich - Analiza Na Podstawie Miasta Portowego Chittagong, Bangladesh

    Science.gov (United States)

    Muhit, I. B.; Chowdhury, S. Tasneem; Nahid, Nurangir; Zaman, M. F.

    2015-03-01

    Low income community development is the prerequisite for the overall development of a society. There are different kinds of parameters to widen community development, such as health, economic, social, a living pattern, etc. Sanitation condition is the crucial aspect that is directly or indirectly inter bond with all the parameters. To see the exact reasons behind brutal unhygienic sanitation conditions of water supply and latrine system in a low cost community, the Chittagong City Corporation area has been picked. Relevant data have been collected from field survey, consultancy with inhabitants, Chittagong City Corporation, Power Development Board, and WASA. To know the possible reasons behind the water supply and germ-infested sanitation, state of a low cost community, this paper attempts to shed some light on the tribulations behind the scarcity of safe drinking water, dirt free as well as sustainable latrine and drainage system and offensive water management. Obszary takie jak rozwój gospodarczy, bariery społeczne, standard życia i zdrowie, ściśle związane są ze stanem wyposażenia sanitarnego. W artykule dokonano analizy warunków sanitarnych związanych z zaopatrzeniem w wodę i odprowadzeniem ścieków dla społeczności o niskich dochodach w obszarze Chittagong City Corporation. Dane zostały zebrane podczas ankietowych badań terenowych, rozmów z mieszkańcami, z bazy Chittagong City Corporation, Power Development Board i WASA.

  14. Analiza dendroecologică a regimului perturbărilor în pădurile din nordul Carpaţilor Orientali [Dendroecological analysis of disturbance regime in forests form the North of Eastern Carpathian

    Directory of Open Access Journals (Sweden)

    Popa I

    2003-07-01

    Full Text Available The present structure of natural forest ecosystems from the North of Eastern Carpathian, his heterogeneity, is the results of the historic disturbances. The wind damage represent the most important disturbance factor in these forests, with significant impacts on growth process through the modification of the spatial stand structure. The effects of the disturbance factor on the growth process is visible by a high acceleration of growth over more than 10 years. Using the tools of dendroecology, respectively the graphical analysis of radial growth and primary growth index, obtained by the separation of signal, was possible to establish the disturbance regime in forest form the North of Eastern Carpathians. In Rodna Mountains windthrow frequency is lower than in Moldova basin, where we can see a major disturbance at every 35-40 years. Interesting is that the windthrow from 1815- 1820 is preset in all dendrochronological series, more or less intensive, having a great impact on the landscape of superior basin of Bila, determining the apperance of the stands from BILB and BILC and a high destructuration of stone pine ecosystem from BILD. Other important disturbance are from 1880- 1890, very evident in the dendrochronological series from GIUA, SLAA, BILB, PUTB. This disturbance, assimilated with a windthow, was mentioned in historic books dated in 26 June 1885 in the North of Eastern Carpathians.

  15. Wpływ przejęcia przedsiębiorstwa na kształt jego systemu rachunkowości zarządczej – analiza studium przypadku firmy farmaceutycznej

    OpenAIRE

    Zarzycka, Ewelina; Firkowska-Jakobsze, Zuzanna

    2011-01-01

    Mergers and acquisitions in the pharmaceutical sector are widespread in the recent years, not only on the global market, but also in Poland. Those processes are changing all areas of the companies` activity. The paper is focused on the changes in the system of management accounting in one of the multinational pharmaceutical company present on the polish market which was taken over by other international concern. The case study presented in this paper shows that...

  16. Analiza postojećeg stanja i potrebe razvoja sistema za procjenu vrijednosti nekretnina u Republici Srbiji : Analysis of actual status and needs for real estate valuation model development in Republic of Serbia

    Directory of Open Access Journals (Sweden)

    Branko Božić

    2016-12-01

    Full Text Available U radu je opisano stanje u oblasti razvoja tzržišta nekretnina u Republici Srbiji, sadašnji nosioci poslova procjene, neki primeri dobre prakse u Evropi i međunarodne organizacije koje tu oblast uređuju. Na kraju, na bazi analize pojedinih sistema vrednovanja u nekim evropskim državama, dat je prijedlog buduće organizacije,a koji je ujedno zasnovan i na specifičnostima u Republici Srbiji. : This article points out to real estate market in Republic of Serbia and main actors at the process of real estate valuation. Some international organizations at the area of property valuation were explaned, also. At the end releting to the good practice of some EU valuation systems, a proposal for new valuation system at the Republic of Serbia was explaned.

  17. The analysis of the bipolarity features in students of arts and the students of technology [Analiza cech dwubiegunowości wśród studentów kierunków artystycznych oraz politechnicznych

    OpenAIRE

    2013-01-01

    Background. The aim of the research was to assess the prevalence of the bipolar spectrum features among students of a variety of faculties, by dividing them arbitrarily into ‘art’ or ‘technology’ cohorts.Material and methods. 120 subjects were examined, including 57 students of arts, and 63 students of technology. The tools used included a basic socio-demographic questionnaire and the Hirschfeld Mood Disorder Questionnaire (MDQ).Results. The bipolar spectrum features (as identified by the MDQ...

  18. Podział na „swoich” i „obcych”. Analiza kategoryzacji społecznych funkcjonujących wśród robotników

    OpenAIRE

    Sztabiński, Franciszek; Sztabiński, Paweł B.

    1989-01-01

    The study deals with further deepened analyses being a continuation of those undertaken in the previous one. In the previous study stereotypes of particular groups were considered in isolation from each other; in the present one the unit of analysis is the stereotype of a workman in comparison with the stereotypes of a peasant and of a clerk. In the interpretation of results of these analyses exploited was the conception of social categorization developed by H. Tajfel. According to this conce...

  19. Prvi koraki utemeljevanja posebne vloge členka fu 夫 v stavi klasične kitajščine: Analiza besedil mojstra Han Feizija 韩非子

    Directory of Open Access Journals (Sweden)

    Jan VRHOVSKI

    2012-12-01

    Full Text Available Despite the prevailing academic opinion regarding the use of the particle fu 夫 in Classical Chinese syntax, this article proposes a new interpretation of fu 夫 as an introductory particle expressing a special kind of generalizing force that results in a shift of the truth-value of a sentence to a higher level. Based on a thorough text analysis of Han Feizi 韩非子 it represents the first steps in unveiling the rhetorical use of fu 夫 and its systemic application in dialectical reasoning. By accounting for certain judgments of value made on an intuitive basis by a comparatively objective and consistent procedure, this paper hopes to shed new light on the characteristics of the special syntactic properties of Classical Chinese. This paper also represents the intuitive part of our investigation, forming an outline and laying a pattern for a following linguistic analysis.

  20. The Numerical Analysis of the Phenomena of Superficial Hardening of the Hot-Work Tool Steel Elements / Analiza Numeryczna Zjawisk Przypowierzchniowego Hartowania Elementów Ze Stali Narzędziowej Do Pracy Na Gorąco

    Directory of Open Access Journals (Sweden)

    Bokota A.

    2015-12-01

    Full Text Available In the paper the complex model of hardening of the hot-work tool steel is presented. Model of estimation of phase fractions and their kinetics is based on the continuous heating diagram (CHT and cooling diagram (CCT. Phase fractions which occur during the continuous heating and cooling (austenite, pearlite or bainite are described by Johnson-Mehl (JM formula. To determine of the formed martensite the modified Koistinen-Marburger (KM equation is used. Model takes into account the thermal, structural, plastic strains and transformation plasticity. To calculate the plastic strains the Huber-Mises plasticity condition with isotopic hardening is used. Whereas to determine transformations induced plasticity the Leblond model is applied. The numerical analysis of phase compositions and residual stresses in the hot-work steel (W360 element is considered.

  1. Nieformalne związki jedno i dwupłciowe jako alternatywne formy życia małżeńsko-rodzinnego. Analiza jakości i stabilności relacji

    OpenAIRE

    Jankowiak, Barbara

    2013-01-01

    This thesis presents the characteristics of alternative forms of marriage and family life with special consideration of cohabitation and homosexual relations. These untraditional kinds of partnership relations are more and more common and become new socialization patterns. An analysis was carried out of the satisfaction and stability of informal same- and different sex relations and a comparison of these relations was made to the intimate relations of marriages in order to esta...

  2. Određivanje daljine cilja pomoću video senzora i analiza uticaja grešaka i šuma merenja / Target range evaluation using video sensor and analysis of the influence of measurement noise and errors

    Directory of Open Access Journals (Sweden)

    Dragoslav Ugarak

    2006-01-01

    Full Text Available U radu je opisan matematički model određivanja daljine cilja obradom video snimaka u toku praćenja. Analizirani su doprinosi parametara koji utiču na veličinu grešaka i određene su vrednosti standardnog odstupanja. / This paper presents mathematical model of determining target range by analyzing video frame during the tracking. The contribution of effective parameters to accuracy are analyzed and values of standard deviation are determined.

  3. Rozwój lokalnych mediów internetowych wobec kształtowania się społeczeństwa obywatelskiego. Analiza na podstawie portalu MM Moje Miasto

    Directory of Open Access Journals (Sweden)

    Paula Majcherczyk

    2012-02-01

    Full Text Available Artykuł poświęcony jest przedstawieniu Internetu jako miejsca rozwoju mediów lokalnych, a tym samym kształtowania się społeczeństwa obywatelskiego. Skupia się na analizie portalu społecznościowego MM Moje Miasto jako platformy dziennikarstwa obywatelskiego, bazującego na lokalności przekazu. Opisuje działanie portalu i jego otoczenie medialne.  

  4. Analiza rolului serviciilor ecosistemice ale pădurii în strategia de marketing turistic a regiunii Bucovina [The role of forest ecosystem services in the tourism marketing strategy of region Bucovina

    Directory of Open Access Journals (Sweden)

    Maria Cîrnu

    2014-08-01

    Full Text Available The paper provides an analysis of the use of ecosystem services in the marketing strategies of accommodation facilities and tourism agencies promoting nature based tourism in Bucovina region. The territorial marketing of goods and services provided by forests is a marketing tool which links the local natural and cultural resources to a specific territory. Bucovina region is well known for its cultural world heritages, the painted monasteries, but are also tourism attraction of the region natural landscapes and the traditional gastronomic products. The study uses a qualitative analysis based on two online marketing surveys which have targeted 214 managers of accommodation facilities and 95 tourism agencies. Given the reduced rate of responses, the results of the study are interpreted from an exploratory perspective resulting in hypotheses which have to be further validated. The study indentifies that for the majority of the respondents the nature based tourism is perceived as a complementary form of tourism to the classical cultural one, even though its promotion potential is identified as very high. The natural “portfolio” of Bucovina region is not promoted using an integrated strategy, but rather as individual cases. The study also derives as a research hypothesis the fact that the visible degradation of the forest landscapes is likely to negatively impact the promotion of Bucovina as an eco-region.

  5. Človeški kapital, raziskave in razvoj ter rast produktivnosti: empirična analiza za Slovenijo = Human Capital, Research and Development and Productivity Growth: Empirical Analysis for Slovenia

    Directory of Open Access Journals (Sweden)

    Matjaž Novak

    2008-06-01

    Full Text Available The aim of this article is to present empirical estimates about the impact of human capital on labor productivity growth in the case of Slovenia. Instead the conventional methodology the methodology principally aimed at estimating the real convergence of labor productivity was used. The basic difference between both methodological frameworks is in the bias of the result. The conventional methodology estimates the growth impact of human capital directly and for this purpose empirical data on the amount of human capital are needed. However, human capital is in itself an imaginary category and there is no exact methodology for measuring its value. The results about the impact of human capital on labor productivity are therefore questionable and potentially biased. In such cases the use of methodological frameworks which estimate the growth impact of human capital indirectly is more appropriate. This was also the main reason why the methodology principally used for convergence analysis was employed in the research. In this way the obtained empirical estimates at sectoral level indicated that the basic pillars of economic growth in the case of Slovenia are in line with theoretical expectations. The results are at the same time also an argument in favor of the proposed empirical method.

  6. Analiza Strukture Nezaposlenosti Visokoobrazovanih Kadrova u Republici Srpskoj i Mjere za Njezino Smanjenje / Analysis Of the Unemployment Structure of Highly Educated Personnel in the Republic of Srpska and Measures for its Reduction

    Directory of Open Access Journals (Sweden)

    Mastilo

    2015-06-01

    Full Text Available The paper aims to analyse the structure of unemployed highly educated staff in the Republic of Srpska. As indicated, such structure shall enable analysis of unemployment of highly educated staff as well as of vacant jobs on the basis of gender and profession, thus demonstrating that more than 1/2 of the staff after graduation finds themselves at the Employment Agency. This survey shall provide data indicating the unemployment duration of highly educated staff, i.e. the time they spend waiting for their first job at the Employment Agency. Unemployment analysis throughout various regions of the Republic of Srpska shall be addressed in detail. Likewise, the relevant institutions of the Republic of Srpska, acting as proxies between highly educated people and the labour market, shall be integrated in the analysis. The paper shall be particularly focused on assessment of unemployment of highly educated people from the field of economy. The problem of unemployment in the Republic of Srpska has been particularly pronounced with the last few years (2009, 2010, 2011, 2012, 2013 and 2014. It is constantly deepened due to the inadequate enrolment policy by the Ministry and the inability of the labour market to absorb the staff in the real and the public sector. The analysis is not based exclusively on the Republic of Srpska. The measures to reduce unemployment of highly educated people in the Republic of Srpska shall also be introduced. It is evident that today’s society faces massive unemployment, including the unemployment of highly educated people in the Republic of Srpska, which represents an enormous issue, and is after all, the focus of the paper itself.

  7. Learning in artistic gymnastics. An experimental study with children analysing some variables in that process Aprendizaje en gimnasia artística. Un estudio experimental con niños que analiza ciertas variables del proceso

    Directory of Open Access Journals (Sweden)

    J. López

    2010-09-01

    Full Text Available

    Today the training of sports skills has lead to the conception of new approaches to attain maximum results. In practice, many teaching methods are used, yet most of the articles on motor learning or sports training refer to the total or global and the partial or analytic methods, both of interest in the field of gymnastics, offering a number of important combinations between either extreme.

    Opinions differ concerning effectiveness, and such differences also exist in gymnastics. Carrasco (1977, nevertheless, proposes "mini-circuits" as the ideal teaching method in gymnastics. In looking for a practical solution to global or analytical teaching, one experimental group study was undertaken with children participating in Sports Schools between the ages of 9 and 11. The aim was to compare the effect of three training sessions (analytical training, "mini-circuit" training, mixed training on the learning and recall of gymnastic skills.

    Interested in both final performance as well as the teaching process, the following variables were studied: motor activity time, waiting time, total number of global movements, total number of feedbacks emitted by the teacher (amount and direction, and total number of spot checks. A pre-test, post-test and re- test design was used with three groups to assess the three training sessions. Each group was trained to learn the same variable-dependent outcome.

    The results of the study showed that the "mini-circuit" training was the most effective learning and recall method. The most highly-influence process variables were both the type of aids and type of feedback provided. Overall, it is worth highlighting the importance of using the "mini-circuit" method with children. From a pedagogic perspective, this is an important finding to take into consideration, which could yield important results during schooling.
    KEY WORDS: Gymnastics, teaching methods, Children training, Feedback, Aids

    En la actualidad el entrenamiento de la técnica deportiva ha motivado la creación de nuevos planteamientos con el fin de obtener máximos resultados. En la práctica son muchos los métodos de enseñanza empleados, pero la mayor parte de las publicaciones relativas al aprendizaje motor y al entrenamiento deportivo hablan del método global o total y del método parcial o analítico, cobrando ambos un interés especial dentro de la Gimnasia Artística.

    Sobre la efectividad de estas estrategias las opiniones son diferentes. Sin embargo, Carrasco (1977 propone los Mini-circuitos como la estrategia más eficaz para el aprendizaje de habilidades gimnásticas. Motivados por dar una solución práctica a esta cuestión del aprendizaje global y fraccionado hemos realizado un estudio experimental de grupos con niños de escuelas deportivas con un rango de edad de 9 a 11 años. El objetivo era delimitar la eficacia diferencial de tres tipos de entrenamiento ( Analítico, "Mini-circuito" y Mixto sobre el aprendizaje y retención en una habilidad gimnástica. Interesados no sólo en el rendimiento final sino también en todo el proceso de enseñanza, estudiamos las siguientes variables: Tiempo de Actividad Motriz,Tiempo de Espera, Nº de Movimientos Globales, Nº de Feedbacks Emitidos por el Profesor y Nº Total de Asistencias.

    Los resultados del estudio muestran la eficacia del Minicircuito sobre el resto de las estrategias. Las variables del proceso más afectadas han sido, los tipos de Asistencias prestadas así como los tipos de Feedbacks. Desde el punto de vista de la enseñanza, es un dato importante a considerar, ya que su aplicación puede resultar de gran utilidad en la etapa escolar.

    PALABRAS CLAVE: Gimnasia, Metodología, Entrenamiento con niños, Feedback, Ayudas.

  8. The analysis of the bipolarity features in students of arts and the students of technology [Analiza cech dwubiegunowości wśród studentów kierunków artystycznych oraz politechnicznych

    Directory of Open Access Journals (Sweden)

    Siwek, Marcin

    2013-10-01

    Full Text Available Background. The aim of the research was to assess the prevalence of the bipolar spectrum features among students of a variety of faculties, by dividing them arbitrarily into ‘art’ or ‘technology’ cohorts.Material and methods. 120 subjects were examined, including 57 students of arts, and 63 students of technology. The tools used included a basic socio-demographic questionnaire and the Hirschfeld Mood Disorder Questionnaire (MDQ.Results. The bipolar spectrum features (as identified by the MDQ responses were significantly more prevalent among the students of arts, as compared to the students of technology (28.2% vs. 4.8%, p≤0.001; OR=7.8; CI 95%: 2.13–28.51; p≤0.01. Moreover, in comparisonto the students of technology, the students of arts were more likely to: 1 report mood patterns of intermittent ‘highs’ and ‘lows’ (49.1% vs. 15.9%, p≤0.0001; OR=5.11; CI 95%: 2.18–11.99; p≤0.001; 2 seek for psychiatric or psychological support (12.3% vs. 1.5%; p≤0.05; OR=5.2; CI 95%: 1.79–15.21; p≤0.01; 3 have a history of utilisation of psychotropic medications (31% vs. 7.9%, p≤0.001; OR = 8.7; CI 95%: 1.03–72.9; p≤0.05. They were also more likely to use psychoactive substances (other than alcohol.Conclusions. The considerable prevalence of the bipolarity features (as measured by the MDQ, combined with higher prevalence of intermittent periods of elevated or depressed mood, higher likelihood of seeking for psychiatric or psychological treatment, and higher prevalence of using psychoactive medications/substances in the cohort of the students of arts indicate a significant association between artistic talents and creativity, and the bipolar spectrum disorders.

  9. Ontologia czterowymiarowa a podróż w czasie analiza argumentu Theodore’a Sidera (Four-dimensional ontology and time travel analysis of Theodore Sider’s argument

    Directory of Open Access Journals (Sweden)

    Adam Andrzejewski

    2012-03-01

    Full Text Available The main goal of this paper is to show that Theodore Sider’s argument from time travel cannot be treated as convincing, elegant, and in favour of perdurantism. The author reconstructs and debates foundations of Sider’s perdurantist time travel scenario. A set of arguments reveals a plethora of unwelcome metaphysical consequences of this vision, including problems of: (i identification of temporal parts, (ii person stages and (iii identity. Agreeing with the latter, the author acknowledges a few general comments about using the possibility of time travel in ontological debate between perdurantism and endurantism.

  10. Analysis of the Deformability of Two-Layer Materials AZ31/Eutectic / Analiza Możliwości Odkształcania Plastycznego Materiału Dwuwarstwowego AZ31/Eutektyka

    Directory of Open Access Journals (Sweden)

    Mola R.

    2015-12-01

    Full Text Available The paper present the results of physical simulation of the deformation of the two-layered AZ31/eutectic material using the Gleeble 3800 metallurgical processes simulator. The eutectic layer was produced on the AZ31 substrate using thermochemical treatment. The specimens of AZ31 alloy were heat treated in contact with aluminium powder at 445°C in a vacuum furnace. Depending on the heating time, Al-enriched surface layers with a thickness of 400, 700 and 1100 μm were fabricated on a substrate which was characterized by an eutectic structure composed of the Mg17Al12 phase and a solid solution of aluminium in magnesium. In the study, physical simulation of the fabricated two-layered specimens with a varying thickness of the eutectic layer were deformed using the plane strain compression test at various values of strain rates. The testing results have revealed that it is possible to deform the two-layered AZ31/eutectic material at low strain rates and small deformation values.

  11. ChTO DELAT'', ESLI V PERIOD LEChENIYa INGIBITORAMI FAKTORA NEKROZA OPUKhOLI α VOZNIK PSORIAZ?

    Directory of Open Access Journals (Sweden)

    Yu. V. Muravyev

    2011-01-01

    Full Text Available Ingibitory faktora nekroza opukholi α (FNO α – infliksimab, adalimumab i etanertsept – k aprelyu 2009 g. poluchili bolee 2 mln bol'nykh vo vsem mire. Vse eti preparaty okazalis' odinakovo effektivny (okolo 60% bol'nykh otvetili na lechenie pri revmatoidnom artrite (RA, ankiloziruyushchem spondilite (AS, psoriaze, psoriaticheskom artrite i odobreny dlya lecheniya etikh boleznei [1, 2]. Odnako ikh ispol'zovanie mozhet byt' svyazano s tselym ryadom neblagopriyatnykh reaktsii, odnoi iz kotorykh yavlyaetsya obostrenie ili razvitie novykh sluchaev psoriaza [3].

  12. Numerical Analysis of the Forming Process of Head Toothing in Rolling Extrusion on a Shaft from Aluminum Alloy 7075 / Analiza Numeryczna Kształtowania Uzębienia Czołowego W Procesie Przepychania Obrotowego Na Wałku Ze Stopu Aluminium 7075

    Directory of Open Access Journals (Sweden)

    Bartnicki J.

    2015-12-01

    Full Text Available This paper presents the forming method of head toothing with the application of rolling extrusion technology. Tools numerical models were used in numerical calculations. The presented numerical results concern metals flow kinematics, distributions of stresses and strains. Determined in the process technological parameters of head toothing forming allow foreseeing real material flow in the experiment planned for conducting.

  13. Comparative analysis of two diffusion methods for radon Rn-222 estimation in atmospheric air by means of gamma-ray spectroscopy and liquid scintillation counting; Analiza porownawcza dwoch metod dyfuzyjnych pomiaru radonu Rn-222 w powietrzu z wykorzystaniem spektrometru promieni gamma i metody cieklej scyntylacji

    Energy Technology Data Exchange (ETDEWEB)

    Gorzkowski, B.; Pachocki, K.; Pensko, J.; Majle, T.; Rozycki, Z. [Panstwowy Zaklad Higieny, Warsaw (Poland)

    1995-12-31

    The comparative measurements of radon Rn-222 concentration in indoor air some buildings and in radon labour chamber have been conducted using two diffusions methods. The results of parallel measurements using radon charcoal detectors and gamma-ray spectroscopy with liquid alpha scintillation counting (Pico-Rad) have been presented. It was concluded that both methods offer the similar measurements possibilities of radon concentrations in the air from about 30 Bq/m{sup 3} to about 600 Bq/m{sup 3} with the real average divergence between both methods of about {+-}11%. (author). 10 refs, 6 figs, 1 tab.

  14. Evaluation of the Possibility of Applying Spatial 3D Imaging Using X-Ray Computed Tomography Reconstruction Methods for Quantitative Analysis of Multiphase Materials / Rentgenowska Analiza Ilościowa Materiałów Wielofazowych Z Wykorzystaniem Przestrzennego Obrazowania (3D Przy Użyciu Metod Rekonstrukcji Tomografii Komputerowej

    Directory of Open Access Journals (Sweden)

    Matysik P.

    2015-12-01

    Full Text Available In this paper the possibility of using X-ray computed tomography (CT in quantitative metallographic studies of homogeneous and composite materials is presented. Samples of spheroidal cast iron, Fe-Ti powder mixture compact and epoxy composite reinforced with glass fibers, were subjected to comparative structural tests. Volume fractions of each of the phase structure components were determined by conventional methods with the use of a scanning electron microscopy (SEM and X-ray diffraction (XRD quantitative analysis methods. These results were compared with those obtained by the method of spatial analysis of the reconstructed CT image. Based on the comparative analysis, taking into account the selectivity of data verification methods and the accuracy of the obtained results, the authors conclude that the method of computed tomography is suitable for quantitative analysis of several types of structural materials.

  15. Numerical Analysis of the Forming Process of Head Toothing in Rolling Extrusion on a Shaft from Aluminum Alloy 7075 / Analiza Numeryczna Kształtowania Uzębienia Czołowego W Procesie Przepychania Obrotowego Na Wałku Ze Stopu Aluminium 7075

    OpenAIRE

    Bartnicki J.; Tomczak J.

    2015-01-01

    This paper presents the forming method of head toothing with the application of rolling extrusion technology. Tools numerical models were used in numerical calculations. The presented numerical results concern metals flow kinematics, distributions of stresses and strains. Determined in the process technological parameters of head toothing forming allow foreseeing real material flow in the experiment planned for conducting.

  16. Studiu privind sursele de creștere a competitivității Muzeului Național de Istorie a României în contextul dezvoltării urbane prin analiza percepției vizitatorilor

    Directory of Open Access Journals (Sweden)

    Ruxandra Irina POPESCU

    2011-12-01

    Full Text Available The increasing influence of culture in the contemporary society, along with the higher importance of tourism in the economy have in recent years led to the opening of logo museums, which represent a city attraction that cannot be missed by visitors and also a reason for visitors to prolong their stay, resulting into more money spent in that city. Practice proves that museums do not represent anymore just a cultural resource, but also an economic resource for cities. Therefore, cultural management gains more and more popularity thanks to the specific goals it aims: reaching a satisfactory effectiveness for cultural organizations from an educational point of view and setting an adequate level of economic efficiency. In this context, our study is aimed at analyzing visitors’ perception on the Romanian National History Museum, by analyzing data gathered in a survey based on a questionnaire, that indicated the level of information visitors have in relation to the museum, their opinion about the exhibitions’ quality and collection attractiveness, as well as the level of satisfaction. We consider the results may contribute to improving the efficiency and effectiveness of the museum’s activity, both from a cultural and educational point of view, as well as from an economic and financial perspective, as key factor for increasing the competitiveness of this type of cultural organization.

  17. Static and dynamic analyses of the stability of mining wastes (Ravaneti) in the Carrara marble area (Apuan Alps, Italy) / Analiza statyczna i dynamiczna stabilności hałd odpadów górniczych w regionie wydobycia marmurów Carrara (Alpy Apuańskie, Italia)

    Science.gov (United States)

    Oreste, Pierpaolo; Soldano, Silvia

    2012-12-01

    The problem of the stability of "ravanetos" (debris piles of mining waste material extracted from the Apuan Alps, Italy) is very relevant, because of the consequences a landslide would have on the people and the existing civil infrastructures throughout the territory. In this work, the stability of two ravanetos that can be considered as representative of those in the Carrara area has been studied: the Polvaccio ravaneto, a recent type of debris pile and the Torrione-Tecchione, an old debris pile at present undergoing re-naturalisation. The study using the LEM (Limit Equilibrium Method) in a static and pseudo-static field, has made it possible to first carry out a back-analysis to define the most probable apparent cohesion and friction angle values of the material that makes up the ravanetos. Subsequently, it was possible to determine the intensity of the seismic wave that would be able to lead the two ravanetos to limit stability conditions and to determine the probability of such a seismic wave occurring in the next 50 years. A more accurate analysis, carried out with a numerical method in the dynamic field, of the most critical condition (the Polvaccio ravaneto) has led to more conservative results (higher safety factors) than those obtained with the LEM. This result allows us to reveal how the LEM can be considered a cautionary instrument to judge the stability of debris piles during a seismic event and that the likelihood of a landslide occurring in the two studied representative ravanetos over the next 50 years is very slim.

  18. Analiza performanţelor energetice şi de mediu ale unui captator solar pe întreaga durată de viaţă a acestuia în condiţii climatice specifice României

    Directory of Open Access Journals (Sweden)

    Mihai-Lucian Radu

    2012-03-01

    Full Text Available The paper has as main objective the energy and environmental performances analysis of a solar thermal collector for domestic hot water, during its entire life cycle, in the specific climatic conditions of Romania. An energy analysis taking into account the energy flows which appear during all phases of the life cycle is presented, taking into consideration the energy obtained by the solar collector and the energy consumed during production process, transport, installation, maintenance, disposal. These processes generally consume energy produced in a classical way, from fossil fuels, so different pollutants are generated. Under these circumstances it’s interesting to observe if the studied equipment is a truly ecological one, managing to produce sufficient energy to counterbalance energy consumption and pollutants release production processses, normal use and disposal. The analysis is performed using available data at European level considering the production of solar thermal collectors. The energy produced by the system is computed based on climatic data for Bucharest (outdoor temperature and solar radiation.

  19. Web application security analysis using the Kali Linux operating system / Анализ безопасности веб-приложений оперционной системой Kali Linux / Analiza bezbednosti web aplikacija operativnim sistemom Kali Linux

    OpenAIRE

    Ivan M. Babincev; Dejan V. Vuletić

    2016-01-01

    The Kali Linux operating system is described as well as its purpose and possibilities. There are listed groups of tools that Kali Linux has together with the methods of their functioning, as well as a possibility to install and use tools that are not an integral part of Kali. The final part shows a practical testing of web applications using the tools from the Kali Linux operating system. The paper thus shows a part of the possibilities of this operating system in analysing web applications s...

  20. Rezultatele obţinute în cadrul proiectului AQUACON la analiza apelor de precipitaţii şi a apelor de suprafaţă de către laboratorul I.C.A.S. Câmpulung Moldovenesc [Results obtained in the framework of the AQUACON Project for precipitation and surface water samples by the I.C.A.S. Câmpulung Moldovenesc laboratory

    Directory of Open Access Journals (Sweden)

    Iacoban C

    1999-07-01

    Full Text Available In order to asses the air pollution effects on forests, the laboratories involved in the ICP Forests Program must use analytical methods that allow to obtain comparable results for the precipitation samples parameters (pH, conductivity, alkalinity, SO 4 2-, NO 3 - , NH 4 + , Cl - Ca2+, Mg2+, Na + , K + . In the framework of the project “Analytical Quality Control and Assessment in the Mediterranean Basin (AQUACON”, each year are organized intercomparison exercises using simulated water samples. The chemistry laboratory of the Forest Research Station Campulung Moldovenesc participated to these exercises in 1996, 1997 and 1998. The analytical methods used and the results obtained are presented in this article. It can be concluded that from the total of 110 results ( 10 for each parameter, 8 1 (74 % registered deviations less than 20% and 29 (26 % exceed this limit. The most frequent accepted results (deviation less than 20% were obtained for pH, Na + , conductivity and Mg2+, SO 4 2-, NO 3 - . The lower precisions were obtained for Cl - K + and Ca2+. For K + and Ca2+ we didn’t use the methods recommanded by the Manual ICP Forests and for Cl - we used an alternative method. In order to verify the precision of our methods and results, our laboratory will continue to participate to intercomparison exercises organised by laboratories certificated at European and international level.

  1. Web application security analysis using the Kali Linux operating system / Анализ безопасности веб-приложений оперционной системой Kali Linux / Analiza bezbednosti web aplikacija operativnim sistemom Kali Linux

    Directory of Open Access Journals (Sweden)

    Ivan M. Babincev

    2016-04-01

    Full Text Available The Kali Linux operating system is described as well as its purpose and possibilities. There are listed groups of tools that Kali Linux has together with the methods of their functioning, as well as a possibility to install and use tools that are not an integral part of Kali. The final part shows a practical testing of web applications using the tools from the Kali Linux operating system. The paper thus shows a part of the possibilities of this operating system in analysing web applications security, which presents the goal of this work. / В статье дается описание операционной системы Kali Linux, включая цели и возможности ее использования. Приведен список инструментов системы Kali Linux, способ работы ее конкретных инструментов, а также возможность установки и использования инструментов, которые не являются частью операционной системы Kali Linux. В заключительной части статьи, наглядно представлено тестирование веб-приложений с применением инструментов операционной системы Linux Кали. Таким образом, представлена часть возможностей Кали Linux операционной системы, применяемой для анализа безопасности веб-приложений, что являлось целью данной работы. / U radu je opisan operativni sistem Kali Linux , njegove namene i mogućnosti. Navedene su grupe alata kojima Kali Linux raspolaže, način rada određenih alata koje ovaj sistem sadrži, kao i mogućnost instalacije i korišćenja alata koji nisu njegov sastavni deo. U završnom delu rada praktično je prikazano testiranje web aplikacija korišćenjem alata iz operativnog sistema Kali Linux. Time je prikazan deo mogućnosti ovog operativnog sistema u analizi bezbednosti web aplikacija, što predstavlja cilj ovog rada.

  2. Analiza poluprovodničkih kvantnih generatora tipa A3B5 po nano nivoima / Analysis of semiconductor quantum generators of A3B5 type at nano levels / Наноуровневый анализ полупроводниковых квантовых генераторов типа A3B5

    Directory of Open Access Journals (Sweden)

    Leonid I. Grečihin

    2015-04-01

    Full Text Available U članku se obrazlaže formiranje klasterne rešetkaste strukture poluprovodničkog kristala tipa A3B5. Predstavljen je način deformacije elektronskih opni atoma koji su u sastavu elemenata poluprovodničke kristalne strukture. Na primeru kristala iz jedinjenja indijuma i elemenata pete grupe Mendeljejeve tablice, utvrđeno je među kakvim energetskim nivoima dolazi do generisanja poluprovodničkog kvantnog generatora. Definisani su tehnološki uslovi za izradnju lasera tipa A3B5. / The article describes the formation of the cluster grid structure of semiconductor crystals of A3B5 type. The deformation of the electron shells of the atoms in semiconductor crystal structure elements has been presented. Crystals of the Indium compounds and the elements from Group 5 of the Mendeleev periodic table have been used to show the energy levels where a semiconductor quantum generator is generated. The technological conditions for an A3B5 type laser realisation have been defined. / Обосновано образование кластерной решеточной структуры полупроводниковых кристаллов типа А3В5. Показано, каким образом происходит деформация электронных оболочек атомов составных элементов полупроводниковой кристаллической структуры. На примере кристаллов из соединений индия с элементами пятой группы таблицы Менделеева установлено, между какими энергетическими уровнями реализуется генерация полу- проводникового квантового генератора. Сформулированы тре бования к технологии изготовления лазеров на основе А3В5.

  3. Il personaggio scontornato in Škola dlja Durakov. Dal romanzo di Saša Sokolov agli adattamenti teatrali

    Directory of Open Access Journals (Sweden)

    Irina Marchesini

    2012-12-01

    Full Text Available Sokolov’s Shkola dlya Durakov (A School for Fools, 1976 is an extremely complex novel, which “depicts [the] world”, as D. Barton Johnson (1986:640[1] poignantly observes, “through the eyes, and pure, if eccentric, language, of a schizophrenic youth”. How is it possible to translate such linguistic features and the effects they create into another medium? This question lies at the core of my proposal, which aims to approach the problem of intermedial translation from prose to theatre through the presentation of an individual case-study. In fact, A School for Fools has been staged by the director Andrey Moguchy (Formalny Theatre, Saint Petersburg, Russia. With the intention of reproducing Sokolov’s aesthetic construction of illusion, Moguchy introduces a new genre in the theatrical context, the so-called “vizualnaya associaciya” (“visual association”. As the director explained in a recent interview, this original genre recalls the Impressionists’ position in observing and representing nature, in order to obtain the same effect generated by the reading of the novel. To comprehend this process better, special attention is devoted to the construction of unusual, hybrid characters, highlighting their constitutive features both in the novel and in the theatrical adaptation. Moreover, this research seeks to enrich discussion of the work of Sokolov and Moguchy. [1] Johnson, D. Barton (1986 “Sasha Sokolov's Twilight Cosmos: Themes and Motifs”, in: Slavic Review, 45, 4 (Winter 1986, pp. 639-649.

  4. EL DERECHO FUNDAMENTAL AL OLVIDO EN LA WEB Y EL SISTEMA CONSTITUCIONAL CHILENO. Comentario a la sentencia de protección Rol nº 22243-2015 de la Corte suprema

    Directory of Open Access Journals (Sweden)

    Rodrigo Pica F.

    2016-01-01

    Full Text Available El presente trabajo analiza una sentencia que reconoce el denominado derecho al olvido en el sistema constitucional chileno, explorando sus fuentes, alcances y principios generales.

  5. Una concepción iusadministrativista de los contratos públicos

    Directory of Open Access Journals (Sweden)

    José Luis Meilán Gil

    2011-12-01

    Full Text Available El artículo analiza las principales características de los contratos administrativos y destaca el enfoque de supraconcepto, común a los contratos privados y públicos. Luego partiendo desde una aproximación desde el Derecho público, se analiza los distintos enfoques doctrinales sobre la naturaleza del contrato administrativo.

  6. Lo exótico en el cine sobre la conquista de América

    OpenAIRE

    2014-01-01

    Este artículo de investigación analiza el cine como un instrumento para la recuperaciónde la memoria histórica. Analiza los filmes “Lope de Aguirre larra de Dios” (1972);“Guaz: la conquista del paraíso” (1992).

  7. LA MUERTE DE LA ALEGRÍA DEL PUEBLO

    Directory of Open Access Journals (Sweden)

    José Sergio Leite Lopes

    2011-12-01

    Full Text Available Este texto analiza el proceso de profesionalización del futbol y del deporte en general en el Brasil. Para ello analiza la trayectoria de Garrincha y la comprende a la luz de las posibles trayectorias de jugadores contemporáneos como Pelé.

  8. LA MUERTE DE LA ALEGRÍA DEL PUEBLO

    OpenAIRE

    José Sergio Leite Lopes; Sylvain Maresca

    2011-01-01

    Este texto analiza el proceso de profesionalización del futbol y del deporte en general en el Brasil. Para ello analiza la trayectoria de Garrincha y la comprende a la luz de las posibles trayectorias de jugadores contemporáneos como Pelé.

  9. Tratamiento psicológico en el trastorno de somatización : eficacia y propuestas de intervención

    OpenAIRE

    García Campayo, Javier; Pascual López, Aída; Alda, Marta; Oliván Blazquez, Bárbara

    2005-01-01

    Este trabajo de revisión analiza los estudios controlados randomizados realizados tanto en pacientes con trastorno de somatización como en pacientes con trastorno somatomorfo indiferenciado que han sido tratados mediante dos tipos de intervenciones: 1.

  10. EL PERFIL DEL EDITOR DE JUEGOS DE ROL

    Directory of Open Access Journals (Sweden)

    Héctor Sevillano Pareja

    2010-11-01

    Full Text Available El presente trabajo estudia y analiza, a través de diversas encuestas personalizadas, el perfil tipo que presentan los profesionales que se dedican al arte de editar libros de rol en España.

  11. Performatividad y narración: del happening a la base de datos

    OpenAIRE

    Albarrán Diego, Juan

    2009-01-01

    Se analiza la evolución del concepto de tiempo desde mediados del siglo XX y la influencia de este cambio de concepto en la evolución de las estructuras narrativas hacia una temporalidad de tipo performativo.

  12. Reporteros Sin Fronteras: la defensa internacional de la libertad de expresión y sus problemas.

    OpenAIRE

    2016-01-01

    El trabajo analiza en profundidad la labor de Reporteros Sin Fronteras en defensa de la libertad de expresión en el ámbito internacional. Estudia su estructura, sus actividades principales así como los problemas asociados.

  13. en el derecho interno

    Directory of Open Access Journals (Sweden)

    Osvaldo Alfredo Gozaíni

    2006-01-01

    Full Text Available El artículo analiza en una perspectiva general y en el derecho argentino la incidencia y cumplimiento de los fallos de la Corte Interamericana en el ordenamiento jurídico interno de los estados.

  14. El ejercicio de la potestad sancionadora por parte de la Administración Pública y sus límites tratándose de restricciones a derechos políticos

    Directory of Open Access Journals (Sweden)

    Nicolás Prado Hidalgo

    2012-07-01

    Full Text Available El presente estudio analiza el tema de la potestad sancionadora de la Administración Pública y procura demostrar que los derechos políticos constituyen un límite a dicha potestad.

  15. Improcedencia del control represivo de constitucionalidad de tratados internacionales

    OpenAIRE

    Miriam Lorena Henríquez Viñas

    2007-01-01

    La autora analiza la situación de los tratados internacionales cuando ya han ingresado al ordenamiento jurídico. Considerando los argumentos que le permiten concluir la inconveniencia de un control reparador de tratados internacionales.

  16. Reflexiones sobre territorio e identidad de género en Bolivia.

    Directory of Open Access Journals (Sweden)

    Ana Rosa López

    2013-09-01

    Full Text Available El presente trabajo analiza la relación entre identidad cultural femenina y el territorio en Bolivia. Se reflexiona sobre la Reforma Agraria, la Ley de Participación Popular y el nuevo Estado Plurinacional.

  17. Independencia del Banco Central y estabilidad de precios

    OpenAIRE

    Perez, Fernando; Quispe, Zenon; Rodriguez, Donita

    2007-01-01

    Este artículo analiza uno de los elementos fundamentales de las reformas de las autoridades monetarias, la independencia del banco central, concepto trascendental en el objetivo de mantener la estabilidad de precios.

  18. Factores de riesgo para el desarrollo de fistulas gastrointestinales postoperatorias en Hospital Universitario Mayor

    OpenAIRE

    Neira Rojas, Andrés Mauricio

    2015-01-01

    Estudio de tipo casos y controles que analiza los posibles factores de riesgo identificados en los pacientes llevados a cirugía abdominal mayor en el Hospital Universitario Mayor por el grupo de CIrugía General.

  19. La migración internacional en Centroamérica y su evolución reciente

    OpenAIRE

    Castillo, Manuel Ángel

    2001-01-01

    ResumenAnaliza las tendencias en los patrones migratorios de los centroamericanos a partir del decenio de 1980.AbstractThe author analyzes central american migratory patterns from the 1980´s onwards 

  20. La responsabilidad civil derivada de los daños ocasionados al derecho al honor, a la intimidad personal y familiar y a la propia imágen

    OpenAIRE

    Rovira-Sueiro, María E.

    2011-01-01

    [Resumen] SE ANALIZA LA RESPONSABILIDAD CIVIL EN EL AMBITO ESPECIFICO DE LOS DERECHOS AL HONOR, INTIMIDAD E IMAGEN COMPARANDOLA CON EL REGIMEN COMUN DE RESPONSABILIDAD CIVIL CONTENIDO EN EL ARTICULO 1902 DEL CODIGO CIVIL.

  1. Tasas retributivas por contaminación hidríca y su aplicación en Colombia: un instrumento económico hacia el desarrollo sostenible

    Directory of Open Access Journals (Sweden)

    Yecid Angarita Palma

    2001-06-01

    Full Text Available En este artículo se analizan la experiencia de las Corporaciones Autónomas Regionales y Autoridades Ambientales concretas, en este caso se analiza la experiencia de las Corporaciones Autónomas Regionales y Autoridades Ambientales Urbanas, obtenida en el proceso de implementación de las tasas retributivas por contaminación hídrica (Decreto 901 de 1997 y se analiza si éstas armonizan con el desarrollo sostenible.

  2. SEGURO DE RESPONSABILIDAD CIVIL POR DAÑO MEDIOAMBIENTAL EN ESPAÑA

    OpenAIRE

    Teixeira,César; Pauletto, Fernando; Fruet, Ana Paula Burin; Kirinus, Jackeline Karsten; Dörr, Andrea Cristina

    2014-01-01

    En este trabajo se analiza el seguro de responsabilidad civil por el daño medioambiental en España. Para ello, se analiza la Directiva 2004/35/CE del Parlamento Europeo y del Consejo juntamente con la ley de responsabilidad civil medioambiental de España. Luego, se expone el concepto de seguro de responsabilidad civil y la estructura de la póliza de seguro. Y, finalmente se formulan unas breves consideraciones y las conclusiones.

  3. Análisis de extinción de una ecuación de difusión no local con término de absorción

    Directory of Open Access Journals (Sweden)

    Mauricio Bogoya

    2014-01-01

    Full Text Available Se estudia un problema de difusión no local con término de absorción y condiciones de frontera de Neumann. Se analiza la existencia y unicidad de las soluciones, y se da un principio de comparación para ellas. Se analiza la extinción de la solución para algunos términos de absorción.

  4. Primena cost-benefit analize u vrednovanju i izboru javnih projekata (finansijski aspekt

    Directory of Open Access Journals (Sweden)

    Dragana N. Petrović

    2013-06-01

    Full Text Available Cost – benefit analiza predstavlja veoma koristan instrument za vrednovanje i izbor javnih projekata,prvenstveno onih sa životnim vekom 30 i više godina, kao što su: izgradnja bolnice, kanala za navodnjavanje, mosta,tunela, razvoj i proizvodnja novog sredstva NVO i sl. Analiza se primenjuje i u privatnom sektoru, za ocenjivanje projekata koji se, jednim delom, finansiraju iz državnih sredstava ili putem kredita. Preduzetnik ili privredno društvo ne pokazuju iunteresovanje ili ne raspolažu sredstvima dovoljnim za realizaciju projekata (za otvaranje škola, pozorišta i sl.Cost – benefit analiza daje informacije državnim organima i poslovnim bankama o isplativosti ulaganja, bez kojih oni ne mogu doneti odluku o finansijskoj podršci realizacije projekta.Izbor najbolje investicione alternative ostvaruje se na bazi finansijske i ekonomske analize, kao dva integralna dela cost – benefit analize. Sadržaj ovog rada ćini finansijska analiza koja istražuje finansijsku isplativost projekta isključivo sa stanovišta predlagača i finansijera. U jednom od narednih brojeva časopisa, obradićemo i ekonomsku analizu, kao celovitu analiza efikasnosti projekta.

  5. Costes irrecuperables de exportación, productividad y elección de mercado de exportación de las empresas españolas

    OpenAIRE

    José Vicente Blanes Cristóbal; Juliette Milgram Baleix

    2009-01-01

    Este trabajo analiza si los costes irrecuperables de exportación difieren según el mercado de exportación y como ello afecta a la decisión de exportar de las empresas españolas. Dado que las pequeñas y medianas empresas presentan características distintas a las grandes empresas, analizamos también si estos costes irrecuperables afectan de manera distinta a la decisión de exportar en función del tamaño de la empresa. Del mismo modo se analiza si la productividad afecta a la decisión de exporta...

  6. El pagaré cambiario y las excepciones basadas en las relaciones personales en el Anteproyecto de Ley del Código mercantil (ACM).

    OpenAIRE

    López Curbelo, Jorge

    2015-01-01

    En este estudio se analiza la problemática relativa al régimen de oposición de excepciones basadas en las relaciones personales por parte del demandado cambiario firmante de un pagaré. Se hace una breve referencia histórica a fin de delimitar correctamente la naturaleza del pagaré respecto de la que es propia de la letra de cambio. Se analiza la regulación prevista en el Anteproyecto de Ley del Código Mercantil en los artículos 610-14 y 638-34 en materia de excepciones oponible...

  7. Los mejores esfuerzos (best efforts) en el derecho contemporáneo de los contratos

    OpenAIRE

    Alberto Acevedo Rehbein

    2010-01-01

    Este artículo analiza las cláusulas de mejores esfuerzos (best efforts). En la primera parte, el autor analiza desde la óptica del common law cómo las cortes estadounidenses han definido y determinado el alcance de las cláusulas de mejores esfuerzos. Posteriormente, se hace un análisis comparativo frente al ordenamiento jurídico colombiano con el propósito de determinar la aplicación de este tipo de cláusulas en Colombia. La tesis central del artículo es que las cláusulas de mejores esfuerzos...

  8. La plebe de Quito a mediados del siglo XVIII: una mirada de la periferia de la sociedad barroca

    Directory of Open Access Journals (Sweden)

    Rosemarie Terán Najas

    2009-11-01

    Full Text Available Este artículo analiza el comportamiento de los actores sociales ubicados en la periferia de la sociedad colonial, con el objetivo de desvelar el funcionamiento de las redes de socialización de estos grupos en relación con la estructura jerárquica estamental, cuyo orden giraba en torno a la figura del Rey, marcada por representaciones sociales, políticas y religiosas de la Contrarreforma. El estudio analiza varios juicios relacionados con el comportamiento de los personajes plebeyos de la sociedad colonial quiteña.

  9. Los sujetos procesales en el Código Procesal Peruano de 2004 (acusatorio, garantizador, de tendencia adversativa, eficiente y eficaz

    Directory of Open Access Journals (Sweden)

    Mario Pablo Rodriguez Hurtado

    2010-12-01

    Full Text Available El autor analiza el nuevo ordenamiento procesal penal, edificado, como” modelo acusatorio, garantizador y de tendencia adversativa”, analiza además las variables por las que resulta  que sin persecución, defensa y fallo, entendidas como funciones diferenciadas y a cargo de un correspondiente sujeto procesal, sea imposible predicar la existencia de un proceso justo, debido y legal, propio de un régimen democrático y republicano al servicio de los ciudadanos.

  10. Comportamiento sustentable y educación ambiental: una visión desde las prácticas culturales

    OpenAIRE

    Marithza Sandoval Escobar

    2012-01-01

    El presente artículo analiza el problema de la EA (educación ambiental) para el desarrollo de comportamientos sustentables desde el marco de las prácticas culturales. Desde esta perspectiva, se analizan los factores infraestructurales que contribuyen al desarrollo de las problemáticas ambientales y se relacionan con los aspectos estructurales de la cultura que actúan determinando el contexto en el que ocurre la interacción de los individuos con su entorno ambiental. Se analiza específicamente...

  11. Perfeccionamiento de los recursos humanos en archivología

    Directory of Open Access Journals (Sweden)

    Teresa Fittipaldi Huelmo

    2013-11-01

    Full Text Available Se analiza la situación y las posibles soluciones para mejorar los recursos humanos disponibles en el área de Archivología. Este tema está considerado en varios aspectos: la formación docente de docentes e investigadores; la calidad y la cantidad de los estudiantes; la capacitación de las personas que se encuentran realizando tareas en Archivos. El tema se analiza en el marco de la situación concreta del Uruguay. 

  12. Límites en las competencias entre la Sala Constitucional y el Tribunal Supremo de Elecciones

    Directory of Open Access Journals (Sweden)

    Bernal Arias Ramirez

    2007-07-01

    Full Text Available Ponencia que en tres partes analiza las competencias del Tribunal Supremo de Elecciones y de la Sala Constitucional, y el posible roce que existe entre ambos. En la primera analiza las competencias del Tribunal Supremo de Elecciones, mientras que en la segunda se centra en las competencias de la Sala Constitucional en materia electoral y por último, el tercer apartado expone el peligro que a criterio del ponente representa la anulación de resoluciones del Tribunal Supremo de Elecciones por parte de la Jurisdicción Constitucional

  13. Structural and Thermal Analysis of Automotive Disc Brake Rotor

    Directory of Open Access Journals (Sweden)

    Belhocine Ali

    2014-03-01

    Full Text Available Głównym celem pracy jest analiza zjawisk termomechanicznych w obszarze suchego styku pomiedzy tarcza hamulca a klockiem ciernym wystepujacych w fazie hamowania. Strategia symulacji jest oparta na oprogramowaniu ANSYS11. Wyniki modelowania stanów przejsciowych temperatury w tarczy hamulca wykorzystano do identyfikacji geometrycznych współczynników projektowych, uzytych do instalacji systemu wentylacji. Sprzezona analiza strukturalno-termiczna jest nastepnie uzyta do wyznaczenia deformacji tarczy, naprezenia Von Misses’a, oraz rozkładu cisnienia kontaktowego w klockach ciernych. Wyniki analizy wykazuja zadowalajaca zgodnosc z podobnymi podawanymi w literaturze.

  14. La migración infantil indocumentada de Centroamérica, un desafío a la reformulación de la política migratoria de Estados Unidos. Estudio de caso de Honduras (2010-2014)

    OpenAIRE

    Forero Padilla, Fabian Enrique

    2016-01-01

    El siguiente estudio de caso analiza la influencia de la llegada de la migración infantil indocumentada centroamericana en la reformulación de la política migratoria de Estados Unidos en el período 2010-2014. Enfocándose en el caso de Honduras para dar a conocer y analizar las causas que crean las dinámicas migratorias por parte de los menores, este trabajo analiza como la llegada de estas poblaciones genera ciertos efectos en el proceso de toma de decisión de las políticas internas de los Es...

  15. IMPACTOS DEL TURISMO EN EL MEDIO AMBIENTE DE HUANCHACO

    OpenAIRE

    ZAVALETA ALFARO, MARÍA SIXTINA

    2007-01-01

    Se analiza los impactos negativos del turismo sobre el medio ambiente de la Bahía de Huanchaco, previamente se evalúa el flujo de visitantes, la oferta turística en cuanto a recursos naturales, culturales y planta o infraestructura (hoteles, restaurantes, otros). Se incide en al generación de residuos sólidos domésticos, calidad del agua, transporte, deterioro de ecosistema de humedales (calidad ambiental) y se analiza la opinión o percepción del turista a través de una encuesta. Los resulta...

  16. Construir comunidades educativas desde la referencialidad geográfica: La evolución de la representación de las instituciones educativas en Barcelona en los mapas urbanos

    OpenAIRE

    Collelldemont, Eulalia

    2013-01-01

    En el artículo se presentan los resultados de la investigación realizada sobre los planos y mapas urbanísticos y civiles de la ciudad de Barcelona. Con una primera aproximación a la evolución de la cartografía urbana, el estudio analiza la referencialidad de las instituciones educativas en la ciudad Condal. Se analiza para ello la presencia-ausencia de referencias de instituciones de los distintos grados del sistema educativo y se atiende a las formas de representación de las mismas, observan...

  17. Construir comunidades educativas desde la referencialidad geográfica

    OpenAIRE

    Collelldemont Pujadas, Eulàlia

    2013-01-01

    En el artículo se presentan los resultados de la investigación realizada sobre los planos y mapas urbanísticos y civiles de la ciudad de Barcelona. Con una primera aproximación a la evolución de la cartografía urbana, el estudio analiza la referencialidad de las instituciones educativas en la ciudad Condal. Se analiza para ello la presencia-ausencia de referencias de instituciones de los distintos grados del sistema educativo y se atiende a las formas de representación de las m...

  18. How the socialism of the twenty-first century became populism, and how its leaders use rhetoric to sustain themselves in power. The Ecuadorian Case

    OpenAIRE

    De Guzmán Valdivieso, Patricia Victoria

    2014-01-01

    La presente disertación analiza el origen del denominado "Socialismo del siglo XXI" y como éste fue mutando hasta convertirse en lo que varios autores consideran la forma clásica de populismo. Así mismo analiza la importancia de la retórica para los sistemas populistas y cómo los líderes del socialismo del siglo XXI usan la misma para mantener su popularidad. Se hace un estudio de la aplicación de estos conceptos en el caso ecuatoriano.

  19. Escrituras anárquicas: prácticas textuales del anarquismo literario en el Río de la Plata

    OpenAIRE

    2015-01-01

    En este artículo se analiza la escritura anárquica en cuatro autores rioplatenses vinculados de manera distinta con el anarquismo. Primero, se señala la intervención anárquica en los registros del argentino Alberto Ghiraldo, escritos en su reclusión a bordo de un barco esperando su deportación. Segundo, se observa la “incorrección” sintáctica y gramatical en un texto de su compatriota Alejandro Sux, escrito a consecuencia de su reclusión en una cárcel de Mendoza. Tercero, se analiza el caráct...

  20. Integración, mestizaje y nacionalismo en el México revolucionario. Forjando Patria de Manuel Gamio: la diversidad subordinada al afán de unidad

    OpenAIRE

    Guillermo Castillo Ramírez

    2014-01-01

    E ste trabajo analiza el programa integracionista de Manuel Gamio en su obra Forjando Patria como un proyecto d e nacionalidad surgido e n el contexto histó rico del México revolucionario, en el que la diversidad cultural se supeditaba a la idea de unidad . En primer lugar, se rastrea la relación del programa integracionista con sus antecedentes, las ideas de “ mestizaj e ” y “ mestizo ” de fines del siglo XIX y principios del XX. Luego se analiza la influencia que el integracionismo de Gamio...

  1. Posmodernismo y educación moral

    OpenAIRE

    Rojas Osorio, Carlos

    2015-01-01

    En este ensayo, con base en las obras : La era del vacío y El crepúsculo del deber, se analiza el papel de la educación y de la ética en una sociedad posmoderna. Analiza la vaciedad de esta sociedad, la pérdida de valores y el endiosamiento de la publicidad. Más allá del bien y del mal, la sociedad vive la era del posmoralismo. Al final el autor critica algunas posiciones de Lipovetsky, como el humanismo individualista, la cuestión de la verdad devaluada, el ocaso de la moral ilustrada y la e...

  2. Resumen de tesis. La configuración del derecho fundamental al recurso en un proceso penal con todas las garantías.

    OpenAIRE

    Letelier Loyola, Enrique

    2012-01-01

    [ES]Partiendo del supuesto que la impugnación no es una fase escindida del proceso penal y que el respeto a la coherencia interna es un estándar esperable de todo sistema, la investigación analiza la naturaleza del derecho a la impugnación en asuntos penales como garantía constitucional, describe, armoniza y contrasta la actividad impugnativa con los principios fundamentales de un sistema acusatorio, y describe y analiza el derecho a la impugnación desde la perspectiva de los mecanismos de tu...

  3. Fitness-management: el conflictivo devenir de una cultura empresarial

    OpenAIRE

    María Inés Landa

    2016-01-01

    Resumen El artículo analiza el conflictivo devenir de la cultura del fitness en Argentina a partir de las categorías foucaulteanas de dispositivo, prácticas, gubernamentalidad y empresario de sí. En primer lugar, aborda la emergencia del fitness en la escena local y hace hincapié en las objeciones que la comunidad de profesores de educación física realiza a las producciones de este dispositivo cultural. A continuación, analiza las tácticas de conversión cultural que implementa el dispositivo ...

  4. Libertad y acción en Arendt y Sartre

    OpenAIRE

    José Luis Arias Venegas

    2006-01-01

    Se analiza en este trabajo las ideas que desarrollan Arendt y Sartre sobre libertad y acción. Para Sartre, al actuar modificamos la estructura del mundo, esperando el resultado previsto. La condición del acto es la libertad del para-sí, punto de partida absoluto. El acto proyecta al para-sí hacia algo que no-es, haciendo surgir motivos y móviles de la acción. Luego se analiza el concepto de libertad en Arendt, desentrañando su concepto de acción. Para ella no es ...

  5. EL DERECHO CONSTITUCIONAL DE HUELGA Y EL MODERNO DERECHO SINDICAL

    OpenAIRE

    Héctor SANTOS AZUELA

    2009-01-01

    De cara al li bre comercio y los retos incesantes de la economía global, se hace interesante meditar sobre las bases constitucionales del derecho sindical dentro del ordenamiento mexicano. De esta suerte, se analiza el carácter pro tec tor y reivindicativo de sus principios sociales por lo que hace, particularmente, a sus tres figuras esenciales: el derecho de sindicalización, el de negociación profesional y desde luego, el de huelga. En este sentido, se analiza que, a partir de nuestros prin...

  6. La detención operativa en la frontera entre el Derecho Internacional Humanitario y el Derecho Internacional de los Derechos Humanos

    OpenAIRE

    Martínez Guillem, Ramón

    2012-01-01

    La tesis analiza, desde una perspectiva de Derecho internacional, la detención de personas y algunostemas relacionados, en particular los asesinatos selectivos como alternativa legítima a la detención, en operaciones internacionales básica, pero no exclusivamente militares. El primer capítulo analiza aspectos generales: el concepto mismo de detención, la aplicación extraterritorial del Derecho de los Derechos Humanos, la aplicación del Derecho Internacional Humanitario, la interacció...

  7. Evaluación de la calidad asistencial en un servicio de salud mental a través de la percepción y evolución de pacientes con trastorno obsesivo-compulsivo

    OpenAIRE

    SANTIAGO BARAJAS MARTÍNEZ

    2001-01-01

    El presente estudio analiza la aplicación de un breve cuestionario, diseñado al efecto por el autor, con el objetivo de conocer la percepción de los pacientes con trastorno obsesivo-compulsivo sobre los siguientes aspectos: información sobre su trastorno, tipos de tratamiento recibidos, eficacia de los mismos, satisfacción con la atención recibida y evolución de los síntomas. Se analiza profundamente la eficacia diferencial de distintos tratamientos psicológicos en función de su orientación t...

  8. La Competitividad de las exportaciones de vino español y el mercado mundial 1960-2011

    OpenAIRE

    2012-01-01

    Este trabajo analiza la evolución y competitividad de las exportaciones españolas de vino en el mercado mundial desde la década de 1960. Con ello explora las respuestas de la industria vinícola durante la globalización del vino. Analiza el comportamiento evolutivo del sector por tipos de vinos y el peso relativo de las exportaciones en volumen, valor y precios unitarios en el mercado mundial. El estudio de la ventaja comparativa del comercio exterior se realiza a través del índice de Ventaja ...

  9. Las políticas de atracción de inversión en infraestructura pública. Estado actual y futuros desarrollos

    OpenAIRE

    Ricardo Lara

    2010-01-01

    El gobierno colombiano se encuentra construyendo el Plan Nacional de Desarrollo, en el cual la infraestructura juega un rol fundamental. En este documento se analiza la evolución de la participación privada en infraestructura, su desarrollo y también su atraso en los últimos años; así mismo, se analiza la necesidad de financiar la infraestructura a través de la atracción de inversiones, como tema central para que la infraestructura en Colombia responda a las necesidades actuales y futuras de...

  10. Influencia de las medidas queratométricas en el cálculo de la potencia de lentes intraoculares

    OpenAIRE

    Mateo Pérez, Verónica; Camps Sanchis, Vicente Jesús; Piñero Llorens, David Pablo; Fez Saiz, Dolores de

    2011-01-01

    PROPÓSITO: Determinar la influencia del error cometido en el cálculo de la potencia corneal queratométrica en el cálculo de la potencia de una lente intraocular. MÉTODO: Se analiza el error que se comete cuando se calcula la potencia de la lente intraocular utilizando la potencia corneal calculada por el método de Gauss ó por medio de un índice queratométrico (nk), y se analiza las dependencias con los radios de la cara anterior (r1c) y posterior (r2c) de la cornea, de la razón k, del modelo ...

  11. Comportamiento mecánico de ADI tratada superficialmente mediante la aplicación de recubrimientos PVD de baja temperatura

    OpenAIRE

    Colombo, Diego Alejandro; Echeverría, María D.; Massone, Juan Miguel

    2015-01-01

    En este trabajo se aplican recubrimientos PVD de TiN y CrN sobre ADI y se analiza la influencia del material del recubrimiento sobre las propiedades mecánicas del producto ADI recubierto. Se analiza también, el efecto del proceso de deposición sobre la microestructura de los sustratos. Los recubrimientos se aplican en un reactor industrial mediante la técnica de plateado iónico con arco catódico, utilizando parámetros de proceso específicamente seleccionados para este material. Se determinan ...

  12. Responsabilidad social y relaciones laborales en España

    Directory of Open Access Journals (Sweden)

    Francisco Javier Calvo Gallego

    2010-12-01

    Full Text Available El autor, analiza la evolución y las características de  la Responsabilidad Social Empresarial, en España, su impacto económico y social con especial atención a los aspectos laborales dentro de ella,  la opinión y  las actitudes de los interlocutores sociales; toma importancia a los poderes públicos, estatales y autonómicos, del mismo modo analiza la relación de la RSE y la negociación colectiva en España

  13. Oliver Wendell Holmes Jr. y su obra: Una fusión sistemático-existencial

    OpenAIRE

    Portela Valentín, Orlando Guillermo

    2016-01-01

    607 p. La presente Tesis, analiza las ideas filosófico-jurídicas del Juez Oliver Wendell Holmes, Jr. Y la manera en que dichas ideas influyen en las diferentes escuelas modernas del pensamiento jurídico norteamericano. En particular se analiza su visión instrumental del Derecho y la forma en que éste se relaciona con la moral, la historia y el poder político y económico, todas estas ideas que marcan el pensamiento filosófico-jurídico norteamericano en la modernidad.Para alcanzar este propó...

  14. Stalking : El nuevo delito de acecho del art. 172 ter del Código Penal. Aproximación al cyberstalking

    OpenAIRE

    Lorenzo Barcenilla, Silvia

    2015-01-01

    En el presente trabajo se analiza el tratamiento en el ordenamiento penal español de las conductas de stalking, también denominado acecho o acoso predatorio. Se realiza en primer lugar una definición del concepto y de sus características, con una breve referencia a las diferencias con otras modalidades de acoso. A continuación se analiza una concreta forma de stalking, denominada cyberstalking, por presentar particularidades respecto al stalking tradicional y constituir un fenómeno creciente ...

  15. Descripci?n de los factores de riesgo virales y no virales para el desarrollo de hepatocarcinoma en pacientes tratados en el Hospital Carlos Andrade Mar?n y el Hospital de Solca n?cleo de Quito, desde el a?o 2003 hasta el a?o 2014

    OpenAIRE

    G?mez Jaramillo, Ana Mar?a

    2016-01-01

    Introducci?n: se trata de un estudio descriptivo transversal que analiza a todos los pacientes diagnosticados de hepatocarcinoma del Hospital Carlos Andrade Mar?n y del Hospital de Solca N?cleo de Quito. El objetivo principal es describir los factores de riesgo para el desarrollo de hepatocarcinoma en los pacientes con dicho diagn?stico. Materiales y m?todos: las variables a ser medidas son en primera instancia las caracter?sticas demogr?ficas de los pacientes, se analiza la pr...

  16. Contradicciones entre hegemonía y subalternidad en la Costa Rica del siglo XXI. Una crítica a la concepción de democracia representativa de G. Sartori

    OpenAIRE

    2016-01-01

    Este artículo analiza la relación que se establece, en el contexto del siglo XXI, entre aquellos actores político-partidarios que se agruparon desde posicionamientos “anti-neoliberales” y el conjunto de actores sociales que conformaron lo que se conoció como “Movimiento del No”. Se trata de una investigación de carácter cualitativo, que analiza la producción discursiva y los posicionamientos políticos de estos actores sociales. El proceso conclusivo apuntó a la comprensión del carácter de la ...

  17. ¿SON LAS COOPERATIVAS MÁS FAVORABLES A LA PRESENCIA DE MUJERES EN LOS CONSEJOS QUE OTRAS ENTIDADES? / ARE THE COOPERATIVES IN MORE FAVOURABLE OF HAVING WOMEN IN THEIR BOARD OF DIRECTORS THAN OTHER ENTITIES?

    OpenAIRE

    María Luisa ESTEBAN SALVADOR

    2013-01-01

    Este trabajo analiza en qué empresas se cuenta con órganos de gobierno más favorables a la participación femenina en el periodo previo al desarrollo de medidas y recomendaciones sobre la presencia de mujeres en los consejos de administración de las grandes sociedades españolas, entre las que se incluyen cooperativas. Asimismo pone en relación la rentabilidad con el género en sus órganos de gobierno. Para ello, en un primer análisis se analiza la rentabilidad económica de las sociedades no fin...

  18. Turismo y TIC. Notas sobre los procesos recientes de tecnificación de los destinos turísticos

    OpenAIRE

    López Palomeque, Francisco

    2016-01-01

    En el texto se aportan unas notas sobre los procesos recientes de tecnificación de los destinos turísticos, bajo el marco de la relación entre el turismo y las tecnologías de la información y la comunicación (TIC). En concreto, se analiza el proceso de creación y difusión de los conceptos y de los discursos en torno a los paradigmas ciudad inteligente y destino inteligente. Se analiza el papel que tienen los diversos agentes en dicho proceso (la academia, los agentes del mercado y las institu...

  19. Redes de colaboración en Educación Superior

    OpenAIRE

    Solano Fernández, Isabel Mª

    2012-01-01

    Redes de colaboración para la Educación Superior. Se analiza el modelo pedagógico constructivista social, y dentro de este el método colaborativo. Posteriormente analiza las posibilidades de las redes, redes sociales y medios sociales, para la Educación. Presentación realizada para realizar el taller "redes de colaboración en Educación Superior" en el Seminario de innovación docente Organizado por el Centro de Desarrolo Docente (CDDOC) de la Universidad Católica de Chile.

  20. Innovación y empresas turísticas

    OpenAIRE

    2006-01-01

    El artículo analiza la innovación en las empresas de servicios turísticos a partir de una conceptualización que incluye los procesos de innovación en el marco de la teoría de desarrollo local. Se analiza la relación entre conocimiento e innovación y a partir de ese enfoque, la importancia del entorno en los proceso de aprendizaje colectivo, Teniendo en cuenta estos desarrollos en la economía industrial y los antecedentes en el sector turismo, se realiza una propuesta de indicadores para el es...

  1. Derecho a la educación. Su contenido esencial en el derecho chileno

    Directory of Open Access Journals (Sweden)

    Juan Carlos Flores Rivas

    2014-01-01

    Full Text Available El artículo analiza los elementos esenciales del derecho a la educación en el Derecho Chileno, situando al educando en el centro de todo el proceso educacional. De este modo, se estudia el derecho y el deber de los padres a educar a sus hijos, eligiendo el establecimiento educacional que estimen conveniente para el mejor desarrollo de sus habilidades. Asimismo, se analiza el deber del Estado de diseñar un régimen gratuito para la educación obligatoria, con la finalidad de permitir el acceso a los niveles educativos obligatorios de toda la población.

  2. Ten years of Argentine Foreign Policy in "International Relations"

    OpenAIRE

    Simonoff, Alejandro César

    2002-01-01

    Con motivo de haberse cumplido recientemente el décimo aniversario de la revista Relaciones Internacionales, este artículo estudia cómo se analiza la política exterior argentina en sus páginas. Para ello, el autor analiza cuáles han sido los temas de política exterior abordados y qué tratamiento se les ha otorgado, con el fin de develar si existe en la publicación, una única o varias visiones sobre los mismos. On the tenth anniversary of the "Relaciones Internacionales" magazine, this artc...

  3. Desigualdades educativas y segregación en el sistema educativo peruano. Una mirada comparativa de las pruebas PISA 2000 y 2009

    OpenAIRE

    Benavides, Martín; León, Juan; Etesse, Manuel

    2014-01-01

    Utilizando la información disponible de los países de la región participantes en la ronda del Programa Internacional para la Evaluación de Estudiantes (PISA, por sus siglas en inglés) 2009, este estudio analiza comparativamente el impacto diferenciado del nivel socioeconómico sobre el rendimiento educativo. Analiza también de forma comparada la descomposición de dicho efecto y su relación con las desigualdades educativas de activos, de ocupación y de capital cultural. Finalmente, examina los ...

  4. Estudio mediante simulación numérica de chimeneas solares para ventilación, refrigeración y calefacción

    OpenAIRE

    2008-01-01

    Se explica el funcionamiento de las chimeneas solares, así como los modos de transferencia de calor presentes. En base a datos experimentales se crea un modelo computacional válido para predecir el funcionamiento de las chimeneas solares. Empleando datos solares de Madrid, se analiza el desempeño de las chimeneas solares para ventilación, refrigeración y calefacción. De cara al dimensionado, se analiza la influencia de distintos parámetros geométricos: altura, ancho del canal y tamaño de las ...

  5. Francisco de Vitoria y las cuestiones de Indias

    OpenAIRE

    2013-01-01

    La tesis doctoral analiza el tratamiento que el dominico burgalés da a las cuestiones de Indias. El texto se divide en dos partes y en unas conclusiones. En la parte primera se analiza brevemente la vida de Vitoria. Sobre la fecha y lugar de nacimiento mucho se ha escrito, parece ser, y así lo acreditan las últimas investigaciones, que nación en Burgos, un 1483, y que murió en Salamanca, un 1546. Hemos analizado su ingreso en el convento de San Pablo de Burgos; su estancia en la Universidad d...

  6. inserción nacional e internacional

    Directory of Open Access Journals (Sweden)

    Mariana Calvento

    2009-01-01

    Full Text Available La presente investigación analiza la factibilidad de construir una mar-ca-regional y/o marca-ciudad para las localidades argentinas de Tan-dil, Olavarría y Azul (TOA. Para ello se analiza la valoración de laimagen de la región en los grandes medios gráficos argentinos. Eltrabajo propone indagar las particularidades de una de las estrategiasllevadas a cabo en Argentina con la intención de funcionar como víaalternativa al desarrollo de ciudades y regiones.

  7. Conflicto y Modernización en la Gran Minería del Cobre (1950-1970)

    OpenAIRE

    Ángela Vergara Marshall

    2004-01-01

    Este artículo analiza el proceso de modernización en la Gran Minería del Cobre en Chile entre 1950 y 1971. En primer lugar, se examinan las causas, nacionales e internacionales, que llevaron a las empresas del cobre a introducir cambios en la forma de producción, organización de la fuerza de trabajo y labores administrativas. En segundo lugar, se analiza el impacto que tuvo la modernización en las condiciones de vida y de trabajo de los mineros del cobre. En términos generales, este artículo ...

  8. Aspectos de una Teoría de los Derechos Fundamentales: La Delimitación, Regulación, Garantías y Limitaciones de los Derechos Fundamentales

    Directory of Open Access Journals (Sweden)

    Humberto Nogueira Alcalá

    2005-01-01

    Full Text Available El presente artículo analiza la ubicación de los derechos fundamentales dentro del sistema jurídico nacional y comparado latinoamericano, como asimismo analiza los aspectos relativos a la delimitación, regulación, garantías y limitaciones de los derechos en la Constitución chilena vigente.The present article analyzes the status of fundamental rights within national and Latin American legal system. It also analyzes the aspects related to boundary, regulation, guarantees and limitations of the rights in the current Chilean Constitution.

  9. Trofejni parametri muflona (Ovis ammon musimon Pallas, 1811) u državnom lovištu VIII/6 “Kalifront”

    OpenAIRE

    Krapinec, Krešimir; Grubešić, Marijan; Šegrt, Viktor; Maričić, Kristijan

    2006-01-01

    U radu je načinjena analiza ovisnosti elemenata izmjere muflonskog trofeja, analiza prirasta duljine i opsega tuljca te usporedba s nekim srednjeeuropskim populacijama i korzičkom populacijom. Glede elemenata ocjene rogova muflona s lovišta “Kalifront” najveću ovisnost o starosti pokazuju duljina tuljaca (r = 0,83), opseg na trećoj trećini roga (r = 0,83) i ukupna vrijednost trofeja (r = 0,82). Na ukupnu trofejnu vrijednosti najviše utječe duljina tuljaca (r = 0,98), nakon toga slijedi opseg ...

  10. La cuestión de sexo/género en medicina: Tecnologías de reasignación de sexo y valores de género en España

    OpenAIRE

    2014-01-01

    Este proyecto de tesis analiza desde la perspectiva de los estudios de Ciencia, Tecnología y Sociedad (CTS) en intersección con los estudios feministas de la ciencia y los estudios transgénero, las prácticas tecno-científicas que se realizan sobre los cuerpos de personas trans (transexuales y transgéneros) y los valores de género asociados a estas prácticas. En concreto, la tesis analiza los discursos y prácticas socio-médicas sobre los cuerpos de personas trans. Este análisis ...

  11. Radio y elecciones

    Directory of Open Access Journals (Sweden)

    Alma Rosa Alva de la Selva

    2000-01-01

    Full Text Available En este trabajo se analiza el comportamiento de la radio en México ante la contienda electoral de julio de 2000. Se examina el papel de la radio como espacio para la discusión política, así como el tratamiento informativo que hizo del tema. Asimismo, se analiza la posible repercusión de factores de reciente surgimiento en el panorama radiofónico para un manejo más autónomo de la información política en la radio

  12. La educación emocional a través de las prácticas motrices de expresión. Perspectiva de género

    OpenAIRE

    Mateu Serra, Mercè; Romero-Martín, Mª Rosario; Gelpi Fleta, Paula; Rovira Bahillo, Glòria; Lavega Burgués, Pere

    2014-01-01

    Esta investigación en Educación Física, analiza el tipo de emociones que suscitan las prácticas de expresión motriz (PME) de carácter cooperativo y psicomotor, según la clasificación de Parlebas. La vivencia emocional se analiza además en base al género y a la sede (localización geográfica) donde se desarrolló el estudio.Se aplicó el cuestionario GES (GamesEmotionalScale) sobre conciencia emocional, a 172 estudiantes (61 mujeres y 111 hombres) de primer curso ...

  13. HISTORIA, HISTORIOGRAFÍA Y GÉNERO. NOTAS PARA LA MEMORIA DE SUS VÍNCULOS EN LA ARGENTINA

    Directory of Open Access Journals (Sweden)

    DORA BARRANCOS

    2011-10-01

    Full Text Available Este artículo presenta el estado de arte en la historiografía de género en Argentina. Analiza sus tempranos fondos y los centros, sobre todo acerca de las transformaciones de historiografía que ocurrieron desde los años 80. Además, analiza las diferentes contribuciones y el principal objeto de fenómenos de historiografía de mujeres en Argentina. Esto saca la conclusión sobre el nivel de producción, alguna vez creciente, de estudios cuantitativos y cualitativos en materia sexual en este país.

  14. Análisis de la fuerza laboral en educación en Honduras

    OpenAIRE

    Gustavo Arcia; Carlos Gargiulo

    2010-01-01

    Este estudio analiza la estructura del mercado laboral magisterial, su marco regulatorio y los incentivos implícitos que tienen los maestros para apoyar las confrontaciones con el Gobierno. También analiza la economía política del mercado laboral magisterial, las características del último acuerdo laboral Programa de Ajuste Social y Calidad Educativa (PASCE) y las alternativas para una reforma del sistema actual. La conclusión principal es que el acuerdo actual es insostenible a corto plazo, ...

  15. Rehabilitación en edificación y espacios libres como revitalización de ciudades: El caso de Constantina en Algeria

    OpenAIRE

    2012-01-01

    El trabajo que se presenta es el proceso de estudio previo, análisis y justificación para la redacción del proyecto integral de Rehabilitación de los edificios y los espacios exteriores de la calle Aouati Moustefa de la ciudad de Constantine, en Argelia, mediante un estudio que analiza factores generales, para plantear soluciones concretas al problema de la decadencia urbana. Se analiza un muestrario de edificaciones por período de construcción, una elección de espacios exteriores que se cons...

  16. Ensayos sobre la teoría de la evasión y la elusión de impuestos indirectos

    OpenAIRE

    2011-01-01

    Se presentan tres ensayos que incluyen contribuciones originales al análisis teórico de la evasión y la elusión fiscal de impuestos indirectos. Luego de la revisión de la literatura, en el Capítulo 2 se presenta un análisis de la incidencia de impuestos especificos y ad valorem que pueden ser evadidos en entornos competitivos y bajo monopolio. En el Capítulo 3 se analiza la evasión fiscal dentro de una estructura vertical. En particular, se analiza el efecto de la posibilidad de evasión de un...

  17. La oferta de trabajo en los estudiantes de licenciatura en México

    OpenAIRE

    Salvador Carrillo Regalado; Jesús Gerardo Ríos Almodóvar

    2009-01-01

    Se analiza la participación y el tiempo de trabajo ofrecido por los estudiantes de licenciatura en el mercado laboral en México. Se analiza el efecto de diferentes factores socioeconómicos sobre la oferta laboral de los estudiantes mediante el empleo de MCO (regresión a través de mínimos cuadrados ordinarios) y de modelos de regresión probabilística. Se consideran variables como los ingresos laborales, los ingresos no laborales, la escolaridad del jefe del hogar, la edad, sexo y la carrera es...

  18. Feasibility study for the manufacturing of a shock absorber using 3D printing technology

    OpenAIRE

    Bixby Mera, Sergio

    2014-01-01

    El presente estudio identifica los beneficios y ventajas de la utilización de impresoras 3D para la fabricación de productos industriales. Mediante el uso de impresoras 3D se diseña y elabora un amortiguador funcional. Se estudia y analiza nuevos materiales que pueden ser utilizados con impresoras 3D.

  19. El efecto del posicionamiento en la lealtad del cliente: Un análisis empírico para el caso de Iberdrola

    OpenAIRE

    Forcada Sainz, Francisco Javier; Hartmann, Patrick; Apaolaza Ibáñez, Vanesa

    2002-01-01

    [ES] En el presente trabajo se analiza la relación causal entre los conceptos de fidelidad del cliente y posicionamiento. Concretamente, se estudia el efecto diferenciado del posicionamiento percibido de una empresa en la lealtad de sus clientes, comprobando empíricamente dicha relación para el caso de Iberdrola.

  20. Permanencia y cambio en la cultura de las clases subalterna

    Directory of Open Access Journals (Sweden)

    Ricard Vinyes Ribas

    2000-04-01

    Full Text Available Este artículo analiza la pervivencia y formas de transmisión de la cultura subalterna en los movimientos sociales europeos a lo largo del siglo XX, y muestra que su rasgo político-cultural definitorio ha consistido en la construcción de instituciones democráticas colectivas.

  1. El factor emocional en la narrativa transmedia y la televisión social

    Directory of Open Access Journals (Sweden)

    Mª Adoración MERINO ARRIBAS

    2014-10-01

    Full Text Available Este artículo analiza el crecimiento de la televisión social y de la narrativa transmedia, debido al componente emocional que conlleva y a la variedad de plataformas que utiliza, logrando que la audiencia abandone su postura pasiva y se convierta en prosumidor de contenidos (Brian, 2012.

  2. Heliodoro peñasco pardo. El republicanismo radical como forma de vida

    OpenAIRE

    Valle Calzado, Ángel Ramón del

    2010-01-01

    Preámbulo a la reedición del libro publicado por Pedro Torres sobre el asesinato de Heliodoro Peñasco en 1913. Se hace un recorrido por la historia contemporánea de Argamasilla y se analiza la vida del abogado asesinado.

  3. Consideraciones teóricas sobre el desarrollo de la Inteligencia moral en niños y niñas

    OpenAIRE

    Castillo Briceño, Cristina

    2011-01-01

    El presente trabajo trata sobre el desarrollo de la inteligencia moral, y la trascendencia que tiene la familia y la escuela en este proceso. Esta temática se analiza a partir de los postulados de Coles (1997). Asimismo, se abordan los elementos constitutivos de la inteligencia moral y los procesos que contribuyen a la formación de la conciencia moral.

  4. Las políticas sociales durante el Neodesarrollismo. Estudios sobre el impacto de la Asignación Universal por Hijo.

    Directory of Open Access Journals (Sweden)

    Melina Morzilli

    2016-10-01

    Full Text Available Este trabajo expone un recorrido por los diversos estudios sobre el impacto de la Asignación Universal por Hijo en general y en la escolaridad y la salud en particular. Al mismo tiempo, analiza las distintas perspectivas desde donde fue abordado el tema. Por último, se realizan reflexiones finales intentando visualizar las dimensiones que no han sido estudiadas.

  5. El lugar del mythos en la ciencia moderna: una crítica a la idea neopositivista de “progreso racional” en la historia de las revoluciones científicas

    Directory of Open Access Journals (Sweden)

    Juan Manuel Sánchez Arteaga

    2007-01-01

    Full Text Available El artículo propone una revisión de las ideas habituales de > asociadas a la visión neopositivista de las revoluciones científicas. Se analiza el papel de la conceptualización mítica en dos de estas revoluciones: la mecanicista y la evolucionista.

  6. Perfiles de la integraci??n del extranjero

    OpenAIRE

    S??nchez Lorenzo, Sixto A.

    2009-01-01

    Este cap??tulo analiza los diversos ??mbitos de la integraci??n de los extranjeros (econ??mico, laboral, social, cultural y pol??tico). Contiene un estudio de las f??rmulas pol??ticas de integraci??n de los inmigrantes y de las claves del debate filos??fico-pol??tico en torno a la integraci??n de inmigrantes.

  7. Dinámica de objetos transplutonianos: resultados preliminares

    Science.gov (United States)

    Fernández, S.; Brizuela, H.; Roig, F.; Varela, O.

    Se presentan los resultados de una integración numérica de las ecuaciones de movimiento para objetos transplutonianos. Se han calculado los tiempos de Lyapunov para esos objetos y se analiza el comportamiento dinámico de los mismos.

  8. Perspectiva del derecho del medio ambiente y de políticas ambientales de la Unión Europea

    OpenAIRE

    Huici Sancho, Laura

    2011-01-01

    El artículo expone la actividad de las instituciones en el ámbito de la política europea de medio ambiente. Se analiza también el papel de la Unión Europea en materia de cambio climático y biodiversidad.

  9. Tratamiento psicológico de la fobia a la oscuridad en un contesto lúdico : un ensayo controlado

    OpenAIRE

    Méndez Carrillo, F. Xavier; Orgilés Amorós, Mireia; Espada Sánchez, José

    2003-01-01

    Se presentan los resultados de un trabajo que analiza cómo contribuye el juego a la eficacia del programa de escenificaciones emotivas en el tratamiento de la fobia a la oscuridad. Participaron 64 niños, de edades comprendidas entre 5 y 8 años, y una e

  10. Hip??tesis sobre una funci??n del carnaval

    OpenAIRE

    Fern??ndez Cuesta, Eliseo

    1988-01-01

    El art??culo analiza una serie de letrillas de las comparsas carnavalescas, como por ejemplo la del "entierro de la zorra", procedentes de varias localidades de la provincia de Granada. La hip??tesis defendida afirma que el carnaval es un instrumento de poder, a veces en manos del pueblo, pero que actualmente est?? siendo controlado por los ayuntamientos.

  11. Cuestionamientos internos e impugnaciones desde el flanco militar a la expedición botánica

    Directory of Open Access Journals (Sweden)

    José Antonio Amaya

    2004-01-01

    Full Text Available Se analiza el Proyecto de reorganización de la Expedición Botánica de FranciscoAntonio Zea (1766-1822 y el "Plan razonado de un cuerpo militar de ingenierosmineralógicos en el Nuevo Reino de Granada", elaborados a principios del sigloXIX. Se trata de dos

  12. La introducción y el cultivo de la rana toro (Rana catesbeiana. ¿Un atentado a la biodiversidad de México?

    Directory of Open Access Journals (Sweden)

    Gustavo Casas Andreu

    2001-01-01

    Full Text Available Se analiza el efecto que la introducción y el cultivo de la rana toro (Rana catesbeiana ha tenido en el ecosistema y la biodiversidad en México. Se recomienda el cultivo de especies nativas para sustituir a la rana toro.

  13. Resultados de FIV/ICSI en relación con la edad de la mujer. Unidad de Reproducción Humana Asistida del HUCA

    OpenAIRE

    2012-01-01

    El trabajo analiza los resultados de los ciclos de Fecundación In Vitro (FIV) e Inyección Intracitoplasmática de Espermatozoides (ICSI)en relación con la edad de la mujer. Se obtienen unas conclusiones que nos dan una información relevante en la práctica diaria de la Unidad.

  14. ESTRATEGIAS Y DESEMPEÑO DE LAS NUEVAS Y EMERGENTES EMPRESAS MULTINACIONALES MEXIANAS

    Directory of Open Access Journals (Sweden)

    José G. Vargas-Hernández

    2010-11-01

    Full Text Available El artículo analiza las nuevas empresas emergentes multinacionales mexicanas (MexEMNEs en el mercado global. Se analizan sus estrategias y desempeño para determinar perfiles y futuros escenarios de desarrollo. Se concluye que la innovación es clave para buscar ventajas y oportunidades en el cambio.

  15. El debido procedimiento administrativo

    Directory of Open Access Journals (Sweden)

    Enrique Rojas Franco

    2011-12-01

    Full Text Available El presente artículo analiza la manifestación y aplicación del debidoproceso como derecho y garantía de protección, y como principio esencialen el procedimiento administrativo, el cual está basado fundamentalmente enlas resoluciones de la Sala Constitucional costarricense y en la Corte Interamericanade Derechos Humanos.

  16. El amor y la muerte en El amor en los tiempos del cólera

    OpenAIRE

    Cifo González, Manuel

    2011-01-01

    En este artículo se analiza la presencia de los temas del amor y de la muerte en la novela El amor en los tiempos del cólera, de Gabriel García Márquz Material para la PAU de Murcia en la materia de Comentario de Texto

  17. EL SISTEMA POLITICO Y MOVIMIENTOS INDÍGENAS: EL CASO DEL EZLN

    OpenAIRE

    Asael Mercado Maldonado; Vicente González Hidalgo

    2009-01-01

    El presente artículo analiza la vinculación del EZLN con la situación miserable en que se encuentran millones de indígenas en México contra la ingobernabilidad neoliberal. Presentamos posibles soluciones al conflicto EZLN, y resumimos los logros alcanzados por los grupos étnicos en materia de democracia dentro del Estado mexicano.

  18. Ruptura del monopolio de los partidos políticos en la postulación de candidatos a cargos municipales de elección popular

    Directory of Open Access Journals (Sweden)

    Vinicio Mora Mora

    2006-07-01

    Full Text Available El presente trabajo analiza la posibilidad de eliminar el monopolio que ostentan los partidos políticos en la presentación de candidaturas para las elecciones municipales, así como permitir en éstas la postulación de candidaturas independientes

  19. Ruptura del monopolio de los partidos políticos en la postulación de candidatos a cargos municipales de elección popular

    OpenAIRE

    2006-01-01

    El presente trabajo analiza la posibilidad de eliminar el monopolio que ostentan los partidos políticos en la presentación de candidaturas para las elecciones municipales, así como permitir en éstas la postulación de candidaturas independientes

  20. Primena cost-benefit-benefit analize u vrednovanju i izboru javnih projekata (ekonomski aspekt

    Directory of Open Access Journals (Sweden)

    Dragana N. Petrović

    2013-10-01

    Full Text Available Cost-benefit analiza je celovita analiza koristi i troškova koje jedan projekat donosi samom vlasniku projekta i društvu u celini (uključujući i investitora. Izbor najbolje investicione alternative ostvaruje na osnovu finansijske i ekonomske analize, kao dva integralna dela cost-benefit analize. Prvu od ovih analiza obradila je ista grupa autora u članku „Primena cost-benefit analize u vrednovanju i izboru javnih projekata (finansijski aspekt“, objavljenom u prethodnom broju časopisa Vojnotehnički glasnik. Predmet obrade ovog rada je ekonomska analiza, kao logički nastavak prethodnog rada. Zbog toga se na brojne oznake tabela, uključenih u sadržaj finansijske analize (1-–5, nadovezuju (prema hronološkom redu oznake tabela koje pripadaju ekonomskoj analizi (6–8 Sprovođenje ekonomske analize ostvaruje se prema određenoj, dosta složenoj proceduri, a završava se utvrđivanjem kriterijuma ekonomske (društvene isplativosti projekta. U radu su obrađeni osnovni pokazatelji ekonomskog (društvenog prinosa projekta,  kao što su: neto sadašnja vrednost novčanih tokova i cost-benefit koeficijent.

  1. La transmisión de los derechos de propiedad intelectual derivados de la actividad investigadora realizada en la Universidad pública española

    Directory of Open Access Journals (Sweden)

    Rosalía Estupiñán Cáceres

    2014-12-01

    Full Text Available Este artículo analiza las luces y sombras de los procedimientos que prevé el ordenamiento jurídico español para la transmisión a terceros de los derechos de propiedad intelectual derivados de la actividad investigadora generada en el seno de las universidades públicas españolas.

  2. El tratamiento por parte de Naciones Unidas de la violación sexual a mujeres en los conflictos armados: las guerras en los Balcanes

    OpenAIRE

    Oion Encina, Rakel

    2000-01-01

    32 p. Este trabajo aborda la evolución de la normativa internacional sobre los Derechos Humanos y el Derecho Internacional Humanitario en cuanto al tratamiento de la violencia contra las mujeres y garantías de respeto de sus derechos humanos. En particular, se analiza el caso de la guerra en los Balcanes.

  3. El movimiento del derecho libre : una fuente de ideas que perviven hasta hoy en distintas teorías del derecho, incluso en el constituconalismo contemporáneo

    Directory of Open Access Journals (Sweden)

    José Ignacio Núñez Leiva

    2014-01-01

    Full Text Available Este trabajo analiza el Movimiento del Derecho Libre o Freirechtsbewegung. Revisa y sistematiza sus principales postulados, todo con la intención de revelar las semejanzas que existen entre ellos y teorías del Derecho contem - poráneas, especialmente aquellas surgidas al amparo del constitucionalismo contemporáneo.

  4. Lenguaje y cacoutopía en la novela 1984 de George Orwell

    OpenAIRE

    Maggiori, Luis

    2015-01-01

    El artículo analiza la novela 1984 de George Orwell, tomando como referencia las categorías lenguaje y cacoutopía, para de esta manera, estableciendo vinculaciones internas y externas a la obra y al contexto. Centro de Investigación en Lectura y Escritura (CILE)

  5. El proceso de profesionalización del trabajo social

    OpenAIRE

    María Cristina Salazar

    2006-01-01

    En este artículo se analiza el significado de la profesionalización del trabajo social en el país, a partir del estudio sobre qué es una profesión, cuáles son las características y condiciones del proceso de profesionalización, y los requisitos que deben

  6. Estudio empírico del componente léxico en materiales pedagógicos de inglés y de español como lenguas no maternas (L2)

    OpenAIRE

    López Jiménez, María Dolores

    2009-01-01

    El presente trabajo de investigación analiza diversos aspectos relacionados con el vocabulario en libros de texto de inglés y de español como L2, con especial atención al tratamiento dado a las áreas de interés mencionadas anteriormente y a la aplicación

  7. La espectacularización de la noticia en los medios de comunicación

    OpenAIRE

    Gómez Durán, Inés Mercedes

    2014-01-01

    Se analiza el tratamiento de la información que han realizado diversos medios de comunicación españoles sobre un caso concreto: la trágica muerte una familia de Alcalá de Guadaira (Sevilla), el 14 de diciembre de 2013

  8. Integración económica: barreras que limitan la evolución del T.L.C.A.N. hacia una unión económica

    Directory of Open Access Journals (Sweden)

    Juan José Gómez Martínez

    2013-07-01

    Full Text Available Esta investigación se analiza y se compara al Tratado de Libre Comercio de América del Norte y la Unión Europea, dándole importancia a las deficiencias de cada tratado y como mejorar para tener un balance.

  9. LA HUMANIZACIÓN DE LA FORMACIÓN EN ORGANIZACIONES DE PRESTACIÓN DE SERVICIOS CASO: LA GERENCIA DE LA MUERTE

    Directory of Open Access Journals (Sweden)

    Ana María Romano Sosa

    2015-04-01

    Este artículo analiza brevemente las diferencias entre ambos esquemas de adiestramiento y propone claves para incorporar a los actuales modelos de formación técnica elementos de desarrollo personal orientados a la humanización de la prestación de servicios

  10. La región de la triple frontera: territorios de integración y desintegración

    OpenAIRE

    Fogel,Ramón

    2008-01-01

    En el articulo se analiza la triple frontera (Foz de Iguazú, Puerto Iguazu e Ciudad del Elste) como territorio construido, apropriado y controlado por actores, algunos extra regionales. Estos actores mantienen vínculos entre si que implican relaciones de poder, y están involucrados en actividades y procesos con incidencia en la integración regional.

  11. La producción de noticias, un acercamiento a la percepción, conocimiento y visión de la política mexicana y el proceso electoral federal del 2003 de los periodistas

    Directory of Open Access Journals (Sweden)

    Karla A. Planter Pérez

    2004-01-01

    Full Text Available En este artículo, la autora analiza, en el marco del proceso electoral federal del 2003, los criterios, conocimientos, percepciones, filias y/o fobias, a partir de los cuales los periodistas construyen y/o modifican un producto informativo a ser publicado en el medio de comunicación en el que laboran.

  12. Economía y democracia: una revisión desde la participación y la libertad humanas

    OpenAIRE

    Peñas Felizzola, Olga Luz

    2010-01-01

    El ensayo analiza las relaciones entre los dos conceptos articuladores: economía y libertad. Para ello desarrolla una serie de planteamientos en torno a los conceptos y coincidencias de la economía y la democracia; y la Libertad y la participación como expresiones de la articulación entre desarrollo económico y democracia.

  13. Estados Unidos – Cuba : historia de un embargo : análisis del cambio a través de los titulares en prensa

    OpenAIRE

    Cristina Millán Regueira

    2015-01-01

    Se analiza la historia de las relaciones entre Estados Unidos y Cuba, desde la victoria de la Revolución en Cuba hasta la actualidad y las noticias o reportajes que se publicaron en varios medios de diferentes países de Latinoamérica, Estados Unidos y Europa

  14. Dimensiones cognitivo-motivacionales y aprendizaje autorregulado

    OpenAIRE

    1996-01-01

    El artículo analiza el aprendizaje escolar donde una perspectiva cognitivo- motivacional, en la que se destacan una serie de ideas relevantes de profundizar en la comprensión de los factores cognitivo-motivacionales que inciden en el aprendizaje escolar.

  15. La religión y el debate político en El Ecuador

    OpenAIRE

    Camino, Juan Francisco

    2013-01-01

    [ES] Este ensayo analiza la identificación religiosa de los ciudadanos ecuatorianos y sus élites legislativas, vinculándola a su influencia en el debate público en temas como la despena-lización del aborto, la legalización de las drogas y el matrimonio igualitario.

  16. El duelo migratorio

    OpenAIRE

    Valentín González Calvo.

    2005-01-01

    La inmigración conlleva una enorme cantidad de pérdidas. No siempre se analiza el fenómeno dela inmigración desde una perspectiva individual, centrándose especialmente en la persona, en los sufrimientos que comporta dejar el país de origen e intentar inte

  17. El duelo migratorio

    Directory of Open Access Journals (Sweden)

    Valentín González Calvo.

    2005-01-01

    Full Text Available La inmigración conlleva una enorme cantidad de pérdidas. No siempre se analiza el fenómeno dela inmigración desde una perspectiva individual, centrándose especialmente en la persona, en los sufrimientos que comporta dejar el país de origen e intentar inte

  18. Epidemia de coqueluche (tos ferina en 1910 en Villardefrades (Valladolid

    Directory of Open Access Journals (Sweden)

    Francisco Feo Parrondo

    2010-01-01

    Full Text Available Se analiza la epidemia de coqueluche (tos ferina en Villardefrades (Valladolid hace un siglo, en 1910, afectando fundamentalmente a los niños de uno a cuatro años, existiendo notables discrepancias entre los médicos de la época sobre los medios adecuados para combatirla.

  19. Epidemia de coqueluche (tos ferina)en 1910 en Villardefrades (Valladolid)

    OpenAIRE

    Francisco Feo Parrondo

    2010-01-01

    Se analiza la epidemia de coqueluche (tos ferina) en Villardefrades (Valladolid) hace un siglo, en 1910, afectando fundamentalmente a los niños de uno a cuatro años, existiendo notables discrepancias entre los médicos de la época sobre los medios adecuados para combatirla.

  20. Aplicación de algoritmos genéticos en la planificación de redes de telefonia celular

    OpenAIRE

    Figueroa de la Cruz, Mario M.; Zakour, José; Juarez, Gustavo; Ibarra, Daniel

    2007-01-01

    Este trabajo analiza la problemática que tiene la planificación celular considerando el crecimiento y la evolución hacia nuevas tecnologías proponiendo como alternativa de planificación el uso de algoritmos de Inteligencia Artificial como son los Algoritmos Genéticos.

  1. Transparencia y acceso a la información

    OpenAIRE

    Mangas, Araceli

    2016-01-01

    Este trabajo analiza la transparencia en la propuesta de las normas por la Comisión Europea y en su posterior aprobación por el Parlamento y el Consejo de la Unión Europea. También expone el acceso a los documentos de la UE.

  2. LIGADURA DE LAS ARTERIAS ILIACAS INTERNAS (HIPOGASTRICAS) EN CIRUGIA OBSTETRICA

    OpenAIRE

    Torres A,Octavio; Bueno N,Francisco; González R,Reinaldo; Bronda M.,Alessandro

    2002-01-01

    Se presentan diez casos de ligadura de arteria hipogástrica de causa obstétrica. Describimos la técnica, se analiza las indicaciones, riesgos y complicaciones quirúrgicas. El procedimiento fue efectivo en controlar la hemorragia en todos los casos. La principal indicación fue la inercia uterina.

  3. Libertad económica, crecimiento y convergencia

    OpenAIRE

    Fernández Cornejo, José Andrés

    1997-01-01

    Trabajo que analiza el papel fundamental que puede jugar una "buena política económica" a la hora de explicar los fenómenos de crecimiento a largo plazo y convergencia real para llevar a cabo un proceso de apertura y liberalización de la economía

  4. ¿Qué debo recordar? Los historiadores y la configuración de la memoria

    OpenAIRE

    Bermejo-Barrera, J.C. (José Carlos)

    2002-01-01

    En este trabajo, partiendo de la teoría de los actos del habla, se plantea el problema de la memoria colectiva. Dentro de este campo se analiza más específicamente cómo los historiadores contribuyen al proceso social de creación de la memoria, ilustrándolo en diferentes épocas.

  5. Obstáculos para el acceso a la justicia en casos de discriminación étnica-racial

    OpenAIRE

    Javier CHINCHÓN ÁLVAREZ; Ramírez, Javier

    2007-01-01

    Este trabajo repasa y analiza los distintos obstáculos, detectados sobre la base del extenso estudio del Projecto ACODI, que las víctimas de casos de discriminación étnica/racial encuentran a la hora de acceder al sistema de justicia española.

  6. La trayectoria de las reformas del Estado

    Directory of Open Access Journals (Sweden)

    Luis Ibarra

    2007-01-01

    Full Text Available Este artículo analiza los conflictos en torno a las reformas del Estado. Argumenta que las luchas políticas produjeron, no solo continúas variantes estratégicas, sino que condujeron también a la constitución de proyectos antagónicos.

  7. Introducción al proyecto de declaración de las Naciones Unidas sobre los derechos de los pueblos indígenas

    Directory of Open Access Journals (Sweden)

    Marta Méndez Díaz

    2006-05-01

    Full Text Available Este artículo analiza pormenorizadamente el articulado del Proyecto de Declaración sobre los Derechos de los Pueblos Indígenas, su proceso de elaboración y el contexto internacional en el que se enmarca.

  8. Condrosarcoma de la tibia con metástasis al sistema nervioso central

    OpenAIRE

    Toro G., Gabriel; Suárez C., Héctor A.; Mena R., Hernando

    2011-01-01

    Se analiza el caso de un hombre de 48 años de edad con condrosorcoma de la tibia derecha que dio metástasis al lóbulo occipital izquierdo. Encontramos en nuestra parcial revisión bibliográfica que solamente Talerman en 1970 comunicó un caso semejante.

  9. Genetic Diversity of Brown Trout Populations Using Mitochondrial Markers In Relatively Similar Geographical and Ecological Conditions – a Carpathian Case Study

    Directory of Open Access Journals (Sweden)

    Popa Gina-Oana

    2013-12-01

    Full Text Available Analiza diversităţii genetice cu ajutorul markerilor mitocondriali, a unor populaţii de păstrav comun aflate în condiţii geografice şi ecologice relativ similare în Munţii Carpaţi.

  10. El derecho fundamental a la libertad física: reflexiones a partir de la Constitución, el Código Procesal Penal y la jurisprudencia del Tribunal Constitucional

    Directory of Open Access Journals (Sweden)

    Luis Alberto Huerta Guerrero

    2010-12-01

    Full Text Available El autor analiza lo dispuesto en la Constitución Política de 1993, así como en la jurisprudencia del Tribunal Constitucional peruano, incluyendo algunos artículos del Código Procesal Penal de 1991 del 2004.

  11. Presencia de los repositorios digitales de la UNMSM en Google Scholar: 2005-2015

    OpenAIRE

    Alhuay-Quispe, Joel

    2016-01-01

    Este artículo analiza la presencia de los repositorios digitales de la UNMSM en el buscador académico Google Scholar a partir de la identificación de la cantidad de citas y documentos indexados por cada repositorio y publicados entre 2005-2015. Los repositorios estudiados son Ateneo, Cybertesis y Revistas de Investigación.

  12. Los periódicos gratuitos después de la crisis

    NARCIS (Netherlands)

    Bakker, P.

    2010-01-01

    En este artículo se analiza cómo la prensa gratuita se ha visto gravemente afectada por la crisis financiera global. En el texto, se pone de manifiesto la vulnerabilidad económica de este tipo de medios en comparación con otros. Sin embargo, la reciente sacudida que ha sufrido este tipo de prensa, n

  13. Where is the dividing line? The case of Spanish civil procedure

    OpenAIRE

    2009-01-01

    En el artículo se analiza hasta qué punto la división tradicional entre sistemas procesales de civil law y sistemas procesales de common law está bien definida, teniendo en cuenta las dudas que, respecto de algunos elementos, podría suscitar un sistema propio del Derecho continental, como el español

  14. a través del Rorschach

    Directory of Open Access Journals (Sweden)

    Guillermo Delahanty

    2006-01-01

    Full Text Available Se analiza el registro del material de Rorschach de un paciente esquizofrénico para mostrar el tipo de respuestas de barrera y penetración que proporciona el índice de perturbación en su esquema corporal.

  15. Literatura y esquizofrenia: en torno a Las Rubáiyátas de Horacio Martín de Félix Grande

    OpenAIRE

    Mora Contreras, Francisco Javier

    2000-01-01

    Artículo que analiza las conexiones entre la creatividad y la esquizofrenia en el marco de la poesía autobiográfica y, más concretamente, sobre Las Rubáyatas de Horacio Martín, de Félix Grande.

  16. La (escasa influencia de la antropología en la toma de decisiones relativas a las migraciones en el ámbito internacional

    Directory of Open Access Journals (Sweden)

    David Martín-Castro

    2007-09-01

    Full Text Available Este texto analiza la escasa influencia que tienen los antropólogos tanto en la definición de las agendas como en el contenido de las políticas y normas internacionales en el ámbito de las migraciones. Para ello, utiliza algunos ejemplos de eventos recientes.

  17. Arcos de la Frontera. Recursos humanos y econ??micos

    OpenAIRE

    Gonz??lez Cid, Mar??a Luisa

    1984-01-01

    Breve aproximaci??n a ciertos rasgos caracter??sticos de un pueblo de la provincia de C??diz: Arcos de la Frontera. Analiza la evoluci??n demogr??fica (1900-1980), la emigraci??n, los principales recursos econ??micos y la distribuci??n de la propiedad agr??cola.

  18. La dinámica de la confianza: comunicación, acción y terceras partes

    OpenAIRE

    Bart Nooteboom

    2010-01-01

    Después de aclarar la noción de confianza, este escrito analiza los fundamentos de la confianza y el papel de la franqueza y la comunicación, las acciones y las terceras partes en la construcción, ruptura y reparación de la confianza.

  19. ASPECTE REGLEMENTATIVE ŞI PRACTICE PRIVIND PROTECŢIA COPILULUI ÎN ROMÂNIA

    Directory of Open Access Journals (Sweden)

    Mihaela Tofan

    2013-11-01

    Full Text Available Protectia sociala a copiilor, conditie obligatorie a economiei sociale, este un subiect de analiza teoretica si practica opportun pentru sistemul de drept roman. Abordarea cadrului reglementativ in vigoare si urmarirea impactului practic al efectelor pe care le genereaza normele de drept, pot conduce la concluzii privind imbunatatireasi perfectionarea institutiilor si mecanismelor care sprijina functionarea coerenta a economiei sociale.

  20. Estudio sobre la Inserción de la Gestión Ambiental en las Políticas Sectoriales: Colombia

    OpenAIRE

    Banco Interamericano de Desarrollo (BID)

    2002-01-01

    Este estudio analiza la inserción de la política ambiental en las políticas sectoriales para el caso de Colombia. Nuestro foco de interés son el sector industrial manufacturero y el sector energético.

  1. Del ocio al neg-ocio... y otra vez al ocio

    OpenAIRE

    1997-01-01

    A través de la historia del pensamiento social se analiza el binomio ocio/negocio en términos de actividad y tiempo. Through the history of social thought the dicotomic relationship between leisure and business is analysed in terms of activity and use of time.

  2. Liderazgo político femenino y medios de comunicación: Buenas prácticas y recomendaciones para la cobertura de la información

    Directory of Open Access Journals (Sweden)

    Thais Aguilar Zúñiga

    2017-01-01

    Full Text Available Analiza la cobertura mediática a los liderazgos femeninos en la política y la incidencia de los medios de comunicación en la consolidación de una imagen positiva y en la sana crítica del papel de la mujeres en los puestos de liderazgo.

  3. Coyuntura electoral 2005-2006: Lecciones aprendidas desde la perspectiva de la organización de los procesos electorales y la resolución de conflictos en Centroamérica y Panamá

    Directory of Open Access Journals (Sweden)

    Luis Antonio Sobrado González

    2008-01-01

    Full Text Available Analiza los eventos electorales del 2005 y el 2006 en Centroamérica y Panamá. Interesa cómo fueron atendidos por los organismos electorales, aún en escenarios de fuerte conflictividad postelectoral producto de resultados ajustados u otras circunstancias especiales, lo que constituyó un factor de afianzamiento institucional.

  4. El movimiento del Software Libre en Cuba

    Directory of Open Access Journals (Sweden)

    Héctor Rodríguez Figueredo

    2011-10-01

    Full Text Available Se describe el movimiento de Software Libre y estándares abiertos de software en Cuba, su surgimiento y evolución hasta la fecha. Se analiza además la necesidad de incorporarlo en el proceso de informatización de la sociedad cubana y lo que ha venido haciéndose en ese sentido.

  5. CONFLICTOS INDIVIDUALES DE SEGURIDAD SOCIAL. LOS DESACIERTOS DE LA REFORMA LABORAL

    OpenAIRE

    2014-01-01

    El presente artículo analiza el aspecto procesal de los conflictos individuales de seguridad social, su indebida regulación en la Ley Federal del Trabajo y la incompetencia de la autoridad que los resuelve, siendo éstos dos últimos los principales desaciertos procesales de la reforma laboral de 2012.

  6. La violencia en Colombia: inercias y novedades1945-1950,1985-1988

    Directory of Open Access Journals (Sweden)

    Medófilo Medina

    2008-01-01

    Full Text Available El autor analiza dos etapas de violencia o más propiamente la violencia en dos coyunturas de la historia contemporánea de colombia: la segunda mitad de los años cuarenta y la segunda de los ochenta. ambos momentos presentan un perfil de auge económico. As

  7. Los medios ante la crisis

    OpenAIRE

    Restrepo, Javier Dario

    1995-01-01

    La ponencia analiza el papel que los medios de comunicación deben cumplir en la actual crisis política que atraviesa Colombia. La actual crisis permite poner en duda la capacidad de los medios para encontrar y difundir solola verdad.

  8. La depresión en la infancia desde la perspectiva de las taxonomías empíricas

    OpenAIRE

    1998-01-01

    En este trabajo se analiza la depresión infantil desde el modelo de taxonomías empíricas propuesto por Achenbach y Edelbrock. Se revisan algunos aspectos diferenciales en el diagnóstico de la depresión en menores y adultos. La parte empírica se cent

  9. Sobre el principio de Symploké en El Sofista de Platón y los conceptos conjugados de reposo y movimiento

    OpenAIRE

    Armesilla Conde, Santiago Javier

    2013-01-01

    Se analiza la importancia de las ideas filosóficas de reposo y movimiento en El Sofista de Platón y su relación en el campo gnoseológico de la ciencia Física como conceptos conjugados en el materialismo filosófico de Gustavo Bueno.

  10. EL DERECHO PROCESAL CONSTITUCIONAL A INICIOS DEL SIGLO XXI EN AMÉRICA LATINA

    Directory of Open Access Journals (Sweden)

    Humberto Nogueira Alcalá

    2009-01-01

    Full Text Available A través del presente artículo se analiza la emergencia y desarrollo del derecho procesal constitucional en latinoamérica y su estado actual desde la perspectiva de su desarrollo académico, el debate sobre sus contenidos y su interdependencia o autonomía respecto del derecho procesal y del derecho constitucional.

  11. Evolución constructiva de San Ginés de la Jara y propuesta arquitectónica de recuperación.

    OpenAIRE

    Sánchez Medrano, Francisco José

    2012-01-01

    El artículo analiza las etapas constructivas del monasterio de San Ginés de la Jara (Cartagena, Murcia) desde su fundación en el siglo XIII hasta la actualidad. Asimismo, presenta una propuesta de restauración arquitectónica y las actuaciones parciales que se han realizado entre 2004 y 2012.

  12. El buen vivir: de los genes a la práctica

    OpenAIRE

    2009-01-01

    El autor analiza los hallazgos de las últimas investigaciones en torno a las variables asociadas con la felicidad y el bienestar, con especial hencapié en las características de personalidad y la capacidad de adaptación. Universidad de Málaga. Campus de Excelencia Internacional Andalucía Tech

  13. El diferencial semántico del diseño gráfico de la identidad visual de los Juegos Olímpicos de Río de Janeiro frente a los de Londres

    OpenAIRE

    Martín Rodilla, Isabel

    2013-01-01

    Se estudia y analiza la entidad visual de los Juegos Olímpicos de Londres y los de Río de Janeiro. La percepción que tiene el público de estas dos entidades visuales diferentes mediante la técnica de comparación de Osgood

  14. La gestión del agua en la Región Texcoco, Estado de México

    Directory of Open Access Journals (Sweden)

    Alejandro Alejo Pompilio Aguilar Miranda

    2011-01-01

    Full Text Available Este artículo analiza la gestión del agua para el uso público urbano en los municipios de la Región Texcoco. Describe sus actores, procesos e instituciones, así como las relaciones que se fincan entre estos elementos.

  15. ¿Una verdad cómoda?: el espectro de la catástrofe ambiental global y el desarrollo sostenible en China

    NARCIS (Netherlands)

    M. Arsel (Murat)

    2010-01-01

    textabstractRESUMEN Desde un punto de vista crítico, este artículo analiza los debates relativos a la sostenibilidad del desarrollo chino. Concretamente, aborda el doble argumento de que el desarrollo en China no es sostenible y de que representa una amenaza directa a la seguridad medioambiental del

  16. EL VALOR ASIGNADO POR LA JURISPRUDENCIA DEL TRIBUNAL CONSTITUCIONAL A LA JURISPRUDENCIA DE LA CORTE INTERAMERICANA DE DERECHOS HUMANOS

    Directory of Open Access Journals (Sweden)

    Liliana Galdámez Zelada

    2014-01-01

    Full Text Available Este trabajo analiza la invocación de la jurisprudencia de la Corte Interamericana de Derechos Humanos por parte del Tribunal Constitucional de Chile, una de las obligaciones promovidas por la Corte IDH a partir del llamado control de convencionalidad. En este trabajo se dará seguimiento a estos desarrollos y se adelantarán algunas conclusiones.

  17. Corte Interamericana de Derechos Humanos

    Directory of Open Access Journals (Sweden)

    Carlos M. Ayala Corao

    2007-01-01

    Full Text Available El autor analiza en el presente artículo el tema de la ejecución de las sentencias dictadas por la Corte Interamericana de Derechos Humanos en los Estados parte, considerando la jurisprudencia de la propia Corte Interamericana y la evolución habida sobre la materia y la legislación de los Estados parte.

  18. Las guerrillas liberales de los años 50 y 60 en el Quindío

    Directory of Open Access Journals (Sweden)

    Carlos Miguel Ortíz

    2012-08-01

    Full Text Available Analiza el surgimiento de las "guerrillas" liberales quíndianas como efecto de la persecusión oficial y de el desplazamiento de campesinos que ven en estas organizaciones la única forma de defensa frente a la presión del Estado y los terratenientes.

  19. Clientelismo y Familias en Acción: una mirada desde lo local

    Directory of Open Access Journals (Sweden)

    Mónica Barrios González

    2011-11-01

    Full Text Available Este artículo analiza la estructuración de redes clientelares en la implementación del programa Familias en Acción como espacios para la acumulación de capital simbólico y político en beneficio de actores internos y externos al programa.

  20. Estabilidad de algunos criterios de selección de modelos

    OpenAIRE

    1996-01-01

    En este artículo se comparan nueve criterios de selección de modelos. Se analiza si el número de criterios influye en la selección. Se estudia la estabilidad y robustez de la selección. La comparación se lleva a cabo mediante simulación.

  1. Análisis dinámico no lineal físico y geométrico de barras: Discusión del campo de aplicación de teorías aproximadas

    OpenAIRE

    Möller, Oscar; Rubinstein, Marcelo

    1995-01-01

    Se analiza el comportamiento de barras con material elastoplástico, bajo la acción de cargas transversales aplicadas en forma estática o dinámica. Se evalúa el campo de aplicación de teorías aproximadas de flexión de vigas y cables Peer Reviewed

  2. Estudio empírico de los enfoques de aprendizaje de los estudiantes universitarios en función del perfil de su titulación (profundo VS superficial) = Empirical research on university students’ learning approaches depending on the degree undertaken (de

    OpenAIRE

    Hernández Pina, Fuensanta; García, Mª P.; Maquilón, J. J.

    2001-01-01

    En la presente investigación se trata de estudiar, en primer lugar, a partir del análisis factorial los items que mejor definen los enfoques de aprendizaje -motivos y estrategias-de los estudiantes universitarios. En segundo lugar, se analiza la actuaci

  3. Nociones fundamentales de la Teoría de los Campos Conceptuales

    Directory of Open Access Journals (Sweden)

    María Rita Otero

    2011-07-01

    Full Text Available En este trabajo se desarrollan algunas de las nociones centrales de la teoría de Vergnaud y se discuten algunos ejemplos. Se analiza en detalle la noción de esquema y se discuten algunas vinculaciones con la didáctica de la matemática.

  4. " Viva M xico/Viva la Revoluci n ". One hundred years of Popular/Protest Songs: The Heartbeat of a Collective Identity

    Directory of Open Access Journals (Sweden)

    Lois Marie Jaeck

    2001-01-01

    Full Text Available Los corridos son un ejemplo de comunicar vivencias, como el amor a la nación. En este artículo se analiza el vínculo entre el corrido de la época de la Revolución Mexicana y algunas canciones populares mexicanas de protesta de los años noventa.

  5. Apuntes sobre la gestión del conocimiento en organizaciones

    OpenAIRE

    Plaza-Angulo, Juan J.

    2015-01-01

    La gestión del conocimiento es el conjunto de actividades que fomentan, coordinan y desarrollan el conocimiento que dentro de una organización posibilitan el logro de sus objetivos. El presente manual describe y analiza los principales conceptos y teorías que nos acercan al estudio de esta materia, ofreciendo las claves para entenderla y aplicarla.

  6. La propuesta de generalización del voto divergente

    OpenAIRE

    Sánchez-Calero Guilarte, Juan

    2014-01-01

    El fraccionamiento del derecho de voto de un mismo accionista como presupuesto de su voto divergente se incorpora a los trabajos de reforma del Derecho de sociedades de capital. Este trabajo analiza la evolución normativa y apunta algunas cuestiones sobre el voto divergente.

  7. Revisión histórica y análisis epidemiológico del VIH_SIDA

    OpenAIRE

    Macías Merayo, Noé

    2015-01-01

    Se realiza un estudio sobre la aparición y evolución del VIH y el impacto socioeconómico y político que desencadenó. También se analiza el presente y futuro de la enfermedad desde un punto de vista epidemiológico y curativo

  8. Higiene industrial y ergonomía. Aplicación de métodos ergonómicos

    OpenAIRE

    Jiménez Zabaleta, Itziar

    2015-01-01

    Este trabajo fin de carrera analiza los siguientes aspectos: prevención de riesgos laborales; marco normativo y plan de prevención; higiene industrial; ergonomía y psicosociología; métodos ergonómicos y su aplicación.

  9. La Persistencia de la Pobreza Rural en Honduras, Nicaragua y Bolivia: un Fracaso del Neoliberalismo

    NARCIS (Netherlands)

    C. Kay (Cristóbal)

    2009-01-01

    textabstractLos documentos de estrategia de lucha contra la pobreza, preparados por los gobiernos mediante un proceso en el que participan instituciones internacionales y actores de la sociedad civil, no dieron los resultados previstos. El artículo analiza los casos de Honduras, Nicaragua y Bolivia

  10. Avances a los diez años de vigencia de la Ley del Procedimiento Administrativo General

    Directory of Open Access Journals (Sweden)

    Milagros Maraví Sumar

    2011-12-01

    Full Text Available En el artículo, la autora analiza lo ocurrido en estos diez años con respecto a temas como los principios del procedimiento administrativo, la simplificación administrativa, los procedimientos sancionadores, el contro ldifuso en sede administrativa y el silencio administrativo.

  11. Valoración del tratamiento fisioterapeútico previo a la reconstrucción del ligamento anterior de la rodilla. Revisión bibliográfica

    OpenAIRE

    Arribas Anteportamlatinam, Vanessa

    2013-01-01

    Este trabajo es una revisión bibliográfica que analiza el estado óptimo en que debe estar la rodilla antes de la reconstrucción del ligamento cruzado anterior y los beneficios de la fisioterapia para poder conseguirlo.

  12. Urbanoticias

    OpenAIRE

    Alfredo Palacios Barra

    2015-01-01

    • Plan Regional de Desarrollo Urbano (Prdu). • Premio Ciudad de Concepción a la mejor obra de "Arquitectura y Urbanismo" año 2000. • Estacionamientos subterráneos en el centro de la ciudad. • Entrega de Premios de Proyectos "Portal Bicentenario" en Santiago. • Directorio Urbano de Concepción analiza Proyecto Costanera.

  13. Mujer inmigrante: de Nicaragua a Costa Rica

    OpenAIRE

    2016-01-01

    Este artículo analiza el proceso migratorio de la mujer nicaragüense en Costa Rica. Se hace un recuentohistórico del fenómeno migratorio femenino nicaragüense; así como expone el caso de la inmigración enla región pacífica, del país.

  14. fisonomía y las atribuciones del Tribunal Constitucional

    Directory of Open Access Journals (Sweden)

    Lautaro Ríos Álvarez

    2005-01-01

    Full Text Available El artículo analiza la transferencia del recurso de inaplicabilidad por inconstitucionalidad de competencia hasta ahora de la Corte Suprema de Justicia al Tribunal Constitucional, considerando sus implicancias en el sistema de control de constitucionalidad y las innovaciones que ello implica en nuestro ordenamiento jurídico.

  15. Evolución de las destrezas básicas para el cálculo y su influencia en el rendimiento escolar en matemáticas

    OpenAIRE

    Hidalgo, Santiago; Maroto, Ana; Palacios, Andrés

    1999-01-01

    Los factores que determinan el rendimiento escolar de matemáticas son diversas. En el presente artículo se analiza la importancia que a este respecto, tienen ciertas aptitudes básicas y se estudia su versión en los últimos años en una muestra escolar de tercer ciclo de primaria.

  16. La investigación en gestión de la cadena de suministro a nivel mundial

    Directory of Open Access Journals (Sweden)

    Luz Mary Nova Caldas

    2010-07-01

    Full Text Available Este artículo analiza el estado del arte en relación con la investigación sobre gerencia de la cadena de suministro. Se hace particular énfasis en las variables estudiadas y los principales resultados obtenidos. Varias encuestas aplicadas alrededor del mundo son analizadas para identificar patrones en este tema.

  17. Emprendimiento: diferentes aproximaciones

    OpenAIRE

    Rodrigo, Zárate; Argüelles Pabón, Denise Caroline; Parra, León Darío; Argote C., Milenka; Salcedo P., Carlos; Ibarra M., Alberto; Aparicio G., Santiago; Matiz, Francisco

    2013-01-01

    La Universidad EAN pionera en Colombia por liderar proyectos emprendores, presenta el libro Emprendimiento: diferentes aproximaciones, el cual a partir de la experiencia de varios académicos, analiza algunas teorias sobre liderazgo, vinculadas a temas relacionados con el inicio de nuevas empresas. Las herramientas aquí proporcionadas, son un aporte al conocimiento para su aplicación en las organizaciones.

  18. Trastorno por déficit de atención con hiperactividad, evolución en dimensiones clínicas, cognitivas, académicas y relacionales

    OpenAIRE

    2004-01-01

    El estudio analiza el desarrollo a través de la edad de dimensiones clínicas, cognitivas, académicas y relacionales en casos clínicos de Trastorno por Déficit de Atención con Hiperactividad (TDAH).

  19. Dimensiones cognitivo-motivacionales y aprendizaje autorregulado

    Directory of Open Access Journals (Sweden)

    Antonio Valle Arias

    1996-06-01

    Full Text Available El artículo analiza el aprendizaje escolar donde una perspectiva cognitivo- motivacional, en la que se destacan una serie de ideas relevantes de profundizar en la comprensión de los factores cognitivo-motivacionales que inciden en el aprendizaje escolar.

  20. El "PNBpm" en el sistema de recursos propios cominitarios

    OpenAIRE

    Alfonso Utrilla de la Hoz

    1989-01-01

    El trabajo aquí presentado analiza las lineas generales de la reforma del sistema de recursos propios de la Comunidad Económica Europea, centrándose en el estudio del Producto Nacional Bruto a precios de mercado como nuevo componente del presupuesto de ingresos comunitarios.

  1. Nuevas oportunidades y viejos circunloquios de la Corte Internacional de Justicia: A propósito de la legítima defensa (preventiva) en la historia de una violación grave de la prohibición del uso de la fuerza que no quiso ser llamada agresión. La sentencia de la Corte Internacional de Justicia de 19 de diciembre de 2005 en el asunto relativo a las actividades armadas en el territorio del Congo (República Democrática del Congo c. Uganda)

    OpenAIRE

    Chinchón Álvarez, Javier

    2010-01-01

    En esta contribución se analiza la sentencia de la Corte Internacional de Justicia de 19 de diciembre de 2005 en el asunto relativo a las actividades armadas en el territorio del Congo (República Democrática del Congo c. Uganda).

  2. Ética y gerencia de organizaciones

    OpenAIRE

    Bernardo Kliksberg

    2003-01-01

    El autor analiza el "vacío ético" en el que se encuentran varias sociedades latinoamericanas, la relación de la ética con el liderazgo directivo y el diseño de las políticas económicas y sociales en la asignación de los recursos de las organizaciones.

  3. Relaciones internacionales (RRII) entre economías subterráneas o ilícitas (ESoL) narcoviolentas en Colombia y México y la incidencia de las políticas estatales de EE. UU. 1990-2014

    OpenAIRE

    2014-01-01

    Estudio comparativo de variable cultural que analiza los fenómenos y organizaciones trasnacionales narcoviolentas en Colombia y México y la condicionalidad que refieren las pautas imperativas de las políticas estatales antinarcóticas estadounidenses desde 1990 a 2014. Facultad de Ciencias Jurídicas y Sociales

  4. Las megaciudades y la transición urbana

    Directory of Open Access Journals (Sweden)

    Heriberta Castaños Lomnitz

    2005-01-01

    Full Text Available En este artículo, la autora analiza los factores tanto favorables como adversos que intervienen en los procesos de urbanización y en los problemas de sustentabilidad de la población mundial en general y de la zona conurbada de la ciudad de México en particular.

  5. Posicionamiento Web y dinámicas de información en motores de búsqueda: propuestas de análisis y estudio comparativo de visibilidad de contenidos digitales en el caso de procesos electorales

    Directory of Open Access Journals (Sweden)

    Carlos Gonzalo Penela

    2015-11-01

    Full Text Available La metodología propuesta analiza la composición de los resultados de búsquedas electorales y categoriza los sitios web siguiendo una ontología basada en el modelo de Infoesfera propuesto por W.L.Bennet, permitiendo así el análisis de resultados de Google durante elecciones.

  6. Beethoven y la revolución francesa

    OpenAIRE

    Massin, Jean; Massin, Brigitte

    2009-01-01

    Artículo que analiza la producción de Beethoven, a partir de su adhesión a los principios de la Revolución francesa. Este ensayo fue publicado en el N° 40 de la Revista L'Arc, dedicado íntegramente a Beethoven. Traducción de Julio Sánchez Reyes.

  7. R. D. Laing: un “rebelde” que desafió el orden psiquiátrico imperante.

    Directory of Open Access Journals (Sweden)

    Francisco Balbuena Rivera

    2011-01-01

    Full Text Available En este trabajo se analiza el pensamiento de R. D. Laing, uno de los padres del llamado movimiento antipsiquiátrico, para quien la locura conformaba una reacción racional frente a la sinrazón y el envilecimiento tecnológico del hombre.

  8. FACTORES ASOCIADOS AL GRADO SINTOMATOLÓGICO DEL SÍNDROME DE BURNOUT EN LOS ESTUDIANTES ENFERMEROS DE LA SEGUNDA ESPECIALIDAD DEL CENTRO QUIRÚRGICO DE LA FACULTAD DE ENFERMERÍA DE LA UCSM. AREQUIPA, 2013

    OpenAIRE

    LECAROS OLAECHEA, GERALDINE DELIA

    2016-01-01

    SÍNDROME DE BURNOUT ¿CÓMO SE ANALIZA EL SÍNDROME DE BURNOUT? MANIFESTACIONES CLÍNICAS FACTORES ASOCIADOS AL SÍNDROME DE BURNOUT EVALUACIÓN DEL SÍNDROME DE BURNOUT ANTECEDENTES INVESTIGATIVOS RESULTADOS

  9. Análisis del ciclo de vida de la ventana de madera

    OpenAIRE

    Vignote Peña, Santiago; Llorente Díaz, Isabel Mª; Martin Rojas, I.; Moro Coco, O.

    2013-01-01

    Se analiza el ciclo de vida de una ventana de madera y se calcula su huella ecológica. Se compara con la bibliografía existente la huella ecológica de la ventana de madera con la de PVC y la de alumnio

  10. La investigación formativa en los procesos de investigación asumidos en la universidad

    Directory of Open Access Journals (Sweden)

    Olga Lucía Anzola Morales

    2007-12-01

    Full Text Available El documento analiza la importancia de la investigación como motor de la gestión y operación de las universidades. Igualmente, presenta los elementos fundamentales que deben caracterizar la investigación formativa como enfoque para el diseño curricular.

  11. Diseño organizativo del Centro de Innovación en Tecnología para el Desarrollo Humano de la UPM (itdUPM). Estrategia y procesos fundamentales.

    OpenAIRE

    Moreno Serna, Jaime

    2014-01-01

    En este TFM se analiza el contexto y las claves organizativas que han guiado el lanzamiento operativo del Centro de Innovación en Tecnología para el Desarrollo Humano de la Universidad Politécnica de Madrid.

  12. de recursos humanos

    Directory of Open Access Journals (Sweden)

    Fernando J. Fuentes García

    2005-01-01

    Full Text Available En este trabajo se analiza el concepto de Responsabilidad Social Corporativa en relación a la gestión de RRHH. Se definen cinco instrumentos de posible desarrollo, sus ventajas e inconvenientes. Finalmente, se estudia la implantación de la herramienta más avanzada y potente: la norma SA8000.

  13. Emprender en creatividad publicitaria a nivel local. El caso Youart como estrategia de especialización

    OpenAIRE

    Lamarti Elvira, María Inmaculada

    2016-01-01

    Más allá de las agencias publicitarias y los servicios clásicos de creatividad publicitaria, destacan como eficaces las estrategias de especialización. Se analiza el caso malagueño de Youart. Universidad de Málaga. Campus de Excelencia Internacional Andalucía Tech.

  14. Transparencia, buenas prácticas y gestión de la calidad en la actividad de la Administración Pública gallega

    OpenAIRE

    Almeida Cerreda, Marcos; Santiago Iglesias, Diana

    2010-01-01

    Este artículo analiza la regulación gallega con respecto a la trasparencia, buenas prácticas y calidad en su Gestión Pública para clarificar su alcance, sus efectos y el grado de puesta en práctica.

  15. La inconstitucionalidad por omisión

    Directory of Open Access Journals (Sweden)

    Luz Bulnes Aldunate

    2006-01-01

    Full Text Available El artículo analiza la facultad de los tribunales constitucionales para determinar la inconstitucionalidad por omisión, en virtud del silencio u omisión de la autoridad de normar un principio o regla constitucional dispuesto por la Constitución explícita o implícitamente.

  16. Por los derechos humanos de las mujeres: la Ley General de Acceso de las Mujeres a una Vida Libre de Violencia

    Directory of Open Access Journals (Sweden)

    Marcela Lagarde y de los Ríos

    2007-01-01

    Full Text Available Este artículo analiza la Ley General de Acceso de las Mujeres a una Vida Libre de Violencia, misma que es considerada por la autora como un paradigma en el proceso de consolidación de los derechos humanos de las mujeres en México.

  17. Empleo y escolaridad en México

    OpenAIRE

    Román-Morales, Ignacio

    2004-01-01

    Se analiza la relación entre empleo y escolaridad en México, donde si bien los trabajadores con educación superior mantienen condiciones cada vez mejores que el promedio, esto se da en una situación nacional cada vez más difícil, caracterizada por el deterioro general del empleo.

  18. Analysis of some aspects upon the magnetosphere terrestrial

    OpenAIRE

    Mendoza, Miller; Morales, John

    2014-01-01

    Usando un modelo simple se analiza cualitativamente la deformación que sufre el campo magnético terrestre debido al viento solar. Se estudiaron también las corrientes eléctricas generadas en el viento solar debido a la presencia del campo magnético de la Tierra.

  19. Homeostasis iónica y respuestas a estrés salino en levaduras

    OpenAIRE

    Navarrete, C.; J. L. Martínez; Ramos, J.

    2009-01-01

    La homeostasis de cationes es fundamental para cualquier célula viva, especialmente cuando se encuentra en situaciones de estrés salino. Utilizando levaduras como organismo modelo de célula eucariota, se analiza la función de algunos de los transportadores de potasio y sodio así como sus procesos de regulación

  20. internacionales

    Directory of Open Access Journals (Sweden)

    Miriam Lorena Henríquez Viñas

    2007-01-01

    Full Text Available La autora analiza la situación de los tratados internacionales cuando ya han ingresado al ordenamiento jurídico. Considerando los argumentos que le permiten concluir la inconveniencia de un control reparador de tratados internacionales.

  1. La evolución del diseño gráfico en la prensa de provincias (1850-1936) : estructuras de compaginación

    OpenAIRE

    Gragera Martín de Saavedra, Manuel

    2011-01-01

    Analiza la prensa de provincias en el periodo antes dicho deteniéndose en las señas de identidad de los periódicos seleccionados en función de ellas. El diseño de sus paginas, y las paginas especiales, realizando un estudio pormenorizado del defensor de granada como muestra representativa

  2. LA ESTRATEGIA DE GESTIÓN DE LA INVESTIGACIÓN EN LAS UNIVERSIDADES VENEZOLANAS Caso: Universidad Centroccidental “Lisandro Alvarado”

    Directory of Open Access Journals (Sweden)

    José Nicolás Vizcaya

    2010-07-01

    Full Text Available Esta investigación tiene como propósito analizar la Gestión de Investigación en los Centros de Estudios Superiores o en las Universidades Venezolanas, en este caso la Universidad Centroccidental “Lisandro Alvarado”. Se analiza el contexto y las normas que regulan dicha actividad así como sus estrategias.

  3. ¿Tecnología y ciencia, o sólo tecnología? Hacia una comprensión de las relaciones ciencia-tecnología

    OpenAIRE

    López Devesa, Emilio Juan

    2001-01-01

    Este artículo analiza las relaciones entre ciencia y tecnología desde la perspectiva de la negación de una demarcación entre ellas. Se sostiene que la ciencia puede ser entendida como tecnología, es decir, como una dimensión de sistemas sociotécnicos complejos.

  4. Tres mitos griegos en la narrativa de Gabriel García Márquez

    OpenAIRE

    David GARCÍA PÉREZ

    2010-01-01

    Este trabajo expone la recepción de los mitos de Antígona, Ulises y Prometeo en la narrativa del escritor colombiano Gabriel García Márquez. Se analiza la re-creación de los mitos indicados en el contexto peculiar del Realismo mágico.

  5. The Anthropology of Clifford Geertz. Cultural Theory and the Interpretative Analysis of Cultures by Gordana Gorunović

    Directory of Open Access Journals (Sweden)

    Marija Krstić

    2016-03-01

    Full Text Available Gordana Gorunović. Antropologija Kliforda Gerca. Kulturna teorija i interpretativna analiza kultura. 2010. Beograd: Srpski genealoški centar i Odeljenje za etnologiju i antropologiju Filozofskog fakulteta. str. 286. [The Anthropology of Clifford Geertz. Cultural Theory and the Interpretative Analysis of Cultures

  6. Reutilización de aguas grises: grupo de viviendas en el municipio de Victoria de Acentejo

    OpenAIRE

    Ysún Barrio, Mª Teresa

    2009-01-01

    Esta tesina analiza el potencial de la reutilización de las aguas grises generadas en las viviendas para devenir una fuente no convencional de agua, y ofrecer así una opción adicional con la que paliar los déficits hídricos.

  7. Vida y muerte empresarial. Estudios empíricos de perdurabilidad : proyecto : empresas saludables. Caso : hamburguesas El Corral

    OpenAIRE

    Uribe Antia, Pablo; Reina Zapata, Juan Sebastian

    2012-01-01

    Este Proyecto analiza los factores determinantes que hacen que Hamburguesas El Corral haya sido una idea empresarial exitosa y duradera en el tiempo. Se basa en un modelo de perdurabilidad de la Universidad del Rosario, compuesto por 13 elementos y se complementa con unos lineamientos transversales de investigación de la Facultad de Administración, en liderazgo y gerencia.

  8. La configuraci??n jur??dica del accidente de trabajo

    OpenAIRE

    S??nchez P??rez, Jos??

    2013-01-01

    Esta obra incorpora un an??lisis global del accidente de trabajo y su configuraci??n jur??dica. Analiza su evoluci??n hist??rica e incorpora una selecci??n de m??s de 300 sentencias del Tribunal Supremo que permiten identificar su contenido.

  9. El Naturalismo Biológico de Kuhn en "La Estructura de las Revoluciones científicas"

    OpenAIRE

    Castrodeza, Carlos

    1998-01-01

    Se Contempla Historicamente Y Conceptualmente El Desarrollo Del Naturalismo Enla Historia Reciente De La Filosofia De La Ciencia. Acto Seguido, Se Analiza, Ala Luz De Dicha Doctrina, El Libro Mas Emblematico De Kuhn. Se Concluye Que Elnaturalismo Biologico Del "Filosofo" Americano Esta, En Conjunto, Acorde Con Laortodoxia Bioantropologica Actual Y Puede Que, Incluso, La Haya Propiciado Enbuena Medida.

  10. La universidad como claustro, vergel y árbol de la ciencia. Una invención iconodráfica de la Universidad del Cuzco

    Directory of Open Access Journals (Sweden)

    Francisco Stastny M.

    1984-12-01

    Full Text Available En un minucioso estudio iconológico, según el método definido porE. Panofsky, el autor analiza algunas pinturas que le permiten explorar el pensamiento religioso y social del Cuzco y de ese modo llega a señalar la orignalidad el arte cuzqueño del siglo XVIII.

  11. La universidad como claustro, vergel y árbol de la ciencia. Una invención iconográfica de la Universidad del Cuzco

    Directory of Open Access Journals (Sweden)

    Francisco Stastny M.

    1984-12-01

    Full Text Available En un minucioso estudio iconológico, según el método definido por E. Panofsky, el autor analiza algunas pinturas que le permiten explorar el pensamiento religioso y social del Cuzco y de ese modo llega a señalar la orignalidad del arte cuzqueño del siglo XVIII.

  12. De la ebullición a la contrarrevolución. Los significados del orden público en los libros de los gobernantes de la Segunda República Española, 1931-1936

    OpenAIRE

    Vaquero Martínez, Sergio

    2016-01-01

    Este artículo analiza los significados del orden público atribuidos por los gobernantes de la Segunda República española, en el marco de la cultura política republicana, mediante el estudio de sus memorias, diarios y libros. Para ampliar la compre

  13. En torno a la etología. Acerca de la obra de Konrad Z. Lorenz: Decadencia de lo humano un ensayo sobre el presente y futuro de la humanidad.

    OpenAIRE

    1986-01-01

    En su ensayo Lorenz aplica la ciencia por el creada para proyectar una mínima prospectiva sobre la evolución humana aunque es cosnciente de la imposibilidad de definiciones ciertas respecto al futuro de un ser adaptable como el hombre. el autor analiza las raices ideológicas de Lorenz y las limitaciones de su punto de vista.

  14. Del libro y sus formas. El ordenador y las nuevas modalidades de lectura

    Directory of Open Access Journals (Sweden)

    Dra. Carmen Espejo Cala

    1998-01-01

    Full Text Available 1La autora analiza la irrupción de las nuevas tecnologías en la producción de libros y la incidencia de estos procedimientos en los lectores, deteniéndose con detalle en soportes como el cdrom

  15. Mundos equivocados: cuando la “abundancia” y la “carencia” se encuentran en la Amazonía colombiana

    NARCIS (Netherlands)

    Verschoor, G.M.; Torres, C.

    2016-01-01

    Este artículo describe y analiza los efectos de la minería artesanal que involucra a comunidades Andoque del Resguardo Aduche (Amazonía colombiana) en su seguridad alimentaria. En términos analíticos, el punto de partida es la existencia de diferentes perspectivas sobre las actividades de las poblac

  16. ¿Existen diferentes tipos de turismo rural? Su influencia en el desarrollo territorial en el caso andaluz

    OpenAIRE

    Mercedes Jiménez García; José Ruiz Chico; Antonio Rafael Peña Sánchez

    2013-01-01

    El documento analiza la relación entre las distintas zonas rurales andaluzas; estudia la relación entre turismo rural y desarrollo territorial y examina las características de las zonas rurales entre sí

  17. Las Perspectivas y Retos de la Antropología Aplicada en el Siglo XXI

    Directory of Open Access Journals (Sweden)

    Marisol Pérez L.

    2007-01-01

    Full Text Available El presente artículo reflexiona acerca del rol de la Antropología aplicada en el siglo XXI. Analiza las posibilidades de la antropología aplicada en el contexto actual, sus fortalezas y debilidades frente a los problemas sociales contemporáneos.

  18. La responsabilidad civil de los magistrados del tribunal constitucional en tela de juicio = Civil liability of Constitutional Court Judges al issue

    OpenAIRE

    Delgado del Rincón, Luis Esteban

    2014-01-01

    En el trabajo se analiza la responsabilidad civil de los magistrados del Tribunal Constitucional teniendo en cuenta dos resoluciones judiciales. La primera, una sentencia de la Sala Primera del Tribunal Supremo, de 23 de enero de 2004 que, extralimitándo

  19. Productos turísticos novedosos del mercado alemán

    OpenAIRE

    Collazo López, Sofía

    2013-01-01

    En un sector tan cambiante como es el turismo, debemos estar siempre alerta de las nuevas tendencias. Este trabajo analiza las novedades del mercado turístico de Alemania en 2013, sus gustos y preferencias, así como las expectativas del turista alemán en un destino

  20. Más que una imprenta: el taller tipográfico La Academia (1878-1892) y la cultura republicana

    OpenAIRE

    Taló Martí, Marcel

    2016-01-01

    La Academia fue un taller tipográfico de Barcelona fundado por un republicano federal, dirigido por un anarquista y en donde se imprimió prensa catalanista, republicana, librepensadora y anarquista. Este artículo analiza el conjunto de su producció

  1. Lacuna Inc. o la residencia del olvido: Encuentro de una narración de 1907 y una película del 2004

    OpenAIRE

    Casasa Núñez, Laura; Escuela de Ciencias del Lenguaje, Instituto Tecnológico de Costa Rica

    2013-01-01

    En este artículo la autora analiza la relación que existe entre el filme EternoResplandor de una Mente sin Recuerdos y un cuento de ciencia ficción escrito por Don Mark Lemon en 1907, titulado “La residencia del olvido”. Asimismo, se establece como intertexto el cuento de Edgar Allan Poe, “Morella”.

  2. ¿Se puede recobrar el capital invertido en participaciones preferentes?

    Directory of Open Access Journals (Sweden)

    Gómez Hernández, José Antonio

    2013-01-01

    Full Text Available En este trabajo se analiza qué son las participaciones preferentes, cómo y por qué se han comercializado en España y las diversas posibilidades que ofrece el ordenamiento jurídico para intentar recuperar el capital desembolsado.

  3. Estadísticas Universitarias. Segunda entrega

    Directory of Open Access Journals (Sweden)

    Gabriela S. Giba

    2013-05-01

    Full Text Available Con base en el documento "Posgrados acreditados en la República Argentina" de CONEAU se analiza el estado de los pogrados universitarios con acreditación en el marco de la establecido por la Ley de Educación Superior (LES N°24.512

  4. La teoría de las representaciones sociales de Serge Moscovici

    Directory of Open Access Journals (Sweden)

    Martín Mora

    2002-11-01

    Full Text Available En este escrito se describe y analiza el modelo de las representaciones sociales desde el punto de vista del propio Moscovici, así como desde la perspectiva de investigadores que han trabajado en esta línea, procurando apuntar algunas notas acerca de la teoría como su metodología.

  5. Normas para vivienda

    OpenAIRE

    Coupé, Françoise

    1990-01-01

    El Seminario Taller Normas para Vivienda, analiza los efectos de las normas vigentes en el país, sobre el desarrollo urbano, la vivienda y la calidad de vida, para participar en la discusión del Estatuto Metropolitano de Usos del Suelo, Urbanismo y Construcción. Se presenta en este Boletín algunos resultados del trabajo realizado.

  6. Indicadores y estándares internacionales de calidad universitaria

    OpenAIRE

    Nicolás Velasco; Rodrígo Fernández; Yerko Martínez

    2006-01-01

    Este documento expone los antecedentes relativos a la metodología de rankings y analiza 12 ejemplos de EE.UU., Australia, Reino Unido y Asia, los clasifica según tres directrices y, finalmente, extrae las variables más comunes y representativas.

  7. Patrimonio industrial en Brasil

    Directory of Open Access Journals (Sweden)

    Ângelo Braghirolli

    2010-07-01

    Full Text Available La ampliación del concepto de ‘patrimonio’ ha despertado el interés por las tipologías urbanas y arquitectónicas no consagradas, como los conjuntos industriales y los barrios obreros de las primeras décadas del siglo XX. Reconocer el valor cultural de estos espacios incide en los marcos legales del orden internacional, nacional y local, a través de las respuestas de las comunidades involucradas y, sobre todo, en los mecanismos de gestión y los lineamientos de intervención. Este artículo analiza la reciente valoración cultural del legado de la industria como una consecuencia de la ampliación del concepto de ‘patrimonio’ y analiza seis ejemplos precursores y relevantes en el contexto brasilero.

  8. América Latina a inicios de la segunda década del siglo XXI: entre el regionalismo estratégico y la regionalización fragmentada

    Directory of Open Access Journals (Sweden)

    Lincoln Bizzozero

    2011-01-01

    Full Text Available El artículo analiza la evolución del regionalismo en América Latina desde los años noventa. Expone las opciones que se plantean a los países en sus políticas exteriores frente a las iniciativas de Estados Unidos y los cambios en el sistema internacional. Se expone la importancia funcional de las potencias emergentes (PEMS y las regiones en la fase actual del capitalismo. Finalmente el artículo analiza las perspectivas del regionalismo en América Latina tanto en el sistema internacional como en la construcción de un modelo de gobernanza regional.

  9. Los ambiguos efectos de la fluidez y la contingencia: la postemancipación en el Brasil fronterizo (Amazonia, 1888-1950

    Directory of Open Access Journals (Sweden)

    Óscar de la Torre

    2015-02-01

    Full Text Available Este artículo analiza cómo la flexibilidad y la fluidez en las relaciones sociales de los territorios fronterizos afectaron a los proyectos de libertad de los afrobrasileños después de la abolición. Estudiando el caso de la Amazonía, analiza los patrones de movilidad geográfica y los mecanismos de acceso a la propiedad agraria. Aunque datos censales sugieren una aparente estabilidad espacial, en realidad existieron patrones de movilidad supralocal. Además, la informalidad en el acceso a la propiedad agraria facilitó la pervivencia de estrategias políticas propias entre las comunidades negras rurales de la Amazonía.

  10. Temperatura y humedad relativas en un secador solar de plantas para la salud

    Directory of Open Access Journals (Sweden)

    Diego Chaverri

    2016-03-01

    Full Text Available Se describen las características de un secador solar pasivo, tipo invernadero, que se utiliza para el secado de plantas para la salud en la zona norte de Costa Rica. Se analiza el régimen de temperaturas en función de la radiación solar global recibida durante el proceso de secado. También se analiza el comportamiento de la humedad relativa interna comparada con la humedad relativa ambiente y su relación con las características físicas del secador. El secador presenta características que le permiten mantener un régimen de secado para las plantas.

  11. EL CONTROL DE CONSTITUCIONALIDAD DE LAS OMISIONES LEGISLATIVAS. ALGUNAS CUESTIONES DOGMÁTICAS

    Directory of Open Access Journals (Sweden)

    Francisco Fernández Segado

    2009-01-01

    Full Text Available El autor analiza el tema siempre actual en el derecho constitucional comparado sobre la institución del control de constitucionalidad de las omisiones legislativas, pasando revista a su surgimiento y desarrollo histórico, su clasificación y taxonomía, la doctrina desarrollada sobre la institución y su concreción en las constituciones a través del tiempo, como asimismo la situación actual de la institución en el derecho constitucional vigente. Asimismo, el trabajo analiza la constitucionalización de instrumentos procesales de las inacciones legislativas, como asimismo las tensiones que pueden producirse entre el juez constitucional y el legislador en esta materia.

  12. TRANSPARENCIA Y LEYES SECRETAS EN CHILE

    Directory of Open Access Journals (Sweden)

    Pablo Contreras V.

    2010-01-01

    Full Text Available El autor analiza el problema de constitucionalidad de las leyes secretas en Chile, en razón de las modificaciones introducidas a la Constitución en el 2005. Primero, describe brevemente el fundamento sobre la publicidad de la ley en el Estado Democrático. Luego, se analiza el nuevo principio constitucional de publicidad establecido en el artículo 8º de la Constitución. Adicionalmente, se examina la constitucionalidad de las leyes secretas desde dos puntos de vista: confrontando la compatibilidad con el principio general de transparencia -como base de la institucionalidad- y analizando la afectación en el contenido esencial del derecho fundamental de acceso a la información pública.

  13. Comportamiento sustentable y educación ambiental: una visión desde las prácticas culturales

    Directory of Open Access Journals (Sweden)

    Marithza Sandoval Escobar

    2012-01-01

    Full Text Available El presente artículo analiza el problema de la EA (educación ambiental para el desarrollo de comportamientos sustentables desde el marco de las prácticas culturales. Desde esta perspectiva, se analizan los factores infraestructurales que contribuyen al desarrollo de las problemáticas ambientales y se relacionan con los aspectos estructurales de la cultura que actúan determinando el contexto en el que ocurre la interacción de los individuos con su entorno ambiental. Se analiza específicamente el caso colombiano en cuanto a la configuración de macrocontingencias y metacontingencias para el comportamiento sustentable, y finalmente, se conceptualiza la EA como un proceso que ocurre en diferentes espacios sociales más allá de las Instituciones Escolares.

  14. Religiosidad popular y santos españoles en México: el culto a Santiago Apóstol y a San Isidro Labrador en un pueblo mixteco de Oaxaca (Santiago Yolomécatl)

    OpenAIRE

    San Juan Molina, Luis Etelberto

    2011-01-01

    [ES] Esta tesis analiza el fenómeno de la religiosidad popular en una comunidad de origen indígena situada en la región Mixteca del estado de Oaxaca, en México. Se analiza el fenómeno, tomando en cuenta su conformación a partir de dos raíces básicas, la mesoamericana y la hispánica, enlazadas a raíz de la Colonia y desarrolladas a lo largo de la historia, con la aportación de influencias diversas que han motivado su transformación paulatina, de modo que se estudia un fenómeno de origen premod...

  15. PRESOJA MOŽNIH REŠITEV REKONSTRUKCIJE ŠTIRIKRAKEGA KRIŽIŠČA V KOPRIVNICI

    OpenAIRE

    Biškup, Nikola

    2015-01-01

    Predmet obravnave magistrskega dela je analiza križišča v Koprivnici na Hrvaškem, v okviru katere so predstavljene morebitne rešitve. V nadaljevanju je prikazan postopek načrtovanja rekonstrukcije križišča z opisom obstoječega stanja, prometnimi podatki in prikazom dveh možnosti, čemur sledi njuna analiza. Prva rešitev temelji na enostavnejši rekonstrukciji obstoječega stanja s spreminjanjem glavne prometne smeri in osi cest, kot druga rešitev pa je predlagano krožno križišče s spiralnim pote...

  16. El periodismo finisecular de Ramiro de Maeztu

    OpenAIRE

    2014-01-01

    El presente artículo analiza la crónica y el periodismo finisecular antes de centrarse en el caso de Ramiro de Maeztu, del que estudia su práctica y concepto del periodismo, el análisis que en sus artículos hace de la situación española tras el «desastre», sus propuestas de «regeneración» y su crítica economicista del Estado y la Iglesia. También analiza su posición frente al anarquismo y sus puntos de contacto con Nietzsche (creación de una ética, un estilo y una máscara textual). Antecede a...

  17. “Jeneros de gusto y sobretodos ingleses”: el impacto cultural del consumo de bienes ingleses por la clase alta bogotana .

    Directory of Open Access Journals (Sweden)

    Ana Maria Otero Cleves.

    2009-05-01

    Full Text Available Este artículo analiza el impacto cultural del consumo de bienes Inglés por la clase alta de Bogotá durante el siglo XIX. Se sugiere que el consumo de productos Inglés después de la independencia del país fue uno de los principales mecanismos empleados por las clases altas para asegurar su posición social, así como para construir una nación moderna, de acuerdo a las normas europeas. Por lo tanto, el artículo analiza el papel que el consumo de bienes extranjeros en el proceso de construcción de la nación y la diferenciación social en el siglo XIX.

  18. Integración, mestizaje y nacionalismo en el México revolucionario. Forjando Patria de Manuel Gamio: la diversidad subordinada al afán de unidad

    Directory of Open Access Journals (Sweden)

    Guillermo Castillo Ramírez

    2014-01-01

    Full Text Available E ste trabajo analiza el programa integracionista de Manuel Gamio en su obra Forjando Patria como un proyecto d e nacionalidad surgido e n el contexto histó rico del México revolucionario, en el que la diversidad cultural se supeditaba a la idea de unidad . En primer lugar, se rastrea la relación del programa integracionista con sus antecedentes, las ideas de “ mestizaj e ” y “ mestizo ” de fines del siglo XIX y principios del XX. Luego se analiza la influencia que el integracionismo de Gamio recibió de algunos modelos europeos de nacionalidad y cambio sociocultural en el contexto de la heterogeneidad socio - étnica del México de 1916. Finalmente , se hacen visibles los vínculos entre las concepciones de diversidad cultural, nación y nacionalismo en la obra de l autor .

  19. El conflicto entre realidad y ficción: hibridaciones entre imagen, sonido y tecnología en el arte contemporáneo

    OpenAIRE

    2016-01-01

    Este trabajo de investigación estudia la relación recíproca existente entre realidad y ficción en la historia de las prácticas híbridas y analiza la mutua capacidad que existe por parte de ambos términos para producir al otro. Es decir, se analiza cómo la realidad es el principal productor de ficción y cómo la ficción produce realidad, señalando al género de ciencia-ficción como el espacio privilegiado para definir dicho conflicto. Se trata de un trabajo que busca los conceptos tecnológicos i...

  20. la Vall de Boí como caso de estudio

    Directory of Open Access Journals (Sweden)

    Francesc Fusté Forné

    2016-01-01

    Full Text Available El turismo gastronómico es una tipología turística que sea o no la motivación principal de un desplazamiento turístico, está presente en cualquier viaje. Éste representa una fuente de ingresos provenientes de los turistas y a la vez genera también sinergias que benefician el desarrollo de la comunidad local. Este artículo analiza cómo el queso actúa como un recurso turístico y a la vez como una herramienta para el desarrollo de los productores autóctonos, desde un punto de vista cualitativo. Para ello se analiza en qué formas el queso está presente en las cartas de los restaurantes de la Vall de Boí, destino Patrimonio de la Humanidad en el Pirineo catalán.

  1. La política y el conocimiento científico

    OpenAIRE

    2011-01-01

    El presente artículo analiza el alcance que, desde la perspectiva de Max Webwe, se otorga a la labor de científico en la actividad política. En la primera parte se analiza la naturaleza de la labor del político, las cualidades que éste debe poseer, así como la ética propia de esta actividad. En la segunda, se desarrollan los aspectos íntimos de la vocación del científico, así como el sentido del trabajo científico. En la tercera se analizan los vínculos entre ciencia y política, así ...

  2. La política y el conocimiento científico

    OpenAIRE

    2011-01-01

    El presente artículo analiza el alcance que, desde la perspectiva de Max Weber, se otorga a la labor de científico en la actividad política. En la primera parte se analiza la naturaleza de la labor del político, las cualidades que éste debe poseer, así como la ética propia de esta actividad. En la segunda, se desarrollan los aspectos íntimos de la vocación del científico, así como el sentido del trabajo científico. En la tercera se analizan los vínculos entre ciencia y política, así como los ...

  3. Análisis de la tensión educación científica vs. educación técnica en la Argentina : 1862-1930

    OpenAIRE

    Lopez Arriazu, F.; Soba, A.

    2009-01-01

    En este trabajo se analiza la presencia u omisión de contenidos referentes a técnica/tecnología en libros y programas de estudio de los niveles medio y universitario entre los años 1862-1930 en la Argentina. Partiendo de un posicionamiento epistemológico e histórico, se analiza la introducción en el curriculum escolar de dos contenidos paradigmáticos por su relación con el conocimiento técnico: la electricidad y la termodinámica. Se intenta describir la alteración histórica en la enseñanza de...

  4. El rol de los actores con poder de veto informal en la determinación del gasto social en la Argentina post-neoliberal (2002-2008

    Directory of Open Access Journals (Sweden)

    Emiliano López

    2012-01-01

    Full Text Available El presente trabajo analiza la importancia de los actores con poder de veto informal para la determinación de algunas políticas públicas en Argentina luego de la crisis del modelo neoliberal. En particular, se realiza una relectura de los modelos estándar de actores con poder de veto para incorporar a los movimientos de desocupados que surgieron en Argentina en el período de consolidación y crisis del neoliberalismo. Asimismo, se analiza empíricamente la capacidad de estas nuevas organizaciones para modificar el statu quo de las políticas de gasto público social.

  5. La responsabilidad civil del servidor público en el combate a la corrupción

    Directory of Open Access Journals (Sweden)

    Oscar A. Müller Creel

    2012-01-01

    Full Text Available En este artículo se analiza el fenómeno de la corrupción como una actividad dañina a la sociedad. Se estudia la existencia de los sistemas legales en el combate a la corrupción y su análisis en lo concerniente a la legislación mexicana. Se determina la posibilidad de establecer responsabilidad civil tanto a los servidores públicos como a los corruptores, mediante un análisis de antecedentes y los elementos que justifican a la misma. Se contiene un estudio comparativo respecto de la legislación internacional, por último, se analiza la acción Qui Tam, sus antecedentes en los sistemas anglosajones y la posibilidad de establecer este instrumento en la legislación mexicana.

  6. El proceso constituyente boliviano como escenario de disputas por la economía

    Directory of Open Access Journals (Sweden)

    Milena González Piñeros

    2011-04-01

    Full Text Available Este artículo analiza el reciente proceso constituyente boliviano como un escenario de disputas sociales y políticas por el tipo de economía por plasmar en la Nueva Constitución. En la primera parte se hace referencia al entramado monocultural, colonial y excluyente que ha sostenido una forma de entender la economía, la cual ha estado respaldada por la Constitución en favor de un bloque específico de poder. En la segunda parte, el escenario constituyente se analiza como oportunidad histórica para debatir el sentido de la economía. Como resultado de esa disputa, surge el modelo económico nacional productivo dentro del texto constitucional.

  7. Discurso y comunicación en Venezuela: del determinismo al nacionalismo tecnológico

    Directory of Open Access Journals (Sweden)

    Jesús Alberto Andrade Castro

    2010-01-01

    Full Text Available Este trabajo analiza el desarrollo de las tecnologías de información en Venezuela y cómo el elemento discursivo legitima su uso; para ello, se identifican tres tipos de discursos (determinismo tecnológico, democracia tecnológica y nacionalismo tecnológico. Se parte del supuesto de que la hegemonía es un proceso ideológico en constante búsqueda de poder, que usa el discurso para su legitimación. Se analiza cómo en Venezuela, junto con las políticas estatales que buscan la construcción de un modelo comunicacional basado en tecnologías de información, el discurso técnico "permea" los ambientes donde las tic puedan legitimar su existencia, con el fin de establecer una hegemonía ideológica en la sociedad.

  8. Cuando Oliver se dio un beso con otro niño, con su mejor amigo, Dick: lenguajes literarios y lenguajes violentos dirigidos a jóvenes LGBTQ en el sistema escolar

    Directory of Open Access Journals (Sweden)

    Mauricio Pulecio

    2015-04-01

    Full Text Available En este trabajo se analiza la forma en la que el lenguaje ofensivo contribuye al mantenimiento de la discriminación contra jóvenes LGBTQ en el sistema de educación básica. Se argumenta que este problema es global, aunque se analiza el caso colombiano como forma de articular una respuesta local. Se muestran los resultados de un trabajo de campo realizado en colegios de estratos altos de Bogotá, para ejemplificar las expresiones de odio que circulan en el entorno educativo. También, se estudian piezas literarias, especialmente del escritor homosexual Fernando Molano Vargas, y se aboga por su inclusión dentro de los currículos educativos. De esta forma, se intenta contraponer, a un lenguaje ofensivo, un lenguaje literario en el que se expresan formas de resistencia capaces de legitimar afectos no heterosexuales.

  9. Desarrollismo, dictaduras y postdictaduras: Discurso pedagógico y podel en Chile

    Directory of Open Access Journals (Sweden)

    José Abel Malaver Rodríguez

    2011-09-01

    Full Text Available En este artículo se presenta una reflexión a partir de conceptos desarrollados por Michel Foucault y Basil Berstein. Se analiza el papel del dispositivo de control que se ejerce en la educación chilena por la Junta Militar (Chile, 1973, a través de cuatro mecanismos: disciplina, autoridad, examen y control y estandarización curricular. Se analiza en conjunto el papel de este dispositivo en el marco de la historia de la educación chilena en el período 1950-1995, en especial se destaca el fenómeno denominado “pedagogía del olvido”.

  10. Planeta Verne. La vuelta al mundo en ochenta libros

    OpenAIRE

    Martínez de Pisón, Eduardo

    2015-01-01

    Eduardo Martínez de Pisón se centra en la faceta geográfica de Julio Verne a través de un libro suyo titulado la “Tierra de Jules Verne. Geografía y aventura”, en donde se realiza una introducción a la obra geográfica del escritor. Para ello, el autor analiza la producción literaria de Verne buscando elementos geográficos en los pasajes de ficción y se estudia en relación a la abundante e influyente base geográfica de sus relatos. También se analiza el valor manifiestamente pedagógico de la o...

  11. La propaganda electoral en el Código Electoral.

    Directory of Open Access Journals (Sweden)

    Juan Luis Rivera Sánchez

    2010-01-01

    Full Text Available El artículo hace una exposición acerca de la nueva regulación de la propaganda electoral -artículos 136 al 142 del Código Electoral- sus principales cambios, innovaciones y diferencias entre la anterior legislación y la nueva. Así, en el primer capítulo, analiza la definición de propaganda que, a lo largo del tiempo, ha acuñado la jurisprudencia electoral y cómo ésta se recoge en el nuevo código. En el segundo capítulo aborda lo relativo a la propaganda en la legislación electoral. En el tercer capítulo analiza la estructura del Código Electoral en lo concerniente a las distintas actividades relacionadas con la propaganda electoral.

  12. De la tradición sáfica a los círculos tribádicos: la búsqueda de las identidades lésbicas desde una perspectiva histórica (De la antigüedad clásica a la edad moderna)

    OpenAIRE

    Beteta Martín, Yolanda

    2012-01-01

    El artículo analiza la visibilidad y percepción social del lesbianismo desde una perspectiva histórica desde la Antigüedad Clásica hasta la Edad Moderna. Se inicia con un análisis de la estigmatización que ha padecido el estudio del lesbianismo en las Ciencias Sociales y a continuación analiza el tratamiento social, político e ideológico de las relaciones lésbicas desde la Antigüedad hasta el siglo XVII a través del estudio de las fuentes literarias, jurídicas e inquisitoriales. El estudio se...

  13. Los Millenials y las redes sociales : Estudio del comportamiento, ideología, personalidad y estilos de vida de los estudiantes de Ciencias Económicas de la Universidad Nacional de La Plata a través del análisis cluster

    OpenAIRE

    Fernando Rogelio Simonato; Mario A. Mori

    2015-01-01

    El presente trabajo analiza la investigación realizada a la generación "Y" que asiste a las distintas carreras de la facultad de ciencias económicas de la UNLP. Se analiza el comportamiento e interacción de esta generación de estudiantes en las Redes Sociales. Se describen las características socioeconómicas, la ideología social, política, económica y cultural de los estudiantes. Se presenta el modelo de la personalidad de consumo de la generación Y a través de un análisis factorial confirmat...

  14. "Riesgo", "peligrosidad" e "implicacion subjetiva": un analisis de las decisiones de internacion psiquiatrica en la ciudad de Buenos Aires

    Directory of Open Access Journals (Sweden)

    María Jimena Mantilla

    2010-03-01

    Full Text Available Este artículo describe y analiza los procesos de decisión de internación psiquiátrica a partir de una aproximación etnográfica. Se concentra en la cuestión de la peligrosidad y el riesgo; condiciones que definen el criterio de internación desde una perspectiva psiquiátrica. Analiza los argumentos psicoanalíticos sobre la hospitalización como estrategia terapéutica. Los resultados del análisis muestran que internar o no internar a una persona se decide mediante un saber práctico, situacional y contextual puesto en juego a cada momento. En esta decisión operan el lugar institucional del profesional, la pertenencia a una especialidad, las lecturas teóricas sobre la situación del paciente y la finalmente la disponibilidad de recursos alternativos.

  15. "Riesgo", "peligrosidad" e "implicacion subjetiva": un analisis de las decisiones de internacion psiquiatrica en la ciudad de Buenos Aires

    Directory of Open Access Journals (Sweden)

    María Jimena Mantilla

    Full Text Available Este artículo describe y analiza los procesos de decisión de internación psiquiátrica a partir de una aproximación etnográfica. Se concentra en la cuestión de la peligrosidad y el riesgo; condiciones que definen el criterio de internación desde una perspectiva psiquiátrica. Analiza los argumentos psicoanalíticos sobre la hospitalización como estrategia terapéutica. Los resultados del análisis muestran que internar o no internar a una persona se decide mediante un saber práctico, situacional y contextual puesto en juego a cada momento. En esta decisión operan el lugar institucional del profesional, la pertenencia a una especialidad, las lecturas teóricas sobre la situación del paciente y la finalmente la disponibilidad de recursos alternativos.

  16. El Principio de autonomía cooperativa frente al Estado: su articulación bajo la legislación de Puerto Rico

    Directory of Open Access Journals (Sweden)

    Rubén Colón Morales

    2014-12-01

    Full Text Available Este trabajo examina los orígenes históricos y los fundamentos doctrinarios sobre los que se fundamenta el concepto de la autonomía cooperativa frente al Estado. Asimismo analiza la complementariedad del concepto con otros postulados y principios cooperativos como el de membresía abierta y voluntaria y de control democrático. A la luz de tales principios, se analiza el desarrollo del precepto de la autonomía cooperativa dentro de la legislación cooperativa en Puerto Rico, con particular atención a las reformas habidas en torno a las estructuras gubernamentales de supervisión y reglamentación del sector cooperativista en Puerto Rico en los últimos años.Recibido: 15.05.2014Aceptado: 01.09.2014

  17. Ideología en el Diccionario Nacional (1846-47) de Ramón Joaquín Domínguez: la nomenclatura vergonzante

    OpenAIRE

    Quilis Merín, Mercedes

    2014-01-01

    En este estudio se analiza una muestra de las voces sometidas a tabú presentes en el Diccionario Nacional (1846-47) de R. J. Domínguez. Se analizan sus técnicas lexicográficas en la presentación y tratamiento de estas voces, en contraste con el Diccionario de la RAE (1843) y con el Nuevo diccionario (1843) de V. Salvá. Se analiza la presencia de la ideología y la subjetividad del autor sobre este ámbito del léxico en relación con las restricciones sociales y las prácticas lexicográficas del s...

  18. Análisis macroeconómico de los efectos de la liberalización financiera y comercial sobre el crecimiento económico de México, 1988-2011

    Directory of Open Access Journals (Sweden)

    Francisco Martínez

    2015-01-01

    Full Text Available Este artículo analiza cuáles han sido los principales obstáculos para el crecimiento económico de México durante los últimos veinticinco años, con particular énfasis en el periodo posterior a la entrada en vigor del Tratado de Libre Comercio de América del Norte (tlcan. Si bien la política económica mexicana desde 1982 se ha guiado por una serie de suposiciones y disposiciones conocidas como el Consenso de Washington, estas políticas en lugar de estimular un mayor dinamismo de la economía mexicana han acentuado sus problemas estructurales y reducido el potencial de crecimiento del país. También se analiza cómo las políticas fiscal, monetaria, cambiaria y de libre comercio han obstaculizado el crecimiento económico.

  19. Santander

    Directory of Open Access Journals (Sweden)

    Julio Cerviño

    2008-01-01

    Full Text Available Este trabajo analiza, en primer lugar, la expansión reciente y posicionamiento de las marcas españolas en los mercados internacionales y sus efectos en una mejor y más reforzada imagen país. En este contexto, y en una segunda parte, se analiza la proyección, imagen y estrategia internacional de la marca Santander, situándola en las distintas fases de un modelo de desarrollo de marca internacional, comenzando por su fase de marca local hasta alcanzar un fuerte posicionamiento y notoriedad internacional. Los análisis teóricos conceptuales se acompañan con datos descriptivos de las investigaciones más recientes sobre el valor de las marcas financieras en el mundo y sobre la notoriedad internacional de las marcas españolas

  20. los servicios en redes E-MAN

    Directory of Open Access Journals (Sweden)

    Eduardo de la Cruz Gámez

    2006-01-01

    Full Text Available Ethernet, al evolucionar a través del tiempo, ha presentado la necesidad de un mejor desempeño en el tráfico de datos; propuestas como la implementación del protocolo 802.1p ofrecen hasta cierta medida un control de la calidad de los servicios (QoS, pero al crecer la red Ethernet a ambientes metropolitanos (e-man, surgen nuevos retos. Este trabajo evalúa los parámetros de desempeño necesarios para caracterizar la red e-man, y analiza un nuevo procedimiento para abordar los problemas de la calidad de los servicios; este trabajo también analiza el comportamiento del desempeño de un modelo de simulación basado en el núcleo de backbone de una red metropolitana rpr.

  1. Resonancias Vocales y Memoria Sonora en Helen Brown

    Directory of Open Access Journals (Sweden)

    Andrés Grumann Sölter

    2016-09-01

    Full Text Available El artículo se concentra en indagar aspectos referidos a la intensificación de los usos de la voz y la sonorización musical que proponen Trinidad Piriz y Daniel Marabolí en Helen Brown (2013. Dando cuenta de un marco teórico que cuestiona la dimensión referencial con la que se analiza frecuentemente al teatro y proponiendo una aproximación fenomenológica que dé cuenta de la materialidad performativa que insta a intensificar las resonancias de la voz y la capacidad audible del sonido, el escrito analiza dos escenas o tracks en los que la memoria hecha cuerpo compromete de un modo particular a los espectadores que participan de la performance escénica.

  2. Les polítiques turístiques en el marc de la reestructuració de les destinacions litorals. Avaluació dels plans d'excel·lència turística al litoral català.

    OpenAIRE

    2009-01-01

    En esta tesis se analiza si las políticas turísticas han servido para reorientar y revitalizar la actividad turística del litoral catalán. El trabajo se estructura en tres partes, una primera más teórica, donde se explica el marco conceptual y el punto de partida de esta investigación; una segunda en la cual se analiza el estado y la evolución de la actividad turística al litoral catalán; y la tercera donde se evalúa la figura de los planes de excelencia turística, como instrumento de polític...

  3. Agroecología, territorio, recampesinización y movimientos sociales

    Directory of Open Access Journals (Sweden)

    Peter Michael Rosset

    2016-01-01

    Full Text Available El artículo analiza el fenómeno de la agroecología en el contexto actual de disputa por los territorios rurales entre el agronegocio, y otros acaparadores de tierras, y el campesinado organizado y sus aliados. Usando los conceptos de soberanía alimentaria, territorios material e inmaterial en disputa y recampesinización, se explica el mayor énfasis que los movimientos sociales rurales dan a la agroecología en este contexto. Se muestran ejemplos de “Campesino a Campesino,” tanto un movimiento propio, como una meto- dología que otros movimientos sociales rurales han usado para llevar la agroecología a mayor escala y se analiza el proceso creciente de construcción de procesos de agroecología dentro del movimiento social transnacional, de movimientos rurales, organizaciones campesinas y agricultores familiares, La Vía Campesina ( LVC .

  4. LA TUTELA SUPRACONSTITUCIONAL DE LOS DERECHOS HUMANOS EN COSTA RICA

    Directory of Open Access Journals (Sweden)

    Gilbert Armijo

    2003-01-01

    Full Text Available El presente artículo analiza la posición de los derechos fundamentales y la recepción de los derechos humanos en el ordenamiento jurídico de Costa Rica, considerando la eficacia de los instrumentos internacionales sobre la materia y la jurisprudencia de la Comisión y la Corte Interamericana de Derechos Humanos. El artículo analiza especialmente la jurisprudencia de la Sala Constitucional de la Corte Suprema de Costa Rica.This article analyzes the place of human rights and their reception in the Costa Rican legal system, considering the effectiveness of international treaties on the subject and the decisions of the Inter-American Commission and Court on Human Rights. The decisions of the Constitutional Chamber of the Costa Rican Supreme Court are also commented.

  5. Fitness-management: el conflictivo devenir de una cultura empresarial

    Directory of Open Access Journals (Sweden)

    María Inés Landa

    2016-03-01

    Full Text Available Resumen El artículo analiza el conflictivo devenir de la cultura del fitness en Argentina a partir de las categorías foucaulteanas de dispositivo, prácticas, gubernamentalidad y empresario de sí. En primer lugar, aborda la emergencia del fitness en la escena local y hace hincapié en las objeciones que la comunidad de profesores de educación física realiza a las producciones de este dispositivo cultural. A continuación, analiza las tácticas de conversión cultural que implementa el dispositivo del fitness en su vertiente managerial. Se concluye que el ethos empresarial que caracteriza las formas contemporáneas del fitness trasciende el universo estricto de estas prácticas ya que éste constituye un cimiento fundamental del capitalismo del presente.

  6. Los partidos políticos en Colombia: entre la realidad y la ficción

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Gechem S.

    2009-12-01

    Full Text Available Los partidos políticos son, sin lugar a dudas, los principales actores políticos de una democracia. Nadie podría dudar de que el buen funcionamiento de éstos consolida el régimen del gobierno del pueblo. En el caso de Colombia la regla se aplica sin excepción.En una primera parte se analiza el origen de los partidos colombianos. Este estudio se realiza con base en la teoría de los clivajes, según la cual los partidos son fruto de verdaderas revoluciones sociales. De la misma forma, se estudia la tipología y el financiamiento de los partidos. Luego se estudia el sistema de partidos colombiano. El aparente bipartidismo se analiza de manera crítica; se demuestra que el sistema partidista sufre cambios y refleja la realidad democrática nacional.

  7. Los partidos políticos en Colombia: entre la realidad y la ficción

    Directory of Open Access Journals (Sweden)

    Carlos Eduardo Gechem S.

    2009-12-01

    Full Text Available Los partidos políticos son, sin lugar a dudas, los principales actores políticos de una democracia. Nadie podría dudar de que el buen funcionamiento de éstos consolida el régimen del gobierno del pueblo. En el caso de Colombia la regla se aplica sin excepción. En una primera parte se analiza el origen de los partidos colombianos. Este estudio se realiza con base en la teoría de los clivajes, según la cual los partidos son fruto de verdaderas revoluciones sociales. De la misma forma, se estudia la tipología y el financiamiento de los partidos. Luego se estudia el sistema de partidos colombiano. El aparente bipartidismo se analiza de manera crítica; se demuestra que el sistema partidista sufre cambios y refleja la realidad democrática nacional.

  8. Aprendizaje de las reglas del Fútbol a través del videojuego.

    Directory of Open Access Journals (Sweden)

    Manuel Armenteros Gallardo

    2012-04-01

    Full Text Available El siguiente artículo analiza las ventajas de los nuevos medios interactivos para facilitar el aprendizaje de las reglas del fútbol y la similitud en la estética desarrollada en los hipermedias educativos y los videojuegos, tomando como referencia el videojuego Pro Evolution Soccer 5 y la Guía Interactiva del Fuera de Juego, editada por FIFA. Por otro lado, se analiza la estructura de estos materiales, la forma de presentar su contenido y la construcción gramatical utilizada. Asimismo, se examinan otros factores que influyen sobre el alto grado de aceptación que generan en el usuario. Entre otras conclusiones, se confirma la utilidad de estos materiales multimedia interactivos para facilitar el aprendizaje, capaces de combinar el entretenimiento con la adquisición de conocimiento, convirtiéndoles en una herramienta muy útil en la formación deportiva.

  9. Aproximaciones a los videojuegos y su incidencia en las subjetividades de los jugadores latinoamericanos

    Directory of Open Access Journals (Sweden)

    Álvaro Alfonso Acevedo Merlano

    2016-04-01

    Full Text Available Este artículo analiza los resultados de un estudio sobre el modo en que los videojuegos inciden en la construcción de las subjetividades de los jugadores latinoamericanos desde el punto de vista del consumo cultural y considerando los discursos de la industria en la que fueron creados. A través del método etnográfico, se analiza cómo las subjetividades son afectadas dependiendo de la característica de los videojuegos que son consumidos, mostrando el fenómeno en América Latina. Los resultados se encaminan a superar el estigma de simples consumidores pasivos del tercer mundo, para comprender de manera crítica la producción y consumo de los videojuegos en el contexto latinoamericano.

  10. Posibilidad de brindar información contenida en la cédula de identidad a otras instituciones del Estado, concretamente, la fotografía

    Directory of Open Access Journals (Sweden)

    Juan Luis Rivera Sánchez

    2008-07-01

    Full Text Available La utilización de nuevas tecnologías plantea desafíos cada vez mayores en el campo de la información que obligan a mantener un equilibrio entre la información que se puede brindar y los derechos fundamentales de las personas. La presente investigación analiza este fenómeno a la luz de lo que se considera información pública, privada y sensible; y la posibilidad de que información que se encuentra en bases de datos de instituciones públicas pueda ser suministrada entre ellas. Se analiza el caso de la imagen de la cédula de identidad, si es posible que el Tribunal Supremo de Elecciones permita consultar por parte de otras instituciones la base de datos que contiene esa información, sin violentar los derechos fundamentales de las personas.

  11. Sentidos del trabajo y organización de la vida doméstica   entre policías de la Provincia de Buenos Aires  

    Directory of Open Access Journals (Sweden)

    Sabrina Calandrón

    2015-07-01

    Full Text Available Este artículo analiza las caracterizaciones de la actividad policial como trabajo, describiendo las percepciones de los miembros de una fuerza de seguridad puntual: la Policía de la Provincia de Buenos Aires. A lo largo del texto se analiza el sitio de la actividad policial en la trayectoria laboral de los y las policías. Esto permite identificar las características relevantes del empleo como la estabilidad económica, la seguridad social que otorga y las proyecciones a futuro. No obstante, también se estudia la convivencia de dinámicas apoyadas en el sistema burocrático policial con otras que personalizan los lazos laborales. Finalmente, las concepciones de la familia y la lógica de responsabilidades morales hacia ella obtienen un lugar central en el desarrollo y sentido del trabajo en la policía.

  12. Elementos conceptuales para el análisis organizacional de universidades en contextos de mercado

    Directory of Open Access Journals (Sweden)

    Enrique Fernández Darraz

    2012-12-01

    Full Text Available Este artículo analiza las principales implicaciones que el nuevo contexto histórico y, en especial, la constitución de mercados o cuasimercados de educación superior, tienen para el análisis organizacional de universidades. Para ello revisa, primero, la discusión actual en torno a las teorías neoinstitucionalistas en el estudio de las organizaciones, usando la perspectiva de la elección racional como medio de contraste. Luego, analiza las implicancias teóricas de la creación de mercados o cuasi mercados en el nivel educativo terciario. Finalmente, plantea una serie de hipótesis tendientes a incrementar la viabilidad del análisis de organizaciones universitarias desde una perspectiva neoinstitucional.

  13. El Tranvía eléctrico de Medellín (Colombia y su aporte al proceso de modernización urbana: 1920-1951

    Directory of Open Access Journals (Sweden)

    José Wilson Marquez Estrada

    2012-06-01

    Full Text Available Este artículo analiza la experiencia del primer sistema de transporte masivo que tuvo la ciudad de Medellín (Colombia, el tranvía eléctrico, del proceso de surgimiento, construcción y consolidación de este medio de transporte. Se examina su funcionamiento como proyecto empresarial oficial y las diferentes circunstancias que lo llevaron a ser el eje del sistema vial y las crisis que finalmente producen su declive y su cierre. Igualmente, se describe y analiza el impacto que tuvo esta obra en el proceso de modernización urbana que vivió la ciudad entre 1920-1951.

  14. El Tranvía eléctrico de Medellín (Colombia y su aporte al proceso de modernización urbana: 1920-1951

    Directory of Open Access Journals (Sweden)

    José Wilson Márquez Estrada

    2012-01-01

    Full Text Available Este artículo analiza la experiencia del primer sistema de transporte masivo que tuvo la ciudad de Medellín (Colombia, el tranvía eléctrico, del proceso de surgi - miento, construcción y consolidación de este medio de transporte. Se examina su funcionamiento como proyecto empresarial oficial y las diferentes circunstancias que lo llevaron a ser el eje del sistema vial y las crisis que finalmente producen su declive y su cierre. Igualmente, se describe y analiza el impacto que tuvo esta obra en el proceso de modernización urbana que vivió la ciudad entre 1920-1951.

  15. Crecimiento urbano y dinámica laboral: un análisis intersectorial del commuting en la Comunidad de Madrid (1996-2004

    Directory of Open Access Journals (Sweden)

    Carlos Llano Verduras

    2007-01-01

    Full Text Available El artículo analiza la relación entre la estructura urbana y el mercado laboral, valorando hasta qué punto el modelo monocéntrico de desarrollo urbano es válido para el área metropolitana de Madrid. Junto al análisis de la localización de las empresas y los hogares en la Comunidad, se analizan los flujos intermunicipales de commuting entre 1996-2004. Mediante el cálculo de la redundancia relativa de las matrices de commuting se cuantifica la dispersión de los flujos laborales intermunicipales a lo largo del periodo contemplado. Asimismo, mediante técnicas de análisis de cambio estructural en tablas inut-output se analiza la estabilidad temporal de los patrones de movilidad, identificando comportamientos diferentes para los diferentes sectores.

  16. La Fundación Turismo de Cuenca: Un nuevo modelo de gestión pública y privada

    Directory of Open Access Journals (Sweden)

    Juan Antonio Mondéjar Jiménez

    2009-01-01

    fórmulas de colaboración que permitan una gestión turística integral para poder adaptar la oferta del destino a las necesidades que manifiestan los turistas, teniendo en cuenta las nuevas preferencias de la demanda real y potencial. El presente trabajo analiza el papel jugado por la Fundación Turismo de Cuenca, como ente aglutinador de la iniciativa pública y privada en materia de turismo. Así, se analiza su capacidad para unir en un mismo Patronato a la Junta de Comunidades, Diputación Provincial, Ayuntamiento, Confederación de Empresarios, Agrupación Provincial de Hostelería y Turismo, Cámara de Comercio e Industria y Caja de Castilla-La Mancha. Los resultados obtenidos en su corta, pero intensa, actividad, han sido verdaderamente significativos.

  17. Constitucional sobre la justicia ordinaria

    Directory of Open Access Journals (Sweden)

    José Luis Cea Egaña

    2005-01-01

    Full Text Available El artículo analiza el efecto vinculante y de irradiación de las sentencias del Tribunal Constitucional sobre el conjunto del ordenamiento jurídico y de sus órganos. El autor toma partido por la consideración de la ratio decidendi del fallo como vinculante junto al dictum de la sentencia respectiva. Se plantea la necesidad que la LOC del Tribunal Constitucional explicite los efectos vinculantes de los fallos respecto de los tribunales ordinarios y especiales. Finalmente analiza los efectos de la res iudicata en el ámbito del control reparador de constitucionalidad de preceptos legales en control concreto y en control abstracto.

  18. Intervención humanitaria, soberanía y proceso de paz

    Directory of Open Access Journals (Sweden)

    Marco Gerardo Monroy-Cabra

    2010-03-01

    Full Text Available El trabajo analiza en el campo del derecho internacional público, el conflicto jurídico entre los principios de soberanía y derechos -humanos, y las acciones fácticas de intervención y uso o amenaza de fuerza.  El autor informa sobre "el debate entre los partidarios y adversarios de la intervención humanitaria, los analiza en el ámbito jurídico y con fundamento en la normatividad positiva vigente concluye que la soberanía no puede ser vulnerada por ningún tipo de intervención, incluida la de carácter armado.  "El conflicto colombiano puede requerir la presencia internacional dentro del respeto de la soberanía e independencia nacional y sin la utilización de la intervención armada"

  19. Naturaleza económica y legal de la infraestructura de los servicios públicos de saneamiento básico

    Directory of Open Access Journals (Sweden)

    Luis Eduardo Amador Cabra

    2009-12-01

    Full Text Available En este artículo tiene por objeto caracterizar los servicios públicos de saneamiento en general y el servicio de aseo en particular. Para alcanzar ese propósito se estudia la importancia macroeconómica del sector y se analiza el concepto de servicio público. Igualmente, se analiza cómo el servicio de aseo ostenta fallas de mercado al proveer el servicio por debajo de las necesidades sociales por su naturaleza económica que induce a soluciones ineficientes al determinar precios y cantidades alejados de los criterios de eficiencia económica. También presenta información de la contribución del sector de agua y saneamiento básico a la economía nacional.

  20. Las relaciones digitales entre familias y escuela: análisis y propuestas

    Directory of Open Access Journals (Sweden)

    Mar Beneyto-Seoane

    2016-06-01

    Full Text Available La investigación exploratoria analiza las relaciones digitales entre docentes y familias en diez centros educativos de las provincias de Barcelona y Girona. La investigación recoge y analiza las diferentes herramientas digitales a través del análisis de documentos y de entrevistas semiestructuradas. El estudio muestra que la introducción de las TIC no ha conllevado cambios sustanciales ni en el qué ni en el cómo de las prácticas y las relaciones entre familias y docentes. Finalmente, partiendo de dicho análisis, se plantean pistas y propuestas de mejora en las actuales relaciones digitales entre docentes y familias. 

  1. Rutas al Pacífico. Caminos, transporte y comercio desde el periodo prehispánico hasta el siglo XIX (desde el norte de Guerrero)

    OpenAIRE

    Brígida von Mentz

    2016-01-01

    Con una visión temporal amplia, este ensayo analiza la existencia de rutas comerciales en lo que hoy se conoce como el estado de Guerrero, en México; propone la continuidad de algunas rutas prehispánicas y describe la apertura de nuevas rutas novohispanas, surgidas por el impacto de la minería y del comercio transoceánico. El estudio analiza los productos que se intercambiaban y cómo se transportaban y hace énfasis en el reto que significó vencer el obstáculo de cruzar ríos caudalosos. A part...

  2. Los polos de consolidación electoral: el caso del PAN en Guanajuato

    Directory of Open Access Journals (Sweden)

    Liliana López Levi

    2002-01-01

    Full Text Available Este artículo analiza la conformación y dinámica de una región política en el estado de Guanajuato, desde la perspectiva de la Geografía electoral. Para ello, se abordan los elementos que conforman al sistema político, es decir, el territorio, la sociedad y sus actores políticos; así como también la dinámica electoral de los últimos veinte años, retomando tanto los comicios federales como los locales. A partir de lo anterior, se analiza el espacio territorial como un polo de consolidación electoral panista.

  3. Análisis de extinción de una ecuación de difusión no local con término de absorción

    Directory of Open Access Journals (Sweden)

    Mauricio Bogoya

    2014-12-01

    Full Text Available Se estudia un problema de difusión no local con término de absorción y condiciones de frontera de Neumann. Se analiza la existencia y unicidad de las soluciones, y se da un principio de comparación para ellas. Se analiza la extinción de la solución para algunos términos de absorción. Abstract. We study a nonlocal diffusion problem with absorption term and Neumann boundary conditions. We prove the existence and uniqueness of solutions, and give a comparison principle for them. The quenching phenomena of solutions is analyzed for some absorption term.

  4. Conflictos ambientales y redes transnacionales de defensa en el Chile Postdictadura

    Directory of Open Access Journals (Sweden)

    Claudio Rivera

    2011-01-01

    Full Text Available Los conflictos ambientales reflejan y reproducen configuraciones de poder. El artículo analiza tres conflictos ambientales en Chile postdictadura en los que diferentes actores tales como empresas, agencias estatales, comunidades de base y ONGs ambientalistas se enfrentan por el uso de recursos naturales. Usando la literatura en redes transnacionales de apoyo como marco analítico, el trabajo analiza las condiciones bajo las cuales conflictos ambientales locales alcanzan visibilidad internacional. Se discuten dos campos de investigación interdisciplinarios como son la justicia ambiental y la ecología política podrían avanzar el un mejor entendimiento de la afectividad de estas redes en los niveles a escala internacional, nacional y local.

  5. HACIA UN MODELO TEÓRICO EXPLICATIVO DE LA INNOVACIÓN EN LOS DISTRITOS DE TURISMO CULTURAL

    Directory of Open Access Journals (Sweden)

    Ángela Martínez Pérez

    2012-01-01

    Full Text Available En este trabajo se plantea un modelo teórico que analiza el efecto directo, y mediado por la adquisición de conocimiento, del capital social sobre la innovación desarrollada por las empresas pertenecientes a un distrito turístico cultural. Se analiza el carácter bidimensional del capital social -bonded capital y bridging capital-. Se realiza una aproximación al contexto y las caracteristicas de los distritos turísticos culturales. Se establecen diversas líneas futuras de trabajo vinculadas a la diferenciación entre tipos de conocimiento y de innovación. Se proponen recomendaciones sobre la orientación de las relaciones entre las empresas y con las instituciones de los distritos turísticos culturales.

  6. Posibilidades de crecimiento del Islam en América Latina: oportunidades y dificultades

    Directory of Open Access Journals (Sweden)

    Gabriel Ernesto Andrade

    2001-01-01

    Full Text Available Este trabajo elabora un diagnóstico de las posibilidades de crecimiento del Islam en América Latina, considerando las oportunidades y dificultades para su expansión y crecimiento. En este sentido, se analiza como oportunidades de crecimiento la búsqueda de nuevas identidades, las difíciles condiciones sociales latinoamericanas, el paralelismo entre el Islam y elmarxismo y el apoyo financiero proveniente de naciones islámicas. Como dificultades se analiza la rigidez cultural del Islam, la secularización de la sociedad latinoamericana y la proximidad de América Latina con EE.UU. y Occidente. Finalmente, se muestra las estadísticas de la situación actual del Islam en América Latina, y se concluye que el Islam crece en la región, pero de manera lenta y progresiva.

  7. Soberanía, representación e independencia en Caracas, 1808-1811

    Directory of Open Access Journals (Sweden)

    Inés Quintero

    2009-06-01

    Full Text Available El artículo analiza el impacto que la crisis política de la monarquía española sus- citó en Caracas, en donde tuvo lugar un intenso debate. En noviembre de 1808 se intentó erigir una junta, sin éxito. El 19 de abril de 1810 se constituyó la Junta Conservadora de los Derechos del Rey Fernando VII y, finalmente, el 5 de julio de 1811 se declaró la Independencia. El artículo analiza el contenido del debate acerca del ejercicio de la soberanía, así como la manera en que organizaron la representación política quienes tuvieron a su cargo la conducción de este pro- ceso histórico, desde el inicio del movimiento juntista hasta la declaración de la indepedencia.

  8. Evaluación de la calidad asistencial en un servicio de salud mental a través de la percepción y evolución de pacientes con trastorno obsesivo-compulsivo

    Directory of Open Access Journals (Sweden)

    SANTIAGO BARAJAS MARTÍNEZ

    2001-01-01

    Full Text Available El presente estudio analiza la aplicación de un breve cuestionario, diseñado al efecto por el autor, con el objetivo de conocer la percepción de los pacientes con trastorno obsesivo-compulsivo sobre los siguientes aspectos: información sobre su trastorno, tipos de tratamiento recibidos, eficacia de los mismos, satisfacción con la atención recibida y evolución de los síntomas. Se analiza profundamente la eficacia diferencial de distintos tratamientos psicológicos en función de su orientación teórica. Finalmente, a la luz de los resultados obtenidos, se sugieren cambios para mejorar el tratamiento que reciben estos pacientes en los servicios públicos de salud mental.

  9. The Body as Revolutionary Text: The Dance as Protest Literature in Latin America

    Directory of Open Access Journals (Sweden)

    Lois Jaeck Marie

    2003-01-01

    Full Text Available Se analiza el poder del baile como un medio de comunicación que puede derribar muros y fronteras, unir grupos diversos de la humanidad y promover cambios sociales. El estudio se hace para Latinoamérica en donde es muy notorio que algunas de las luchas étnicas y de clases sociales han utilizado conscientemente el poder comunicativo del baile para realizar sus propósitos.

  10. Género, discurso crítico y violencia simbólica: un trinomio epistemológico en la prensa chilena entre 2006-2011

    Directory of Open Access Journals (Sweden)

    PAULINA SALINAS MERUANE

    2014-01-01

    Full Text Available Este articulo analiza las construcciones de género en la prensa nacional, durante el gobierno de la primera mujer presidenta en Chile (2006-2011. La llegada de Bachelet al gobierno no produjo una transformación efectiva en la manera de significar lo femenino: más bien existe continuidad y escasos cambios. Se advierte lll1 uso naturaliza- do del lenguaje indirecto, develándose sexismo, control social y xenofobia.

  11. Tuenti: pasado, presente y futuro de la marca. Análisis de la evolución del cambio de estrategia de una marca generacional.

    OpenAIRE

    Muñoz Aragón, Roberto

    2016-01-01

    Este TFG analiza los diferentes movimientos estratégicos de la marca Tuenti por medio de sus diferentes identidades visuales y campañas de publicidad, completandolo con el análisis del libro de su creador, Zaryn Dentzel "El futuro lo decides tú" y analizando desde cerca la creación de su última campaña desde dentro del proceso creativo. Grado en Publicidad y Relaciones Públicas

  12. Izdelava kinematičnega modela in poprocesorja dvoosne stružnice v okolju Siemens NX

    OpenAIRE

    Kešpret, Sandi

    2014-01-01

    Magistrsko delo v prvem delu obravnava teoretične splošne osnove simulacij CNC strojev – stružnic. V nadaljevanju so obravnavane simulacije v programskem paketu Siemens NX. Jedro magistrske naloge zavzema podroben opis izdelave simulacije stroja CNC stružnice GF – NDM 16 ter poprocesorja. V zaključku sledijo komentar, analiza in primerjava dobljenih rezultatov z rezultati, dobljenimi s sorodnim programskim paketom.

  13. Propuesta de estudio semiótico para los murales de Bonampak, Chiapas, México

    Directory of Open Access Journals (Sweden)

    Sophia Pincemin Deliberos

    2014-01-01

    Full Text Available En este trabajo se describe y analiza la escena representada en los muros este, sur y oeste del cuarto 1 de los murales de Bonampak, llamada “la presentación del heredero,” utilizando las calcas hechas en 1988 y revisadas en los dos últimos años, así como elementos teóricos y metodologías de la semiótica visual.

  14. Sujetos del fideicomiso testamentario (en el derecho argentino y uruguayo

    Directory of Open Access Journals (Sweden)

    Francisco Ferrer

    2013-11-01

    Full Text Available El autor analiza comparativamente el régimen jurídico del fideicomiso y los sujetos intervinientes, formalizados en un testamento, en el derecho argentino y el derecho uruguayo. Describe sus características, derechos y obligaciones, así como los principios generales de los respectivos códigos civiles y determina especialmente las consecuencias de las normas del derecho de herencia conforme a las leyes que rigen en ambos ordenamientos jurídicos

  15. Convenciones en juegos puros de coordinación simétrica 2 x 2

    OpenAIRE

    Mora Jhon James

    2009-01-01

    Este ensayo analiza la formación de convenciones en juegos de coordinación simétrica 2 × 2. En particular, el análisis se restringe a juegos con iguales niveles de seguridad y se discute que tanto puede explicar la teoría de juegos la formación de convenciones.

  16. Los principios generales del derecho en el control jurisdiccional de las ordenanzas fiscales

    OpenAIRE

    2014-01-01

    El presente trabajo de tesis doctoral tiene por objeto comprobar cómo o de qué manera actúan los Principios Generales del Derecho en el control jurisdiccional de las Ordenanzas Fiscales. A tal efecto, se planta un primer capítulo sobre los principios generales donde analizamos su historia, concepto, naturaleza y funciones. Seguidamente se estudian los instrumentos procesales para el ejercicio de ese control jurisdiccional y, concretamente, se analiza el recurso directo, el recurso indirecto -...

  17. Determinantes de la inclusion financiera en Peru

    OpenAIRE

    Noelia Camara; Ximena Pena; David Tuesta

    2013-01-01

    Este estudio ofrece una primera aproximacion cuantitativa a los determinantes de la inclusion financiera en Peru a partir de microdatos de encuestas. A traves de correlaciones significativas, se identifican aquellas caracteristicas socioeconomicas que podrian afectar a la inclusion (exclusion) financiera para hogares y empresas. Para aquellos individuos no bancarizados, se analiza la sensibilidad a algunas barreras con el fin de determinar su importancia y los factores por los que podrian ver...

  18. Gerencia de organizaciones inteligentes

    OpenAIRE

    Carlos Eduardo Martínez Fajardo

    2000-01-01

    En el presente artículo se analiza el concepto de gerencia de organizaciones inteligentes centrado en tres factores esenciales seleccionados por el autor y que enfocan la capacidad gerencial de las organizaciones hacia el autoaprendizaje y la innovación del conocimiento: Una estructura inteligente capaz de producir bienes, servicios y conocimientos con calidad y costos eficientes. Entorno ambivalente conectado a la estructura interna mediante procesos de realimentación que originan conocimien...

  19. Perspectivas de la educación superior en el Caribe Anglófono

    Directory of Open Access Journals (Sweden)

    Colin Brock

    2008-06-01

    Full Text Available En este capítulo, el autor analiza en sus raíces históricas y desarrollo cultural las perspectivas de la Educación Superior en el Caribe anglófono.In this chapter the author analyzes the historical roots and the cultural developments in order to unveil the perspectives of higher education in the Caribbean English speaking countries.

  20. CIUDAD IDEAL Y OPTIMA GOBIERNO EN LA CASTILLA DEL CUATROCIENTOS: LA INFLUENCIA DEL MODELO CLASICO GRIEGO EN ALONSA DE MADRIGAL

    OpenAIRE

    Barrios Sotos, José Luís

    2015-01-01

    The influence of Aristotle's thinking on Alonso de Madrigal's, el Tostado, work De optima politia is analysed in this article. Special relevance is attached to the fact that this 15th century author, a supporter of conciliarism, defends the convenience of democracy and not monarchy. Se analiza la influencia del pensamiento de Aristóteles sobre la obra De optima politia de Alonso de Madrigal, el Tostado. Se concede especial relevancia al hecho de que este autor del siglo XV, partidario del ...

  1. Teoría crítica, izquierda y políticas públicas de comunicación: el caso de América Latina y los gobiernos progresistas

    OpenAIRE

    2015-01-01

    Este trabajo analiza la evolución de las políticas de comunicación en la agenda pública latinoamericana. Se focaliza en el estudio de países cuyos gobiernos se han proclamado a sí mismos como de izquierda o progresistas, en un intento por encontrar tendencias comunes en los procesos de implementación de sus políticas públicas.

  2. EL PATRIMONIO COMO REPRESENTACIÓN COLECTIVA: LA INTANGIBILIDAD DE LOS BIENES CULTURALES

    Directory of Open Access Journals (Sweden)

    Javier Marcos Ar\\u00E9valo

    2012-01-01

    Full Text Available Enfocado desde la perspectiva de la antropología social, el artículo se estructura en torno a los conceptos de tradición, bienes culturales intangibles y representación de la memoria social. Desde planteamientos críticos el trabajo revisa textos fundamentales y analiza y valora los documentos que sobre patrimonio inmaterial ha hecho público la UNESCO en los últimos quince años.

  3. La globalisation et la gestion financière internationale

    OpenAIRE

    Martínez Fajardo, Carlos Eduardo

    2011-01-01

    Este artículo constituye una reflexión acerca de la incidencia del proceso de globalización en la evolución reciente de las finanzas internacionales y en la expansión apoyada en la mayor capacidad de gestión de las empresas multinacionales. Dicho proceso se analiza de acuerdo con las pautas derivadas del reordenamiento de la estructura mundial de poder y su incidencia en el sistema financiero internacional.

  4. Extranjerización e internacionalización de las burguesías latinoamericanas: el caso argentino

    Directory of Open Access Journals (Sweden)

    Martín Schorr

    2014-07-01

    Full Text Available El presente trabajo analiza el proceso de extranjerización de la economía argentina sucedido a partir de 1990, dentro de la denominada posconvertibilidad (2002 en adelante.Tomando como referencia las tendencias a la internacionalización productiva prevalecientes a nivel mundial y regional, se indaga principalmente sobre las formas en las queha sido asumido este proceso en las fracciones predominantes del capital local.

  5. Los conflictos de intereses de los administradores bajo el nuevo paradigma de la transparencia en el gobierno societario

    Directory of Open Access Journals (Sweden)

    Luis Fernando Sabogal

    2013-07-01

    Full Text Available En este breve trabajo se plantea la existencia de un nuevo paradigma en el derecho de sociedades moderno bajo el nombre de “transparencia en el gobierno societario”. A estos efectos, el autor analiza el contenido, las ventajas y límites de este paradigma, pues a partir de ello explica el alcance que tiene la transparencia como mecanismo jurídico para enfrentar los conflictos de intereses en la relación administrador-sociedad.

  6. Los conflictos de intereses de los administradores bajo el nuevo paradigma de la transparencia en el gobierno societario

    Directory of Open Access Journals (Sweden)

    Luis Fernando Sabogal

    2013-06-01

    Full Text Available En este breve trabajo se plantea la existencia de un nuevo paradigma en el derecho de sociedades moderno bajo el nombre de “transparencia en el gobierno societario”. A estos efectos, el autor analiza el contenido, las ventajas y límites de este paradigma, pues a partir de ello explica el alcance que tiene la transparencia como mecanismo jurídico para enfrentar los conflictos de intereses en la relación administrador-sociedad.

  7. Cien años de soledad : Una aproximación al estudio del tiempo

    OpenAIRE

    Cortés, Karina Alejandra; Valesini, María Silvina

    2006-01-01

    Este trabajo analiza el tratamiento del tiempo en la novela de Gabriel García Márquez Cien años de soledad. Se considera que, dentro de las múltiples miradas que la obra posibilita, la del tiempo es una de las más pregnantes. En esta obra es recurrente y deriva en conceptos relacionados tales como la memoria, el olvido, la muerte. Facultad de Bellas Artes

  8. Ergonomsko oblikovanje delovnega mesta s pomočjo računalniških simulacij

    OpenAIRE

    Hribernik, Blaž

    2016-01-01

    V diplomskem delu ergonomsko oblikovanje delovnega mesta je predstavljena ergonomska analiza montaže sestava zaslonke. V uvodnem delu je predstavljen namen ergonomije in njen pomen, ergonomska metoda OWAS, RULA in podjetje HSS. Osrednji del diplomske naloge predstavlja opis delovnega mesta in oceno kontrole z vidika ergonomskih načel, ročni preračun ergonomske metode OWAS in analizo delovnega mesta z uporabo programskega paketa Human simulation Jack. Zaključni del diplome pa predstavlja rezu...

  9. Acceso a la información: hacia la democratización de la administración pública

    Directory of Open Access Journals (Sweden)

    Ferreyra, Leandro E.

    2013-12-01

    Full Text Available El trabajo se encuentra estructurado en tres partes. En la primera se intenta delimitar un concepto de derecho de acceso a la información pública y de las complejidades derivadas del mismo de acuerdo a lo resuelto y normado en diversos sistemas. En la segunda, se analiza el régimen argentino y sus déficits. En la tercera, se esbozan consideraciones y propuestas en base a lo expuesto anteriormente.

  10. La condición del arte. Entre lo sagrado y lo profano Apuntes de sociología y antropología del arte

    OpenAIRE

    2006-01-01

    En este artículo, el autor analiza el concepto de arte confrontando y cuestionando la oposición y diferencia entre la idea moderna y, con eso, profana, de arte y otra tradicional y antigua, inmersa en la sustancia de lo sagrado. A partir de las definiciones de "arte tradicional" propuestas por diversos autores, se establecen lineamientos teóricos generales para analizar de manera concreta las formas particulares en las que, en diversas culturas, el arte se sit...

  11. Los máximos del programa mínimo de la Mesa Amplia Nacional Estudiantil

    OpenAIRE

    Cortés, Darwin

    2011-01-01

    Darwin Cortés analiza el nuevo escenario de debate luego de lo acontecido con la propuesta de reforma a la Ley 30. Señala como temas claves los de docencia y financiación. Los lineamientos de la MANE son bien conocidos ahora que la Reforma fue tumbada en el Congreso. ¿Qué puntos en realidad solucionan el problema de la educación?

  12. italianos

    Directory of Open Access Journals (Sweden)

    Rodrigo Reynaldo-Carmona

    2008-01-01

    italiana en el plano nacional y regional. Posteriormente se analiza la arquitectura institucional y los distintos actores y niveles que conforman el proceso decisional (governance de la política industrial en el plano territorial. Por último, se hacen algunas conclusiones tentativas sobre la importancia del distrito industrial y sus implicaciones en el ámbito de las políticas públicas y del desarrollo local.

  13. Análisis funcional en la teoría sociológica

    OpenAIRE

    Restrepo, Gabriel

    2009-01-01

    Artículo que trata el desarrollo del modelo de análisis funcional, sus representantes, los conceptos utilizados, y la relación entre éste y otros tipos de análisis. De esta manera, el autor analiza los fundamentos del análisis funcional en Kant, el análisis funcional como complemento en Durkheim, como preliminar en Weber, y como absoluto en Parsons.

  14. Aprendizaje en la producción de capital, crecimiento acelerado y cambio estructural

    OpenAIRE

    2008-01-01

    Con base en un modelo bisectorial de crecimiento endógeno (Rebelo
    1991), en el cual se produce un bien de consumo y un bien de capital, en este artículo se analiza el efecto de suponer aprendizaje en la práctica en el sector productor del bien de capital. El modelo modificado reproduce dos patrones del desarrollo económico de largo plazo: crecimiento acelerado y cambio estructural.

  15. Observatorio regional de transporte de carga y logística

    OpenAIRE

    2013-01-01

    El presente documento analiza la brecha existente entre los requerimientos y la disponibilidad de información al transporte de carga y logística, y propone la creación de una red de observatorios como modelo de institución para superarla información al transporte de carga y logística, y propone la creación de una red de observatorios como modelo de institución para superarla

  16. Sujetos del fideicomiso testamentario (en el derecho argentino y uruguayo)

    OpenAIRE

    Francisco Ferrer

    2013-01-01

    El autor analiza comparativamente el régimen jurídico del fideicomiso y los sujetos intervinientes, formalizados en un testamento, en el derecho argentino y el derecho uruguayo. Describe sus características, derechos y obligaciones, así como los principios generales de los respectivos códigos civiles y determina especialmente las consecuencias de las normas del derecho de herencia conforme a las leyes que rigen en ambos ordenamientos jurídicos

  17. Irregularidades en los contratos swaps o permutas financieras de interés

    OpenAIRE

    2014-01-01

    El presente trabajo analiza desde una óptica crítica las irregularidades cometidas por las entidades financieras españolas en la comercialización de contratos de permuta financiera o swaps en un determinado periodo de tiempo. Primeramente estudiamos lo que son los swaps y su naturaleza jurídica; seguidamente procedemos a detallar el iter contractual: desde las ofertas publicitarias lanzadas al mercado por los bancos hasta las consecuencias para el consumidor; por último, nos ...

  18. Fenómenos de resonancia en chimeneas de equilibrio

    OpenAIRE

    1986-01-01

    En lo que sigue se analiza el comportamiento oscilatorio del sistema de alimentación de una central hidroeléctrica, protegido del golpe de ariete por una chimenea de equilibrio, cuando la potencia suministrada a la red es pequeña frente a la máxima teórica y oscila con frecuencias cercanas a la de resonancia de la chimenea .

  19. El verde vacila en pintar hojas, ¿el rojo aceptará pintar sangre? La literatura y el compromisoen Sartre y Adorno

    Directory of Open Access Journals (Sweden)

    Maya Claudia María

    2015-01-01

    Full Text Available Para responder a la pregunta: ¿Qué es la literatura?, Sartre propone el concepto deunidad como su característica exclusiva que la relaciona con la sociedad por la víadel compromiso. Se analiza tal exclusividad, así como las objeciones de Adorno a lanoción de compromiso, para encontrar, en medio de sus grandes diferencias, algu-nas afinidades que permitan establecer las relaciones entre la literatura y la sociedad.

  20. Los jóvenes de Medellín: ¿ciudadanos apáticos?

    OpenAIRE

    Deisy Hurtado Galeano

    2010-01-01

    El artículo analiza algunas formas de expresión y comunicación que jóvenes de Medellín han construido para mostrar la estrechez de la política y exponer sus formas particulares de ejercerla: la música, el grafiti, el teatro, las artesanías, los medios de comunicación alternativos, la agricultura orgánica y las estéticas corporales.

  1. La esterilidad de la economía del equilibrio: un aspecto de la sociología de la ciencia

    OpenAIRE

    Bhatt, V. V.

    2009-01-01

    Este articulo muestra que la ciencia economica no ha alñcanzado la madurez que la la teoria del equilibrio no capta las relaciones economicas reales y es esteril para formular politicas ecopnomicas. Analiza la formacion de castas entre los economistas, la imposibilidad de formalizar todos los fenomenso economicos en terminos de optimizacion individual y los sesgos ideologicos del trabajo cientifico. Indica la necesidad de replantear las hipotesis basicas del enfoque del equilibrio general y d...

  2. Revisitando la Teoría Democrática: Pactos Intersubjetivos y Esferas Públicas Asociativas

    Directory of Open Access Journals (Sweden)

    Paulo Henrique Martins

    2007-01-01

    Full Text Available El presente artículo analiza corrientes teóricas acerca de la democracia desde un punto de vista filosófico y sociológico. El autor presenta una propuesta teórica relacionada con las teorías de la asociatividad y la colaboración, así como una crítica al utilitarismo.

  3. El mercado transfronterizo de servicios de salud privados entre Tijuana, México y San Diego, EE. UU.

    OpenAIRE

    2005-01-01

    En este trabajo se analiza el impacto del comercio transfronterizo en los servicios de salud de Tijuana en el mercado hispano – mexicano e inclusive de otros hispanos latinoamericanos de California. Los hispanos – estadounidenses son de origen mexicano cuyas ligas culturales y familiares los mantienen regresando periódicamente a los pueblos mexicanos de donde son originarios. Los hispanos de California constituyen un mercado que se disputan las compañías aseguradoras. El turismo de hispanos q...

  4. Gilbert Durand, imagen y símbolo o hacia un nuevo espíritu antropológico

    Directory of Open Access Journals (Sweden)

    Blanca Solares Altamirano

    2011-01-01

    Full Text Available En este artículo, la autora analiza algunos de los elementos básicos que Gilbert Durand denomina el "nuevo espíritu antropológico", particularmente la noción de símbolo (homo symbolicus, punto de inflexión clave para la apertura al punto de vista hermenéutico de este autor.

  5. La traducci??n en el derecho de sociedades espa??ol e ingl??s: estudio descriptivo, comparado y terminol??gico, an??lisis de escrituras de constituci??n, estatutos sociales y documentos de transferencia internacional de sede social

    OpenAIRE

    2012-01-01

    Este estudio ofrece y analiza las peculiaridades definitorias en las diferentes formas societarias existentes en Espa??a, por un lado, y en Inglaterra, Gales e Irlanda del Norte, por otro. Comparando ambos sistemas societarios (de acuerdo con la metodolog??a propia del Derecho comparado) el traductor puede alcanzar el conocimiento necesario para permitirle ser m??s preciso a la hora de emplear unos t??rminos especializados u otros, as?? como conocer los elementos en los que convergen y diverg...

  6. El recurso de amparo electoral

    Directory of Open Access Journals (Sweden)

    Luis Diego Brenes Villalobos

    2006-01-01

    Full Text Available Analiza la figura procesal del recurso de amparo electoral, su génesis, naturaleza jurídica,carácter residual, y otras características propias de su evolución y desarrollo, que lo diferencian con el recurso contencioso-electoral, para lo cual se realiza un amplio análisis de la jurisprudencia emanada tanto del Tribunal Supremo de Elecciones, como de la Sala Constitucional de la Corte Suprema de Justicia

  7. El derecho de autor en el entorno digital: reflexiones de un profesional de la información

    Directory of Open Access Journals (Sweden)

    Silvana Temesio

    2014-10-01

    Full Text Available Se estudia el derecho de autor en el entorno digital y en particular la situación creada por las protecciones tecnológicas para la gestión de los derechos de autor. Se analiza la situación que se plantea con los recursos digitales y los libros electrónicos. Se reflexiona sobre líneas de acción para los profesionales de la información.

  8. Los cambios en los sistemas de partidos municipales en México: del monopartidismo al pluripartidismo

    Directory of Open Access Journals (Sweden)

    Mario Alejandro Carrillo Luvianos

    2010-01-01

    Full Text Available En el presente artículo se analiza una de las principales herencias del régimen posrevolucionario: el control electoral del partido oficial en los espacios municipales. El análisis de las transformaciones por las que pasan los sistemas de partidos municipales constituye el eje de este texto, cuya argumentación fundamental ilustra cómo se difumina paulatinamente este cimiento del andamiaje político posrevolucionario.

  9. Ensayo sobre el feminismo y el sujeto popular

    OpenAIRE

    León Nuñez, Carmen Violeta

    2012-01-01

    Se comenta acá el ensayo escrito por Ana Sojo, el cual se compone de tres partes principales  componen el texto: la primera versa  sobre  el  sujeto popular: la segunda se refiere al estudio de  la definición de la condición subalterna de la mujer y en la tercera analiza el feminismo y el ámbito de la política.

  10. Effects of emotional intelligence on entrepreneurial intention and self-efficacy

    OpenAIRE

    Roxana Andreea Mortan; Pilar Ripoll; Carla Carvalho; M. Consuelo Bernal

    2014-01-01

    Estudios previos relacionan la inteligencia emocional con resultados positivos en el puesto de trabajo, tales como el desempeño y la satisfacción laboral. Sin embargo, la relación entre la inteligencia emocional y las diferencias individuales en emprendimiento han sido escasamente examinadas. En el presente estudio se analiza el efecto de las dimensiones de la inteligencia emocional sobre el potencial emprendedor, tras controlar la influencia de los rasgos de personalidad y variables demográ...

  11. El Discurso Publico de las Mujeres en Los Libros de Enseñanza del Ingles

    OpenAIRE

    Molina Plaza, Silvia

    1997-01-01

    TRAS UNA BREVE INTRODUCCION SOBRE LAS DIFERENCIAS ENTRE EL HABLA DE HOMBRES Y MUJERES EN LENGUA INGLESA, EL OBJETIVO DE ESTE ESTUDIO ES PRESENTAR LA DISTRIBUCION Y FUNCION DE LAS CONTRIBUCIONES DE LAS MUJERES AL HABLA EN AMBITOS PUBLICOS EN DIEZ DIALOGOS PROCEDENTES DE LIBROS DE TEXTO DE INGLES DE SECUNDARIA. SE OFRECEN EJEMPLOS QUE DEMUESTRAN QUE LOS HOMBRES HABLAN MAS Y CONSUMEN MAS TURNOS QUE LAS MUJERES EN ESTAS CONVERSACIONES. A CONTINUACION SE ANALIZA EL DIALOGO MOONDOWN CON MAYOR DETAL...

  12. Efectos del capital psicológico en el comportamiento innovador

    OpenAIRE

    Buenaventura Vera, Guillermo

    2013-01-01

    Este trabajo analiza el impacto del Capital Psicológico del líder sobre el Comportamiento Innovador de los colaboradores en la organización, estableciendo la influencia que en ello tienen los factores Capacidad de Aprendizaje Organizacional y Apoyo o Intercambio entre los miembros del Equipo (Team Member Exchange). El Capital Psicológico, un constructo de segundo orden que incorpora los recursos psicológicos positivos, eficacia, esperanza, optimismo y resiliencia, tiene la posibilidad de ...

  13. La denominación de origen en los mercados vinícolas: sus efectos en las relaciones empresa-consumidor en un contexto relacional

    OpenAIRE

    2001-01-01

    La presente tesis analiza desde un enfoque de marketing relacional las denominaciones de origen como marca. Atendiendo a los conceptos de identidad e imagen, se plantea el desarrollo de dos investigaciones empíricas dirigidas a empresas y consumidores, con el ánimo de establecer el papel de la imagen de la denominación de origen en la construcción de un capital comercial fundamentado en el comportamiento diferencial del consumidor.

  14. Transporte neumático de harina

    Directory of Open Access Journals (Sweden)

    Alberto Duarte Torres

    2012-05-01

    Full Text Available En el presente artículo se analiza la información obtenida en las líneas de transporte neumático de una empresa productora de harina de maíz y sus derivados con el propósito de obtener criterios para el cambio de escala, desafío, y control de sistemas similares.

  15. PREGLED REŠITEV ZA UVEDBO E-POSLOVANJA V MALIH PODJETJIH

    OpenAIRE

    Radaković, Milan

    2012-01-01

    V sodobnem času se zavedamo pomembnosti informacijskih tehnologij in njihovega vpliva na kakovost dela v podjetjih, učinkovitost, organiziranost in inovativnost. Ponudba sodobnih informacijskih tehnologij in programov je na današnji dan zelo široka. Za pravilno izbiro potrebne tehnologije sta potrebna predhodni pregled in analiza obstoječe ponudbe. V diplomskem delu smo želeli narediti delni pregled aktualnih ponudb za mikro in mala podjetja s poudarkom na prednostih in slabostih posameznih r...

  16. El complejo de Campyloneurum angustifolium (Sw.) Fée (Polypodiaceae) en Costa Rica

    OpenAIRE

    Rojas Alvarado, Alexander Francisco

    2015-01-01

    Se analiza el complejo de Campyloneurum angustifolium en Costa Rica. Como resultado, se describe una nueva especie (C. gracile A.Rojas) y se ofrece un cuadro comparativo y una clave para el grupo.  The Campyloneurum angustifolium complex in Costa Rica is analyzed. As a result, a new species is described (C. gracile A.Rojas), a comparative table and a key are included for the group. 

  17. Prevalencia de factores parafuncionales y la sintomatología dolorosa en pacientes portadores de prótesis parcial removible: un estudio comparativo basado en las diferentes clases de Kennedy

    OpenAIRE

    2014-01-01

    Este estudio analiza, comparativamente, la prevalencia de sintomatología dolorosa entre pacientesportadores de prótesis parcial removible, tomando como base la clasificación de Kennedy.Con esta finalidad, los pacientes, todos sintomáticos (n = 60), fueron divididos en cuatro gruposde 15, correspondiendo cada uno, a una de las cuatros clases de Kennedy. Se procedió a laanamnesis, examen clínico, con observaciones objetivas y subjetivas particularmente dirigidas alas regiones asociadas, incluye...

  18. La política fiscal implementada en Ecuador y su relación con los modelos alternativos de desarrollo (2007-2012)

    OpenAIRE

    Cuestas Caza, Javier Alejandro

    2013-01-01

    La política fiscal es un elemento clave en el fomento de la cohesión social. Por un lado, provee de ingresos al Estado para el financiamiento del gasto público y por otro, constituye una herramienta redistributiva en un contexto de justicia social. La presente investigación analiza la experiencia ecuatoriana entre 2007-2012 a la luz de la adopción su propio paradigma de desarrollo denominado Buen Vivir.

  19. MORFOLOGÍA POLÍNICA DE ESPECIES ARGENTINAS DE REBUTIA S. STR. (CACTACEAE, CACTOIDEAE)

    OpenAIRE

    Silvina Garralla; Nora B. Muruaga; Graciela Cuadrado

    2008-01-01

    Este trabajo analiza las características palinológicas de Rebutia deminuta, R. fabrisii var. fabrisii, R. fabrisii var. aureiflora, R. fiebrigii, R. marsoneri, R. minuscula subsp. minuscula, R. minuscula subsp. wessneriana y R. padcayensis con la finalidad de aportar datos que permitan la delimitación de estas especies. El material polínico procede de ejemplares coleccionados en distintas localidades montanas del noroeste argentino. Las observaciones, conteos y mediciones de los granos de ...

  20. Encuentros con Elena Poniatowska

    OpenAIRE

    Uzquiza González, José Ignacio

    2008-01-01

    El autor analiza, desde su encuentro con Elena Poniatowska, la vertiente de la literatura testimonial como literatura de mujeres. Un análisis interior de la relación entre realidad y ficción, entre Elena, Jesusa o Tinísima. The author analyzes testimonial literature from the perspective of female literature through his meeting with Elena Poniatowska. An analysis of reality vs. Fiction in Elena, Jesusa and Tinisima.

  1. El impacto del formato digital en la mediática del siglo XX. El caso de México

    Directory of Open Access Journals (Sweden)

    Lic. David Reynaldo Díaz Rascón

    2001-01-01

    Full Text Available Para quienes consideran nuevo el concepto de tecnologías en los medios masivos de información, cabe señalar de entrada que en la historia sólo un medio masivo no contó con el auxilio de la tecnología. El autor analiza la llegada de la telemática y aplica esa concepción a México.

  2. La neutralidad perpetua en el panorama mundial

    OpenAIRE

    2015-01-01

    Este documento analiza las caracteristicas de los países permanentes de Europa, así como algunas de las importantes restricciones a la libertad que implica la neutralidad permanente para la política exterior de estso países Europeor. Por último, se abordará un resumen sobre las condiciones políticas  de las que dependen la supervivencia y éxito de los países neutrales de Europa.

  3. Aspectos jurídicos de dos documentos sobre bioética (postura católica e informe Palacios, estudio sobre una antítesis)

    OpenAIRE

    Serrano Ruiz-Calderón, José Miguel

    1987-01-01

    El artículo analiza el informe parlamentario español sobre reproducción asistida que prefiguró la legislación que autorizaba la fivet en mujer sola, la limitación de investigación de paternidad biológica, la donación y encubiertamente la venta de ovulos y la producción de embriones sobrantes.

  4. Cognitive-motivational dimmensions and self-regulated learning

    OpenAIRE

    1996-01-01

    This paper discusses schoollearning from a cognitive-motivational perspective. A number of relevant ideas are highlighted as relevant to undersrand the cognitive-motivational factors that influence school learning. El artículo analiza el aprendizaje escolar donde una perspectiva cognitivo- motivacional, en la que se destacan una serie de ideas relevantes de profundizar en la comprensión de los factores cognitivo-motivacionales que inciden en el aprendizaje escolar.

  5. Metabolismo energético del corazón normal e infartado

    Directory of Open Access Journals (Sweden)

    Aurelio Mendoza Medellín

    2002-01-01

    Full Text Available Se realiza un estudio sobre la actividad del bombeo derivado del catabolismo de ácidos grasos, glucosa y lactato. Además, se analiza a la oclusión coronaria que determina la recepción de sustratos oxidables y oxígeno en parte del tejido cardiaco y se realiza una observación del exceso de Ca+2 intercelular el cual provoca muerte celular.

  6. Hacia un nuevo concepto de gestión pública

    Directory of Open Access Journals (Sweden)

    German Guerrero Chaparro

    1999-12-01

    Full Text Available Se analiza el proceso de transformación de la administración pública tradicional concebida como una simple "tramitadora" hacia una nueva administración receptiva y con capacidad real de respuesta a la evolución de las demandas de los clientes-ciudadanos, en donde los valores de eficiencia y eficacia adquieren una dimensión ampliada al incluirse criterios como efectividad, equidad, excelencia, sostenibilidad y ecología.

  7. Determinants of on-farm diversification: The case of farmers in Catalonia

    OpenAIRE

    Butinya, Lluis; Velazco, Jackeline; Rigall-I-Torrent, Ricard

    2014-01-01

    En las ultimas decadas, el sector agricola y ganadero en Espana ha experimentado una disminucion de su contribucion al PIB y al empleo. Dado que la industria alimentaria y el mantenimiento de los recursos naturales en las zonas rurales dependen de las explotaciones agricolas y ganaderas,, es relevante analizar la diversificacion de las explotaciones agricolas como estrategia para aumentar sy rentabilidad y evitar su abandono. Este trabajo analiza los factores que explican la participacion en ...

  8. BM: Tributación y concentración en el sistema financiero Colombiano 1989 - 2003

    OpenAIRE

    Martínez Ventura, Constanza

    2005-01-01

    El presente documento analiza los determinantes del margen de intermediación para el sistema financiero colombiano entre 1989 y 2003. Bajo una estimación dinámica de los efectos generados por variables específicas de actividad, impuestos y estructura de mercado, se presenta un seguimiento del margen de intermediación financiero, para un período que presenta elementos de liberalización y crisis.

  9. La educación de posgrado en España. Un estudio empírico de la estructura de motivaciones latentes

    Directory of Open Access Journals (Sweden)

    Joaquín Sánchez Herrera

    2009-12-01

    Full Text Available En este trabajo empírico se analiza la estructura de motivaciones que tienen los estudiantes hacia los estudios de posgrado, para poder describir las diferencias que existen entre ellos. Para esto se utiliza el análisis de clases latentes, cuyo resultado muestra tres grupos claramente separados en términos motivacionales, que exigen un tratamiento particular desde la perspectiva de las escuelas de negocios y universidades.

  10. Crear conocimiento colectivamente: aprendizaje organizacional y grupal

    OpenAIRE

    CARLOS MARÍA ALCOVER; FRANCISCO GIL

    2002-01-01

    El objetivo de este trabajo es analizar el aprendizaje colectivo, en qué consiste, en qué niveles se produce, qué condiciones requiere y qué resultados aporta. Se analiza en primer lugar el aprendizaje organizacional, abordando cuestiones conceptuales previas (como la distinción entre aprendizaje organizacional y organizaciones que aprenden); a continuación se revisan las contribuciones de distintas disciplinas, los niveles de aprendizaje, sus tipos o ciclos y los modelos explicativos, su ...

  11. Perspectiva analítica de la alianza sociología rural y cuestiones ambientales

    Directory of Open Access Journals (Sweden)

    Olga Lucía Méndez Polo

    2012-10-01

    reinterpretación, ilustrada en este texto a partir de investigaciones relevantes, comprende retos como la manera en que se analiza al habitante del campo, la relación de éste con los fenómenos naturales globales y locales, así como las tendencias geopolíticas que se evidencian en fenómenos como el nuevo papel de la agricultura en el país y sus impactos ambientales.

  12. Visualidades discursivas: la cuestión de la imagen en dos grupos juveniles de Bogotá

    Directory of Open Access Journals (Sweden)

    Arley Daza Cárdenas

    2011-04-01

    Full Text Available El artículo analiza la configuración de los diferentes medios expresivos utilizados por dos grupos juveniles de Bogotá. Se busca visibilizar las acciones singulares que estos colectivos despliegan de cara a un público impersonal con el que mantienen procesos tanto virtuales como físicos de afectación bidireccional, que generan distintos niveles reflexivos en sus subjetividades.

  13. Construcción participativa del regionalismo estratégico: ¿hacia una agenda medioambiental externa del Mercosur?

    Directory of Open Access Journals (Sweden)

    Amalia Stuhldreher

    2012-01-01

    Full Text Available El artículo analiza la búsqueda de posiciones comunes del Mercosur Ambiental, teniendo en cuenta la evolución del proceso regional. Desde el constructivismo social se pretende identificar las contribuciones de las comunidades epistémicas y de la sociedad civil para definir una agenda ambiental para Brasil y Argentina, y se describen algunas perspectivas.

  14. Análisis de la incidencia de la cooperación entre la Organización de las Naciones Unidas Para la Agricultura y la Alimentación (FAO) y el Programa Mundial de Alimentos (PMA) en la lucha contra el hambre en India. Periodo de estudio 2003-2007

    OpenAIRE

    Murillo Amador, Laura María

    2010-01-01

    Esta monografía analiza los factores que obstaculizan el alcance de la cooperación de la FAO y el PMA en la lucha contra el hambre en India, entre el 2003 y el 2007, a partir de las teorías: Neoliberalismo Institucional y Regímenes Internacionales de R. Keohane, además de algunos conceptos de W. Easterly

  15. de Murcia: Fuensanta de Lorca

    Directory of Open Access Journals (Sweden)

    Martín J. Lillo Carpio

    2007-01-01

    Full Text Available De acuerdo con las condiciones fi siográfi cas del entorno, se analiza el esquema básico de aprovechamiento de estas aguas mineromedicinales, casi inalterado en lo fundamental durante más de un siglo. Para ello se tienen en cuenta diversos factores concurrentes, entre los que destacan por un lado la poca estabilidad y duración de la actividad balnearia y por otro la escasez de medios y recursos sufi cientes.

  16. Modelos econometricos de capital humano: Principales enfoques y evidencia empirica

    OpenAIRE

    Neira, Isabel

    2003-01-01

    En este trabajo se realiza una revision a la literatura empirica de crecimiento economico, desde la vertiente del capital humano. Se analiza la consideracion de la educacion en la economia desde el pensamiento clasico hasta las mas actuales teorias de crecimiento endogeno, teniendo en cuenta efectos directos, como el efecto nivel y el efecto tasa, y efectos indirectos como el efecto inversion y otros. Se incluyen estimaciones cross-section y con datos de panel de los paises de la OCDE.

  17. Desarrollo sustentable y cambio institucional en la planificación urbana: el caso del Área Metropolitana de Monterrey (AMM

    Directory of Open Access Journals (Sweden)

    Ernesto Alfonso Robledo Leal

    2011-01-01

    Full Text Available Tomando en cuenta las limitantes que tienen los municipios de México, principalmente los metropolitanos, en el ámbito de la planificación, el presente artículo explora y analiza el caso de la amm y plantea la factibilidad de inducir un cambio institucional en la planificación urbana estableciendo como base las tesis del desarrollo sustentable, específicamente las relativas al desarrollo urbano.

  18. El Esfuerzo Físico en el Baile Flamenco de Principios del S. XX y el Actual

    Directory of Open Access Journals (Sweden)

    Alfonso Vargas Macías

    2008-06-01

    Full Text Available En este artículo se analiza como ha evolucionado el esfuerzo físico del baile flamenco a lo largo del último siglo. Se ha estudiado el tiempo que se dedica a las fases de braceo y zapateado, así como los tipos, velocidad y frecuencia de zapa- teado. En todas las variables analizadas, se ha observado mayores exigencias en el baile fla- menco actual.

  19. NACIONALISMO Y EDUCACIÓN: LA REFORMA EDUCATIVA DEL 2006 EN MÉXICO Y SU NUEVA VERSIÓN DE LA INDEPENDENCIA EN LOS LIBROS DE TEXTO DE EDUCACIÓN SECUNDARIA

    OpenAIRE

    CELINA PEÑA GUZMÁN

    2010-01-01

    El presente artículo analiza la relación entre el nacionalismo y la educación en los textos de historia a nivel secundaria. De 1993 a la fecha, la reforma educativa ha transformado la enseñanza de la historia. Los textos eliminaron narrativas clave de los eventos del pasado. El enfoque nacionalista en historia ha sido excluido en estos libros.

  20. Fronteras de la legalidad: bucaneros en el siglo xvii

    OpenAIRE

    Pérez Mejía, Ángela

    2011-01-01

    Este artículo analiza algunos de los informes oficiales sobre los ataques bucaneros y algunos de los relatos de testigos que declararon en juicio contra piratas, textos que revelan cómo eran representados los bucaneros en la retórica oficial y la forma cómo la España del siglo XVII asimiló su miedo a estos enemigos de su dominación en el caribe.