WorldWideScience

Sample records for amoeba

  1. [Testate amoebas of pine forests in Mexico].

    Science.gov (United States)

    Bobrov, A A; Krasil'nikov, P A

    2011-01-01

    The population of testate amoebas in the soils of pine forests in Mexico has been studied. In total, 68 species, varieties, and types of testate amoebas with cosmopolite distribution were found. The species diversity of the testate population includes hygrophilous species that differ from hygrophilous species with luvisols in higher andosols. Comparative analysis using the results of one available study of soil testate amoebas from Mexico has been carried out [Bonnet, 1977]. PMID:21870497

  2. Amoebae and Legionella pneumophila in saline environments

    OpenAIRE

    Gast, Rebecca J.; Moran, Dawn M.; Dennett, Mark R.; Wurtsbaugh, Wayne A.; Amaral- Zettler, Linda A.

    2011-01-01

    Amoeboid protists that harbor bacterial pathogens are of significant interest as potential reservoirs of disease-causing organisms in the environment, but little is known about them in marine and other saline environments. We enriched amoeba cultures from sediments from four sites in the New England estuarine system of Mt. Hope Bay, Massachusetts and from sediments from six sites in the Great Salt Lake, Utah. Cultures of amoebae were enriched using both minimal- and non-nutrient agar plates, ...

  3. Amoebas of Complex Hypersurfaces in Statistical Thermodynamics

    Energy Technology Data Exchange (ETDEWEB)

    Passare, Mikael [Stockholm University, Department of Mathematics (Sweden); Pochekutov, Dmitry, E-mail: potchekutov@gmail.com [Siberian Federal University, Institute of Core Undergraduate Programmes (Russian Federation); Tsikh, August, E-mail: atsikh@sfu-kras.ru [Siberian Federal University, Institute of Mathematics (Russian Federation)

    2013-03-15

    The amoeba of a complex hypersurface is its image under the logarithmic projection. A number of properties of algebraic hypersurface amoebas are carried over to the case of transcendental hypersurfaces. We demonstrate the potential that amoebas can bring into statistical physics by considering the problem of energy distribution in a quantum thermodynamic ensemble. The spectrum {l_brace}{epsilon}{sub k}{r_brace} Subset-Of Z{sup n} of the ensemble is assumed to be multidimensional; this leads us to the notions of multidimensional temperature and a vector of differential thermodynamic forms. Strictly speaking, in the paper we develop the multidimensional Darwin-Fowler method and give the description of the domain of admissible average values of energy for which the thermodynamic limit exists.

  4. Experiences with the Amoeba distributed operating system

    NARCIS (Netherlands)

    Tanenbaum, Andrew S.; Renesse, van Robbert; Staveren, van Hans; Sharp, Gregory J.; Mullender, Sape J.; Jansen, Jack; Rossum, van Guido

    1990-01-01

    The Amoeba project is a research effort aimed at understanding how to connect multiple computers in a seamless way [16, 17, 26, 27, 31]. The basic idea is to provide the users with the illusion of a single powerful timesharing system, when, in fact, the system is implemented on a collection of machi

  5. Streaming instability of aggregating slime mold amoebae

    Science.gov (United States)

    Levine, Herbert; Reynolds, William

    1991-05-01

    We propose a new model of aggregation in the cellular slime mold D. Discoideum. Our approach couples the excitable signaling system to amoeba chemotaxis; the resultant system of equations is tractable to analytical and numerical approaches. Using our model, we derive the existence of a streaming instability for the concentric target aggregation pattern.

  6. Intersecting Solitons, Amoeba and Tropical Geometry

    CERN Document Server

    Fujimori, Toshiaki; Ohta, Kazutoshi; Sakai, Norisuke; Yamazaki, Masahito

    2008-01-01

    We study generic intersection (or web) of vortices with instantons inside, which is a 1/4 BPS state in the Higgs phase of five-dimensional N=1 supersymmetric U(Nc) gauge theory on R_t \\times (C^\\ast)^2 \\simeq R^{2,1} \\times T^2 with Nf=Nc Higgs scalars in the fundamental representation. In the case of the Abelian-Higgs model (Nf=Nc=1), the intersecting vortex sheets can be beautifully understood in a mathematical framework of amoeba and tropical geometry, and we propose a dictionary relating solitons and gauge theory to amoeba and tropical geometry. A projective shape of vortex sheets is described by the amoeba. Vortex charge density is uniformly distributed among vortex sheets, and negative contribution to instanton charge density is understood as the complex Monge-Ampere measure with respect to a plurisubharmonic function on (C^\\ast)^2. The Wilson loops in T^2 are related with derivatives of the Ronkin function. The general form of the Kahler potential and the asymptotic metric of the moduli space of a vort...

  7. Combinatorial Optimization by Amoeba-Based Neurocomputer with Chaotic Dynamics

    Science.gov (United States)

    Aono, Masashi; Hirata, Yoshito; Hara, Masahiko; Aihara, Kazuyuki

    We demonstrate a computing system based on an amoeba of a true slime mold Physarum capable of producing rich spatiotemporal oscillatory behavior. Our system operates as a neurocomputer because an optical feedback control in accordance with a recurrent neural network algorithm leads the amoeba's photosensitive branches to search for a stable configuration concurrently. We show our system's capability of solving the traveling salesman problem. Furthermore, we apply various types of nonlinear time series analysis to the amoeba's oscillatory behavior in the problem-solving process. The results suggest that an individual amoeba might be characterized as a set of coupled chaotic oscillators.

  8. Sucker-like structures on the pathogenic amoeba Naegleria fowleri.

    OpenAIRE

    John, D T; Cole, T B; Marciano-Cabral, F M

    1984-01-01

    Using scanning electron microscopy, we observed sucker-like structures on amoebae of 13 human isolates of Naegleria fowleri. The number of suckers per amoeba seemed to vary according to the virulence of the strain. We propose the term amoebastome to describe this unique sucker-like structure of N. fowleri.

  9. Sucker-like structures on the pathogenic amoeba Naegleria fowleri.

    Science.gov (United States)

    John, D T; Cole, T B; Marciano-Cabral, F M

    1984-01-01

    Using scanning electron microscopy, we observed sucker-like structures on amoebae of 13 human isolates of Naegleria fowleri. The number of suckers per amoeba seemed to vary according to the virulence of the strain. We propose the term amoebastome to describe this unique sucker-like structure of N. fowleri. Images PMID:6696410

  10. Anticipation of periodic environmental changes in an amoeba

    Science.gov (United States)

    Saigusa, Tetsu; Nakagaki, Toshiyuki

    2007-07-01

    The amoeboid organism of true slime mold, the plasmodium of Physarum polycephalum, had capacity of memorizing a periodic event. The organism showed vigorous locomotion in the favorite conditions. When stimulation of the unfavorable conditions was given in a pulse-like regime and was repeated three times at interval of 60 minutes, the amoeba reduced the locomotion speed in response to each pulse. Even though the favorite conditions were kept to be constant after the periodic pulses, the amoeba spontaneously reduced the locomotion speed at the timing of next pulse (after 60 minutes). This means that the amoeba anticipated the next environmental change.

  11. Endocannabinoids inhibit the growth of free-living amoebae.

    Science.gov (United States)

    Dey, Rafik; Pernin, Pierre; Bodennec, Jacques

    2010-07-01

    The cannabinoid Delta(9)-tetrahydrocannabinol inhibits the growth of some pathogenic amoebae in vitro and exacerbates amoebic encephalitis in animal models. However, the effects of endogenous cannabinoids on amoebae remain unknown. Therefore, we tested several endocannabinoids (N-acyl ethanolamines and 2-O-acyl glycerol) on different genera of amoebae. The results showed that all of the endocannabinoids tested inhibit amoebic growth at subpharmacological doses, with 50% inhibitory concentrations ranging from 15 to 20 microM. A nonhydrolyzable endocannabinoid had similar effects, showing that the inhibition seen results from endocannabinoids per se rather than from a catabolic product. PMID:20479202

  12. Elemental maps of Amoeba proteus by a scanning proton microprobe

    International Nuclear Information System (INIS)

    Elemental maps for P, S, Cl, K, Ca and Zn of individual Amoeba proteus were obtained with the Melbourne scanning proton microprobe. The emphasis was put on the relationship of both distribution and concentration of Zn within the cell and the growth inhibitory effect of higher Zn concentrations in the culture medium. At a concentration of 0.04 mmol ZnCl2. Amoeba growth was inhibited. But at a concentration of 0.0016 mmol, the Amoeba grew as well as a control grown without addition of Zn. We found that in the former (0.04 mmol) Zn concentrated three times more than in the latter (0.0016 mmol), and also that Zn was enriched much more in the nucleus and endoplasm (five to six times) than in other parts of the cell (two times). Future work along these lines may provide insight into the mechanism by which Zn affects the growth of Amoeba proteus and other cells. (orig.)

  13. [Non-pathogenic intestinal amoebae: a clinical-analytical overview].

    Science.gov (United States)

    Sard, Bárbara Gomila; Navarro, Rafael Toledo; Esteban Sanchis, J Guillermo

    2011-03-01

    Human beings can be parasitized by various species of intestinal amoebae. Entamoeba histolytica is the only intestinal amoeba recognized to be pathogenic, while other amoeba species, E. dispar, E. moshkovskii, E. hartmanni, E. coli, E. polecki, Endolimax nana and Iodamoeba buetschlii are considered to be non-pathogenic. The aim of this review is to synthesize the main morphological characteristics of the trophozoite and cyst stages of each amoeba as the basis for precise microscopical diagnosis. The difficulty of morphological differentiation among species included in the so-called "Entamoeba complex" entails the use of immunological and molecular diagnoses. In addition, a summary of basic epidemiological, therapeutic and prophylactic aspects of these non-pathogenic amoebae is provided. All of these aspects are crucial since these amoebae are usually found to be present in human coproparasitological analyses and must be differentiated from the pathogenic species E. histolytica. Furthermore, they can be used as suitable biological tags of the hygienic state of the environment and the health and hygiene measures of the population. PMID:21458707

  14. Significance testing testate amoeba water table reconstructions

    Science.gov (United States)

    Payne, Richard J.; Babeshko, Kirill V.; van Bellen, Simon; Blackford, Jeffrey J.; Booth, Robert K.; Charman, Dan J.; Ellershaw, Megan R.; Gilbert, Daniel; Hughes, Paul D. M.; Jassey, Vincent E. J.; Lamentowicz, Łukasz; Lamentowicz, Mariusz; Malysheva, Elena A.; Mauquoy, Dmitri; Mazei, Yuri; Mitchell, Edward A. D.; Swindles, Graeme T.; Tsyganov, Andrey N.; Turner, T. Edward; Telford, Richard J.

    2016-04-01

    Transfer functions are valuable tools in palaeoecology, but their output may not always be meaningful. A recently-developed statistical test ('randomTF') offers the potential to distinguish among reconstructions which are more likely to be useful, and those less so. We applied this test to a large number of reconstructions of peatland water table depth based on testate amoebae. Contrary to our expectations, a substantial majority (25 of 30) of these reconstructions gave non-significant results (P > 0.05). The underlying reasons for this outcome are unclear. We found no significant correlation between randomTF P-value and transfer function performance, the properties of the training set and reconstruction, or measures of transfer function fit. These results give cause for concern but we believe it would be extremely premature to discount the results of non-significant reconstructions. We stress the need for more critical assessment of transfer function output, replication of results and ecologically-informed interpretation of palaeoecological data.

  15. Shedding light on vampires: the phylogeny of vampyrellid amoebae revisited.

    Directory of Open Access Journals (Sweden)

    Sebastian Hess

    Full Text Available With the advent of molecular phylogenetic techniques the polyphyly of naked filose amoebae has been proven. They are interspersed in several supergroups of eukaryotes and most of them already found their place within the tree of life. Although the 'vampire amoebae' have attracted interest since the middle of the 19th century, the phylogenetic position and even the monophyly of this traditional group are still uncertain. In this study clonal co-cultures of eight algivorous vampyrellid amoebae and the respective food algae were established. Culture material was characterized morphologically and a molecular phylogeny was inferred using SSU rDNA sequence comparisons. We found that the limnetic, algivorous vampyrellid amoebae investigated in this study belong to a major clade within the Endomyxa Cavalier-Smith, 2002 (Cercozoa, grouping together with a few soil-dwelling taxa. They split into two robust clades, one containing species of the genus Vampyrella Cienkowski, 1865, the other containing the genus Leptophrys Hertwig & Lesser, 1874, together with terrestrial members. Supported by morphological data these clades are designated as the two families Vampyrellidae Zopf, 1885, and Leptophryidae fam. nov. Furthermore the order Vampyrellida West, 1901 was revised and now corresponds to the major vampyrellid clade within the Endomyxa, comprising the Vampyrellidae and Leptophryidae as well as several environmental sequences. In the light of the presented phylogenetic analyses morphological and ecological aspects, the feeding strategy and nutritional specialization within the vampyrellid amoebae are discussed.

  16. Cellular Response of the Amoeba Acanthamoeba castellanii to Chlorine, Chlorine Dioxide, and Monochloramine Treatments ▿

    OpenAIRE

    Mogoa, Emerancienne; Bodet, Charles; Morel, Franck; Rodier, Marie-Hélène; Legube, Bernard; Héchard, Yann

    2011-01-01

    Acanthamoeba castellanii is a free-living amoebae commonly found in water systems. Free-living amoebae might be pathogenic but are also known to bear phagocytosis-resistant bacteria, protecting these bacteria from water treatments. The mode of action of these treatments is poorly understood, particularly on amoebae. It is important to examine the action of these treatments on amoebae in order to improve them. The cellular response to chlorine, chlorine dioxide, and monochloramine was tested o...

  17. Amoeba-resisting bacteria found in multilamellar bodies secreted by Dictyostelium discoideum: social amoebae can also package bacteria.

    Science.gov (United States)

    Paquet, Valérie E; Charette, Steve J

    2016-03-01

    Many bacteria can resist phagocytic digestion by various protozoa. Some of these bacteria (all human pathogens) are known to be packaged in multilamellar bodies produced in the phagocytic pathway of the protozoa and that are secreted into the extracellular milieu. Packaged bacteria are protected from harsh conditions, and the packaging process is suspected to promote bacterial persistence in the environment. To date, only a limited number of protozoa, belonging to free-living amoebae and ciliates, have been shown to perform bacteria packaging. It is still unknown if social amoebae can do bacteria packaging. The link between the capacity of 136 bacterial isolates to resist the grazing of the social amoeba Dictyostelium discoideum and to be packaged by this amoeba was investigated in the present study. The 45 bacterial isolates displaying a resisting phenotype were tested for their capacity to be packaged. A total of seven isolates from Cupriavidus, Micrococcus, Microbacterium and Rathayibacter genera seemed to be packaged and secreted by D. discoideum based on immunofluorescence results. Electron microscopy confirmed that the Cupriavidus and Rathayibacter isolates were formally packaged. These results show that social amoebae can package some bacteria from the environment revealing a new aspect of microbial ecology. PMID:26862140

  18. Advances in the knowledge of amphizoic amoebae infecting fish

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Lom, Jiří

    2004-01-01

    Roč. 51, 2/3 (2004), s. 81-97. ISSN 0015-5683 R&D Projects: GA AV ČR IAA6022202 Institutional research plan: CEZ:AV0Z6022909 Keywords : amphizoic amoebae * fish hosts * review Subject RIV: EA - Cell Biology Impact factor: 0.837, year: 2004

  19. The genome of the social amoeba Dictyostelium discoideum

    DEFF Research Database (Denmark)

    Eichinger, L; Pachebat, J A; Glöckner, G; Rajandream, M-A; Sucgang, R; Berriman, M; Song, J; Olsen, R; Szafranski, K; Xu, Q; Tunggal, B; Kummerfeld, S; Madera, M; Konfortov, B A; Rivero, F; Bankier, A T; Lehmann, R; Hamlin, N; Davies, R; Gaudet, P; Fey, P; Pilcher, K; Chen, G; Saunders, D; Sodergren, E; Davis, P; Kerhornou, A; Nie, X; Hall, N; Anjard, C; Hemphill, L; Bason, N; Farbrother, P; Desany, B; Just, E; Morio, T; Rost, R; Churcher, C; Cooper, J; Haydock, S; van Driessche, N; Cronin, A; Goodhead, I; Muzny, D; Mourier, T; Pain, A; Lu, M; Harper, D; Lindsay, R; Hauser, H; James, K; Quiles, M; Madan Babu, M; Saito, T; Buchrieser, C; Wardroper, A; Felder, M; Thangavelu, M; Johnson, D; Knights, A; Loulseged, H; Mungall, K; Oliver, K; Price, C; Quail, M A; Urushihara, H; Hernandez, J; Rabbinowitsch, E; Steffen, D; Sanders, M; Ma, J; Kohara, Y; Sharp, S; Simmonds, M; Spiegler, S; Tivey, A; Sugano, S; White, B; Walker, D; Woodward, J; Winckler, T; Tanaka, Y; Shaulsky, G; Schleicher, M; Weinstock, G; Rosenthal, A; Cox, E C; Chisholm, R L; Gibbs, R; Loomis, W F; Platzer, M; Kay, R R; Williams, J; Dear, P H; Noegel, A A; Barrell, B; Kuspa, A

    2005-01-01

    The social amoebae are exceptional in their ability to alternate between unicellular and multicellular forms. Here we describe the genome of the best-studied member of this group, Dictyostelium discoideum. The gene-dense chromosomes of this organism encode approximately 12,500 predicted proteins, a...

  20. Checklist, diversity and distribution of testate amoebae in Chile.

    Science.gov (United States)

    Fernández, Leonardo D; Lara, Enrique; Mitchell, Edward A D

    2015-10-01

    Bringing together more than 170 years of data, this study represents the first attempt to construct a species checklist and analyze the diversity and distribution of testate amoebae in Chile, a country that encompasses the southwestern region of South America, countless islands and part of the Antarctic. In Chile, known diversity includes 416 testate amoeba taxa (64 genera, 352 infrageneric taxa), 24 of which are here reported for the first time. Species-accumulation plots show that in Chile, the number of testate amoeba species reported has been continually increasing since the mid-19th century without leveling off. Testate amoebae have been recorded in 37 different habitats, though they are more diverse in peatlands and rainforest soils. Only 11% of species are widespread in continental Chile, while the remaining 89% of the species exhibit medium or short latitudinal distribution ranges. Also, species composition of insular Chile and the Chilean Antarctic territory is a depauperated subset of that found in continental Chile. Nearly, the 10% of the species reported here are endemic to Chile and many of them are distributed only within the so-called Chilean biodiversity hotspot (ca. 25° S-47° S). These findings are here thoroughly discussed in a biogeographical and evolutionary context. PMID:26340665

  1. Current status of the AMOEBA polarizable force field.

    Science.gov (United States)

    Ponder, Jay W; Wu, Chuanjie; Ren, Pengyu; Pande, Vijay S; Chodera, John D; Schnieders, Michael J; Haque, Imran; Mobley, David L; Lambrecht, Daniel S; DiStasio, Robert A; Head-Gordon, Martin; Clark, Gary N I; Johnson, Margaret E; Head-Gordon, Teresa

    2010-03-01

    Molecular force fields have been approaching a generational transition over the past several years, moving away from well-established and well-tuned, but intrinsically limited, fixed point charge models toward more intricate and expensive polarizable models that should allow more accurate description of molecular properties. The recently introduced AMOEBA force field is a leading publicly available example of this next generation of theoretical model, but to date, it has only received relatively limited validation, which we address here. We show that the AMOEBA force field is in fact a significant improvement over fixed charge models for small molecule structural and thermodynamic observables in particular, although further fine-tuning is necessary to describe solvation free energies of drug-like small molecules, dynamical properties away from ambient conditions, and possible improvements in aromatic interactions. State of the art electronic structure calculations reveal generally very good agreement with AMOEBA for demanding problems such as relative conformational energies of the alanine tetrapeptide and isomers of water sulfate complexes. AMOEBA is shown to be especially successful on protein-ligand binding and computational X-ray crystallography where polarization and accurate electrostatics are critical. PMID:20136072

  2. Diagnosis of Infections Caused by Pathogenic Free-Living Amoebae

    Directory of Open Access Journals (Sweden)

    Bruno da Rocha-Azevedo

    2009-01-01

    Full Text Available Naegleria fowleri, Acanthamoeba spp., Balamuthia mandrillaris, and Sappinia sp. are pathogenic free-living amoebae. N. fowleri causes Primary Amoebic Meningoencephalitis, a rapidly fatal disease of the central nervous system, while Acanthamoeba spp. and B. mandrillaris cause chronic granulomatous encephalitis. Acanthamoeba spp. also can cause cutaneous lesions and Amoebic Keratitis, a sight-threatening infection of the cornea that is associated with contact lens use or corneal trauma. Sappinia pedata has been identified as the cause of a nonlethal case of amoebic encephalitis. In view of the potential health consequences due to infection with these amoebae, rapid diagnosis is critical for early treatment. Microscopic examination and culture of biopsy specimens, cerebral spinal fluid (CSF, and corneal scrapings have been used in the clinical laboratory. For amoebic keratitis, confocal microscopy has been used to successfully identify amoebae in corneal tissue. More recently, conventional and real-time PCR assays have been developed that are sensitive and specific for the amoebae. In addition, multiplex PCR assays are available for the rapid identification of these pathogens in biopsy tissue, CSF, and corneal specimens.

  3. Counting Legionella cells within single amoeba host cells

    Science.gov (United States)

    Here we present the first attempt to quantify L. pneumophila cell numbers within individual amoebae hosts that may be released into engineered water systems. The maximum numbers of culturable L. pneumophila cells grown within Acanthamoeba polyphaga and Naegleria fowleri were 134...

  4. Methodology to Implement an Amoeba Complex Object Server

    NARCIS (Netherlands)

    Teeuw, Wouter B.; Blanken, Henk M.

    1992-01-01

    The paper describes the methodology used in the design of a complex object server application for the Amoeba distributed operating system. It uses the top-down design that was suggested by Parnas, in which a model is turned into an implementation by gradually adding details. The paper also describes

  5. Molecular Epidemiology of Human Intestinal Amoebas in Iran

    Directory of Open Access Journals (Sweden)

    M Rezaian

    2012-09-01

    Full Text Available Many microscopic-based epidemiological surveys on the prevalence of human intestinal pathogenic and non-pathogenic protozoa including intestinal amoeba performed in Iran show a high prevalence of human intestinal amoeba in different parts of Iran. Such epidemiological studies on amoebiasis are confusing, mainly due to recently appreciated distinction between the Entamoeba histolytica, E. dispar and E. moshkovskii. Differential diagnosis can be done by some methods such as PCR-based methods, monoclonal antibodies and the analysis of isoenzyme typing, however the molecular study of these protozoa in Iran is low. Based on molecular studies, it seems that E. dispar is predominant species especially in the central and northern areas of Iran and amoebiasis due to E. histolytica is a rare infection in the country. It is suggested that infection with E. moshkovskii may be common among Iranians. Considering the importance of molecular epidemiology of amoeba in Iran and also the current data, the present study reviews the data currently available on the molecular distribution of intestinal human amoeba in Iran.

  6. Complement sensitivity of Entamoeba histolytica and various nonpathogenic amoeba species.

    Science.gov (United States)

    Förster, B; Ebert, F; Horstmann, R D

    1994-12-01

    Culture forms of the potentially pathogenic Entamoeba histolytica were compared to those of the nonpathogenic species of E. dispar, E. hartmanni, E. coli, Endolimax nana, and E. moshkovskii regarding the sensitivity to lysis by human complement activated through the alternative pathway. E. dispar was found unique in its complement resistance; all other nonpathogenic isolates resembled E. histolytica in that they were complement sensitive. Thus, a state of complement sensitivity is not a particular property of potentially pathogenic amoebae. PMID:7716404

  7. Genetic Variation in the Free-Living Amoeba Naegleria fowleri

    OpenAIRE

    Pélandakis, Michel; De Jonckheere, Johan F; Pernin, Pierre

    1998-01-01

    In this study, 30 strains of the pathogenic free-living amoeba Naegleria fowleri were investigated by using the randomly amplified polymorphic DNA (RAPD) method. The present study confirmed our previous finding that RAPD variation is not correlated with geographical origin. In particular, Mexican strains belong to the variant previously detected in Asia, Europe, and the United States. In France, surprisingly, strains from Cattenom gave RAPD patterns identical to those of the Japanese strains....

  8. Current Status of the AMOEBA Polarizable Force Field

    OpenAIRE

    Ponder, Jay W.; Wu, Chuanjie; Ren, Pengyu; Pande, Vijay S.; Chodera, John D.; Schnieders, Michael J; Haque, Imran; Mobley, David L.; Lambrecht, Daniel S.; DiStasio, Robert A.; Head-Gordon, Martin; Clark, Gary N. I.; Johnson, Margaret E.; Head-Gordon, Teresa

    2010-01-01

    Molecular force fields have been approaching a generational transition over the past several years, moving away from well-established and well-tuned, but intrinsically limited, fixed point charge models towards more intricate and expensive polarizable models that should allow more accurate description of molecular properties. The recently introduced AMOEBA force field is a leading publicly available example of this next generation of theoretical model, but to date has only received relatively...

  9. Automation of AMOEBA polarizable force field parameterization for small molecules

    OpenAIRE

    Wu, Johnny C.; Chattree, Gaurav; Ren, Pengyu

    2012-01-01

    A protocol to generate parameters for the AMOEBA polarizable force field for small organic molecules has been established, and polarizable atomic typing utility, Poltype, which fully automates this process, has been implemented. For validation, we have compared with quantum mechanical calculations of molecular dipole moments, optimized geometry, electrostatic potential, and conformational energy for a variety of neutral and charged organic molecules, as well as dimer interaction energies of a...

  10. Methodology to Implement an Amoeba Complex Object Server

    OpenAIRE

    Teeuw, Wouter B.; Blanken, Henk M.

    1992-01-01

    The paper describes the methodology used in the design of a complex object server application for the Amoeba distributed operating system. It uses the top-down design that was suggested by Parnas, in which a model is turned into an implementation by gradually adding details. The paper also describes the abstraction levels that show up if going from a specification of the behaviour towards an implementation, and shows the methodology in which performance will be measured (instead of estimated)...

  11. The chastity of amoebae: re-evaluating evidence for sex in amoeboid organisms

    OpenAIRE

    Lahr, Daniel J.G; Parfrey, Laura Wegener; Mitchell, Edward A. D.; Katz, Laura A.; Lara, Enrique

    2011-01-01

    Amoebae are generally assumed to be asexual. We argue that this view is a relict of early classification schemes that lumped all amoebae together inside the ‘lower’ protozoa, separated from the ‘higher’ plants, animals and fungi. This artificial classification allowed microbial eukaryotes, including amoebae, to be dismissed as primitive, and implied that the biological rules and theories developed for macro-organisms need not apply to microbes. Eukaryotic diversity is made up of 70+ lineages,...

  12. Pathogenic Free-Living Amoebae Isolated From Contact Lenses of Keratitis Patients

    Directory of Open Access Journals (Sweden)

    Elham HAJIALILO

    2015-12-01

    Full Text Available Background: Free-living amoeba (FLA-related keratitis is a progressive infection of the cornea with poor prognosis. The present study aimed to investigates the con­tact lenses of patients with keratitis for pathogenic free-living amoebae.Methods: Overall, 62 contact lenses and their paraphernalia of patients with kerati­tis cultured and tested for the presence of free-living amoebae using morphological criteria. Unusual plates including plates containing mix amoebae and Vermamoeba were submitted to molecular analysis. Results: Out of 62 plates, 11 revealed the outgrowth of free living amoeba of which 9 were Acanthamoeba, one plates contained mix amoebae including Acan­thamoeba and Vermamoeba and one showed the presence of Vermamoeba. These two latter plates belonged to patients suffered from unilateral keratitis due to the mis­used of soft contact lenses. One of the patients had mix infection of Acanthamoeba (T4 and V. vermiformis meanwhile the other patient was infected with the V. vermiformis. Conclusion: Amoebic keratitis continues to rise in Iran and worldwide. To date, various genera of free-living amoebae such as Vermamoeba could be the causative agent of keratitis. Soft contact lens wearers are the most affected patients in the country, thus awareness of high-risk people for preventing free-living amoebae re­lated keratitis is of utmost importance.

  13. IDENTIFICATION OF Pseudomonas spp. AS AMOEBA-RESISTANT MICROORGANISMS IN ISOLATES OF Acanthamoeba

    Directory of Open Access Journals (Sweden)

    Vinicius José Maschio

    2015-02-01

    Full Text Available Acanthamoeba is a “Trojan horse” of the microbial world. The aim of this study was to identify the presence of Pseudomonas as an amoeba-resistant microorganism in 12 isolates of Acanthamoeba. All isolates showed the genus Pseudomonas spp. as amoeba-resistant microorganisms. Thus, one can see that the Acanthamoeba isolates studied are hosts of Pseudomonas.

  14. AMOEBA: Designing for Collaboration in Computer Science Classrooms through Live Learning Analytics

    Science.gov (United States)

    Berland, Matthew; Davis, Don; Smith, Carmen Petrick

    2015-01-01

    AMOEBA is a unique tool to support teachers' orchestration of collaboration among novice programmers in a non-traditional programming environment. The AMOEBA tool was designed and utilized to facilitate collaboration in a classroom setting in real time among novice middle school and high school programmers utilizing the IPRO programming…

  15. Pack hunting by a common soil amoeba on nematodes.

    Science.gov (United States)

    Geisen, Stefan; Rosengarten, Jamila; Koller, Robert; Mulder, Christian; Urich, Tim; Bonkowski, Michael

    2015-11-01

    Soils host the most complex communities on Earth, including the most diverse and abundant eukaryotes, i.e. heterotrophic protists. Protists are generally considered as bacterivores, but evidence for negative interactions with nematodes both from laboratory and field studies exist. However, direct impacts of protists on nematodes remain unknown. We isolated the soil-borne testate amoeba Cryptodifflugia operculata and found a highly specialized and effective pack-hunting strategy to prey on bacterivorous nematodes. Enhanced reproduction in presence of prey nematodes suggests a beneficial predatory life history of these omnivorous soil amoebae. Cryptodifflugia operculata appears to selectively impact the nematode community composition as reductions of nematode numbers were species specific. Furthermore, we investigated 12 soil metatranscriptomes from five distinct locations throughout Europe for 18S ribosomal RNA transcripts of C. operculata. The presence of C. operculata transcripts in all samples, representing up to 4% of the active protist community, indicates a potential ecological importance of nematophagy performed by C. operculata in soil food webs. The unique pack-hunting strategy on nematodes that was previously unknown from protists, together with molecular evidence that these pack hunters are likely to be abundant and widespread in soils, imply a considerable importance of the hitherto neglected trophic link 'nematophagous protists' in soil food webs. PMID:26079718

  16. Amoebae as Potential Environmental Hosts for Mycobacterium ulcerans and Other Mycobacteria, but Doubtful Actos in Buruli Ulcer Epidemiology

    DEFF Research Database (Denmark)

    Gryseels, Sophie; Amissah, Diana; Durnez, Lies; Vandelannoote, Koen; Leirs, Herwig; De Jonckheere, Johan; Silva, Manuel T.; Portaels, Francoise; Ablordey, Anthony; Eddyani, Miriam

    2012-01-01

    Ghana, from which we cultivated amoeboid protozoa and mycobacteria. M. ulcerans was not isolated, but other mycobacteria were as frequently isolated from intracellular as from extracellular sources, suggesting that they commonly infect amoebae in nature. We screened the samples as well as the amoeba...... cultures for the M. ulcerans markers IS2404, IS2606 and KR-B. IS2404 was detected in 2% of the environmental samples and in 4% of the amoeba cultures. The IS2404 positive amoeba cultures included up to 5 different protozoan species, and originated both from Buruli ulcer endemic and non-endemic communities....... Conclusions/Significance This is the first report of experimental infection of amoebae with M. ulcerans and of the detection of the marker IS2404 in amoeba cultures isolated from the environment. We conclude that amoeba are potential natural hosts for M. ulcerans, yet remain sceptical about their implication...

  17. SPATIAL-VARIANT MORPHOLOGICAL FILTERS WITH NONLOCAL-PATCH-DISTANCE-BASED AMOEBA KERNEL FOR IMAGE DENOISING

    Directory of Open Access Journals (Sweden)

    Shuo Yang

    2015-01-01

    Full Text Available Filters of the Spatial-Variant amoeba morphology can preserve edges better, but with too much noise being left. For better denoising, this paper presents a new method to generate structuring elements for Spatially-Variant amoeba morphology.  The amoeba kernel in the proposed strategy is divided into two parts: one is the patch distance based amoeba center, and another is the geodesic distance based amoeba boundary, by which the nonlocal patch distance and local geodesic distance are both taken into consideration. Compared to traditional amoeba kernel, the new one has more stable center and its shape can be less influenced by noise in pilot image. What’s more important is that the nonlocal processing approach can induce a couple of adjoint dilation and erosion, and combinations of them can construct adaptive opening, closing, alternating sequential filters, etc. By designing the new amoeba kernel, a family of morphological filters therefore is derived. Finally, this paper presents a series of results on both synthetic and real images along with comparisons with current state-of-the-art techniques, including novel applications to medical image processing and noisy SAR image restoration.

  18. Endosymbiotic bacteria associated with nematodes, ticks and amoebae.

    Science.gov (United States)

    Taylor, Mark; Mediannikov, Oleg; Raoult, Didier; Greub, Gilbert

    2012-02-01

    Endosymbiosis is a mutualistic, parasitic or commensal symbiosis in which one symbiont is living within the body of another organism. Such symbiotic relationship with free-living amoebae and arthropods has been reported with a large biodiversity of microorganisms, encompassing various bacterial clades and to a lesser extent some fungi and viruses. By contrast, current knowledge on symbionts of nematodes is still mainly restricted to Wolbachia and its interaction with filarial worms that lead to increased pathogenicity of the infected nematode. In this review article, we aim to highlight the main characteristics of symbionts in term of their ecology, host cell interactions, parasitism and co-evolution, in order to stimulate future research in a field that remains largely unexplored despite the availability of modern tools. PMID:22126456

  19. Streaming instability of slime mold amoebae: An analytical model

    Science.gov (United States)

    Höfer, Thomas; Maini, Philip K.

    1997-08-01

    During the aggregation of amoebae of the cellular slime mould Dictyostelium, the interaction of chemical waves of the signaling molecule cAMP with cAMP-directed cell movement causes the breakup of a uniform cell layer into branching patterns of cell streams. Recent numerical and experimental investigations emphasize the pivotal role of the cell-density dependence of the chemical wave speed for the occurrence of the streaming instability. A simple, analytically tractable, model of Dictyostelium aggregation is developed to test this idea. The interaction of cAMP waves with cAMP-directed cell movement is studied in the form of coupled dynamics of wave front geometries and cell density. Comparing the resulting explicit instability criterion and dispersion relation for cell streaming with the previous findings of model simulations and numerical stability analyses, a unifying interpretation of the streaming instability as a cAMP wave-driven chemotactic instability is proposed.

  20. Large scale spontaneous synchronization of cell cycles in amoebae

    Science.gov (United States)

    Segota, Igor; Boulet, Laurent; Franck, Carl

    2014-03-01

    Unicellular eukaryotic amoebae Dictyostelium discoideum are generally believed to grow in their vegetative state as single cells until starvation, when their collective aspect emerges and they differentiate to form a multicellular slime mold. While major efforts continue to be aimed at their starvation-induced social aspect, our understanding of population dynamics and cell cycle in the vegetative growth phase has remained incomplete. We show that substrate-growtn cell populations spontaneously synchronize their cell cycles within several hours. These collective population-wide cell cycle oscillations span millimeter length scales and can be completely suppressed by washing away putative cell-secreted signals, implying signaling by means of a diffusible growth factor or mitogen. These observations give strong evidence for collective proliferation behavior in the vegetative state and provide opportunities for synchronization theories beyond classic Kuramoto models.

  1. Genetic Variation in the Free-Living Amoeba Naegleria fowleri

    Science.gov (United States)

    Pélandakis, Michel; De Jonckheere, Johan F.; Pernin, Pierre

    1998-01-01

    In this study, 30 strains of the pathogenic free-living amoeba Naegleria fowleri were investigated by using the randomly amplified polymorphic DNA (RAPD) method. The present study confirmed our previous finding that RAPD variation is not correlated with geographical origin. In particular, Mexican strains belong to the variant previously detected in Asia, Europe, and the United States. In France, surprisingly, strains from Cattenom gave RAPD patterns identical to those of the Japanese strains. In addition, all of these strains, together with an additional French strain from Chooz, exhibited similarities to South Pacific strains. The results also confirmed the presence of numerous variants in Europe, whereas only two variants were detected in the United States. The two variants found in the United States were different from the South Pacific variants. These findings do not support the previous hypothesis concerning the origin and modes of dispersal of N. fowleri. PMID:9687460

  2. Water from ambient to supercritical conditions with the AMOEBA model.

    Science.gov (United States)

    Chipman, Daniel M

    2013-05-01

    The flexible polarizable AMOEBA force field for water is tested with classical molecular dynamics simulations from ambient up to supercritical conditions. Good results are obtained for the heat of vaporization, dielectric constant, self-diffusion constant, and radial distribution functions provided densities are fixed at the experimental values. If instead the densities are allowed to relax to those characteristic of the liquid-gas equilibrium for the model, then satisfactory results are obtained near ambient conditions, whereas at high temperatures the liquid densities are generally underestimated and the gas densities overestimated. As a consequence, the critical point of the model is reached at significantly too low temperature, although it occurs at approximately the correct density. PMID:23593996

  3. Mechanics and control of the cytoskeleton in Amoeba proteus.

    Science.gov (United States)

    Dembo, M

    1989-06-01

    Many models of the cytoskeletal motility of Amoeba proteus can be formulated in terms of the theory of reactive interpenetrating flow (Dembo and Harlow, 1986). We have devised numerical methodology for testing such models against the phenomenon of steady axisymmetric fountain flow. The simplest workable scheme revealed by such tests (the minimal model) is the main preoccupation of this study. All parameters of the minimal model are determined from available data. Using these parameters the model quantitatively accounts for the self assembly of the cytoskeleton of A. proteus: for the formation and detailed morphology of the endoplasmic channel, the ectoplasmic tube, the uropod, the plasma gel sheet, and the hyaline cap. The model accounts for the kinematics of the cytoskeleton: the detailed velocity field of the forward flow of the endoplasm, the contraction of the ectoplasmic tube, and the inversion of the flow in the fountain zone. The model also gives a satisfactory account of measurements of pressure gradients, measurements of heat dissipation, and measurements of the output of useful work by amoeba. Finally, the model suggests a very promising (but still hypothetical) continuum formulation of the free boundary problem of amoeboid motion. by balancing normal forces on the plasma membrane as closely as possible, the minimal model is able to predict the turgor pressure and surface tension of A. proteus. Several dynamical factors are crucial to the success of the minimal model and are likely to be general features of cytoskeletal mechanics and control in amoeboid cells. These are: a constitutive law for the viscosity of the contractile network that includes an automatic process of gelation as the network density gets large; a very vigorous cycle of network polymerization and depolymerization (in the case of A. proteus, the time constant for this reaction is approximately 12 s); control of network contractility by a diffusible factor (probably calcium ion); and

  4. Intra-amoeba multiplication induces chemotaxis and biofilm colonization and formation for Legionella.

    Directory of Open Access Journals (Sweden)

    Renaud Bigot

    Full Text Available Legionella pneumophila, a facultative intracellular bacterium, is the causative agent of legionellosis. In the environment this pathogenic bacterium colonizes the biofilms as well as amoebae, which provide a rich environment for the replication of Legionella. When seeded on pre-formed biofilms, L. pneumophila was able to establish and survive and was only found at the surface of the biofilms. Different phenotypes were observed when the L. pneumophila, used to implement pre-formed biofilms or to form mono-species biofilms, were cultivated in a laboratory culture broth or had grown intracellulary within the amoeba. Indeed, the bacteria, which developed within the amoeba, formed clusters when deposited on a solid surface. Moreover, our results demonstrate that multiplication inside the amoeba increased the capacity of L. pneumophila to produce polysaccharides and therefore enhanced its capacity to establish biofilms. Finally, it was shown that the clusters formed by L. pneumophila were probably related to the secretion of a chemotaxis molecular agent.

  5. Intra-amoeba multiplication induces chemotaxis and biofilm colonization and formation for Legionella.

    Science.gov (United States)

    Bigot, Renaud; Bertaux, Joanne; Frere, Jacques; Berjeaud, Jean-Marc

    2013-01-01

    Legionella pneumophila, a facultative intracellular bacterium, is the causative agent of legionellosis. In the environment this pathogenic bacterium colonizes the biofilms as well as amoebae, which provide a rich environment for the replication of Legionella. When seeded on pre-formed biofilms, L. pneumophila was able to establish and survive and was only found at the surface of the biofilms. Different phenotypes were observed when the L. pneumophila, used to implement pre-formed biofilms or to form mono-species biofilms, were cultivated in a laboratory culture broth or had grown intracellulary within the amoeba. Indeed, the bacteria, which developed within the amoeba, formed clusters when deposited on a solid surface. Moreover, our results demonstrate that multiplication inside the amoeba increased the capacity of L. pneumophila to produce polysaccharides and therefore enhanced its capacity to establish biofilms. Finally, it was shown that the clusters formed by L. pneumophila were probably related to the secretion of a chemotaxis molecular agent. PMID:24205008

  6. Seasonal changes in Sphagnum peatland testate amoeba communities along a hydrological gradient

    OpenAIRE

    Katarzyna Marcisz; Łukasz Lamentowicz; Sandra Slowińska; Michal Slowinski; Witold Muszak; Mariusz Lamentowicz

    2014-01-01

    Testate amoebae are an abundant and functionally important group of protists in peatlands, but little is known about the seasonal patterns of their communities. We investigated the relationships between testate amoeba diversity and community structure and water table depth and light conditions (shading vs. insolation) in a Sphagnum peatland in Northern Poland (Linje mire) in spring and summer 2010. We monitored the water table at five sites across the peatland and collected Sphagnum samples i...

  7. TESTATE AMOEBAE COMMUNITIES FROM CAVES OF SOME TERRITORIES IN EUROPEAN RUSSIA AND NORTH-EASTERN ITALY

    OpenAIRE

    Mazei, Yuri; Belyakova, Olga; Trulova, Alisa; Guidolin, Laura; Coppellotti, Olimpia

    2012-01-01

    The species composition of testate amoebae in caves from European Russia and North-East Italy was studied. Twenty-seven species were identified from various habitats inside caves (moist substratum on floor, guano, sediments of cave streams and pools, water droplets and bacterial mats on rocky surfaces). In caves of simple structure (without differing types of habitats), the species richness of testate amoebae was far lower than in that from habitats outside the caves. In heterogeneous caves, ...

  8. The Polarizable Atomic Multipole-based AMOEBA Force Field for Proteins

    OpenAIRE

    Shi, Yue; Xia, Zhen; Zhang, Jiajing; Best, Robert; Wu, Chuanjie; Ponder, Jay W.; Ren, Pengyu

    2013-01-01

    Development of the AMOEBA (Atomic Multipole Optimized Energetics for Biomolecular Simulation) force field for proteins is presented. The current version (AMOEBA-2013) utilizes permanent electrostatic multipole moments through the quadrupole at each atom, and explicitly treats polarization effects in various chemical and physical environments. The atomic multipole electrostatic parameters for each amino acid residue type are derived from high-level gas phase quantum mechanical calculations via...

  9. Dynamics of hybrid amoeba proteus containing zoochlorellae studied using fluorescence spectroscopy

    Science.gov (United States)

    Liu, C.-H.; Fong, B. A.; Alfano, S. A., Jr.; Rakhlin, I.; Wang, W. B.; Ni, X. H.; Yang, Y. L.; Zhou, F.; Zuzolo, R. C.; Alfano, R. R.

    2011-03-01

    The microinjection of organelles, plants, particles or chemical solutions into Amoeba proteus coupled with spectroscopic analysis and observed for a period of time provides a unique new model for cancer treatment and studies. The amoeba is a eukaryote having many similar features of mammalian cells. The amoeba biochemical functions monitored spectroscopically can provide time sequence in vivo information about many metabolic transitions and metabolic exchanges between cellar organelles and substances microinjected into the amoeba. It is possible to microinject algae, plant mitochondria, drugs or carcinogenic solutions followed by recording the native fluorescence spectra of these composites. This model can be used to spectroscopically monitor the pre-metabolic transitions in developing diseased cells such as a cancer. Knowing specific metabolic transitions could offer solutions to inhibit cancer or reverse it as well as many other diseases. In the present study a simple experiment was designed to test the feasibility of this unique new model by injecting algae and chloroplasts into amoeba. The nonradiative dynamics found from these composites are evidence in terms of the emission ratios between the intensities at 337nm and 419nm; and 684nm bands. There were reductions in the metabolic and photosynthetic processes in amoebae that were microinjected with chloroplasts and zoochlorellae as well of those amoebae that ingested the algae and chloroplasts. The changes in the intensity of the emissions of the peaks indicate that the zoochlorellae lived in the amoebae for ten days. Spectral changes in intensity under the UV and 633nm wavelength excitation are from the energy transfer of DNA and RNA, protein-bound chromophores and chlorophylls present in zoochlorellae undergoing photosynthesis. The fluorescence spectroscopic probes established the biochemical interplay between the cell organelles and the algae present in the cell cytoplasm. This hybrid state is indicative

  10. Amoeba-Inspired Heuristic Search Dynamics for Exploring Chemical Reaction Paths.

    Science.gov (United States)

    Aono, Masashi; Wakabayashi, Masamitsu

    2015-09-01

    We propose a nature-inspired model for simulating chemical reactions in a computationally resource-saving manner. The model was developed by extending our previously proposed heuristic search algorithm, called "AmoebaSAT [Aono et al. 2013]," which was inspired by the spatiotemporal dynamics of a single-celled amoeboid organism that exhibits sophisticated computing capabilities in adapting to its environment efficiently [Zhu et al. 2013]. AmoebaSAT is used for solving an NP-complete combinatorial optimization problem [Garey and Johnson 1979], "the satisfiability problem," and finds a constraint-satisfying solution at a speed that is dramatically faster than one of the conventionally known fastest stochastic local search methods [Iwama and Tamaki 2004] for a class of randomly generated problem instances [ http://www.cs.ubc.ca/~hoos/5/benchm.html ]. In cases where the problem has more than one solution, AmoebaSAT exhibits dynamic transition behavior among a variety of the solutions. Inheriting these features of AmoebaSAT, we formulate "AmoebaChem," which explores a variety of metastable molecules in which several constraints determined by input atoms are satisfied and generates dynamic transition processes among the metastable molecules. AmoebaChem and its developed forms will be applied to the study of the origins of life, to discover reaction paths for which expected or unexpected organic compounds may be formed via unknown unstable intermediates and to estimate the likelihood of each of the discovered paths. PMID:26129639

  11. Accelerated Molecular Dynamics Simulations with the AMOEBA Polarizable Force Field on Graphics Processing Units.

    Science.gov (United States)

    Lindert, Steffen; Bucher, Denis; Eastman, Peter; Pande, Vijay; McCammon, J Andrew

    2013-11-12

    The accelerated molecular dynamics (aMD) method has recently been shown to enhance the sampling of biomolecules in molecular dynamics (MD) simulations, often by several orders of magnitude. Here, we describe an implementation of the aMD method for the OpenMM application layer that takes full advantage of graphics processing units (GPUs) computing. The aMD method is shown to work in combination with the AMOEBA polarizable force field (AMOEBA-aMD), allowing the simulation of long time-scale events with a polarizable force field. Benchmarks are provided to show that the AMOEBA-aMD method is efficiently implemented and produces accurate results in its standard parametrization. For the BPTI protein, we demonstrate that the protein structure described with AMOEBA remains stable even on the extended time scales accessed at high levels of accelerations. For the DNA repair metalloenzyme endonuclease IV, we show that the use of the AMOEBA force field is a significant improvement over fixed charged models for describing the enzyme active-site. The new AMOEBA-aMD method is publicly available (http://wiki.simtk.org/openmm/VirtualRepository) and promises to be interesting for studying complex systems that can benefit from both the use of a polarizable force field and enhanced sampling. PMID:24634618

  12. Potentially pathogenic free-living amoebae in contact lenses of the asymptomatic contact lens wearers.

    Directory of Open Access Journals (Sweden)

    Maryam Niyyati

    2014-03-01

    Full Text Available Free-living amoebae (FLA including Acanthamoeba spp. and Hartmannella spp. are the causative agents of serious corneal infection especially within contact lens wearers. Thus contact lenses and their storage case could be a suitable niche for potentially pathogenic amoebae. The main objective of the present study was to evaluate the contamination of contact lenses to free living amoebae using morphological and sequencing based methods.Overall, 90 volunteers provided their contact lenses. All volunteers wore soft contact lenses. Both lenses were cultured in the same plate. Forty-eight of the volunteers were medical and dentistry student and 42 were ophthalmology attendees of hospitals in Tehran, Iran. All of the samples were inoculated to non-nutrient medium and monitored daily for the outgrowth of the amoebae. PCR and sequencing were performed using various primer pairs.Of the 90 volunteers, 9 (10% were positive for free-living amoebae outgrowth. Morphological analysis revealed that 3 isolates were belonged to Hartmannella genus according to small round cysts and 6 isolates were belonged to Acanthamoeba genus based on the star shape of endocysts. Sequencing revealed that Acanthamoeba belonged to T4, T3 and T5 genotype. Hartmannella were also belonged to vermiformis species.The presence of potentially pathogenic free living amoebae including Acanthamoeba and Hartmannella could be a high risk for people using soft contact lenses. These results revealed that improved clarification and professional recommendations for contact lens wearers is of utmost importance.

  13. Permissiveness of freshly isolated environmental strains of amoebae for growth of Legionella pneumophila.

    Science.gov (United States)

    Dupuy, Mathieu; Binet, Marie; Bouteleux, Celine; Herbelin, Pascaline; Soreau, Sylvie; Héchard, Yann

    2016-03-01

    Legionella pneumophila is a pathogenic bacterium commonly found in water and responsible for severe pneumonia. Free-living amoebae are protozoa also found in water, which feed on bacteria by phagocytosis. Under favorable conditions, some L. pneumophila are able to resist phagocytic digestion and even multiply within amoebae. However, it is not clear whether L. pneumophila could infect at a same rate a large range of amoebae or if there is some selectivity towards specific amoebal genera or strains. Also, most studies have been performed using collection strains and not with freshly isolated strains. In our study, we assess the permissiveness of freshly isolated environmental strains of amoebae, belonging to three common genera (i.e. Acanthamoeba, Naegleria and Vermamoeba), for growth of L. pneumophila at three different temperatures. Our results indicated that all the tested strains of amoebae were permissive to L. pneumophila Lens and that there was no significant difference between the strains. Intracellular proliferation was more efficient at a temperature of 40°C. In conclusion, our work suggests that, under favorable conditions, virulent strains of L. pneumophila could equally infect a large number of isolates of common freshwater amoeba genera. PMID:26832643

  14. A study of nucleo-cytoplasmic large DNA viruses: detection and characterization of viruses in environmental amoeba

    OpenAIRE

    Fugas, Mariana Costa

    2012-01-01

    Tese de mestrado. Biologia (Biologia Molecular e Genética). Universidade de Lisboa, Faculdade de Ciências, 2012 Amoeba associated microorganisms (ARMs) are bacteria or viruses that share a symbiotic relationship with amoebas. Many ARMs are associated with human diseases and it has been reported the acquisition of resistance inside their host. These facts highlight the importance of finding and characterizing ARMs in a public health’s perspective. In the present work, amoebas from environme...

  15. Prevalence of Acanthamoeba and other naked amoebae in South Florida domestic water.

    Science.gov (United States)

    Shoff, M E; Rogerson, A; Kessler, K; Schatz, S; Seal, D V

    2008-03-01

    The purpose was to identify the prevalence of naked amoebae in tap water in south Florida to ascertain the risk of amoebal infections of the cornea in contact lens wearers. Over the course of a 2-year period, water samples were collected from sites throughout Broward, Palm Beach, and Dade counties, Florida. The presence of amoebae in samples was based on an enrichment cultivation method appropriate for Acanthamoeba. Amoebae were identified using diagnostic features discernable by light microscopy. A total of 283 water samples were processed and amoebae were noted in 80 of these. Acanthamoeba were found on 8 occasions (2.8%). The genera Hartmannella and Vahlkampfia, rarely involved in keratitis cases, were found in 3.5% and 2.8% of samples, respectively. A total of 19 different naked amoebae were recorded and amoebae (regardless of genus) were present in 19.4% of all samples. Previous surveys in England and Korea have shown that acanthamoebae are found in 15 to 30% of tap water samples in the home and have been associated with corneal infection in contact lens wearers. The incidence of acanthamoebae infection in the USA (2.8%) has been found to be lower than that in the UK and it has been postulated that this is related to the lack of a storage water tank in the roof loft space. However, the level of treatment of municipal water is clearly not effective at killing amoebal cysts (or trophozoites) as evidenced by the high occurrence of amoebae (19.4%) in this study. PMID:17998610

  16. Automation of AMOEBA polarizable force field parameterization for small molecules.

    Science.gov (United States)

    Wu, Johnny C; Chattree, Gaurav; Ren, Pengyu

    2012-02-26

    A protocol to generate parameters for the AMOEBA polarizable force field for small organic molecules has been established, and polarizable atomic typing utility, Poltype, which fully automates this process, has been implemented. For validation, we have compared with quantum mechanical calculations of molecular dipole moments, optimized geometry, electrostatic potential, and conformational energy for a variety of neutral and charged organic molecules, as well as dimer interaction energies of a set of amino acid side chain model compounds. Furthermore, parameters obtained in gas phase are substantiated in liquid-phase simulations. The hydration free energy (HFE) of neutral and charged molecules have been calculated and compared with experimental values. The RMS error for the HFE of neutral molecules is less than 1 kcal/mol. Meanwhile, the relative error in the predicted HFE of salts (cations and anions) is less than 3% with a correlation coefficient of 0.95. Overall, the performance of Poltype is satisfactory and provides a convenient utility for applications such as drug discovery. Further improvement can be achieved by the systematic study of various organic compounds, particularly ionic molecules, and refinement and expansion of the parameter database. PMID:22505837

  17. Diverse sensitivity thresholds in dynamic signaling responses by social amoebae.

    Science.gov (United States)

    Wang, C Joanne; Bergmann, Adriel; Lin, Benjamin; Kim, Kyuri; Levchenko, Andre

    2012-02-28

    The complex transition from a single-cell to a multicellular life form during the formation of a fruiting body by the amoeba Dictyostelium discoideum is accompanied by a pulsatile collective signaling process that instigates chemotaxis of the constituent cells. Although the cells used for the analysis of this phenomenon are normally genetically identical (isogenic), it is not clear whether they are equally responsive to the waves of the signaling stimulus, nor is it clear how responses across the population influence collective cell behavior. Here, we found that isogenic Dictyostelium cells displayed differing sensitivities to the chemoattractant cyclic adenosine monophosphate (cAMP). Furthermore, the resulting signaling responses could be explained by a model in which cells are refractory to further stimulation for 5 to 6 min after the initial input and the signaling output is amplified, with the amplification threshold varying across the cells in the population. This pathway structure could explain intracellular amplification of the chemoattractant gradient during cell migration. The new model predicts that diverse cell responsiveness can facilitate collective cell behavior, specifically due to the presence of a small number of cells in the population with increased responsiveness that aid in propagating the initial cAMP signaling wave across the cell population. PMID:22375055

  18. Sensitivity of free-living amoeba trophozoites and cysts to water disinfectants.

    Science.gov (United States)

    Dupuy, Mathieu; Berne, Florence; Herbelin, Pascaline; Binet, Marie; Berthelot, Nelsie; Rodier, Marie-Hélène; Soreau, Sylvie; Héchard, Yann

    2014-03-01

    Free-living amoebae are naturally present in water. These protozoa could be pathogenic and could also shelter pathogenic bacteria. Thus, they are described as a potential hazard for health. Also, free-living amoebae have been described to be resistant to biocides, especially under their cyst resistant form. There are several studies on amoeba treatments but none of them compare sensitivity of trophozoites and cysts from different genus to various water disinfectants. In our study, we tested chlorine, monochloramine and chlorine dioxide on both cysts and trophozoites from three strains, belonging to the three main genera of free-living amoebae. The results show that, comparing cysts to trophozoites inactivation, only the Acanthamoeba cysts were highly more resistant to treatment than trophozoites. Comparison of the disinfectant efficiency led to conclude that chlorine dioxide was the most efficient treatment in our conditions and was particularly efficient against cysts. In conclusion, our results would help to adapt water treatments in order to target free-living amoebae in water networks. PMID:23932411

  19. Amoeba-inspired nanoarchitectonic computing: solving intractable computational problems using nanoscale photoexcitation transfer dynamics.

    Science.gov (United States)

    Aono, Masashi; Naruse, Makoto; Kim, Song-Ju; Wakabayashi, Masamitsu; Hori, Hirokazu; Ohtsu, Motoichi; Hara, Masahiko

    2013-06-18

    Biologically inspired computing devices and architectures are expected to overcome the limitations of conventional technologies in terms of solving computationally demanding problems, adapting to complex environments, reducing energy consumption, and so on. We previously demonstrated that a primitive single-celled amoeba (a plasmodial slime mold), which exhibits complex spatiotemporal oscillatory dynamics and sophisticated computing capabilities, can be used to search for a solution to a very hard combinatorial optimization problem. We successfully extracted the essential spatiotemporal dynamics by which the amoeba solves the problem. This amoeba-inspired computing paradigm can be implemented by various physical systems that exhibit suitable spatiotemporal dynamics resembling the amoeba's problem-solving process. In this Article, we demonstrate that photoexcitation transfer phenomena in certain quantum nanostructures mediated by optical near-field interactions generate the amoebalike spatiotemporal dynamics and can be used to solve the satisfiability problem (SAT), which is the problem of judging whether a given logical proposition (a Boolean formula) is self-consistent. SAT is related to diverse application problems in artificial intelligence, information security, and bioinformatics and is a crucially important nondeterministic polynomial time (NP)-complete problem, which is believed to become intractable for conventional digital computers when the problem size increases. We show that our amoeba-inspired computing paradigm dramatically outperforms a conventional stochastic search method. These results indicate the potential for developing highly versatile nanoarchitectonic computers that realize powerful solution searching with low energy consumption. PMID:23565603

  20. Free-living freshwater amoebae differ in their susceptibility to the pathogenic bacterium Legionella pneumophila.

    Science.gov (United States)

    Dey, Rafik; Bodennec, Jacques; Mameri, Mouh Oulhadj; Pernin, Pierre

    2009-01-01

    Legionella pneumophila is known as a facultative intracellular parasite of free-living soil and freshwater amoebae, of which several species have been shown to support the growth of the pathogenic bacteria. We report for the first time the behaviour of two strains (c2c and Z503) of the amoeba Willaertia magna towards different strains of L. pneumophila serogroup 1 and compared it with Acanthamoeba castellanii and Hartmannella vermiformis, known to be L. pneumophila permissive. In contrast to the results seen with other amoebae, W. magna c2c inhibited the growth of one strain of Legionella (L. pneumophila, Paris), but not of others belonging to the same serogroup (L. pneumophila, Philadelphia and L. pneumophila, Lens). Also, the different L. pneumophila inhibited cell growth and induced cell death in A. castellanii, H. vermiformis and W. magna Z503 within 3-4 days while W. magna c2c strain remained unaffected even up to 7 days. Electron microscopy demonstrated that the formation of numerous replicative phagosomes observed within Acanthamoeba and Hartmannella is rarely seen in W. magna c2c cocultured with L. pneumophila. Moreover, the morphological differences were observed between L. pneumophila cultured either with Willaertia or other amoebae. These observations show that amoebae are not all equally permissive to L. pneumophila and highlight W. magna c2c as particularly resistant towards some strains of this bacterium. PMID:19016880

  1. Micro PIV Measurements of the Internal Flow of an Amoeba proteus

    Science.gov (United States)

    Resagk, Christian; Lobutova, Elka; Li, Ling; Voges, Danja

    2011-11-01

    We report about micro PIV measurements of the internal flow in the protoplasm of an amoeba. The velocity data shall give information about the mechanism of the change of amoeba's contour during its locomotion in water. The experimental data is used for an analytical modeling of the locomotion mechanism with the help of a variable contour and finally for the development of locomotion principles for micro robots. The experimental set-up consists of a microscope and a CCD camera with 12 frames per second and image analysis software. The illumination of the amoeba was done by the built-in microscope halogen lamp. We use the phase contrast configuration to capture images of the amoeba moving in water. We applied an electrical field to the water channel in order to control the movement of the amoeba in one direction. During this motion we measured time dependent velocity vector fields of the protoplasm flow, estimated velocity profiles and analyzed time series of the maximum velocity. The velocity vector plots are calculated from the images by using cross correlation and naturally occurring particles in the protoplasm. Beside the analyses of the internal flow we recorded the motion of the center of gravity and the variation of the sectional area.

  2. Vampires in the oceans: predatory cercozoan amoebae in marine habitats.

    Science.gov (United States)

    Berney, Cédric; Romac, Sarah; Mahé, Frédéric; Santini, Sébastien; Siano, Raffaele; Bass, David

    2013-12-01

    Vampire amoebae (vampyrellids) are predators of algae, fungi, protozoa and small metazoans known primarily from soils and in freshwater habitats. They are among the very few heterotrophic naked, filose and reticulose protists that have received some attention from a morphological and ecological point of view over the last few decades, because of the peculiar mode of feeding of known species. Yet, the true extent of their biodiversity remains largely unknown. Here we use a complementary approach of culturing and sequence database mining to address this issue, focusing our efforts on marine environments, where vampyrellids are very poorly known. We present 10 new vampyrellid isolates, 8 from marine or brackish sediments, and 2 from soil or freshwater sediment. Two of the former correspond to the genera Thalassomyxa Grell and Penardia Cash for which sequence data were previously unavailable. Small-subunit ribosomal DNA analysis confirms they are all related to previously sequenced vampyrellids. An exhaustive screening of the NCBI GenBank database and of 454 sequence data generated by the European BioMarKs consortium revealed hundreds of distinct environmental vampyrellid sequences. We show that vampyrellids are much more diverse than previously thought, especially in marine habitats. Our new isolates, which cover almost the full phylogenetic range of vampyrellid sequences revealed in this study, offer a rare opportunity to integrate data from environmental DNA surveys with phenotypic information. However, the very large genetic diversity we highlight within vampyrellids (especially in marine sediments and soils) contrasts with the paradoxically low morphological distinctiveness we observed across our isolates. PMID:23864128

  3. [Phosphatase activity in Amoeba proteus at pH 9.0].

    Science.gov (United States)

    Sopina, V A

    2007-01-01

    In the free-living amoeba Amoeba proteus (strain B), after PAAG disk-electrophoresis of the homogenate supernatant, at using 1-naphthyl phosphate as a substrate and pH 9.0, three forms of phosphatase activity were revealed; they were arbitrarily called "fast", "intermediate", and "slow" phosphatases. The fast phosphatase has been established to be a fraction of lysosomal acid phosphatase that preserves some low activity at alkaline pH. The question as to which particular class the intermediate phosphatase belongs to has remained unanswered: it can be both acid phosphatase and protein tyrosine phosphatase (PTP). Based on data of inhibitor analysis, large substrate specificity, results of experiments with reactivation by Zn ions after inactivation with EDTA, other than in the fast and intermediate phosphatases localization in the amoeba cell, it is concluded that only slow phosphatase can be classified as alkaline phosphatase (EC 3.1.3.1). PMID:17933343

  4. Foraging Behaviors and Potential Computational Ability of Problem-Solving in an Amoeba

    Science.gov (United States)

    Nakagaki, Toshiyuki

    We study cell behaviors in the complex situations: multiple locations of food were simultaneously given. An amoeba-like organism of true slime mold gathered at the multiple food locations while body shape made of tubular network was totally changed. Then only a few tubes connected all of food locations through a network shape. By taking the network shape of body, the plasmodium could meet its own physiological requirements: as fast absorption of nutrient as possible and sufficient circulation of chemical signals and nutrients through a whole body. Optimality of network shape was evaluated in relation to a combinatorial optimization problem. Here we reviewed the potential computational ability of problem-solving in the amoeba, which was much higher than we'd though. The main message of this article is that we had better to change our stupid opinion that an amoeba is stupid.

  5. Free energy simulations with the AMOEBA polarizable force field and metadynamics on GPU platform.

    Science.gov (United States)

    Peng, Xiangda; Zhang, Yuebin; Chu, Huiying; Li, Guohui

    2016-03-01

    The free energy calculation library PLUMED has been incorporated into the OpenMM simulation toolkit, with the purpose to perform enhanced sampling MD simulations using the AMOEBA polarizable force field on GPU platform. Two examples, (I) the free energy profile of water pair separation (II) alanine dipeptide dihedral angle free energy surface in explicit solvent, are provided here to demonstrate the accuracy and efficiency of our implementation. The converged free energy profiles could be obtained within an affordable MD simulation time when the AMOEBA polarizable force field is employed. Moreover, the free energy surfaces estimated using the AMOEBA polarizable force field are in agreement with those calculated from experimental data and ab initio methods. Hence, the implementation in this work is reliable and would be utilized to study more complicated biological phenomena in both an accurate and efficient way. © 2015 Wiley Periodicals, Inc. PMID:26493154

  6. Late Holocene palaeohydrological changes in a Sphagnum peat bog from NW Romania based on testate amoebae

    Directory of Open Access Journals (Sweden)

    Andrei-Cosmin Diaconu

    2016-04-01

    Full Text Available This paper investigates the possibility of reconstructing the palaeohydrological changes in an active Sphagnum peat bog from north-western Romania using testate amoebae fauna and organic matter content determined by loss on ignition (LOI. In total 28 taxa of testate amoebae were identified of which 11 were frequent enough to present a remarkable ecological significance. Based on the relative abundance of these taxa nine zones were identified, crossing from very wet to dry climate conditions. The wet periods identified are characterized by taxa like Centropyxis cassis, Amphitrema flavum and Hyalosphenia papilio, while in the dry periods Difflugia pulex and Nebela militaris thrive. We showed that combining qualitative information regarding hydrological preferences with the quantitative percentage data from the fossil record it is possible to obtain information regarding major surface moisture changes from the peat bog surface. Furthermore we identified a link between distribution of testate amoebae assemblages, organic matter variation and minerogenic material.

  7. Accelerated Molecular Dynamics Simulations with the AMOEBA Polarizable Force Field on Graphics Processing Units

    OpenAIRE

    Lindert, Steffen; Bucher, Denis; Eastman, Peter; Pande, Vijay; McCammon, J. Andrew

    2013-01-01

    The accelerated molecular dynamics (aMD) method has recently been shown to enhance the sampling of biomolecules in molecular dynamics (MD) simulations, often by several orders of magnitude. Here, we describe an implementation of the aMD method for the OpenMM application layer that takes full advantage of graphics processing units (GPUs) computing. The aMD method is shown to work in combination with the AMOEBA polarizable force field (AMOEBA-aMD), allowing the simulation of long time-scale eve...

  8. Accelerated molecular dynamics simulations with the AMOEBA polarizable force field on graphics processing units

    OpenAIRE

    Lindert, S; Bucher, D; Eastman, P; Pande, V.; McCammon, JA

    2013-01-01

    The accelerated molecular dynamics (aMD) method has recently been shown to enhance the sampling of biomolecules in molecular dynamics (MD) simulations, often by several orders of magnitude. Here, we describe an implementation of the aMD method for the OpenMM application layer that takes full advantage of graphics processing units (GPUs) computing. The aMD method is shown to work in combination with the AMOEBA polarizable force field (AMOEBA-aMD), allowing the simulation of long time-scale eve...

  9. Mitochondrial alterations produced by misonidazole: a study using Amoeba proteus as a single cell model

    International Nuclear Information System (INIS)

    Misonidazole (MISO) is undergoing clinical trials because of its radiosensitizing and cytotoxic effects. Amoeba proteus was used as a single-cell model to study the mechanism of the action of MISO on aerobic and hypoxic cells. Preliminary ultrastructural findings with MISO treatment of aerobic amoebae are reported. Morphological changes to the mitochondria were noted, which included the generation of matrical inclusions. In earlier investigations similar changes of form have been correlated with a disruption of mitochondrial functioning, and the possible significance of the present results is discussed in the light of these. (author)

  10. [The role of the floodplain gradient in structuring of testate amoebae communities in the Ilych River].

    Science.gov (United States)

    Mazeĭ, Iu A; Malysheva, E A; Lapteva, E M; Komarov, A A; Taskaeva, A A

    2012-01-01

    Forty-two testate amoebae taxa were identified in alluvial soils of floodplain islands in the Ilych River. Among the pedo- and eurybionts, there were aquatic rhizopods. Along the floodplain transect (willow --> meadow --> deciduous forest --> coniferous forest), the testate amoebae community changed directly. There are spatially homogeneous (low beta-diversity) testacean communities but species rich on the local level (high alpha-diversity) within forests. Within willows and meadows, communities are characterized by low alpha-diversity and high heterogeneity that leads to high gamma-diversity. PMID:22988761

  11. Control of Branchionus sp. and Amoeba sp. in cultures of Arthrospira sp. Control de Branchionus sp. y Amoeba sp. en cultivos de Arthrospira sp.

    OpenAIRE

    Carlos Méndez; Eduardo Uribe

    2012-01-01

    Cultivation of cyanobacterium Arthrospira sp. has been developed in many countries for the production of proteins, pigments and other compounds. Outdoor mass cultures are often affected by biological contamination, drastically reducing productivity as far as bringing death. This study evaluates the control of Branchionus sp. and Amoeba sp. with two chemical compounds: urea (U) and ammonium bicarbonate (AB), in laboratory conditions and outdoor mass culture of Arthrospira sp. The lethal concen...

  12. First Report of Vannellidae Amoebae (Vannella Spp. Isolated From Biofilm Source

    Directory of Open Access Journals (Sweden)

    F Zaeri

    2011-09-01

    Full Text Available Background: Members of the Vannellidae family are free-living amoebae (FLA distributed mainly in water and soil sources. The present study reports the first isolation of this genus in the biofilm source from hospital environment in Tehran, Iran.Methods: Biofilm samples were collected from hospital environment. Cultivation was performed in non-nutrient agar covered with a heat-killed Escherichia coli. Cloning of the suspected amoe­bae was done. PCR amplification and Homology analysis using the Basic Local Alignment Search Tool (BLASTn was performed to search for the most similar reference sequences.Results: Microscopic examination showed numerous fan-shaped amoebae and peculiar cysts differ­ent to the usual shape of typical FLA. Sequence analysis of the PCR- product revealed that the suspected amoebae are highly homologous with Vannella spp. gene (99% identity and 100% query coverage available in the gene bank database.Conclusion: Although Vannella spp. is not proved to be pathogenic itself, but they are capable of har­boring pathogenic intracellular organisms such as Microsporidian parasites. Thus, identifica­tion of such amoebae can be of clinical importance, as they could lead to transmission of other pathogens to human.

  13. Seasonal changes in Sphagnum peatland testate amoeba communities along a hydrological gradient.

    Science.gov (United States)

    Marcisz, Katarzyna; Lamentowicz, Lukasz; Słowińska, Sandra; Słowiński, Michał; Muszak, Witold; Lamentowicz, Mariusz

    2014-10-01

    Testate amoebae are an abundant and functionally important group of protists in peatlands, but little is known about the seasonal patterns of their communities. We investigated the relationships between testate amoeba diversity and community structure and water table depth and light conditions (shading vs. insolation) in a Sphagnum peatland in Northern Poland (Linje mire) in spring and summer 2010. We monitored the water table at five sites across the peatland and collected Sphagnum samples in lawn and hummock micro-sites around each piezometer, in spring (3 May) and mid-summer (6 August) 2010. Water table differed significantly between micro-sites and seasons (Kruskal-Wallis test, p=0.001). The community structure of testate amoebae differed significantly between spring and summer in both hummock and lawn micro-sites. We recorded a small, but significant drop in Shannon diversity, between spring and summer (1.76 vs. 1.72). Strongest correlations were found between testate amoeba communities and water table lowering and light conditions. The relative abundance of mixotrophic species Hyalosphenia papilio, Archerella flavum and of Euglypha ciliata was higher in the summer. PMID:25176338

  14. Evaluating the use of testate amoebae for palaeohydrological reconstruction in permafrost peatlands

    DEFF Research Database (Denmark)

    Swindles, Graeme T.; Amesbury, Matthew J.; Turner, T. Edward;

    2015-01-01

    The melting of high-latitude permafrost peatlands is a major concern due to a potential positive feedback on global climate change. We examine the ecology of testate amoebae in permafrost peatlands, based on sites in Sweden (similar to 200 km north of the Arctic Circle). Multivariate statistical ...

  15. Application of Gaussian Electrostatic Model (GEM) Distributed Multipoles in the AMOEBA Force Field.

    Science.gov (United States)

    Cisneros, G Andrés

    2012-12-11

    We present the inclusion of distributed multipoles obtained from the Gaussian Electrostatic Model (GEM) into the AMOEBA force field. As a proof of principle, we have reparametrized water and alanine di-peptide. The GEM distributed multipoles (GEM-DM) have been obtained at the same levels of theory as those used for the original AMOEBA parametrization. The use of GEM allows the derivation of the distributed multipoles from the analytical fit to the molecular density or the numerical fit to the molecular electrostatic potential (mESP). In addition, GEM-DM are intrinsically finite of the highest order of the auxiliary basis used for the GEM fit. We also present the fitting of multipoles for the di-methyl imidazolium/chloride (DMIM(+)-Cl(-)) ionic liquid pair. Results for intermolecular Coulomb for all test systems show very good agreement. MD simulations for a reparametrized AMOEBA water model with GEM-DM provide results on par with the original AMOEBA force field for a series of bulk properties including liquid density and enthalpy of vaporization. A package for the calculation of GEM Hermite coefficients and derived distributed multipoles using the numerical procedure is also presented and released under the GNU public license. PMID:26593198

  16. Genome sequence of Rickettsia bellii illuminates the role of amoebae in gene exchanges between intracellular pathogens.

    Directory of Open Access Journals (Sweden)

    2006-05-01

    Full Text Available The recently sequenced Rickettsia felis genome revealed an unexpected plasmid carrying several genes usually associated with DNA transfer, suggesting that ancestral rickettsiae might have been endowed with a conjugation apparatus. Here we present the genome sequence of Rickettsia bellii, the earliest diverging species of known rickettsiae. The 1,552,076 base pair-long chromosome does not exhibit the colinearity observed between other rickettsia genomes, and encodes a complete set of putative conjugal DNA transfer genes most similar to homologues found in Protochlamydia amoebophila UWE25, an obligate symbiont of amoebae. The genome exhibits many other genes highly similar to homologues in intracellular bacteria of amoebae. We sought and observed sex pili-like cell surface appendages for R. bellii. We also found that R. bellii very efficiently multiplies in the nucleus of eukaryotic cells and survives in the phagocytic amoeba, Acanthamoeba polyphaga. These results suggest that amoeba-like ancestral protozoa could have served as a genetic "melting pot" where the ancestors of rickettsiae and other bacteria promiscuously exchanged genes, eventually leading to their adaptation to the intracellular lifestyle within eukaryotic cells.

  17. Amoebae as Potential Environmental Hosts for Mycobacterium ulcerans and Other Mycobacteria, but Doubtful Actors in Buruli Ulcer Epidemiology

    Science.gov (United States)

    Gryseels, Sophie; Amissah, Diana; Durnez, Lies; Vandelannoote, Koen; Leirs, Herwig; De Jonckheere, Johan; Portaels, Françoise; Ablordey, Anthony; Eddyani, Miriam

    2012-01-01

    Background The reservoir and mode of transmission of Mycobacterium ulcerans, the causative agent of Buruli ulcer, remain unknown. Ecological, genetic and epidemiological information nonetheless suggests that M. ulcerans may reside in aquatic protozoa. Methodology/Principal Findings We experimentally infected Acanthamoeba polyphaga with M. ulcerans and found that the bacilli were phagocytised, not digested and remained viable for the duration of the experiment. Furthermore, we collected 13 water, 90 biofilm and 45 detritus samples in both Buruli ulcer endemic and non-endemic communities in Ghana, from which we cultivated amoeboid protozoa and mycobacteria. M. ulcerans was not isolated, but other mycobacteria were as frequently isolated from intracellular as from extracellular sources, suggesting that they commonly infect amoebae in nature. We screened the samples as well as the amoeba cultures for the M. ulcerans markers IS2404, IS2606 and KR-B. IS2404 was detected in 2% of the environmental samples and in 4% of the amoeba cultures. The IS2404 positive amoeba cultures included up to 5 different protozoan species, and originated both from Buruli ulcer endemic and non-endemic communities. Conclusions/Significance This is the first report of experimental infection of amoebae with M. ulcerans and of the detection of the marker IS2404 in amoeba cultures isolated from the environment. We conclude that amoeba are potential natural hosts for M. ulcerans, yet remain sceptical about their implication in the transmission of M. ulcerans to humans and their importance in the epidemiology of Buruli ulcer. PMID:22880141

  18. Amoebae as potential environmental hosts for Mycobacterium ulcerans and other mycobacteria, but doubtful actors in Buruli ulcer epidemiology.

    Directory of Open Access Journals (Sweden)

    Sophie Gryseels

    Full Text Available BACKGROUND: The reservoir and mode of transmission of Mycobacterium ulcerans, the causative agent of Buruli ulcer, remain unknown. Ecological, genetic and epidemiological information nonetheless suggests that M. ulcerans may reside in aquatic protozoa. METHODOLOGY/PRINCIPAL FINDINGS: We experimentally infected Acanthamoeba polyphaga with M. ulcerans and found that the bacilli were phagocytised, not digested and remained viable for the duration of the experiment. Furthermore, we collected 13 water, 90 biofilm and 45 detritus samples in both Buruli ulcer endemic and non-endemic communities in Ghana, from which we cultivated amoeboid protozoa and mycobacteria. M. ulcerans was not isolated, but other mycobacteria were as frequently isolated from intracellular as from extracellular sources, suggesting that they commonly infect amoebae in nature. We screened the samples as well as the amoeba cultures for the M. ulcerans markers IS2404, IS2606 and KR-B. IS2404 was detected in 2% of the environmental samples and in 4% of the amoeba cultures. The IS2404 positive amoeba cultures included up to 5 different protozoan species, and originated both from Buruli ulcer endemic and non-endemic communities. CONCLUSIONS/SIGNIFICANCE: This is the first report of experimental infection of amoebae with M. ulcerans and of the detection of the marker IS2404 in amoeba cultures isolated from the environment. We conclude that amoeba are potential natural hosts for M. ulcerans, yet remain sceptical about their implication in the transmission of M. ulcerans to humans and their importance in the epidemiology of Buruli ulcer.

  19. Detection and identification of free-living amoeba from aquatic environment in different seasons in Taiwan

    Science.gov (United States)

    Tzeng, K.; Hsu, B.; Tsai, H.; Huang, P.; Tsai, J.; Kao, P.; Huang, K.; Chen, J.

    2013-12-01

    Free-living amoeba includes Acanthamoeba and Naegleria, which are widely distributed in water and soil. Human infection with free-living amoeba leads to serious illness, even lethal. For example, central nervous system infection will cause amoebic meningoencephalitis, and infections will cause amoebic keratitis. The presence of free-living amoeba in environment water can be used as a water quality indicator in ecosystem assessment. In Taiwan, reservoirs are indispensable because of the water source are limited by the steep terrain and the short river flow. Therefore, we need to pay more attention in the quality control of reservoirs water. The aims of this study are to investigate the presence of free-living amoeba in Taiwan reservoirs, and to compare the differences among seasons. At last, the identification and genotyping of Acanthamoeba and Naegleria are investigated. In this study, we use polymerase chain reaction with specific primers to analyze the presence of free-living amoeba in aquatic environment. We collected total 60 samples from reservoirs in Taiwan. The water samples are divided into two parts for both direct concentration method and culture method. The results show the different detection rates among seasons. For Acanthamoeba, the detection rates were 28.3% (17 of 60 water samples), 21.7% (13 of 60 water samples) and 8.3% (5 of 60 water samples) in autumn, winter and spring, respectively. For Naegleria, the detection rates were 6.7% (4 of 60 water samples), 0% (0 of 60 water samples) and 0% (0 of 60 water samples) were detected positive in autumn, winter and spring, respectively. Sequence analysis showed that the major genotypes in Acanthamoeba were T3, T4, T10 and T11 in autumn, T2, T4 and T10 in winter, T4 in spring. Due to the presences of Acanthamoeba and Naegleria in reservoirs, we should pay more attention in water quality monitoring to prevent the potential risks of diseases. Keywords: free-living amoeba, Acanthamoeba, Naegleria, polymerase

  20. A Valence Bond Model for Aqueous Cu(II) and Zn(II) Ions in the AMOEBA Polarizable Force Field

    OpenAIRE

    Xiang, Jin Yu; Ponder, Jay W.

    2012-01-01

    A general molecular mechanics (MM) model for treating aqueous Cu2+ and Zn2+ ions was developed based on valence bond (VB) theory and incorporated into the AMOEBA polarizable force field. Parameters were obtained by fitting molecular mechanics energies to that computed by ab initio methods for gas phase tetra- and hexa-aqua metal complexes. Molecular dynamics (MD) simulations using the proposed AMOEBA-VB model were performed for each transition metal ion in aqueous solution and solvent coordin...

  1. Testate amoebae (Protista) communities in Hylocomium splendens (Hedw.) B.S.G. (Bryophyta): relationships with altitude, and moss elemental chemistry.

    Science.gov (United States)

    Mitchell, Edward A D; Bragazza, Luca; Gerdol, Renato

    2004-12-01

    We studied the testate amoebae in the moss Hylocomium splendens along an altitudinal gradient from 1000 to 2200 m asl. in the south-eastern Alps of Italy in relation to micro- and macro-nutrient content of moss plants. Three mountainous areas were chosen, two of them characterised by calcareous bedrock, the third by siliceous bedrock. A total of 25 testate amoebae taxa were recorded, with a mean species richness of 9.3 per sampling plot. In a canonical correspondence analysis, 63.1% of the variation in the amoebae data was explained by moss tissue chemistry, namely by C, P, Ca, Mg, Al, Fe, and Na content and a binary site variable. We interpreted this result as an indirect effect of moss chemistry on testate amoebae through an influence on prey organisms. Although two species responded to altitude, there was no overall significant relationship between testate amoebae diversity or community structure and altitude, presumably because our sampling protocol aimed at minimizing the variability due to vegetation types and soil heterogeneity. This suggests that previous evidence of altitudinal or latitudinal effects on testate amoebae diversity may at least in part be due to a sampling bias, namely differences in soil type or moss species sampled. PMID:15648722

  2. Engineering an artificial amoeba propelled by nanoparticle-triggered actin polymerization

    Energy Technology Data Exchange (ETDEWEB)

    Yi Jinsoo; Schmidt, Jacob; Chien Aichi; Montemagno, Carlo D [Department of Bioengineering, University of California Los Angeles, 420 Westwood Plaza, 7523 Boelter Hall, Los Angeles, CA 90095-1600 (United States)], E-mail: montemcd@ucmail.uc.edu

    2009-02-25

    We have engineered an amoeba system combining nanofabricated inorganic materials with biological components, capable of propelling itself via actin polymerization. The nanofabricated materials have a mechanism similar to the locomotion of the Listeria monocytogenes, food poisoning bacteria. The propulsive force generation utilizes nanoparticles made from nickel and gold functionalized with the Listeria monocytogenes transmembrane protein, ActA. These Listeria-mimic nanoparticles were in concert with actin, actin binding proteins, ATP (adenosine triphosphate) and encapsulated within a lipid vesicle. This system is an artificial cell, such as a vesicle, where artificial nanobacteria and actin polymerization machinery are used in driving force generators inside the cell. The assembled structure was observed to crawl on a glass surface analogously to an amoeba, with the speed of the movement dependent on the amount of actin monomers and ATP present.

  3. Engineering an artificial amoeba propelled by nanoparticle-triggered actin polymerization

    International Nuclear Information System (INIS)

    We have engineered an amoeba system combining nanofabricated inorganic materials with biological components, capable of propelling itself via actin polymerization. The nanofabricated materials have a mechanism similar to the locomotion of the Listeria monocytogenes, food poisoning bacteria. The propulsive force generation utilizes nanoparticles made from nickel and gold functionalized with the Listeria monocytogenes transmembrane protein, ActA. These Listeria-mimic nanoparticles were in concert with actin, actin binding proteins, ATP (adenosine triphosphate) and encapsulated within a lipid vesicle. This system is an artificial cell, such as a vesicle, where artificial nanobacteria and actin polymerization machinery are used in driving force generators inside the cell. The assembled structure was observed to crawl on a glass surface analogously to an amoeba, with the speed of the movement dependent on the amount of actin monomers and ATP present.

  4. Ecology of Testate Amoebae in the Komořany Ponds in the Vltava Basin

    Czech Academy of Sciences Publication Activity Database

    Burdíková, Zuzana; Čapek, Martin; Švindrych, Zdeněk; Gryndler, M.; Kubínová, Lucie; Holcová, K.

    2012-01-01

    Roč. 64, č. 1 (2012), s. 117-130. ISSN 0095-3628 R&D Projects: GA MŠk(CZ) LC06063; GA ČR(CZ) GAP108/11/0794 Institutional research plan: CEZ:AV0Z50110509 Keywords : ecology * freshwater ecosystem * testate amoeba e * seasonal variability Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.277, year: 2012

  5. Comparative Recoveries of Naegleria fowleri Amoebae from Seeded River Water by Filtration and Centrifugation

    OpenAIRE

    Pernin, P.; Pélandakis, M; Rouby, Y.; Faure, A.; Siclet, F.

    1998-01-01

    Detection of pathogenic Naegleria fowleri in environmental water samples, which is necessary for the prevention of primary amoebic meningoencephalitis, generally requires concentrating the samples. Two concentration techniques, filtration and centrifugation, were used to study the recovery of N. fowleri, in vegetative or cystic form, that had been mixed with the two other thermotolerant Naegleria species, N. lovaniensis and N. australiensis. Counting of amoebae was performed by the most proba...

  6. An Angular Overlap Model for Cu(II) Ion in the AMOEBA Polarizable Force Field

    OpenAIRE

    Xiang, Jin Yu; Ponder, Jay W.

    2013-01-01

    An extensible polarizable force field for transition metal ion was developed based on AMOEBA and the angular overlap model (AOM) with consistent treatment of electrostatics for all atoms. Parameters were obtained by fitting molecular mechanics (MM) energies to various ab initio gas-phase calculations. The results of parameterization were presented for copper (II) ion ligated to water and model fragments of amino acid residues involved in the copper binding sites of type 1 copper proteins. Mol...

  7. The Polarizable Atomic Multipole-based AMOEBA Force Field for Proteins.

    Science.gov (United States)

    Shi, Yue; Xia, Zhen; Zhang, Jiajing; Best, Robert; Wu, Chuanjie; Ponder, Jay W; Ren, Pengyu

    2013-01-01

    Development of the AMOEBA (Atomic Multipole Optimized Energetics for Biomolecular Simulation) force field for proteins is presented. The current version (AMOEBA-2013) utilizes permanent electrostatic multipole moments through the quadrupole at each atom, and explicitly treats polarization effects in various chemical and physical environments. The atomic multipole electrostatic parameters for each amino acid residue type are derived from high-level gas phase quantum mechanical calculations via a consistent and extensible protocol. Molecular polarizability is modeled via a Thole-style damped interactive induction model based upon distributed atomic polarizabilities. Inter- and intramolecular polarization is treated in a consistent fashion via the Thole model. The intramolecular polarization model ensures transferability of electrostatic parameters among different conformations, as demonstrated by the agreement between QM and AMOEBA electrostatic potentials, and dipole moments of dipeptides. The backbone and side chain torsional parameters were determined by comparing to gas-phase QM (RI-TRIM MP2/CBS) conformational energies of dipeptides and to statistical distributions from the Protein Data Bank. Molecular dynamics simulations are reported for short peptides in explicit water to examine their conformational properties in solution. Overall the calculated conformational free energies and J-coupling constants are consistent with PDB statistics and experimental NMR results, respectively. In addition, the experimental crystal structures of a number of proteins are well maintained during molecular dynamics (MD) simulation. While further calculations are necessary to fully validate the force field, initial results suggest the AMOEBA polarizable multipole force field is able to describe the structure and energetics of peptides and proteins, in both gas-phase and solution environments. PMID:24163642

  8. Free living amoebae in water sources of critical units in a tertiary care hospital in India

    OpenAIRE

    Khurana, S; Biswal, M; Kaur, H.; Malhotra, P.; Arora, P.; K Megha; N Taneja; Sehgal, R.

    2015-01-01

    Background: Isolation of free-living amoebae (FLA) is reported sparsely from water taps, ventilators, air conditioners, haemodialysis units and dental irrigation systems of hospitals worldwide. Their prevalence in hospital environment especially in wards having immunocompromised patients may pose a risk to this group of susceptible population as they may cause disease themselves or may carry pathogens inside them. No study from India has performed such surveillance. Objective: To evaluate ext...

  9. Phospholipids trigger Cryptococcus neoformans capsular enlargement during interactions with amoebae and macrophages.

    Directory of Open Access Journals (Sweden)

    Cara J Chrisman

    2011-05-01

    Full Text Available A remarkable aspect of the interaction of Cryptococcus neoformans with mammalian hosts is a consistent increase in capsule volume. Given that many aspects of the interaction of C. neoformans with macrophages are also observed with amoebae, we hypothesized that the capsule enlargement phenomenon also had a protozoan parallel. Incubation of C. neoformans with Acanthamoeba castellanii resulted in C. neoformans capsular enlargement. The phenomenon required contact between fungal and protozoan cells but did not require amoeba viability. Analysis of amoebae extracts showed that the likely stimuli for capsule enlargement were protozoan polar lipids. Extracts from macrophages and mammalian serum also triggered cryptococcal capsular enlargement. C. neoformans capsule enlargement required expression of fungal phospholipase B, but not phospholipase C. Purified phospholipids, in particular, phosphatidylcholine, and derived molecules triggered capsular enlargement with the subsequent formation of giant cells. These results implicate phospholipids as a trigger for both C. neoformans capsule enlargement in vivo and exopolysaccharide production. The observation that the incubation of C. neoformans with phospholipids led to the formation of giant cells provides the means to generate these enigmatic cells in vitro. Protozoan- or mammalian-derived polar lipids could represent a danger signal for C. neoformans that triggers capsular enlargement as a non-specific defense mechanism against potential predatory cells. Hence, phospholipids are the first host-derived molecules identified to trigger capsular enlargement. The parallels apparent in the capsular response of C. neoformans to both amoebae and macrophages provide additional support for the notion that certain aspects of cryptococcal virulence emerged as a consequence of environmental interactions with other microorganisms such as protists.

  10. Toward the use of testate amoeba functional traits as indicator of floodplain restoration success

    OpenAIRE

    Fournier, Bertrand; Malysheva, Elena; Mazei, Yuri; Moretti, Marco; Mitchell, Edward A. D.

    2013-01-01

    Functional traits (FT) offer a new framework to understand the ecology of organisms and overcome taxonomic difficulties that currently limit the study of minute soil taxa. FT are likely to be selected by environmental filters and hence they may provide more direct information on ecosystem characteristics than the species composition of a community. We tested the potential of testate amoeba (TA) functional traits as bioindicators of selected ecosystem processes in the context of a restored fl...

  11. Interactions Between Testate Amoebae and Saprotrophic Microfungi in a Scots Pine Litter Microcosm

    Czech Academy of Sciences Publication Activity Database

    Vohník, Martin; Burdíková, Zuzana; Vyhnal, Aleš; Koukol, O.

    2011-01-01

    Roč. 61, č. 3 (2011), s. 660-668. ISSN 0095-3628 R&D Projects: GA ČR GP206/09/P340; GA ČR(CZ) GD204/09/H084 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z60050516 Keywords : testate amoebae * saprotrophic fungi * litter Subject RIV: EF - Botanics Impact factor: 2.912, year: 2011

  12. Diversity and community structure of testate amoebae (protista) in tropical montane rain forests of southern Ecuador: altitudinal gradient, aboveground habitats and nutrient limitation.

    OpenAIRE

    Krashevs'ka, Valentyna

    2009-01-01

    The tropical Andes in southern Ecuador constitute a hotspot of plant (especially trees and bryophytes) and animal (especially birds, bats, arctiid and geometrid mothes) diversity. However, data on small animals such as testate amoebae as an important component of the soil and aboveground community are lacking. Variations in density, diversity and community structure of testate amoebae along altitudinal transects in tropical regions are largely unknown. Testate amoebae colonize almost any habi...

  13. Free-living Amoebae (FLA: morphological and molecular identification of Acanthamoeba in dental unit water

    Directory of Open Access Journals (Sweden)

    Trabelsi H.

    2010-03-01

    Full Text Available The aim of our study was to detect free-living Amoebae (FLA by morphological methods and to identify Acanthamoeba spp. by PCR in the dental unit water lines (DUWL. Materials and methods: it was a prospective study dealing with 196 water samples collected from DUWL (94 samples taken in the early morning before materials flush and patient consultations and 102 samples taken after consultations. At the same time, 39 samples from tap water were realized. Results: 135 (69 % samples were positives by the morphological study with morphotypical diversity. The predominant morphotype was the monopodial (39.2 %. 18 strains of Acanthamoeba spp. were detected in DUW (13.3 % and three strains in tap water (10 %. The amplification of 18S rDNA gene of these strains of Acanthamoeba spp. was positive for all samples. Conclusion: the FLA and Acanthamoeba were isolated both in tap water and in dental unit. The amoeba pathogenicity has not been demonstrated after oral or dental contamination; but the presence of intracellular and pathogenic bacteria in the amoeba could be a source of microbiological risks for patients in case of deep dental care or immunodepression. The improvement of this dental unit was necessary by putting a filter of 0.2 microns porosity before the arrival of the water in hand-pieces allowing the limitation of FLA passage.

  14. Fine-scale spatial ecology drives kin selection relatedness among cooperating amoebae.

    Science.gov (United States)

    Smith, Jeff; Strassmann, Joan E; Queller, David C

    2016-04-01

    Cooperation among microbes is important for traits as diverse as antibiotic resistance, pathogen virulence, and sporulation. The evolutionary stability of cooperation against "cheater" mutants depends critically on the extent to which microbes interact with genetically similar individuals. The causes of this genetic social structure in natural microbial systems, however, are unknown. Here, we show that social structure among cooperative Dictyostelium amoebae is driven by the population ecology of colonization, growth, and dispersal acting at spatial scales as small as fruiting bodies themselves. Despite the fact that amoebae disperse while grazing, all it takes to create substantial genetic clonality within multicellular fruiting bodies is a few millimeters distance between the cells colonizing a feeding site. Even adjacent fruiting bodies can consist of different genotypes. Soil populations of amoebae are sparse and patchily distributed at millimeter scales. The fine-scale spatial structure of cells and genotypes can thus account for the otherwise unexplained high genetic uniformity of spores in fruiting bodies from natural substrates. These results show how a full understanding of microbial cooperation requires understanding ecology and social structure at the small spatial scales microbes themselves experience. PMID:26931797

  15. Development of AMOEBA force field for 1,3-dimethylimidazolium based ionic liquids.

    Science.gov (United States)

    Starovoytov, Oleg N; Torabifard, Hedieh; Cisneros, G Andrés

    2014-06-26

    The development of AMOEBA (a multipolar polarizable force field) for imidazolium based ionic liquids is presented. Our parametrization method follows the AMOEBA procedure and introduces the use of QM intermolecular total interactions as well as QM energy decomposition analysis (EDA) to fit individual interaction energy components. The distributed multipoles for the cation and anions have been derived using both the Gaussian distributed multipole analysis (GDMA) and Gaussian electrostatic model-distributed multipole (GEM-DM) methods.1 The intermolecular interactions of a 1,3-dimethylimidazolium [dmim(+)] cation with various anions, including fluoride [F(-)], chloride [Cl(-)], nitrate [NO(3)(-)], and tetraflorouborate [BF(4)(-)], were studied using quantum chemistry calculations at the MP2/6-311G(d,p) level of theory. Energy decomposition analysis was performed for each pair using the restricted variational space decomposition approach (RVS) at the HF/6-311G(d,p) level. The new force field was validated by running a series of molecular dynamic (MD) simulations and by analyzing thermodynamic and structural properties of these systems. A number of thermodynamic properties obtained from MD simulations were compared with available experimental data. The ionic liquid structure reproduced using the AMOEBA force field is also compared with the data from neutron diffraction experiment and other MD simulations. Employing GEM-DM force fields resulted in a good agreement on liquid densities ρ, enthalpies of vaporization ΔH(vap), and diffusion coefficients D(±) in comparison with conventional force fields. PMID:24901255

  16. Elimination of free-living amoebae in fresh water with pulsed electric fields.

    Science.gov (United States)

    Vernhes, M C; Benichou, A; Pernin, P; Cabanes, P A; Teissié, J

    2002-08-01

    This study investigates the effects of pulsed electric fields on the inactivation of trophozoite form of Naegleria lovaniensis Ar9M-1 in batch and flow processes, systematically examining the lethal effect of field strength, pulse duration, number of pulses, and pulse frequency. Our results show that amoebae eradication is modulated by pulse parameters, composition of the pulsing medium, and physiological state of the cells. Cell survival is not related to the energy delivered to the cell suspension during the electrical treatment. For a given energy a strong field applied for a short cumulative pulse duration affects viability more than a weak field with a long cumulative pulsation. We also determine the optimal electrical conditions to obtain an inactivation rate higher than 95% while using the least energy. Flow processes allow to treat large-scale volumes. Our results show that the most efficient flow process for amoeba eradication requires a field parallel to the flow. Pulsed electric fields are a new and attractive method for inactivating amoebae in large volumes of fresh water. PMID:12230188

  17. Calcium and initial surface binding phase of pinocytosis in Amoeba proteus

    International Nuclear Information System (INIS)

    The uptake of membrane-bound solute and external medium by bulk-phase pinocytosis in Amoeba proteus is influenced by the level of Ca2+ in the external medium. Increasing external Ca2+ to ∼10-4 M increases pinocytotic intensity, while increases in Ca2+ above this level decrease the intensity of pinocytosis. The initial interaction of pinocytotic inducers and Ca+2 at the surface of A moeba proteus was therefore examined. Alcain blue and Na+, both inducers of pinocytosis, differ in the manner with which they associate with the amoeba surface, suggesting the possibility of different pinocytosis-inducing sites on the amoeba surface. Low levels of external Ca2+ in the range of 3 x 10-5 to 4.5 x 10-4 M increase the amount of cationic inducer associated with the cell surface while, at the same time, decreasing anion association with the cell surface. It is suggested that Ca2+ influences ion association with the cell surface by controlling the availability of negative surface sites, which in turn influences pinocytotic intensity. Surface binding of Na+, Ca2+ and Cl- was determined by adding 22Na, 45Ca or 36Cl

  18. Isolation of Free-Living Amoebae from Sarein Hot Springs in Ardebil Province, Iran

    Directory of Open Access Journals (Sweden)

    A Badirzadeh

    2011-06-01

    Full Text Available Background: Free-living amoebae (FLA are a group of ubiquitous protozoan, which are distrib­uted in the natural and artificial environment sources. The main aim of the current study was to identify the presence of FLA in the recreational hot springs of Sarein in Ardebil Province of Iran.Methods: Seven recreational hot springs were selected in Sarein City and 28 water samples (four from each hot spring were collected using 500 ml sterile plastic bottles during three month. Filtra­tion of water samples was performed, and culture was done in non-nutrient agar medium enriched with Escherichia coli. Identification of the FLA was based on morphological criteria of cysts and trophozoites. Genotype identification of Acanthamoeba positive samples were also per­formed using sequencing based method.Results: Overall, 12 out of 28 (42.9% samples were positive for FLA which Acanthamoeba and Vahlkampfiid amoebae were found in one (3.6% and 11 (39.3% samples, respectively. Se­quence analysis of the single isolate of Acanthamoeba revealed potentially pathogenic T4 geno­type corresponding to A. castellanii.Conclusion: Contamination of hot springs to FLA, such as Acanthamoeba T4 genotype (A. castel­lanii and Vahlkampfiid amoebae, could present a sanitary risk for high risk people, and health authorities must be aware of FLA presence.

  19. Biocide efficiency against Legionellae and amoebae in cooling towers - the necessity to control the risk of Legionnaires' disease

    Energy Technology Data Exchange (ETDEWEB)

    Guhl, W.; Hater, W.; Stumpe, S. [Henkel KGaA, Duesseldorf (Germany)

    2007-08-15

    Legionella, known to be the causative agent of Legionnaires' disease, is a wide-spread bacteria occurring naturally in water. Favorable growing conditions in man-made systems can lead to massive growth and thus to a considerable risk for human beings. Evaporative cooling towers provide good living conditions due to their operational conditions. As a consequence, the growth of Legionella in these systems has to be controlled. Amongst other measures biocides are dosed to control the growth of the microbiological population and thus the possible risk of an infection by Legionellae. However, Legionella preferably lives in biofilms and/or amoebae, which strongly shelter this microbe. Furthermore, amoebae by themselves can be harmful to humans as well. Therefore, a biocide treatment should control Legionella (planktonic in water and in biofilms/amoebae) as well as the amoebae. This paper shows that an adapted biocide treatment can increase the efficiency of a biocide against Legionellae and amoebae und therefore minimize the risk of an infection by Legionella. (orig.)

  20. A valence bond model for aqueous Cu(II) and Zn(II) ions in the AMOEBA polarizable force field.

    Science.gov (United States)

    Xiang, Jin Yu; Ponder, Jay W

    2013-04-01

    A general molecular mechanics (MM) model for treating aqueous Cu(2+) and Zn(2+) ions was developed based on valence bond (VB) theory and incorporated into the atomic multipole optimized energetics for biomolecular applications (AMOEBA) polarizable force field. Parameters were obtained by fitting MM energies to that computed by ab initio methods for gas-phase tetra- and hexa-aqua metal complexes. Molecular dynamics (MD) simulations using the proposed AMOEBA-VB model were performed for each transition metal ion in aqueous solution, and solvent coordination was evaluated. Results show that the AMOEBA-VB model generates the correct square-planar geometry for gas-phase tetra-aqua Cu(2+) complex and improves the accuracy of MM model energetics for a number of ligation geometries when compared to quantum mechanical (QM) computations. On the other hand, both AMOEBA and AMOEBA-VB generate results for Zn(2+)-water complexes in good agreement with QM calculations. Analyses of the MD trajectories revealed a six-coordination first solvation shell for both Cu(2+) and Zn(2+) ions in aqueous solution, with ligation geometries falling in the range reported by previous studies. PMID:23212979

  1. Control of Branchionus sp. and Amoeba sp. in cultures of Arthrospira sp. Control de Branchionus sp. y Amoeba sp. en cultivos de Arthrospira sp.

    Directory of Open Access Journals (Sweden)

    Carlos Méndez

    2012-09-01

    Full Text Available Cultivation of cyanobacterium Arthrospira sp. has been developed in many countries for the production of proteins, pigments and other compounds. Outdoor mass cultures are often affected by biological contamination, drastically reducing productivity as far as bringing death. This study evaluates the control of Branchionus sp. and Amoeba sp. with two chemical compounds: urea (U and ammonium bicarbonate (AB, in laboratory conditions and outdoor mass culture of Arthrospira sp. The lethal concentration 100 (LC100 at 24 h for Branchionus sp. and Amoeba sp. determined was of 60-80 mg L-1 (U and 100-150 mg L-1 (AB. The average effective inhibition concentration for 50% of the population (IC50 in Arthrospira sp., after 72 h, was 80 mg L-1 (U and 150 mg L-1 (AB. The application of doses of 60 mg L-1 (U or 100 mg L-1 (AB in the outdoor mass culture of this contaminated microalga, completely inhibited grazing and did not affect the growth of Arthrospira sp. but rather promoted rapid recovery of algal density at levels prior to infestation. These compounds provided an economical and effective control of predators in cultures of Arthrospira sp.El cultivo de la cianobacteria Arthrospira sp. ha sido desarrollado en muchos países para la obtención de proteínas, pigmentos y otros compuestos. Cultivo que a nivel industrial se ve afectado frecuentemente por contaminación biológica, reduciendo drásticamente la productividad hasta causar la muerte. Este estudio evalúa el control de Branchionus sp. y de Amoeba sp. con dos compuestos químicos, la urea (U y bicarbonato de amonio (AB en cultivos de Arthrospira sp. La concentración letal 100 (LC100 determinada a las 24 h para Branchionus sp. y Amoeba sp. fue de 60-80 mg L-1 (U y 100-150 mg L-1 (AB. La concentración media de inhibición efectiva, después de 72 h, para el 50% de la población (IC50 en Arthrospira fue de 80 mg L-1 (U y 150 mg L-1 (AB. La aplicación de dosis de 60 mg L-1 (U ó 100 mg L-1 (AB en

  2. Kin discrimination and possible cryptic species in the social amoeba Polysphondylium violaceum

    Directory of Open Access Journals (Sweden)

    Lasagni Andrea

    2011-01-01

    Full Text Available Abstract Background The genetic diversity of many protists is unknown. The differences that result from this diversity can be important in interactions among individuals. The social amoeba Polysphondylium violaceum, which is a member of the Dictyostelia, has a social stage where individual amoebae aggregate together to form a multicellular fruiting body with dead stalk cells and live spores. Individuals can either cooperate with amoebae from the same clone, or sort to form clonal fruiting bodies. In this study we look at genetic diversity in P. violaceum and at how this diversity impacts social behavior. Results The phylogeny of the ribosomal DNA sequence (17S to 5.8S region shows that P. violaceum is made up of at least two groups. Mating compatibility is more common between clones from the same phylogenetic group, though matings between clones from different phylogenetic groups sometimes occurred. P. violaceum clones are more likely to form clonal fruiting bodies when they are mixed with clones from a different group than when they are mixed with a clone of the same group. Conclusion Both the phylogenetic and mating analyses suggest the possibility of cryptic species in P. violaceum. The level of divergence found within P. violaceum is comparable to the divergence between sibling species in other dictyostelids. Both major groups A/B and C/D/E/F show kin discrimination, which elevates relatedness within fruiting bodies but not to the level of clonality. The diminished cooperation in mixes between groups suggests that the level of genetic variation between individuals influences the extent of their cooperation.

  3. Confocal Laser Scanning Microscopy and Two Photon Excitation Microscopy as Tools to Study Testate Amoebae

    Czech Academy of Sciences Publication Activity Database

    Burdíková, Zuzana; Čapek, Martin; Ostašov, Pavel; Mitchell, E.A.D.; Machač, Jiří; Kubínová, Lucie

    2010-01-01

    Roč. 16, Suppl.2 (2010), s. 1142-1143. ISSN 1431-9276. [Microscopy and Microanalysis 2010. Portland, 01.08.2010-05.08.2010] R&D Projects: GA MŠk(CZ) LC06063; GA ČR(CZ) GA102/08/0691; GA ČR(CZ) GA304/09/0733 Institutional research plan: CEZ:AV0Z50110509; CEZ:AV0Z60050516 Keywords : testate amoeba e * confocal microscopy * two-photon microscopy Subject RIV: BH - Optics, Masers, Lasers Impact factor: 2.179, year: 2010

  4. Propensity of heavier halides for the water/vapor interface revisited using the Amoeba force field

    Science.gov (United States)

    Tůma, Lukáš; Jeníček, Dominik; Jungwirth, Pavel

    2005-08-01

    Molecular dynamics simulations of aqueous sodium halide solutions in slab geometry were performed using the state-of-the-art polarizable Amoeba force field. The present calculations reveal a propensity of halide anions for the water/vapor interface, which correlates with the ionic size and polarizability and, therefore, increases in the series Cl - < Br - < I -. These results are in a quantitative agreement with previous calculations employing much simpler polarizable potentials and are supported by a mounting experimental evidence from photoelectron and non-linear optical and vibrational spectroscopies.

  5. Isolation of Free-Living Amoebae from Sarein Hot Springs in Ardebil Province, Iran

    OpenAIRE

    Badirzadeh, A; Niyyati, M; Babaei, Z; Amini, H.; H Badirzadeh; Rezaeian, M.

    2011-01-01

    Background: Free-living amoebae (FLA) are a group of ubiquitous protozoan, which are distrib­uted in the natural and artificial environment sources. The main aim of the current study was to identify the presence of FLA in the recreational hot springs of Sarein in Ardebil Province of Iran.Methods: Seven recreational hot springs were selected in Sarein City and 28 water samples (four from each hot spring) were collected using 500 ml sterile plastic bottles during three month. Filtra­tion of wat...

  6. SSU rRNA reveals a sequential increase in shell complexity among the euglyphid testate amoebae (Rhizaria: Euglyphida)

    DEFF Research Database (Denmark)

    Lara, Enrique; Heger, Thierry J; Mitchell, Edward A D; Meisterfeld, Ralf; Ekelund, Flemming

    2007-01-01

    The existing data on the molecular phylogeny of filose testate amoebae from order Euglyphida has revealed contradictions between traditional morphological classification and SSU rRNA phylogeny and, moreover, the position of several important genera remained unknown. We therefore carried out a study...... aiming to fill several important gaps and better understand the relationships among the main euglyphid testate amoebae and the evolutionary steps that led to the present diversity at a higher level. We obtained new SSU rRNA sequences from five genera and seven species. This new phylogeny obtained shows...

  7. Old lineages in a new ecosystem: diversification of arcellinid amoebae (Amoebozoa and peatland mosses.

    Directory of Open Access Journals (Sweden)

    Omar Fiz-Palacios

    Full Text Available Arcellinid testate amoebae (Amoebozoa form a group of free-living microbial eukaryotes with one of the oldest fossil records known, yet several aspects of their evolutionary history remain poorly understood. Arcellinids occur in a range of terrestrial, freshwater and even brackish habitats; however, many arcellinid morphospecies such as Hyalosphenia papilio are particularly abundant in Sphagnum-dominated peatlands, a relatively new ecosystem that appeared during the diversification of Sphagnum species in the Miocene (5-20 Myr ago. Here, we reconstruct divergence times in arcellinid testate amoebae after selecting several fossils for clock calibrations and then infer whether or not arcellinids followed a pattern of diversification that parallels the pattern described for Sphagnum. We found that the diversification of core arcellinids occurred during the Phanerozoic, which is congruent with most arcellinid fossils but not with the oldest known amoebozoan fossil (i.e. at ca. 662 or ca. 750 Myr. Overall, Sphagnum and the Hyalospheniidae exhibit different patterns of diversification. However, an extensive molecular phylogenetic analysis of distinct clades within H. papilio species complex demonstrated a correlation between the recent diversification of H. papilio, the recent diversification of Sphagnum mosses, and the establishment of peatlands.

  8. Testate amoebae communities from some freshwater and soil habitats in China (Hubei and Shandong Provinces)

    Institute of Scientific and Technical Information of China (English)

    Anatoly BOBROV; Yuri MAZEI; Viktor CHERNYSHOV; Yingchun GONG; Weisong FENG

    2012-01-01

    Seventy-eight species and forms of testate amoebae were identified from 29 freshwater and soil habitats in three territories of China (Shandong and Hubei Provinces).Most abundant species from the genera Plagiopyxis,Centropyxis and Trinema represent the globally-distributed and eurybiont group of testate amoebae.The species richness was observed to be the lowest (7-12 species per biotope) in sandy sediments of the Yangtze River,but considerably higher (20-30 taxa) in soil environment.In the range of terrestrial habitats,the most remote communities from Laoshan Mountain in Shandong Province,China manifested the highest difference from others.On the other hand,communities originated in the most distant from industrial center places (Guifeng Mountain in Hubei Province,China) possess the most peculiar species composition including specific Gondwanian taxa (e.g.Nebela bigibbosa).In sum,the results obtained provide the evidence that the community complexity and specificity reduce in the places located within areas that are highly populated and intensively visited by humans.

  9. Acanthamoeba and other free-living amoebae in bat guano, an extreme habitat.

    Science.gov (United States)

    Mulec, Janez; Dietersdorfer, Elisabeth; Üstüntürk-Onan, Miray; Walochnik, Julia

    2016-04-01

    Several representatives of the so-called free-living amoebae (FLA) are of medical relevance, not only as facultative pathogens but also as vehicles for pathogenic bacteria. Some FLA can survive and even grow under extreme environmental conditions. Bat guano is an exceptional habitat, the conditions becoming gradually more extreme with aging. In the current study, samples of bat guano of different ages from five caves in Slovenia were screened for the presence of FLA. FLA were isolated from almost all guano samples, including guano with a pH of 3.5. Only the two samples that had been drawn from >20-year-old guano were negative for FLA. Generally, FLA diversity correlated to high concentrations of cultivable bacteria (∼10(8) CFU/g) and fungi (∼10(5) CFU/g). Interestingly, the absence of FLA in seasoned guanos was mirrored by the presence of dictyostelid slime moulds. The isolated amoebae were identified as belonging to the genera Acanthamoeba, Copromyxa, Naegleria, Sappinia, Tetramitus, Thecamoeba, Vahlkampfia, Vannella and Vermamoeba. To the best of our knowledge, this is the first study on the diversity of FLA in guano. PMID:26678653

  10. Isolation and Molecular Characterization of Free-Living Amoebae from Different Water Sources in Italy

    Directory of Open Access Journals (Sweden)

    Margherita Montalbano Di Filippo

    2015-03-01

    Full Text Available Free-living amoebae (FLA are protozoa ubiquitous in Nature, isolated from a variety of environments worldwide. In addition to their natural distribution, some species have been found to be pathogenic to humans. In the present study a survey was conducted in order to evaluate the presence and to characterize at molecular level the isolates of amoebic organisms collected from different water sources in Italy. A total of 160 water samples were analyzed by culture and microscopic examination. FLA were found in 46 (28.7% of the investigated water samples. Groundwater, well waters, and ornamental fountain waters were the sources with higher prevalence rates (85.7%, 50.0%, and 45.9%, respectively. Identification of FLA species/genotypes, based on the 18S rDNA regions, allowed to identify 18 (39.1% Acanthamoeba isolates (genotypes T4 and T15 and 21 (45.6% Vermamoeba vermiformis isolates. Other FLA species, including Vahlkampfia sp. and Naegleria spp., previously reported in Italy, were not recovered. The occurrence of potentially pathogenic free-living amoebae in habitats related to human population, as reported in the present study, supports the relevance of FLA as a potential health threat to humans.

  11. An Angular Overlap Model for Cu(II) Ion in the AMOEBA Polarizable Force Field.

    Science.gov (United States)

    Xiang, Jin Yu; Ponder, Jay W

    2014-01-01

    An extensible polarizable force field for transition metal ion was developed based on AMOEBA and the angular overlap model (AOM) with consistent treatment of electrostatics for all atoms. Parameters were obtained by fitting molecular mechanics (MM) energies to various ab initio gas-phase calculations. The results of parameterization were presented for copper (II) ion ligated to water and model fragments of amino acid residues involved in the copper binding sites of type 1 copper proteins. Molecular dynamics (MD) simulations were performed on aqueous copper (II) ion at various temperatures, as well as plastocyanin (1AG6) and azurin (1DYZ). Results demonstrated that the AMOEBA-AOM significantly improves the accuracy of classical MM in a number of test cases when compared to ab initio calculations. The Jahn-Teller distortion for hexa-aqua copper (II) complex was handled automatically without specifically designating axial and in-plane ligands. Analyses of MD trajectories resulted in a 6-coordination first solvation shell for aqueous copper (II) ion and a 1.8ns average residence time of water molecules. The ensemble average geometries of 1AG6 and 1DYZ copper binding sites were in general agreement with X-ray and previous computational studies. PMID:25045338

  12. Does buckling instability of the pseudopodium limit how well an amoeba can climb?

    Science.gov (United States)

    Ghosal, Sandip; Fukui, Yoshio

    2011-02-21

    The maximum force that a crawling cell can exert on a substrate is a quantity of interest in cell biomechanics. One way of quantifying this force is to allow the cell to crawl against a measurable and adjustable restraining force until the cell is no longer able to move in a direction opposite to the applied force. Fukui et al. (2000) reported on an experiment where amoeboid cells were imaged while they crawled against an artificial gravity field created by a centrifuge. An unexpected observation was that the net applied force on the amoeba did not seem to be the primary factor that limited its ability to climb. Instead, it appeared that the amoeba stalled when it was no longer able to support a pseudopodium against the applied gravity field. The high g-load bend the pseudopodium thereby preventing its attachment to the target point directly ahead of the cell. In this paper we further refine this idea by identifying the bending of the pseudopodium with the onset of elastic instability of a beam under its own weight. It is shown that the principal features of the experiment may be understood through this model and an estimate for the limiting g-load in reasonable accord with the experimental measurements is recovered. PMID:21130098

  13. Free living amoebae in water sources of critical units in a tertiary care hospital in India

    Directory of Open Access Journals (Sweden)

    S Khurana

    2015-01-01

    Full Text Available Background: Isolation of free-living amoebae (FLA is reported sparsely from water taps, ventilators, air conditioners, haemodialysis units and dental irrigation systems of hospitals worldwide. Their prevalence in hospital environment especially in wards having immunocompromised patients may pose a risk to this group of susceptible population as they may cause disease themselves or may carry pathogens inside them. No study from India has performed such surveillance. Objective: To evaluate extent of FLA contamination in water sources of bone marrow transplant (BMT intensive care unit (ICU, transplant ICU, haemodialysis unit and high dependency unit in a tertiary care hospital in India. Materials and Methods: A total of hundred samples including fifty each of tap water samples and swabs from mouth of taps used for drinking, bathing and hand washing purposes in these units were collected according to standard procedure. Samples were inoculated onto non-nutrient agar plates at room temperature followed by morphological confirmation. Molecular identification including polymerase chain reaction (PCR and sequencing was performed in culture positive samples. Results: Four tap water samples and ten swab samples showed growth of trophozoites and cyst formation. Morphologically, four amoebae resembled Acanthamoeba spp. which was further confirmed by PCR and sequencing showed them to be of T3 and T4 genotypes. Conclusion: The presence of these FLA in hospital water sources emphasises the urgent need of implementing effective preventive measures. Further studies are required to estimate the true prevalence of FLA in Indian hospitals by taking larger number of samples.

  14. Archaeological occurrences and historical review of the human amoeba, Entamoeba histolytica, over the past 6000years.

    Science.gov (United States)

    Le Bailly, Matthieu; Maicher, Céline; Dufour, Benjamin

    2016-08-01

    Understanding parasite history and the evolution of host/parasite relationships is one of the most important aspects of paleoparasitology. Within the framework of this research topic, this paper focuses on the human pathogenic amoeba, Entamoeba histolytica. The compilation of all the available archaeological data concerning this parasite leads to a first glimpse of the history of this parasite of current medical importance. Paleoparasitological investigation into this parasite uses immunological techniques and shows that the modern strain of E. histolytica has been present in Western Europe since at least the Neolithic period (3700yearsBCE), and could have originated in the Old World. The appearance of the modern amoeba strain in the pre-Columbian Americas and the Middle East around the 12th century CE gives rise to hypotheses as to how human migrations (Atlantic or Pacific routes) contributed to the diffusion of this pathogen, resulting in its current distribution. This compilation proves that parasites are valuable proxies for studying past human and animal migrations, and should be given more consideration in the future. PMID:27130884

  15. Testate amoebae (Protozoa) from especially protected spruce forests in the Šumava National Park (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Balík, Vladimír

    České Budějovice : Institute of Soil Biology AS CR, 2003. s. 12. [Central European Workshop on Soil Zoology /7./. 14.04.2003-16.04.2003, České Budějovice] Institutional research plan: CEZ:AV0Z6066911 Keywords : testate amoebae * spruce forests * Šumava National Park Subject RIV: EH - Ecology, Behaviour

  16. A New Species Of Testate Amoebae Of The Genus Difflugia From The Freshwaters Of Azerbaijan (Rhizopoda, Testacea, Difflugiidae

    Directory of Open Access Journals (Sweden)

    Snegovaya N. Yu.

    2015-04-01

    Full Text Available A new testate amoebae species Difflugia alekperovi sp. n. was found during a faunistic study of inland waters of Lenkoran Region, South-Eastern Azerbaijan. The morphology and biometry of this species was described by LM and SEM investigations.

  17. A free-living amoeba with unusual pattern of mitochondrial structure isolated from Atlantic salmon, Salmo salar L

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Veverková, Marie; Fiala, Ivan; Macháčková, Blanka

    2002-01-01

    Roč. 41, - (2002), s. 415-419. ISSN 0065-1583 R&D Projects: GA AV ČR IAA6022202 Institutional research plan: CEZ:AV0Z6022909 Keywords : free-living amoeba * mitochondrial cristae * Salmo salar Subject RIV: EA - Cell Biology Impact factor: 0.446, year: 2002

  18. First evidence of testate amoebae in Lago Fagnano (54° S), Tierra del Fuego (Argentina): Proxies to reconstruct environmental changes

    Science.gov (United States)

    Caffau, Mauro; Lenaz, Davide; Lodolo, Emanuele; Zecchin, Massimo; Comici, Cinzia; Tassone, Alejandro

    2015-12-01

    We report here the first findings of testate amoebae at high southern latitudes (54° S) from four gravity cores recovered in the Lago Fagnano (Tierra del Fuego, Argentina), where twelve taxa have been recognized. Among them, Centropyxis constricta "constricta", Centropyxis elongata, Difflugia globulus, Difflugia oblonga "oblonga", and Difflugia protaeiformis "amphoralis" are always present, while other taxa are randomly distributed. According to the sand/silt ratio in the different cores, the Total Organic Carbon content and the Carbon/Nitrogen ratio, as well as the presence/disappearance and abundance of testate amoebae from cluster analysis, we infer a correlation between major textural/granulometrical changes found in the cores and environmental changes. A seismic event occurred on 1949, which substantially modified the morphology of the eastern Lago Fagnano shoreline and the supply pattern from two main eastern tributaries of the lake, is recorded in the studied cores. This event has in part modified the distribution of testate amoebae taxa within the studied cores. Present results show that testate amoebae represent important indicators to detect changes occurring in the environment in which they live.

  19. Testate Amoebae Communities in the Rhizosphere of Rhododendron ponticum (Ericaceae) in an Evergreen Broadleaf Forest in Southern Spain

    Czech Academy of Sciences Publication Activity Database

    Vohník, Martin; Burdíková, Zuzana; Wilkinson, D. M.

    2012-01-01

    Roč. 51, Sp. iss.3 (2012), s. 259-269. ISSN 0065-1583 Institutional support: RVO:67985939 ; RVO:67985823 Keywords : testate amoebae * Ericaceae * rhizosphere Subject RIV: EF - Botanics; ED - Physiology (FGU-C) Impact factor: 0.984, year: 2012

  20. Effect of Common Drinking Water Disinfectants, Chlorine and Heat, on Free Legionella and Amoebae-Associated Legionella.

    Directory of Open Access Journals (Sweden)

    Sílvia Cervero-Aragó

    Full Text Available Chlorine and thermal treatments are the most commonly used procedures to control and prevent Legionella proliferation in drinking water systems of large buildings. However, cases of legionellosis still occur in facilities with treated water. The purpose of this work was to model the effect of temperature and free chlorine applied in similar exposure conditions as in drinking water systems on five Legionella spp. strains and two amoebal strains of the genera Acanthamoeba. Inactivation models obtained were used to determine the effectiveness of the treatments applied which resulted more effective against Legionella than Acanthamoeba, especially those in cystic stages. Furthermore, to determine the influence of the relationship between L. pneumophila and Acanthamoeba spp. on the treatment effectiveness, inactivation models of the bacteria-associated amoeba were also constructed and compared to the models obtained for the free living bacteria state. The Legionella-amoeba association did not change the inactivation models, but it reduced the effectiveness of the treatments applied. Remarkably, at the lowest free chlorine concentration, 0.5 mg L-1, as well as at the lowest temperatures, 50°C and 55°C, the influence of the Legionella-amoeba associate state was the strongest in reducing the effectiveness of the treatments compared to the free Legionella state. Therefore, the association established between L. pneumophila and amoebae in the water systems indicate an increased health risk in proximal areas of the system (close to the tap where lower free chlorine concentrations and lower temperatures are commonly observed.

  1. Shedding light on microbial dark matter: a TM6 bacterium as natural endosymbiont of a free-living amoeba.

    Science.gov (United States)

    Delafont, Vincent; Samba-Louaka, Ascel; Bouchon, Didier; Moulin, Laurent; Héchard, Yann

    2015-12-01

    The TM6 phylum belongs to the so-called microbial dark matter that gathers uncultivated bacteria detected only via DNA sequencing. Recently, the genome sequence of a TM6 bacterium (TM6SC1) has led to suggest that this bacterium would adopt an endosymbiotic life. In the present paper, free-living amoebae bearing a TM6 strain were isolated from a water network. The amoebae were identified as Vermamoeba vermiformis and the presence of a TM6 strain was detected by polymerase chain reaction and microscopy. The partial sequence of its 16S rRNA gene showed this strain to be closely related to the sequenced TM6SC1 strain. These bacteria displayed a pyriform shape and were found within V. vermiformis. Therefore, these bacteria were named Vermiphilus pyriformis. Interactions studies showed that V. pyriformis was highly infectious and that its relation with V. vermiformis was specific and highly stable. Finally, it was found that V. pyriformis inhibited the encystment of V. vermiformis. Overall, this study describes for the first time an endosymbiotic relationship between a TM6 bacterium and a free-living amoeba in the environment. It suggests that other bacteria of the TM6 phylum might also be endosymbiotic bacteria and may be found in other free-living amoebae or other organisms. PMID:26471960

  2. Effect of Common Drinking Water Disinfectants, Chlorine and Heat, on Free Legionella and Amoebae-Associated Legionella

    Science.gov (United States)

    Cervero-Aragó, Sílvia; Rodríguez-Martínez, Sarah; Puertas-Bennasar, Antoni; Araujo, Rosa M.

    2015-01-01

    Chlorine and thermal treatments are the most commonly used procedures to control and prevent Legionella proliferation in drinking water systems of large buildings. However, cases of legionellosis still occur in facilities with treated water. The purpose of this work was to model the effect of temperature and free chlorine applied in similar exposure conditions as in drinking water systems on five Legionella spp. strains and two amoebal strains of the genera Acanthamoeba. Inactivation models obtained were used to determine the effectiveness of the treatments applied which resulted more effective against Legionella than Acanthamoeba, especially those in cystic stages. Furthermore, to determine the influence of the relationship between L. pneumophila and Acanthamoeba spp. on the treatment effectiveness, inactivation models of the bacteria-associated amoeba were also constructed and compared to the models obtained for the free living bacteria state. The Legionella-amoeba association did not change the inactivation models, but it reduced the effectiveness of the treatments applied. Remarkably, at the lowest free chlorine concentration, 0.5 mg L-1, as well as at the lowest temperatures, 50°C and 55°C, the influence of the Legionella-amoeba associate state was the strongest in reducing the effectiveness of the treatments compared to the free Legionella state. Therefore, the association established between L. pneumophila and amoebae in the water systems indicate an increased health risk in proximal areas of the system (close to the tap) where lower free chlorine concentrations and lower temperatures are commonly observed. PMID:26241039

  3. Pathogenesis of amoebic encephalitis: Are the amoebae being credited to an 'inside job' done by the host immune response?

    Science.gov (United States)

    Baig, Abdul Mannan

    2015-08-01

    Pathogenic free living amoeba like Naegleria fowleri, Acanthamoeba spp., and Balamuthia mandrillaris are known to cause fatal "amoebic meningoencephalitis" by acquiring different route of entries to the brain. The host immune response to these protist pathogens differs from each another, as evidenced by the postmortem gross and microscopic findings from the brains of the affected patients. Cited with the expression of 'brain eating amoeba' when the infection is caused by N. fowleri, this expression is making its way into parasitology journals and books. The impression that it imparts is, as if the brain damage is substantially due to the enzymes and toxins produced by this amoeba. A detailed review of the literature, analysis of archived specimens and with our experimental assays, here we establish that with N. fowleri, Acanthamoeba and Balamuthia spp., the infections result in an extensive brain damage that in fact is substantially caused by the host immune response rather than the amoeba. Due to the comparatively larger sizes of these pathogens and the prior exposure of the amoebal antigen to the human body, the host immune system launches an amplified response that not only breaches the blood brain barrier (BBB), but also becomes the major cause of brain damage in Amoebic meningoencephalitis. It is our understanding that for N. fowleri the host immune response is dominated by acute inflammatory cytokines and that, in cases of Acanthamoeba and Balamuthia spp., it is the type IV hypersensitivity reaction that fundamentally not only contributes to disruption and leakiness of the blood brain barrier (BBB) but also causes the neuronal damage. The further intensification of brain damage is done by toxins and enzymes secreted by the amoeba, which causes the irreversible brain damage. PMID:25930186

  4. Effect of UV irradiation (253.7 nm) on free Legionella and Legionella associated with its amoebae hosts.

    Science.gov (United States)

    Cervero-Aragó, Sílvia; Sommer, Regina; Araujo, Rosa M

    2014-12-15

    Water systems are the primary reservoir for Legionella spp., where the bacteria live in association with other microorganisms, such as free-living amoebae. A wide range of disinfection treatments have been studied to control and prevent Legionella colonization but few of them were performed considering its relation with protozoa. In this study, the effectiveness of UV irradiation (253.7 nm) using low-pressure lamps was investigated as a disinfection method for Legionella and amoebae under controlled laboratory conditions. UV treatments were applied to 5 strains of Legionella spp., 4 strains of free-living amoeba of the genera Acanthamoeba and Vermamoeba, treating separately trophozoites and cysts, and to two different co-cultures of Legionella pneumophila with the Acanthamoeba strains. No significant differences in the UV inactivation behavior were observed among Legionella strains tested which were 3 logs reduced for fluences around 45 J/m(2). UV irradiation was less effective against free-living amoebae; which in some cases required up to 990 J/m(2) to obtain the same population reduction. UV treatment was more effective against trophozoites compared to cysts; moreover, inactivation patterns were clearly different between the genus Acanthamoeba and Vermamoeba. For the first time data about Vermamoeba vermiformis UV inactivation has been reported in a study. Finally, the results showed that the association of L. pneumophila with free-living amoebae decreases the effectiveness of UV irradiation against the bacteria in a range of 1.5-2 fold. That fact demonstrates that the relations established between different microorganisms in the water systems can modify the effectiveness of the UV treatments applied. PMID:25306486

  5. Spontaneous emergence of large-scale cell cycle synchronization in amoeba colonies

    Science.gov (United States)

    Segota, Igor; Boulet, Laurent; Franck, David; Franck, Carl

    2014-06-01

    Unicellular eukaryotic amoebae Dictyostelium discoideum are generally believed to grow in their vegetative state as single cells until starvation, when their collective aspect emerges and they differentiate to form a multicellular slime mold. While major efforts continue to be aimed at their starvation-induced social aspect, our understanding of population dynamics and cell cycle in the vegetative growth phase has remained incomplete. Here we show that cell populations grown on a substrate spontaneously synchronize their cell cycles within several hours. These collective population-wide cell cycle oscillations span millimeter length scales and can be completely suppressed by washing away putative cell-secreted signals, implying signaling by means of a diffusible growth factor or mitogen. These observations give strong evidence for collective proliferation behavior in the vegetative state.

  6. Spontaneous emergence of large-scale cell cycle synchronization in amoeba colonies

    International Nuclear Information System (INIS)

    Unicellular eukaryotic amoebae Dictyostelium discoideum are generally believed to grow in their vegetative state as single cells until starvation, when their collective aspect emerges and they differentiate to form a multicellular slime mold. While major efforts continue to be aimed at their starvation-induced social aspect, our understanding of population dynamics and cell cycle in the vegetative growth phase has remained incomplete. Here we show that cell populations grown on a substrate spontaneously synchronize their cell cycles within several hours. These collective population-wide cell cycle oscillations span millimeter length scales and can be completely suppressed by washing away putative cell-secreted signals, implying signaling by means of a diffusible growth factor or mitogen. These observations give strong evidence for collective proliferation behavior in the vegetative state. (paper)

  7. Ab Initio Extension of the AMOEBA Polarizable Force Field to Fe(2.).

    Science.gov (United States)

    Semrouni, David; Isley, William C; Clavaguéra, Carine; Dognon, Jean-Pierre; Cramer, Christopher J; Gagliardi, Laura

    2013-07-01

    We extend the AMOEBA polarizable molecular mechanics force field to the Fe(2+) cation in its singlet, triplet, and quintet spin states. Required parameters are obtained either directly from first principles calculations or optimized so as to reproduce corresponding interaction energy components in a hexaaquo environment derived from quantum mechanical energy decomposition analyses. We assess the importance of the damping of point-dipole polarization at short distance as well as the influence of charge-transfer for metal-water interactions in hydrated Fe(2+); this analysis informs the selection of model systems employed for parametrization. We validate our final Fe(2+) model through comparison of molecular dynamics (MD) simulations to available experimental data for aqueous ferrous ion in its quintet electronic ground state. PMID:26583987

  8. Bitter tastant responses in the amoeba Dictyostelium correlate with rat and human taste assays.

    Science.gov (United States)

    Cocorocchio, Marco; Ives, Robert; Clapham, David; Andrews, Paul L R; Williams, Robin S B

    2016-01-01

    Treatment compliance is reduced when pharmaceutical compounds have a bitter taste and this is particularly marked for paediatric medications. Identification of bitter taste liability during drug discovery utilises the rat in vivo brief access taste aversion (BATA) test which apart from animal use is time consuming with limited throughput. We investigated the suitability of using a simple, non-animal model, the amoeba Dictyostelium discoideum to investigate taste-related responses and particularly identification of compounds with a bitter taste liability. The effect of taste-related compounds on Dictyostelium behaviour following acute exposure (15 minutes) was monitored. Dictyostelium did not respond to salty, sour, umami or sweet tasting compounds, however, cells rapidly responded to bitter tastants. Using time-lapse photography and computer-generated quantification to monitor changes in cell membrane movement, we developed an assay to assess the response of Dictyostelium to a wide range of structurally diverse known bitter compounds and blinded compounds. Dictyostelium showed varying responses to the bitter tastants, with IC50 values providing a rank order of potency. Comparison of Dictyostelium IC50 values to those observed in response to a similar range of compounds in the rat in vivo brief access taste aversion test showed a significant (p = 0.0172) positive correlation between the two models, and additionally a similar response to that provided by a human sensory panel assessment test. These experiments demonstrate that Dictyostelium may provide a suitable model for early prediction of bitterness for novel tastants and drugs. Interestingly, a response to bitter tastants appears conserved from single-celled amoebae to humans. PMID:26708104

  9. Evolutionary diversity of social amoebae N-glycomes may support interspecific autonomy.

    Science.gov (United States)

    Feasley, Christa L; van der Wel, Hanke; West, Christopher M

    2015-08-01

    Multiple species of cellular slime mold (CSM) amoebae share overlapping subterranean environments near the soil surface. Despite similar life-styles, individual species form independent starvation-induced fruiting bodies whose spores can renew the life cycle. N-glycans associated with the cell surface glycocalyx have been predicted to contribute to interspecific avoidance, resistance to pathogens, and prey preference. N-glycans from five CSM species that diverged 300-600 million years ago and whose genomes have been sequenced were fractionated into neutral and acidic pools and profiled by MALDI-TOF-MS. Glycan structure models were refined using linkage specific antibodies, exoglycosidase digestions, MALDI-MS/MS, and chromatographic studies. Amoebae of the type species Dictyostelium discoideum express modestly trimmed high mannose N-glycans variably modified with core α3-linked Fuc and peripherally decorated with 0-2 residues each of β-GlcNAc, Fuc, methylphosphate and/or sulfate, as reported previously. Comparative analyses of D. purpureum, D. fasciculatum, Polysphondylium pallidum, and Actyostelium subglobosum revealed that each displays a distinctive spectrum of high-mannose species with quantitative variations in the extent of these modifications, and qualitative differences including retention of Glc, mannose methylation, and absence of a peripheral GlcNAc, fucosylation, or sulfation. Starvation-induced development modifies the pattern in all species but, except for universally observed increased mannose-trimming, the N-glycans do not converge to a common profile. Correlations with glycogene repertoires will enable future reverse genetic studies to eliminate N-glycomic differences to test their functions in interspecific relations and pathogen evasion. PMID:25987342

  10. Survival of Campylobacter jejuni in co-culture with Acanthamoeba castellanii: role of amoeba-mediated depletion of dissolved oxygen

    DEFF Research Database (Denmark)

    Bui, Thanh Xuan; Winding, Anne; Qvortrup, Klaus;

    2012-01-01

    Campylobacter jejuni is a major cause of infectious diarrhoea worldwide but relatively little is known about its ecology. In this study, we examined its interactions with Acanthamoeba castellanii, a protozoan suspected to serve as a reservoir for bacterial pathogens. We observed rapid degradation...... of intracellular C. jejuni in A. castellanii 5 h post gentamicin treatment at 25°C. Conversely, we found that A. castellanii promoted the extracellular growth of C. jejuni in co-cultures at 37°C in aerobic conditions. This growth-promoting effect did not require amoebae – bacteria contact. The growth....... Interestingly, the dissolved oxygen levels of co-cultures with or without amoebae – bacteria contact were much lower than those observed with culture media or with C. jejuni alone incubated in aerobic conditions, and were comparable with levels obtained after 24 h of growth of C. jejuni under microaerophilic...

  11. Towards accurate solvation dynamics of divalent cations in water using the polarizable amoeba force field: From energetics to structure

    Science.gov (United States)

    Piquemal, Jean-Philip; Perera, Lalith; Cisneros, G. Andrés; Ren, Pengyu; Pedersen, Lee G.; Darden, Thomas A.

    2006-08-01

    Molecular dynamics simulations were performed using a modified amoeba force field to determine hydration and dynamical properties of the divalent cations Ca2+ and Mg2+. The extension of amoeba to divalent cations required the introduction of a cation specific parametrization. To accomplish this, the Tholé polarization damping model parametrization was modified based on the ab initio polarization energy computed by a constrained space orbital variation energy decomposition scheme. Excellent agreement has been found with condensed phase experimental results using parameters derived from gas phase ab initio calculations. Additionally, we have observed that the coordination of the calcium cation is influenced by the size of the periodic water box, a recurrent issue in first principles molecular dynamics studies.

  12. A QM/MM Approach Using the AMOEBA Polarizable Embedding: From Ground State Energies to Electronic Excitations.

    Science.gov (United States)

    Loco, Daniele; Polack, Étienne; Caprasecca, Stefano; Lagardère, Louis; Lipparini, Filippo; Piquemal, Jean-Philip; Mennucci, Benedetta

    2016-08-01

    A fully polarizable implementation of the hybrid quantum mechanics/molecular mechanics approach is presented, where the classical environment is described through the AMOEBA polarizable force field. A variational formalism, offering a self-consistent relaxation of both the MM induced dipoles and the QM electronic density, is used for ground state energies and extended to electronic excitations in the framework of time-dependent density functional theory combined with a state specific response of the classical part. An application to the calculation of the solvatochromism of the pyridinium N-phenolate betaine dye used to define the solvent ET(30) scale is presented. The results show that the QM/AMOEBA model not only properly describes specific and bulk effects in the ground state but it also correctly responds to the large change in the solute electronic charge distribution upon excitation. PMID:27340904

  13. Growth regulation of Legionella Pneumophila in biofilms and amoebae; Wachstumsregulation von Legionella Pneumophila in Biofilmen und Amoeben

    Energy Technology Data Exchange (ETDEWEB)

    Hilbi, H.

    2006-07-01

    This final report for the Swiss Federal Office of Energy (SFOE) presents the results of studies made on the regulation of the growth of Legionella Pneumophila bacteria in biofilms and amoebae. In a first project, the formation of biofilms by Legionella Pneumophila bacteria was analysed in static and dynamic systems using a complex growth medium. Under static and dynamic clinical and environmental conditions, the adherence of the biofilms on polystyrene tissue was studied. This was also examined under dynamic flow conditions. In a second part of the project, the regulation of growth of Legionella Pneumophila in amoebae was examined in that changes were made to the genome of the bacteria. The importance of the work for the de-activation of Legionella Pneumophila bacteria in biofilms is noted in the conclusions of the report.

  14. Testate amoebae (Protozoa) in soils of restored flowery meadows in the Bílé Karpaty Mts. (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Balík, Vladimír

    České Budějovice : Institute of Soil Biology AS CR, 2002, s. 1-5. ISBN 80-86525-00-7. [Central European Workshop on Soil Zoology /6./. České Budějovice (CZ), 23.04.2001-25.04.2001] R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6066911 Keywords : testate amoebae * flowery meadows * restoration Subject RIV: EH - Ecology, Behaviour

  15. A Novel Glycolipid Biosurfactant Confers Grazing Resistance upon Pantoea ananatis BRT175 against the Social Amoeba Dictyostelium discoideum.

    Science.gov (United States)

    Smith, Derek D N; Nickzad, Arvin; Déziel, Eric; Stavrinides, John

    2016-01-01

    Pantoea is a versatile genus of bacteria with both plant- and animal-pathogenic strains, some of which have been suggested to cause human infections. There is, however, limited knowledge on the potential determinants used for host association and pathogenesis in animal systems. In this study, we used the model host Dictyostelium discoideum to show that isolates of Pantoea ananatis exhibit differential grazing susceptibility, with some being resistant to grazing by the amoebae. We carried out a high-throughput genetic screen of one grazing-resistant isolate, P. ananatis BRT175, using the D. discoideum pathosystem to identify genes responsible for the resistance phenotype. Among the 26 candidate genes involved in grazing resistance, we identified rhlA and rhlB, which we show are involved in the biosynthesis of a biosurfactant that enables swarming motility in P. ananatis BRT175. Using liquid chromatography-mass spectrometry (LC-MS), the biosurfactant was shown to be a glycolipid with monohexose-C10-C10 as the primary congener. We show that this novel glycolipid biosurfactant is cytotoxic to the amoebae and is capable of compromising cellular integrity, leading to cell lysis. The production of this biosurfactant may be important for bacterial survival in the environment and could contribute to the establishment of opportunistic infections. IMPORTANCE The genetic factors used for host interaction by the opportunistic human pathogen Pantoea ananatis are largely unknown. We identified two genes that are important for the production of a biosurfactant that confers grazing resistance against the social amoeba Dictyostelium discoideum. We show that the biosurfactant, which exhibits cytotoxicity toward the amoebae, is a glycolipid that incorporates a hexose rather than rhamnose. The production of this biosurfactant may confer a competitive advantage in the environment and could potentially contribute to the establishment of opportunistic infections. PMID:27303689

  16. Pathogenic free-living amoebae in a closed-loop power plant; risk assessment and risk management

    Energy Technology Data Exchange (ETDEWEB)

    Cabanes, P. [Electricite de France (EDF), 75 - Paris (France). Service Etudes Medicales; Pringuez, E.; Siclet, F.; Khalanski, M. [Electricite de France (EDF), 75 - Paris (France). Direction des Etudes et Recherches; Bard, D. [CEA/Fontenay-aux-Roses, Inst. de Protection et de Surete Nucleaire (IPSN), 92 (France); Pernin, P. [Faculte de Pharmacie de Lyon, 69 (France)

    1998-07-01

    Since 1980, the water used for cooling in French power plants has been tested for pathogenic amoebae, especially Naegleria fowleri, the causative agent of Primary Amoebic Meningoencephalitis (PAM), a rapid fatal disease of the central nervous system. The replacement of brass condensers by stainless steel condensers resulted in increased Naegleria fowleri development, to a density of as much as 3000 l{sup -1} in the Dampierre power plant cooling water. Downstream from Dampierre, the maximum detected density of this amoeba during the summer of 1995 was 80 l{sup -1}, at low river flow. The replacement of a second condenser in 1996 at the same power plant was expected to double the amoebae concentration in the river. The hypothetical PAM risk for swimmers was then predicted to be 10{sup -4} per swim. To reduce the risk continuous chlorination of the closed-loop cooling system was implemented at a free residual chlorine level in the range of 0.3-0.5 mg.l{sup -1}. Naegleria fowleri concentrations decreased immediately and thereafter remained under 4 l{sup -1}. Total residual chlorine and chlorinated organic compounds were also monitored in the evaluation of the environmental impact of this preventive action. (authors)

  17. Different growth rates in amoeba of genotypically related environmental and clinical Legionella pneumophila strains isolated from a thermal spa.

    Science.gov (United States)

    Molmeret, M; Jarraud, S; Mori, J P; Pernin, P; Forey, F; Reyrolle, M; Vandenesch, F; Etienne, J; Farge, P

    2001-04-01

    Two cases of legionellosis occurring 3 years apart were acquired in the same French thermal spa and were apparently due to the same strain of Legionella pneumophila serogroup 1, as shown by genomic macrorestriction analysis. Minor differences between the two isolates were found by random amplification PCR profiling which showed an additional band with one of the isolates. Analysis of 107 L. pneumophila strains isolated from the spa waters by genome macrorestriction failed to identify the infective strain, but a closely related L. pneumophila serogroup 3 strain differing from the clinical isolates by only one band was found. To determine if the clinical L. pneumophila serogroup 1 isolates was better adapted for intracellular multiplication than related serogroup 3 environmental isolates, the growth kinetics of six isolates were determined in co-culture with Acanthamoeba lenticulata. One clinical isolate failed to grow within amoeba, while the other clinical isolate yielded the highest increase in bacterial cell count per amoeba (1,200%) and the environmental isolates gave intermediate values. Genetic analysis of L. pneumophila isolates by DNA macrorestriction does not therefore appear to reflect their growth kinetics within amoeba, and is not sufficiently discriminatory to identify potentially virulent strains. PMID:11349974

  18. Pathogenic free-living amoebae in a closed-loop power plant; risk assessment and risk management

    International Nuclear Information System (INIS)

    Since 1980, the water used for cooling in French power plants has been tested for pathogenic amoebae, especially Naegleria fowleri, the causative agent of Primary Amoebic Meningoencephalitis (PAM), a rapid fatal disease of the central nervous system. The replacement of brass condensers by stainless steel condensers resulted in increased Naegleria fowleri development, to a density of as much as 3000 l-1 in the Dampierre power plant cooling water. Downstream from Dampierre, the maximum detected density of this amoeba during the summer of 1995 was 80 l-1, at low river flow. The replacement of a second condenser in 1996 at the same power plant was expected to double the amoebae concentration in the river. The hypothetical PAM risk for swimmers was then predicted to be 10-4 per swim. To reduce the risk continuous chlorination of the closed-loop cooling system was implemented at a free residual chlorine level in the range of 0.3-0.5 mg.l-1. Naegleria fowleri concentrations decreased immediately and thereafter remained under 4 l-1. Total residual chlorine and chlorinated organic compounds were also monitored in the evaluation of the environmental impact of this preventive action. (authors)

  19. Comparative Recoveries of Naegleria fowleri Amoebae from Seeded River Water by Filtration and Centrifugation

    Science.gov (United States)

    Pernin, P.; Pélandakis, M.; Rouby, Y.; Faure, A.; Siclet, F.

    1998-01-01

    Detection of pathogenic Naegleria fowleri in environmental water samples, which is necessary for the prevention of primary amoebic meningoencephalitis, generally requires concentrating the samples. Two concentration techniques, filtration and centrifugation, were used to study the recovery of N. fowleri, in vegetative or cystic form, that had been mixed with the two other thermotolerant Naegleria species, N. lovaniensis and N. australiensis. Counting of amoebae was performed by the most probable number method on 10 water replicates of 100 ml and 10 ml each. With both concentration methods, recovery was better for cysts than for trophozoites (53% ± 21% versus 5% ± 5% by filtration and 57% ± 25% versus 22% ± 5% by centrifugation). The recovery of Naegleria trophozoites by filtration was very low, and centrifugation was significantly better than filtration in recovery of Naegleria trophozoites (22% ± 5% versus 5% ± 5%; P 0.7). Although the recovery of cysts of N. fowleri obtained by filtration (51% ± 24%) appeared higher than that by centrifugation (36% ± 23%), the difference was not significant (P > 0.1). Both concentration methods have highly variable recovery rates, making accurate quantification of low concentrations (<100/liter) of N. fowleri in the environment difficult. PMID:9501435

  20. An expanded phylogeny of social amoebas (Dictyostelia shows increasing diversity and new morphological patterns

    Directory of Open Access Journals (Sweden)

    Stephenson Steven L

    2011-03-01

    Full Text Available Abstract Background Social Amoebae or Dictyostelia are eukaryotic microbes with a unique life cycle consisting of both uni- and multicellular stages. They have long fascinated molecular, developmental and evolutionary biologists, and Dictyostelium discoideum is now one of the most widely studied eukaryotic microbial models. The first molecular phylogeny of Dictyostelia included most of the species known at the time and suggested an extremely deep taxon with a molecular depth roughly equivalent to Metazoa. The group was also shown to consist of four major clades, none of which correspond to traditional genera. Potential morphological justification was identified for three of the four major groups, on the basis of which tentative names were assigned. Results Over the past four years, the Mycetozoan Global Biodiversity Survey has identified many new isolates that appear to be new species of Dictyostelia, along with numerous isolates of previously described species. We have determined 18S ribosomal RNA gene sequences for all of these new isolates. Phylogenetic analyses of these data show at least 50 new species, and these arise from throughout the dictyostelid tree breaking up many previously isolated long branches. The resulting tree now shows eight well-supported major groups instead of the original four. The new species also expand the known morphological diversity of the previously established four major groups, violating nearly all previously suggested deep morphological patterns. Conclusions A greatly expanded phylogeny of Dictyostelia now shows even greater morphological plasticity at deep taxonomic levels. In fact, there now seem to be no obvious deep evolutionary trends across the group. However at a finer level, patterns in morphological character evolution are beginning to emerge. These results also suggest that there is a far greater diversity of Dictyostelia yet to be discovered, including novel morphologies.

  1. A Novel Lineage of 'Naked Filose Amoebae'; Kraken carinae gen. nov. sp. nov. (Cercozoa) with a Remarkable Locomotion by Disassembly of its Cell Body.

    Science.gov (United States)

    Dumack, Kenneth; Schuster, Julia; Bass, David; Bonkowski, Michael

    2016-06-01

    The term 'filose amoebae' describes a highly polyphyletic assemblage of protists whose phylogenetic placement can be unpredictable based on gross morphology alone. We isolated six filose amoebae from soils of two European countries and describe a new genus and species of naked filose amoebae, Kraken carinae gen. nov. sp. nov. We provide a morphological description based on light microscopy and small subunit rRNA gene sequences (SSU rDNA). In culture, Kraken carinae strains were very slow-moving and preyed on bacteria using a network of filopodia. Phylogenetic analyses of SSU sequences reveal that Kraken are core (filosan) Cercozoa, branching weakly at the base of the cercomonad radiation, most closely related to Paracercomonas, Metabolomonas, and Brevimastigomonas. Some Kraken sequences are >99% similar to an environmental sequence obtained from a freshwater lake in Antarctica, indicating that Kraken is not exclusively soil dwelling, but also inhabits freshwater habitats. PMID:27236418

  2. Evidence of transfer by conjugation of type IV secretion system genes between Bartonella species and Rhizobium radiobacter in amoeba.

    Directory of Open Access Journals (Sweden)

    Watcharee Saisongkorh

    Full Text Available BACKGROUND: Bartonella species cospeciate with mammals and live within erythrocytes. Even in these specific niches, it has been recently suggested by bioinformatic analysis of full genome sequences that Lateral Gene Transfer (LGT may occur but this has never been demonstrated biologically. Here we describe the sequence of the B. rattaustraliani (AUST/NH4(T circular plasmid (pNH4 that encodes the tra cluster of the Type IV secretion system (T4SS and we eventually provide evidence that Bartonella species may conjugate and exchange this plasmid inside amoeba. PRINCIPAL FINDINGS: The T4SS of pNH4 is critical for intracellular viability of bacterial pathogens, exhibits bioinformatic evidence of LGT among bacteria living in phagocytic protists. For instance, 3 out of 4 T4SS encoding genes from pNH4 appear to be closely related to Rhizobiales, suggesting that gene exchange occurs between intracellular bacteria from mammals (bartonellae and plants (Rhizobiales. We show that B. rattaustraliani and Rhizobium radiobacter both survived within the amoeba Acanthamoeba polyphaga and can conjugate together. Our findings further support the hypothesis that tra genes might also move into and out of bacterial communities by conjugation, which might be the primary means of genomic evolution for intracellular adaptation by cross-talk of interchangeable genes between Bartonella species and plant pathogens. CONCLUSIONS: Based on this, we speculate that amoeba favor the transfer of genes as phagocytic protists, which allows for intraphagocytic survival and, as a consequence, promotes the creation of potential pathogenic organisms.

  3. Sex ratio and gamete size across eastern North America in Dictyostelium discoideum, a social amoeba with three sexes.

    Science.gov (United States)

    Douglas, T E; Strassmann, J E; Queller, D C

    2016-07-01

    Theory indicates that numbers of mating types should tend towards infinity or remain at two. The social amoeba, Dictyostelium discoideum, however, has three mating types. It is therefore a mystery how this species has broken the threshold of two mating types, but has not increased towards a much higher number. Frequency-dependent selection on rare types in combination with isogamy, a form of reproduction involving gametes similar in size, could explain the evolution of multiple mating types in this system. Other factors, such as drift, may be preventing the evolution of more than three. We first looked for evidence of isogamy by measuring gamete size associated with each type. We found no evidence of size dissimilarities between gametes. We then looked for evidence of balancing selection, by examining mating type distributions in natural populations and comparing genetic differentiation at the mating type locus to that at more neutral loci. We found that mating type frequency varied among the three populations we examined, with only one of the three showing an even sex ratio, which does not support balancing selection. However, we found more population structure at neutral loci than the mating type locus, suggesting that the three mating types are indeed maintained at intermediate frequencies by balancing selection. Overall, the data are consistent with balancing selection acting on D. discoideum mating types, but with a sufficiently weak rare sex advantage to allow for drift, a potential explanation for why these amoebae have only three mating types. PMID:27018644

  4. Paulinella longichromatophora sp. nov., a New Marine Photosynthetic Testate Amoeba Containing a Chromatophore.

    Science.gov (United States)

    Kim, Sunju; Park, Myung Gil

    2016-02-01

    The freshwater testate filose amoeba Paulinella chromatophora is the sole species in the genus to have plastids, usually termed "chromatophores", of a Synechococcus/Prochlorococcus-like cyanobacterial origin. Here, we report a new marine phototrophic species, Paulinella longichromatophora sp. nov., using light and electron microscopy and molecular data. This new species contains two blue-green U-shaped chromatophores reaching up to 40μm in total length. Further, the new Paulinella species is characterized by having five oral scales surrounding the pseudostomal aperture. All trees generated using three nuclear rDNA datasets (18S rDNA, 28S rDNA, and the concatenated 18S + 28S rDNA) demonstrated that three photosynthetic Paulinella species (two freshwater species, P. chromatophora and Paulinella strain FK01, and one marine species, P. longichromatophora) congruently formed a monophyletic group with strong support (≥90% of ML and ≥0.90 of PP), but their relationship to each other within the clade remained unresolved in all trees. P. longichromatophora, nevertheless, clustered consistently together with Paulinella strain FK01 with very low support, but the clade received strong support in plastid phylogenies. Phylogenetic analyses inferred from plastid-encoded 16S rDNA and a concatenated dataset of plastid 16S+23S rDNA demonstrated that chromatophores of all photosynthetic Paulinella species were monophyletic. The monophyletic group fell within a cyanobacteria clade having a close relationship to an α-cyanobacterial clade containing Prochlorococcus and Synechococcus species with very robust support (100% of ML and 1.0 of PP). Additionally, phylogenetic analyses of nuclear 18S rDNA and plastid 16S rDNA suggested divergent evolution within the photosynthetic Paulinella population after a single acquisition of the chromatophore. After the single acquisition of the chromatophore, ancestral photosynthetic Paulinella appears to have diverged into at least two distinct

  5. Polarizable molecular dynamics simulation of Zn(II) in water using the AMOEBA force field.

    Science.gov (United States)

    Wu, Johnny C; Piquemal, Jean-Philip; Chaudret, Robin; Reinhardt, Peter; Ren, Pengyu

    2010-07-13

    The hydration free energy, structure, and dynamics of the zinc divalent cation are studied using a polarizable force field in molecular dynamics simulations. Parameters for the Zn(2+) are derived from gas-phase ab initio calculation of Zn(2+)-water dimer. The Thole-based dipole polarization is adjusted based on the Constrained Space Orbital Variations (CSOV) calculation while the Symmetry Adapted Perturbation Theory (SAPT) approach is also discussed. The vdW parameters of Zn(2+) have been obtained by comparing the AMOEBA Zn(2+)-water dimerization energy with results from several theory levels and basis sets over a range of distances. Molecular dynamics simulations of Zn(2+) solvation in bulk water are subsequently performed with the polarizable force field. The calculated first-shell water coordination number, water residence time and free energy of hydration are consistent with experimental and previous theoretical values. The study is supplemented with extensive Reduced Variational Space (RVS) and Electron Localization Function (ELF) computations in order to unravel the nature of the bonding in Zn(2+)(H(2)O)(n) (n=1,6) complexes and to analyze the charge transfer contribution to the complexes. Results show that the importance of charge transfer decreases as the size of Zn-water cluster grows due to anticooperativity and to changes in the nature of the metal-ligand bonds. Induction could be dominated by polarization when the system approaches condensed-phase and the covelant effects are eliminated from the Zn(II)-water interaction. To construct an "effective" classical polarizable potential for Zn(2+) in bulk water, one should therefore avoid over-fitting to the ab initio charge transfer energy of Zn(2+)-water dimer. Indeed, in order to avoid overestimation of condensed-phase many-body effects, which is crucial to the transferability of polarizable molecular dynamics, charge transfer should not be included within the classical polarization contribution and should

  6. Isolamento de amebas de vida livre a partir de água mineral engarrafada Isolation of free-living amoebae from bottled mineral water

    Directory of Open Access Journals (Sweden)

    Homero Coutinho Salazar

    1982-10-01

    Full Text Available Foram isoladas amebas dos gêneros Vahlkampfia, Glaeseria, Acanthamoeba, Filamoeba, Amoeba, Platyamoeba e Hartmanella de dez diferentes marcas de água mineral engarrafadas, servidas no Rio de Janeiro, RJ (Brasil. Somente uma das marcas foi negativa para protozoários, enquanto que de todas as outras foram isoladas amebas de vida livre. O significado desses resultados é discutido como um indicador de qualidade da água mineral usada comercialmente, destacando-se o fato de que alguns desses microorganismos são potencialmente patogênicos.Amoebae of the genera Vahlkampfia, Glaeseria, Acanthamoeba, Filamoeba, Amoeba, Platyamoeba and Hartmanella were isolated from ten different brands of bottled mineral water used in Rio de Janeiro. Of these brands, only one was negative after an incubation period of twenty days, while the others were all positive for free living amoebae. The results are discussed as an indicator of the quality of commercially used mineral water and it is stressed that some of these microorganisms are potentially pathogenic.

  7. Neoparamoeba spp. and their eukaryotic endosymbionts similar to Perkinsela amoebae (Hollande, 1980): Coevolution demonstrated by SSU rRNA gene phylogenies

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Fiala, Ivan; Pecková, Hana

    2008-01-01

    Roč. 44, č. 4 (2008), s. 269-277. ISSN 0932-4739 R&D Projects: GA MŠk LC522; GA ČR GA206/05/2384 Institutional research plan: CEZ:AV0Z60220518 Keywords : Neoparamoeba spp. * Perkinsela amoebae * coevolution Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2008

  8. First Evidence for Diploidy and Genetic Recombination in Free-Living Amoebae of the Genus Naegleria on the Basis of Electrophoretic Variation

    OpenAIRE

    Cariou, Marie Louise; Pernin, Pierre

    1987-01-01

    Electrophoretic variation for 15 enzyme-coding genes was studied in various Naegleria (Rhizopoda, Vahlkampfiidae) species. The occurrence of complex banding patterns provided the first evidence of a diploid structure of the genome of these amoebae. The putative loci identified were found not to be linked and the genotypic distribution suggested chromosomal recombination for one species (Naegleria lovaniensis).

  9. First Evidence for Diploidy and Genetic Recombination in Free-Living Amoebae of the Genus Naegleria on the Basis of Electrophoretic Variation

    Science.gov (United States)

    Cariou, Marie Louise; Pernin, Pierre

    1987-01-01

    Electrophoretic variation for 15 enzyme-coding genes was studied in various Naegleria (Rhizopoda, Vahlkampfiidae) species. The occurrence of complex banding patterns provided the first evidence of a diploid structure of the genome of these amoebae. The putative loci identified were found not to be linked and the genotypic distribution suggested chromosomal recombination for one species (Naegleria lovaniensis). PMID:17246363

  10. The performance of single- and multi-proxy transfer functions (testate amoebae, bryophytes, vascular plants) for reconstructing mire surface wetness and pH

    Science.gov (United States)

    Mitchell, Edward A. D.; Payne, Richard J.; van der Knaap, Willem O.; Lamentowicz, Łukasz; Gąbka, Maciej; Lamentowicz, Mariusz

    2013-01-01

    Peatlands are widely exploited archives of paleoenvironmental change. We developed and compared multiple transfer functions to infer peatland depth to the water table (DWT) and pH based on testate amoeba (percentages, or presence/absence), bryophyte presence/absence, and vascular plant presence/absence data from sub-alpine peatlands in the SE Swiss Alps in order to 1) compare the performance of single-proxy vs. multi-proxy models and 2) assess the performance of presence/absence models. Bootstrapping cross-validation showing the best performing single-proxy transfer functions for both DWT and pH were those based on bryophytes. The best performing transfer functions overall for DWT were those based on combined testate amoebae percentages, bryophytes and vascular plants; and, for pH, those based on testate amoebae and bryophytes. The comparison of DWT and pH inferred from testate amoeba percentages and presence/absence data showed similar general patterns but differences in the magnitude and timing of some shifts. These results show new directions for paleoenvironmental research, 1) suggesting that it is possible to build good-performing transfer functions using presence/absence data, although with some loss of accuracy, and 2) supporting the idea that multi-proxy inference models may improve paleoecological reconstruction. The performance of multi-proxy and single-proxy transfer functions should be further compared in paleoecological data.

  11. Advances in studies on testate amoebae (Arcellinida and Euglyphida: a scientometric approach - doi: 10.4025/actascibiolsci.v35i4.18184

    Directory of Open Access Journals (Sweden)

    Leilane Talita Fatoreto Schwind

    2013-07-01

    Full Text Available Testate amoebae have a great potential for use in scientific researches due to their ecological characteristics such as abundance, wealth, and generation time. In this way, this study aimed to present a scientometric analysis to describe the evolution of the different advances in researches on testate amoebae and identify a temporal pattern in this evolution. The literature review was based on papers indexed by Thomson Reuters (www.isiwebofknowledge.com and SciVerse Scopus (www.scopus.com. In total 562 papers were examined. Results showed a pattern of evolution in scientific studies, most with ecological approach with descriptive and predictive designs. At the global level, researches on testate amoebae progressed in both the number of articles published as well as in the areas studied, especially in Europe and North America. The low number of experimental studies and review articles can characterize the lack of more knowledge to be acquired, both from particular observations (descriptive studies as well as the observations noted sufficiently predictive of work. In Brazil, studies with testate amoebae are still developing, concentrated in only some regions, but the increased number of studies in recent years allows the prediction of the same overall patterns of advance for Brazilian researches. Thus, we conclude that these organisms are being increasingly used as a tool response in ecological studies.

  12. [Investigation of potentially pathogenic free-living amoebae and their in vivo pathogenicity in water supplies of Turkey].

    Science.gov (United States)

    Yazar, Süleyman; Gürbüz, Esra; Sönmez, Mehmet Fatih; Çetinkaya, Ülfet; Kuk, Salih

    2016-07-01

    Free-living amoebae (FLA) are found widely in soil and water in the nature. Among them in which potentially pathogenic for humans and animals are known as "potential pathogenic free-living amoebae (PPFLA)". PPFLA are characterized as the causes of clinical manifestations leading to death especially in immunosuppressed people. Four genus of PPFLA (Acanthamoeba, Naegleria, Balamuthia and Sappinia) are known to be pathogenic to humans. The aims of this study were to investigate the presence of PPFLA in the water supplies in Turkey and to determine their in vivo pathogenicity. A total of 664 water samples were collected from the ponds, rivers, streams and wells found in provinces located at different regions (central, western, eastern and southeastern regions) of Turkey. These samples were initially inoculated in the monoxenic culture media and evaluated by both microscopy and polymerase chain reaction (PCR) in terms of the presence of FLA. The samples identified as positive were then cultured in axenic media, the growth of amoebae that were confirmed microscopically, were than studied with PCR for molecular characterization. The isolates that were found positive by PCR from axenic cultures were inoculated intranasally to immunocompetent and immunodeficient (athymic) [BALB/c Rag2(-/-) gamma(c)(-/-)] BALB/c mice followed by the evaluation on the 21st day by histopathological and molecular methods to investigate their in vivo pathogenicity. In our study, 143 water samples were detected as positive in monoxenic cultures and 41 of them were detected as positive in axenic cultures. Twenty of 41 samples detected as positive in axenic culture could be continued in culture for three months. As a result of PCR using primers common to SYA, only nine have been identified from 20 samples as positive. According to the result of the PCR with specific primers, all (n= 9) were positive for Acanthamoeba sp., eight for Sappini sp. and five for Balamuthia mandrillaris, while none was

  13. [i]Legionella spp[/i]., amoebae and not-fermenting Gram negative bacteria in an Italian university hospital water system

    OpenAIRE

    Pasqualina Laganà; Gabriella Caruso; Davide Piccione; Maria Eufemia Gioffrè; Raffaella Pino; Santi Delia

    2014-01-01

    [b]Introduction. [/b]In hospital and other health care facilities, contamination of water systems by potentially infectious microorganisms, such as bacteria, viruses and protozoa, is a source of nosocomial infections, which may originate fromcolonization of water pipes, cooling towers, spa pools, taps, showers and water supplies. [b]Objective. [/b]The study focuses on the occurrence of [i]Legionella spp.[/i], free-living amoebae and non-fermenting Gram-negative microorganisms in a Unive...

  14. PCR Detection and Analysis of the Free-Living Amoeba Naegleria in Hot Springs in Yellowstone and Grand Teton National Parks

    OpenAIRE

    Sheehan, Kathy B.; Fagg, Jennifer A.; Ferris, Michael J.; Henson, Joan M.

    2003-01-01

    Free-living thermotolerant amoebae pose a significant health risk to people who soak and swim in habitats suitable for their growth, such as hot springs. In this survey of 23 different hot springs in Yellowstone and Grand Teton National Parks, we used PCR with primer sets specific for Naegleria to detect three sequence types that represent species not previously described, as well as a fourth sequence type identified as the pathogen Naegleria fowleri.

  15. Changes in Structure and Functioning of Protist (Testate Amoebae) Communities Due to Conversion of Lowland Rainforest into Rubber and Oil Palm Plantations

    Science.gov (United States)

    Krashevska, Valentyna; Klarner, Bernhard; Widyastuti, Rahayu; Maraun, Mark; Scheu, Stefan

    2016-01-01

    Large areas of tropical rainforest are being converted to agricultural and plantation land uses, but little is known of biodiversity and ecological functioning under these replacement land uses. We investigated the effects of conversion of rainforest into jungle rubber, intensive rubber and oil palm plantations on testate amoebae, diverse and functionally important protists in litter and soil. Living testate amoebae species richness, density and biomass were all lower in replacement land uses than in rainforest, with the impact being more pronounced in litter than in soil. Similar abundances of species of high and low trophic level in rainforest suggest that trophic interactions are more balanced, with a high number of functionally redundant species, than in rubber and oil palm. In contrast, plantations had a low density of high trophic level species indicating losses of functions. This was particularly so in oil palm plantations. In addition, the relative density of species with siliceous shells was >50% lower in the litter layer of oil palm and rubber compared to rainforest and jungle rubber. This difference suggests that rainforest conversion changes biogenic silicon pools and increases silicon losses. Overall, the lower species richness, density and biomass in plantations than in rainforest, and the changes in the functional composition of the testate amoebae community, indicate detrimental effects of rainforest conversion on the structure and functioning of microbial food webs. PMID:27463805

  16. Isolamento de amebas de vida livre potencialmente patogênicas em poeira de hospitais Isolation of potencially pathogenic free-living amoebas in hospital dust

    Directory of Open Access Journals (Sweden)

    Maria Aparecida da Silva

    2003-04-01

    Full Text Available OBJETIVO: Observar a ocorrência de amebas de vida livre dos gêneros Acanthamoeba e Naegleria em amostras de poeira coletadas em hospitais. MÉTODOS: Foram coletadas 132 amostras de poeira em dois hospitais do município de Presidente Prudente, São Paulo. Os locais da coleta foram: Unidade de Terapia Intensiva, Centro Cirúrgico, Isolamento de Moléstias Infecciosas, Berçário, Emergência e Cozinha. As amostras foram semeadas em três meios de cultura: meio de ágar não nutriente com Escherichia coli, meio de ágar infusão de soja e microcultivo em meio de Pavlova modificado por Giazzi. As amebas isoladas foram identificadas segundo critérios morfológicos. RESULTADOS: O índice geral de positividade para amebas de vida livre, potencialmente patogênicas, dos gêneros Acanthamoeba e Naegleria, foi de 45,5%, sendo positivas 41,6% das amostras de poeira coletadas no hospital universitário e 50% no hospital estadual. Obtiveram-se 45,5% de positividade do gênero Acanthamoeba e 3,8% para amebas do gênero Naegleria. CONCLUSÕES: As amebas de vida livre, potencialmente patogênicas, estavam presentes em todos os ambientes estudados dos dois hospitais, sendo que as espécies do gênero Acanthamoeba foram as isoladas com maior freqüência.OBJECTIVE: To evaluate the occurrence of free-living amoebas of the genera Acanthamoeba and Naegleria is dust samples colleted in two hospitals. METHODS: One-hundred and thirty-two dust samples were collected in two hospitals in Brazil. Hospital collection sites were the following: intensive care unit, operation rooms, nursery, kitchen, emergency and infectious diseases isolation room . The isolation of the amoebas was performed in three culture media: non-nutrient agar inoculated with Escherichia coli, soy agar, and microculture in Giazzi-modified Pavlova's medium. The amoebas were identified according to morphological criteria. RESULTS: Amoebas of the genera Acanthamoeba and Naegleria were found in 45.5% of

  17. Environmental factors shaping cultured free-living amoebae and their associated bacterial community within drinking water network.

    Science.gov (United States)

    Delafont, Vincent; Bouchon, Didier; Héchard, Yann; Moulin, Laurent

    2016-09-01

    Free-living amoebae (FLA) constitute an important part of eukaryotic populations colonising drinking water networks. However, little is known about the factors influencing their ecology in such environments. Because of their status as reservoir of potentially pathogenic bacteria, understanding environmental factors impacting FLA populations and their associated bacterial community is crucial. Through sampling of a large drinking water network, the diversity of cultivable FLA and their bacterial community were investigated by an amplicon sequencing approach, and their correlation with physicochemical parameters was studied. While FLA ubiquitously colonised the water network all year long, significant changes in population composition were observed. These changes were partially explained by several environmental parameters, namely water origin, temperature, pH and chlorine concentration. The characterisation of FLA associated bacterial community reflected a diverse but rather stable consortium composed of nearly 1400 OTUs. The definition of a core community highlighted the predominance of only few genera, majorly dominated by Pseudomonas and Stenotrophomonas. Co-occurrence analysis also showed significant patterns of FLA-bacteria association, and allowed uncovering potentially new FLA - bacteria interactions. From our knowledge, this study is the first that combines a large sampling scheme with high-throughput identification of FLA together with associated bacteria, along with their influencing environmental parameters. Our results demonstrate the importance of physicochemical parameters in the ecology of FLA and their bacterial community in water networks. PMID:27219048

  18. Response of forest soil euglyphid testate amoebae (Rhizaria: Cercozoa) to pig cadavers assessed by high-throughput sequencing.

    Science.gov (United States)

    Seppey, Christophe V W; Fournier, Bertrand; Szelecz, Ildikò; Singer, David; Mitchell, Edward A D; Lara, Enrique

    2016-03-01

    Decomposing cadavers modify the soil environment, but the effect on soil organisms and especially on soil protists is still poorly documented. We conducted a 35-month experiment in a deciduous forest where soil samples were taken under pig cadavers, control plots and fake pigs (bags of similar volume as the pigs). We extracted total soil DNA, amplified the SSU ribosomal RNA (rRNA) gene V9 region and sequenced it by Illumina technology and analysed the data for euglyphid testate amoebae (Rhizaria: Euglyphida), a common group of protozoa known to respond to micro-environmental changes. We found 51 euglyphid operational taxonomic units (OTUs), 45 of which did not match any known sequence. Most OTUs decreased in abundance underneath cadavers between days 0 and 309, but some responded positively after a time lag. We sequenced the full-length SSU rRNA gene of two common OTUs that responded positively to cadavers; a phylogenetic analysis showed that they did not belong to any known euglyphid family. This study confirmed the existence of an unknown diversity of euglyphids and that they react to cadavers. Results suggest that metabarcoding of soil euglyphids could be used as a forensic tool to estimate the post-mortem interval (PMI) particularly for long-term (>2 months) PMI, for which no reliable tool exists. PMID:25874666

  19. A weak pulsed magnetic field affects adenine nucleotide oscillations, and related parameters in aggregating Dictyostelium discoideum amoebae.

    Science.gov (United States)

    Davies, E; Olliff, C; Wright, I; Woodward, A; Kell, D

    1999-02-01

    A model eukaryotic cell system was used to explore the effect of a weak pulsed magnetic field (PMF) on time-varying physiological parameters. Dictyostelium discoideum cells (V12 strain) were exposed to a pulsed magnetic field (PMF) of flux density 0.4 mT, generated via air-cored coils in trains of 2 ms pulses gated at 20 ms. This signal is similar to those used to treat non-uniting fractures. Samples were taken over periods of 20 min from harvested suspensions of amoebae during early aggregation phase, extracted and derivatised for HPLC fluorescent assay of adenine nucleotides. Analysis of variance showed a significant athermal damping effect (P < 0.002, n = 22) of the PMF on natural adenine nucleotide oscillations and some consistent changes in phase relationships. The technique of nonlinear dielectric spectroscopy (NLDS) revealed a distinctive effect of PMF, caffeine and EGTA in modulating the cellular harmonic response to an applied weak signal. Light scattering studies also showed altered frequency response of cells to PMF, EGTA and caffeine. PMF caused a significant reduction of caffeine induced cell contraction (P < 0.0006, n = 19 by paired t-test) as shown by Malvern particle size analyser, suggesting that intracellular calcium may be involved in mediating the effect of the PMF. PMID:10228582

  20. The TOM Complex of Amoebozoans: the Cases of the Amoeba Acanthamoeba castellanii and the Slime Mold Dictyostelium discoideum.

    Science.gov (United States)

    Wojtkowska, Małgorzata; Buczek, Dorota; Stobienia, Olgierd; Karachitos, Andonis; Antoniewicz, Monika; Slocinska, Małgorzata; Makałowski, Wojciech; Kmita, Hanna

    2015-07-01

    Protein import into mitochondria requires a wide variety of proteins, forming complexes in both mitochondrial membranes. The TOM complex (translocase of the outer membrane) is responsible for decoding of targeting signals, translocation of imported proteins across or into the outer membrane, and their subsequent sorting. Thus the TOM complex is regarded as the main gate into mitochondria for imported proteins. Available data indicate that mitochondria of representative organisms from across the major phylogenetic lineages of eukaryotes differ in subunit organization of the TOM complex. The subunit organization of the TOM complex in the Amoebozoa is still elusive, so we decided to investigate its organization in the soil amoeba Acanthamoeba castellanii and the slime mold Dictyostelium discoideum. They represent two major subclades of the Amoebozoa: the Lobosa and Conosa, respectively. Our results confirm the presence of Tom70, Tom40 and Tom7 in the A. castellanii and D. discoideum TOM complex, while the presence of Tom22 and Tom20 is less supported. Interestingly, the Tom proteins display the highest similarity to Opisthokonta cognate proteins, with the exception of Tom40. Thus representatives of two major subclades of the Amoebozoa appear to be similar in organization of the TOM complex, despite differences in their lifestyle. PMID:26074248

  1. Thecamoebians (Testate Amoebae) Straddling the Permian-Triassic Boundary in the Guryul Ravine Section, India: Evolutionary and Palaeoecological Implications

    Science.gov (United States)

    Singh, Vartika; Pandita, Sundeep K.; Tewari, Rajni; van Hengstum, Peter J; Pillai, Suresh S. K.; Agnihotri, Deepa; Kumar, Kamlesh; Bhat, G. D.

    2015-01-01

    Exceptionally well-preserved organic remains of thecamoebians (testate amoebae) were preserved in marine sediments that straddle the greatest extinction event in the Phanerozoic: the Permian-Triassic Boundary. Outcrops from the Late Permian Zewan Formation and the Early Triassic Khunamuh Formation are represented by a complete sedimentary sequence at the Guryul Ravine Section in Kashmir, India, which is an archetypal Permian-Triassic boundary sequence [1]. Previous biostratigraphic analysis provides chronological control for the section, and a perspective of faunal turnover in the brachiopods, ammonoids, bivalves, conodonts, gastropods and foraminifera. Thecamoebians were concentrated from bulk sediments using palynological procedures, which isolated the organic constituents of preserved thecamoebian tests. The recovered individuals demonstrate exceptional similarity to the modern thecamoebian families Centropyxidae, Arcellidae, Hyalospheniidae and Trigonopyxidae, however, the vast majority belong to the Centropyxidae. This study further confirms the morphologic stability of the thecamoebian lineages through the Phanerozoic, and most importantly, their apparent little response to an infamous biological crisis in Earth’s history. PMID:26288245

  2. Use of highly sensitive sublethal stress responses in the social amoeba Dictyostelium discoideum for an assessment of freshwater quality.

    Science.gov (United States)

    Sforzini, Susanna; Dagnino, Alessandro; Torrielli, Sara; Dondero, Francesco; Fenoglio, Stefano; Negri, Alessandro; Boatti, Lara; Viarengo, Aldo

    2008-06-01

    In this work, the sensitivity of a battery of tests on the social amoeba Dictyostelium discoideum has been assessed within a freshwater toxicity study. The results obtained from the evaluation of survival and replication rate of D. discoideum were compared to those derived with a series of widely used tests for freshwater toxicity assessment, i. e. bioassays using Vibrio fischeri, Daphnia magna and Pseudokirchneriella subcapitata. The effects on sublethal endpoints, i.e. lysosomal membrane stability (LMS) and endocytotic rate, were analysed in conjunction with high-level endpoints to verify the potential to make a typical bioassay more sensitive. The field ecotoxicological investigation employing D. discoideum is part of a monitoring study assessing environmental quality of the Bormida River (Italy), subjected until recently to a chronic industrial pollution. The survey was carried out at several stations (upstream and downstream of a chemical factory outlet) in two different periods. In 2002, the results of chemical analyses performed on river water indicated no contamination. The ecotoxicological data obtained in this period showed that no evidence of biological effects was observed using V. fischeri and D. magna bioassays. In spite of the previous classical acute toxicity tests, significant differences in cell viability of D. discoideum were found. By analysing the effects measured on LMS and endocytotic rate, more relevant changes were observed for these sublethal stress biomarkers compared to survival. The chronic toxicity data showed significant changes in cell growth both of P. subcapitata and D. discoideum. Nevertheless, more sensitive and rapid responses were obtained when assessing the effects of exposure on D. discoideum. The chemical and ecotoxicological data obtained in 2006 indicated a full recovery of the quality of the river water (neither contamination nor toxicity found). Altogether, the results reported in this study underline that the use of a

  3. Amoeba-based computing for traveling salesman problem: long-term correlations between spatially separated individual cells of Physarum polycephalum.

    Science.gov (United States)

    Zhu, Liping; Aono, Masashi; Kim, Song-Ju; Hara, Masahiko

    2013-04-01

    A single-celled, multi-nucleated amoeboid organism, a plasmodium of the true slime mold Physarum polycephalum, can perform sophisticated computing by exhibiting complex spatiotemporal oscillatory dynamics while deforming its amorphous body. We previously devised an "amoeba-based computer (ABC)" to quantitatively evaluate the optimization capability of the amoeboid organism in searching for a solution to the traveling salesman problem (TSP) under optical feedback control. In ABC, the organism changes its shape to find a high quality solution (a relatively shorter TSP route) by alternately expanding and contracting its pseudopod-like branches that exhibit local photoavoidance behavior. The quality of the solution serves as a measure of the optimality of which the organism maximizes its global body area (nutrient absorption) while minimizing the risk of being illuminated (exposure to aversive stimuli). ABC found a high quality solution for the 8-city TSP with a high probability. However, it remains unclear whether intracellular communication among the branches of the organism is essential for computing. In this study, we conducted a series of control experiments using two individual cells (two single-celled organisms) to perform parallel searches in the absence of intercellular communication. We found that ABC drastically lost its ability to find a solution when it used two independent individuals. However, interestingly, when two individuals were prepared by dividing one individual, they found a solution for a few tens of minutes. That is, the two divided individuals remained correlated even though they were spatially separated. These results suggest the presence of a long-term memory in the intrinsic dynamics of this organism and its significance in performing sophisticated computing. PMID:23438635

  4. Amoeba-inspired Tug-of-War algorithms for exploration-exploitation dilemma in extended Bandit Problem.

    Science.gov (United States)

    Aono, Masashi; Kim, Song-Ju; Hara, Masahiko; Munakata, Toshinori

    2014-03-01

    The true slime mold Physarum polycephalum, a single-celled amoeboid organism, is capable of efficiently allocating a constant amount of intracellular resource to its pseudopod-like branches that best fit the environment where dynamic light stimuli are applied. Inspired by the resource allocation process, the authors formulated a concurrent search algorithm, called the Tug-of-War (TOW) model, for maximizing the profit in the multi-armed Bandit Problem (BP). A player (gambler) of the BP should decide as quickly and accurately as possible which slot machine to invest in out of the N machines and faces an "exploration-exploitation dilemma." The dilemma is a trade-off between the speed and accuracy of the decision making that are conflicted objectives. The TOW model maintains a constant intracellular resource volume while collecting environmental information by concurrently expanding and shrinking its branches. The conservation law entails a nonlocal correlation among the branches, i.e., volume increment in one branch is immediately compensated by volume decrement(s) in the other branch(es). Owing to this nonlocal correlation, the TOW model can efficiently manage the dilemma. In this study, we extend the TOW model to apply it to a stretched variant of BP, the Extended Bandit Problem (EBP), which is a problem of selecting the best M-tuple of the N machines. We demonstrate that the extended TOW model exhibits better performances for 2-tuple-3-machine and 2-tuple-4-machine instances of EBP compared with the extended versions of well-known algorithms for BP, the ϵ-Greedy and SoftMax algorithms, particularly in terms of its short-term decision-making capability that is essential for the survival of the amoeba in a hostile environment. PMID:24384066

  5. Whole genome sequencing of mutation accumulation lines reveals a low mutation rate in the social amoeba Dictyostelium discoideum.

    Directory of Open Access Journals (Sweden)

    Gerda Saxer

    Full Text Available Spontaneous mutations play a central role in evolution. Despite their importance, mutation rates are some of the most elusive parameters to measure in evolutionary biology. The combination of mutation accumulation (MA experiments and whole-genome sequencing now makes it possible to estimate mutation rates by directly observing new mutations at the molecular level across the whole genome. We performed an MA experiment with the social amoeba Dictyostelium discoideum and sequenced the genomes of three randomly chosen lines using high-throughput sequencing to estimate the spontaneous mutation rate in this model organism. The mitochondrial mutation rate of 6.76×10(-9, with a Poisson confidence interval of 4.1×10(-9 - 9.5×10(-9, per nucleotide per generation is slightly lower than estimates for other taxa. The mutation rate estimate for the nuclear DNA of 2.9×10(-11, with a Poisson confidence interval ranging from 7.4×10(-13 to 1.6×10(-10, is the lowest reported for any eukaryote. These results are consistent with low microsatellite mutation rates previously observed in D. discoideum and low levels of genetic variation observed in wild D. discoideum populations. In addition, D. discoideum has been shown to be quite resistant to DNA damage, which suggests an efficient DNA-repair mechanism that could be an adaptation to life in soil and frequent exposure to intracellular and extracellular mutagenic compounds. The social aspect of the life cycle of D. discoideum and a large portion of the genome under relaxed selection during vegetative growth could also select for a low mutation rate. This hypothesis is supported by a significantly lower mutation rate per cell division in multicellular eukaryotes compared with unicellular eukaryotes.

  6. An evolutionarily significant unicellular strategy in response to starvation in Dictyostelium social amoebae [v2; ref status: indexed, http://f1000r.es/4kb

    Directory of Open Access Journals (Sweden)

    Darja Dubravcic

    2014-12-01

    Full Text Available The social amoeba Dictyostelium discoideum is widely studied for its multicellular development program as a response to starvation. Aggregates of up to 106 cells form fruiting bodies containing (i dormant spores (~80% that can persist for months in the absence of nutrients, and (ii dead stalk cells (~20% that promote the dispersion of the spores towards nutrient-rich areas. It is often overlooked that not all cells aggregate upon starvation. Using a new quantitative approach based on time-lapse fluorescence microscopy and a low ratio of reporting cells, we have quantified this fraction of non-aggregating cells. In realistic starvation conditions, up to 15% of cells do not aggregate, which makes this third cell fate a significant component of the population-level response of social amoebae to starvation. Non-aggregating cells have an advantage over cells in aggregates since they resume growth earlier upon arrival of new nutrients, but have a shorter lifespan under prolonged starvation. We find that phenotypic heterogeneities linked to cell nutritional state bias the representation of cells in the aggregating vs. non-aggregating fractions, and thus affect population partitioning. Next, we report that the fraction of non-aggregating cells depends on genetic factors that regulate the timing of starvation, signal sensing efficiency and aggregation efficiency. In addition, interactions between clones in mixtures of non-isogenic cells affect the partitioning of each clone into both fractions. We further build a numerical model to test the evolutionary significance of the non-aggregating cell fraction. The partitioning of cells into aggregating and non-aggregating fractions is optimal in fluctuating environments with an unpredictable duration of starvation periods. Our study highlights the unicellular component of the response of social amoebae to starvation, and thus extends its evolutionary and ecological framework.

  7. Isolation and identification of pathogenic free-living amoeba from surface and tap water of Shiraz City using morphological and molecular methods.

    Science.gov (United States)

    Armand, B; Motazedian, M H; Asgari, Q

    2016-01-01

    Free-living amoebae (FLA) are the most abundant and widely distributed protozoa in the environment. An investigation was conducted to determine the presence of free-living amoebae (FLA), Acanthamoeba and Vermamoeba in waterfronts of parks and squares and tap water of Shiraz City, Iran. FLA are considered pathogenic for human. These ubiquitous organisms have been isolated from different environments such as water, soil, and air. Eighty-two water samples were collected from different places of Shiraz City during the summer of 2013. All samples were processed in Dept. of Parasitology and Mycology, Shiraz University of Medical Sciences, Fars, Iran. Samples were screened for FLA and identified by morphological characters in the cultures, PCR amplification targeting specific genes for each genus and sequencing determined frequent species and genotypes base on NCBI database. Overall, 48 samples were positive for Acanthamoeba and Vermamoeba in non-nutrient agar culture based on morphological characteristics. The PCR examination was done successfully. Sequencing results were revealed T4 (62.96 %) genotypes as the most common genotype of Acanthamoeba in the Shiraz water sources. In addition, T5 (33.33 %) and T15 (3.71 %) were isolated from water supplies. Vermamoeba vermiformis was known the dominant species from this genus. The high frequency of Acanthamoeba spp. and Vermamoeba in different environmental water sources of Shiraz is an alert for the public health related to water sources. The result highlights a need for taking more attention to water supplies in order to prevent illnesses related to free-living amoebae. PMID:26412057

  8. Defects in the synthetic pathway prevent DIF-1 mediated stalk lineage specification cascade in the non-differentiating social amoeba, Acytostelium subglobosum

    Directory of Open Access Journals (Sweden)

    Kurato Mohri

    2014-05-01

    Full Text Available Separation of somatic cells from germ-line cells is a crucial event for multicellular organisms, but how this step was achieved during evolution remains elusive. In Dictyostelium discoideum and many other dictyostelid species, solitary amoebae gather and form a multicellular fruiting body in which germ-line spores and somatic stalk cells differentiate, whereas in Acytostelium subglobosum, acellular stalks form and all aggregated amoebae become spores. In this study, because most D. discoideum genes known to be required for stalk cell differentiation have homologs in A. subglobosum, we inferred functional variations in these genes and examined conservation of the stalk cell specification cascade of D. discoideum mediated by the polyketide differentiation-inducing factor-1 (DIF-1 in A. subglobosum. Through heterologous expression of A. subglobosum orthologs of DIF-1 biosynthesis genes in D. discoideum, we confirmed that two of the three genes were functional equivalents, while DIF-methyltransferase (As-dmtA involved at the final step of DIF-1 synthesis was not. In fact, DIF-1 activity was undetectable in A. subglobosum lysates and amoebae of this species were not responsive to DIF-1, suggesting a lack of DIF-1 production in this species. On the other hand, the molecular function of an A. subglobosum ortholog of DIF-1 responsive transcription factor was equivalent with that of D. discoideum and inhibition of polyketide synthesis caused developmental arrest in A. subglobosum, which could not be rescued by DIF-1 addition. These results suggest that non-DIF-1 polyketide cascades involving downstream transcription factors are required for fruiting body development of A. subglobosum.

  9. Ubiquiter circovirus sequences raise challenges in laboratory diagnosis: the case of honey bee and bee mite, reptiles, and free living amoebae.

    Science.gov (United States)

    Marton, Szilvia; Ihász, Katalin; Lengyel, György; Farkas, Szilvia L; Dán, Ádám; Paulus, Petra; Bányai, Krisztián; Fehér, Enikő

    2015-03-01

    Circoviruses of pigs and birds are established pathogens, however, the exact role of other, recently described circoviruses and circovirus-like viruses remains to be elucidated. The aim of this study was the detection of circoviruses in neglected host species, including honey bees, exotic reptiles and free-living amoebae by widely used broad-spectrum polymerase chain reaction (PCR) assays specific for the replication initiation protein coding gene of these viruses. The majority of sequences obtained from honey bees were highly similar to canine and porcine circoviruses, or, were distantly related to dragonfly cycloviruses. Other rep sequences detected in some honey bees, reptiles and amoebae showed similarities to various rep sequences deposited in the GenBank. Back-to-back PCR primers designed for the amplification of whole viral genomes failed to work that suggested the existence of integrated rep-like elements in many samples. Rolling circle amplification and exonuclease treatment confirmed the absence of small circular DNA genomes in the specimens analysed. In case of honey bees Varroa mite DNA contamination might be a source of the identified endogenous rep-like elements. The reptile and amoebae rep-like sequences were nearly identical with each other and with sequences detected in chimpanzee feces raising the possibility that detection of novel or unusual rep-like elements in some host species might originate from the microbial community of the host. Our results indicate that attention is needed when broad-spectrum rep gene specific polymerase chain reaction is chosen for laboratory diagnosis of circovirus infections. PMID:25823454

  10. 187-gene phylogeny of protozoan phylum Amoebozoa reveals a new class (Cutosea) of deep-branching, ultrastructurally unique, enveloped marine Lobosa and clarifies amoeba evolution.

    Science.gov (United States)

    Cavalier-Smith, Thomas; Chao, Ema E; Lewis, Rhodri

    2016-06-01

    Monophyly of protozoan phylum Amoebozoa, and subdivision into subphyla Conosa and Lobosa each with different cytoskeletons, are well established. However early diversification of non-ciliate lobose amoebae (Lobosa) is poorly understood. To clarify it we used recently available transcriptomes to construct a 187-gene amoebozoan tree for 30 species, the most comprehensive yet. This robustly places new genus Atrichosa (formerly lumped with Trichosphaerium) within lobosan class Tubulinea, not Discosea as previously supposed. We identified an earliest diverging lobosan clade comprising marine amoebae armoured by porose scaliform cell-envelopes, here made a novel class Cutosea with two pseudopodially distinct new families. Cutosea comprise Sapocribrum, ATCC PRA-29 misidentified as 'Pessonella', plus from other evidence Squamamoeba. We confirm that Acanthamoeba and ATCC 50982 misidentified as Stereomyxa ramosa are closely related. Discosea have a strongly supported major subclade comprising Thecamoebida plus Glycostylida (suborders Dactylopodina, Stygamoebina; Vannellina) phylogenetically distinct from Centramoebida. Stygamoeba is sister to Dactylopodina. Himatismenida are either sister to Centramoebida or deeper branching. Discosea usually appear holophyletic (rarely paraphyletic). Paramoeba transcriptomes include prokinetoplastid Perkinsela-like endosymbiont sequences. Cunea, misidentified as Mayorella, is closer to Paramoeba than Vexillifera within holophyletic Dactylopodina. Taxon-rich site-heterogeneous rDNA trees confirm cutosan distinctiveness, allow improved conosan taxonomy, and reveal previous dictyostelid tree misrooting. PMID:27001604

  11. A Record of Moisture History in Hawaii since the Arrival of Humans Inferred from Testate Amoebae and Cladocera Fossils Preserved in Bog Sediments

    Science.gov (United States)

    Barrett, K.; Kim, S. H.; Hotchkiss, S.

    2015-12-01

    Around AD 800, Polynesians arrived on the Hawaiian Islands where they expanded and intensified distinct agricultural practices in the islands' wet and dry regions. Dryland farming productivity in particular would have been sensitive to atmospheric rearrangements of the ENSO and PDO systems that affect rainfall in Hawaii. The few detailed terrestrial paleoclimate records in Hawaii are mainly derived from vegetation proxies (e.g. pollen, seeds, fruits, and plant biomarkers) which are heavily influenced by widespread landscape modification following human arrival. Here we present initial results of an independent paleomoisture proxy: fossil remains of moisture-sensitive testate amoebae (Protozoa: Rhizopoda) and cladocera (water fleas) preserved in continuous bog sediments on Kohala Volcano uplsope of the ancient Kohala agricultural field system, one of the largest dryland field systems in Hawaii. Hydrologic conditions inferred from testate amoebae and cladoceran fossil assemblages correlate with observed decadal moisture regimes in Hawaii and state changes of the PDO system during the last century. Testate ameoabe and cladoceran fossils in older sediments reveal an alternating history of very wet, lake-forming conditions on the bog surface to periods when bog soils were much drier than today's, demonstrating that this method can be paired with vegetation proxies to provide a better understanding of hydroclimate variability in prehistoric Hawaii.

  12. Evidence of test detachment in Astrorhiza limicola and two consequential synonyms: Amoeba gigantea and Megamoebomyxa argillobia (Foraminiferida)

    DEFF Research Database (Denmark)

    Cedhagen, Tomas; Tendal, Ole S.

    1989-01-01

    Laboratory observations and experiments demonstrate that the naked rhizopods Amoeba gigantea SANDAHL, 1857 and Megamoebomyxa argillo~ia NYHOLM, 1950, and the foraminifers Astrorhiza arenifera STSCHEDRlNA, 1946, A. sabulifera STSCHEDRINA, 1946 and A. arctlca STSCHEDRINA, 1958 are synonyms of...

  13. [i]Legionella spp[/i]., amoebae and not-fermenting Gram negative bacteria in an Italian university hospital water system

    Directory of Open Access Journals (Sweden)

    Pasqualina Laganà

    2014-09-01

    Full Text Available [b]Introduction. [/b]In hospital and other health care facilities, contamination of water systems by potentially infectious microorganisms, such as bacteria, viruses and protozoa, is a source of nosocomial infections, which may originate fromcolonization of water pipes, cooling towers, spa pools, taps, showers and water supplies. [b]Objective. [/b]The study focuses on the occurrence of [i]Legionella spp.[/i], free-living amoebae and non-fermenting Gram-negative microorganisms in a University hospital water system located in the town of Messina (Sicily, Italy, which had never been examined previously. Materials and Methods. From January 2008 – March 2009, hot tap water samples were collected from 10 wards.[i] Legionella spp[/i]. recovered on selective culture medium were identified by microagglutination latex test; free-living amoebae were cultured using [i]Escherichia coli [/i]as a food source. Non-fermenting Gram negative microorganisms were identified by API 20 NE strips. [b]Results.[/b] [i]Legionella spp.[/i] were found in 33.33% of the samples. [i]L. pneumophila[/i] serogroup 1 was recovered from the Laboratory Diagnostic and Anaesthesia-Neurology Wards, with a peak of 3.5 × 10[sup]4[/sup] cfu/L in May 2008. [i]L. pneumophila[/i] serogroups 2–14 were found in the Othorhinolaryngology, Pathologic Anatomy, Paediatrics and Surgery Wards, and peaked (4 × 10[sup]4[/sup] cfu/L in April 2008. Pseudomonadaceae and Hyphomycetes were also detected. Legionella spp. were recovered from samples positive for non-pathogenic amoebae [i]Hartmannella spp[/i]. [b]Conclusion.[/b] This first study of a Messina hospital water system suggested potential health risks related to the detection of [i]Hartmannella spp[/i]., as reservoirs for[i] Legionella spp.[/i], and Pseudomonas aeruginosa, a Gram negative non-fermenting bacterium frequently causing nosocomial pneumonia. The urgent need for monitoring programmes and prevention measures to ensure hospital water

  14. Amoebae Anticipate Periodic Events

    Science.gov (United States)

    Saigusa, Tetsu; Tero, Atsushi; Nakagaki, Toshiyuki; Kuramoto, Yoshiki

    2008-01-01

    When plasmodia of the true slime mold Physarum were exposed to unfavorable conditions presented as three consecutive pulses at constant intervals, they reduced their locomotive speed in response to each episode. When the plasmodia were subsequently subjected to favorable conditions, they spontaneously reduced their locomotive speed at the time when the next unfavorable episode would have occurred. This implied the anticipation of impending environmental change. We explored the mechanisms underlying these types of behavior from a dynamical systems perspective.

  15. The Bionic Amoeba.

    Science.gov (United States)

    Wright, Emmett L.

    1979-01-01

    A demonstration is described that encourages students to engage in inquiry in biology. Using chemicals and an overhead projector, the instructor can simulate a living organism projected onto a screen. The reaction can aid students in defining the characteristics of life. (SA)

  16. Species richness of testate amoebae in different environments from the upper Paraná river floodplain (PR/MS - doi: 10.4025/actascibiolsci.v33i3.7261 Species richness of testate amoebae in different environments from the upper Paraná river floodplain (PR/MS - doi: 10.4025/actascibiolsci.v33i3.7261

    Directory of Open Access Journals (Sweden)

    Fábio Amodêo Lansac-Tôha

    2011-07-01

    Full Text Available This study evaluated the species richness of testate amoebae in the plankton from different environments of the upper Paraná river floodplain. Samplings were performed at subsurface of pelagic region from twelve environments using motorized pump and plankton net (68 µm, during four hydrological periods. We identified 67 taxa, distributed in seven families and Arcellidae, Difflugiidae and Centropyxidae were the most representative families. Higher values of species richness were observed in the lakes (connected and isolated during the flood pulses. Centropyxis aculeata, Difflugia gramem and D. pseudogramem were frequent throughout the study period. Seasonal variability of species in the channels and isolated lakes was evidenced by beta diversity. Besides that, in the rivers, extreme changes in species composition were verified during the high-water period. Our results highlight the importance of the present study to improve the knowledge about the diversity and geographic distribution of these organisms in Brazil and emphasize the importance of current flow in the displacement of testate amoebae from their preferred habitats, marginal vegetation and sediment.This study evaluated the species richness of testate amoebae in the plankton from different environments of the upper Paraná river floodplain. Samplings were performed at subsurface of pelagic region from twelve environments using motorized pump and plankton net (68 µm, during four hydrological periods. We identified 67 taxa, distributed in seven families and Arcellidae, Difflugiidae and Centropyxidae were the most representative families. Higher values of species richness were observed in the lakes (connected and isolated during the flood pulses. Centropyxis aculeata, Difflugia gramem and D. pseudogramem were frequent throughout the study period. Seasonal variability of species in the channels and isolated lakes was evidenced by beta diversity. Besides that, in the rivers, extreme

  17. Evolution of the actin gene family in testate lobose amoebae (Arcellinida) is characterized by two distinct clades of paralogs and recent independent expansions.

    Science.gov (United States)

    Lahr, Daniel J G; Nguyen, Truc B; Barbero, Erika; Katz, Laura A

    2011-01-01

    The evolution of actin gene families is characterized by independent expansions and contractions across the eukaryotic tree of life. Here, we assess diversity of actin gene sequences within three lineages of the genus Arcella, a free-living testate (shelled) amoeba in the Arcellinida. We established four clonal lines of two morphospecies, Arcella hemisphaerica and A. vulgaris, and assessed their phylogenetic relationship within the "Amoebozoa" using small subunit ribosomal DNA (SSU-rDNA) genealogy. We determined that the two lines of A. hemisphaerica are identical in SSU-rDNA, while the two A. vulgaris are independent genetic lineages. Furthermore, we characterized multiple actin gene copies from all lineages. Analyses of the resulting sequences reveal numerous diverse actin genes, which differ mostly by synonymous substitutions. We estimate that the actin gene family contains 40-50 paralogous members in each lineage. None of the three independent lineages share the same paralog with another, and divergence between actins reaches 29% in contrast to just 2% in SSU-rDNA. Analyses of effective number of codons (ENC), compositional bias, recombination signatures, and genetic diversity in the context of a gene tree indicate that there are two groups of actins evolving with distinct patterns of molecular evolution. Within these groups, there have been multiple independent expansions of actin genes within each lineage. Together, these data suggest that the two groups are located in different regions of the Arcella genome. Furthermore, we compare the Arcella actin gene family with the relatively well-described gene family in the slime mold Dictyostelium discoideum and other members of the Amoebozoa clade. Overall patterns of molecular evolution are similar in Arcella and Dictyostelium. However, the separation of genes in two distinct groups coupled with recent expansion is characteristic of Arcella and might reflect an unusual pattern of gene family evolution in the lobose

  18. Free-living amoebae (FLA: detection, morphological and molecular identification of Acanthamoeba genus in the hydraulic system of an haemodialysis unit in Tunisia

    Directory of Open Access Journals (Sweden)

    Dendana F.

    2008-06-01

    Full Text Available The free-living amoebae (FLA are ubiquitous and opportunistic protozoa. They can induce human and animal diseases. The aim of our study was to detect the FLA and Acanthamoeba genus in the hydraulic system of an hemodialysis unit. It was a prospective study of 46 water samples. The first collect (23 was before cleaning and after the haemodialysis sessions and the second (23 after cleaning and before the hemodialysis sessions. Results: the morphological study enabled us to detect morphotypic diversity. The predominant morphotypes were the acanthopodial forms (29%. At the entrance of hemodialysis unit there were acanthopodial (44% and monotactic (25% forms; at the outlet, acanthopodial and fan-shaped forms (25% each. In addition, Acanthamoeba genus was present in 39% (1st collect and 18% (2nd collect. The amplification of the FLA 18S rDNA gene was negative in only one sample localized in the last stage of water treatment unit (WTU. The amplification of the 18S rDNA (ASA.A1 Acanthamoeba gene was positive in15 samples. Conclusions: we noted that, in the hemodialysis unit, the purification techniques used in the WTU were effective, but there is a problem of water stagnation in the drain, which constitutes an appropriate condition for the biofilms formation. It is then necessary to use a filter with a low porosity (0.2 μm at the entrance of the hemodialysis unit and if possible to change the drain

  19. Evolution of stalk/spore ratio in a social amoeba: cell-to-cell interaction via a signaling chemical shaped by cheating risk.

    Science.gov (United States)

    Uchinomiya, Kouki; Iwasa, Yoh

    2013-11-01

    The social amoeba (or cellular slime mold) is a model system for cell cooperation. When food is depleted in the environment, cells aggregate together. Some of these cells become stalks, raising spores to aid in their dispersal. Differentiation-inducing factor-1 (DIF-1) is a signaling chemical produced by prespore cells and decomposed by prestalk cells. It affects the rate of switching between prestalk and prespore cells, thereby achieving a stable stalk/spore ratio. In this study we analyzed the evolution of the stalk/spore ratio. Strains may differ in the production and decomposition rates of the signaling chemical, and in the sensitivity of cells to switch in response to the signaling chemical exposure. When two strains with the same stalk/spore ratio within their own fruiting body are combined into a single fruiting body, one strain may develop into prespores to a greater degree than the other. Direct evolutionary simulations and quantitative genetic dynamics demonstrate that if a fruiting body is always formed by a single strain, the cells evolve to produce less signaling chemical and become more sensitive to the signaling chemical due to the cost of producing the chemical. In contrast, if a fruiting body is formed by multiple strains, the cells evolve to become less sensitive to the signaling chemical and produce more signaling chemical in order to reduce the risk of being exploited. In contrast, the stalk-spore ratio is less likely to be affected by small cheating risk. PMID:23911583

  20. Loss of Cln3 function in the social amoeba Dictyostelium discoideum causes pleiotropic effects that are rescued by human CLN3.

    Science.gov (United States)

    Huber, Robert J; Myre, Michael A; Cotman, Susan L

    2014-01-01

    The neuronal ceroid lipofuscinoses (NCL) are a group of inherited, severe neurodegenerative disorders also known as Batten disease. Juvenile NCL (JNCL) is caused by recessive loss-of-function mutations in CLN3, which encodes a transmembrane protein that regulates endocytic pathway trafficking, though its primary function is not yet known. The social amoeba Dictyostelium discoideum is increasingly utilized for neurological disease research and is particularly suited for investigation of protein function in trafficking. Therefore, here we establish new overexpression and knockout Dictyostelium cell lines for JNCL research. Dictyostelium Cln3 fused to GFP localized to the contractile vacuole system and to compartments of the endocytic pathway. cln3- cells displayed increased rates of proliferation and an associated reduction in the extracellular levels and cleavage of the autocrine proliferation repressor, AprA. Mid- and late development of cln3- cells was precocious and cln3- slugs displayed increased migration. Expression of either Dictyostelium Cln3 or human CLN3 in cln3- cells suppressed the precocious development and aberrant slug migration, which were also suppressed by calcium chelation. Taken together, our results show that Cln3 is a pleiotropic protein that negatively regulates proliferation and development in Dictyostelium. This new model system, which allows for the study of Cln3 function in both single cells and a multicellular organism, together with the observation that expression of human CLN3 restores abnormalities in Dictyostelium cln3- cells, strongly supports the use of this new model for JNCL research. PMID:25330233

  1. Loss of Cln3 function in the social amoeba Dictyostelium discoideum causes pleiotropic effects that are rescued by human CLN3.

    Directory of Open Access Journals (Sweden)

    Robert J Huber

    Full Text Available The neuronal ceroid lipofuscinoses (NCL are a group of inherited, severe neurodegenerative disorders also known as Batten disease. Juvenile NCL (JNCL is caused by recessive loss-of-function mutations in CLN3, which encodes a transmembrane protein that regulates endocytic pathway trafficking, though its primary function is not yet known. The social amoeba Dictyostelium discoideum is increasingly utilized for neurological disease research and is particularly suited for investigation of protein function in trafficking. Therefore, here we establish new overexpression and knockout Dictyostelium cell lines for JNCL research. Dictyostelium Cln3 fused to GFP localized to the contractile vacuole system and to compartments of the endocytic pathway. cln3- cells displayed increased rates of proliferation and an associated reduction in the extracellular levels and cleavage of the autocrine proliferation repressor, AprA. Mid- and late development of cln3- cells was precocious and cln3- slugs displayed increased migration. Expression of either Dictyostelium Cln3 or human CLN3 in cln3- cells suppressed the precocious development and aberrant slug migration, which were also suppressed by calcium chelation. Taken together, our results show that Cln3 is a pleiotropic protein that negatively regulates proliferation and development in Dictyostelium. This new model system, which allows for the study of Cln3 function in both single cells and a multicellular organism, together with the observation that expression of human CLN3 restores abnormalities in Dictyostelium cln3- cells, strongly supports the use of this new model for JNCL research.

  2. Holocene palaeohydrological history of the Tǎul Muced peat bog (Northern Carpathians, Romania) based on testate amoebae (Protozoa) and plant macrofossils

    Science.gov (United States)

    Cosmin Diaconu, Andrei; Feurdean, Angelica; Lamentowicz, Mariusz; Gałka, Mariusz; Tanţǎu, Ioan

    2016-04-01

    Knowledge of past local vs. regional hydro-climate variability is a priority in climate research. This is because ecosystems and human depend on local climatic conditions and the magnitude of these climate changes is more variable at local and regional rather than at global scales. Ombrotrophic bogs are highly suitable for hydro-climate reconstructions as they are entirely dependent on the water from precipitation. We used stratigraphy, radiocarbon dating, testate amoebae (TA) and plant macrofossils on a peat profile from an ombrotrophic bog (Tǎul Muced) located in the Biosphere Reserve of the Rodna National Park Romania. We performed quantitative reconstruction of the depth to water table (DWT) and pH over the last 8000 years in a continental area of CE Europe. We identified six main stages in the development of the bog based on changes in TA assemblages in time. Wet conditions and pH between 2 and 4.5 were recorded between 4600-2750 and 1300-400 cal. yr BP, by the occurrence of Archerella flavum, Amphitrema wrightianum and Hyalosphenia papilio. This was associated to a local vegetation primarily composed of Sphagnum magellanicum and S. angustifolium. Dry stages and pH of 2.5 to 5 were inferred between 7550-4600, 2750-1300 and -50 cal. yr BP, by the dominance of Nebela militaris, Difflugia pulex and Phryganella acropodia. These overall dry conditions were also connected with increased abundance of Eriophorum vaginatum. The period between 400 and -50 cal. yr BP was characterized by a rapid shift from dry to wet conditions on the surface of the bog. Vegetation shifted from Sphagnum magellanicum to Sphagnum russowii dominated community. Our reconstruction remains in relatively good agreement with other palaeohydrological records from Central Eastern Europe. However, it shows contrasting conditions to others particularly with records from NW Europe. The valuable information regarding bog hydrology offered by our record puts an accent on the need of more regional TA

  3. Giant Viruses of Amoebas: An Update

    Science.gov (United States)

    Aherfi, Sarah; Colson, Philippe; La Scola, Bernard; Raoult, Didier

    2016-01-01

    During the 12 past years, five new or putative virus families encompassing several members, namely Mimiviridae, Marseilleviridae, pandoraviruses, faustoviruses, and virophages were described. In addition, Pithovirus sibericum and Mollivirus sibericum represent type strains of putative new giant virus families. All these viruses were isolated using amoebal coculture methods. These giant viruses were linked by phylogenomic analyses to other large DNA viruses. They were then proposed to be classified in a new viral order, the Megavirales, on the basis of their common origin, as shown by a set of ancestral genes encoding key viral functions, a common virion architecture, and shared major biological features including replication inside cytoplasmic factories. Megavirales is increasingly demonstrated to stand in the tree of life aside Bacteria, Archaea, and Eukarya, and the megavirus ancestor is suspected to be as ancient as cellular ancestors. In addition, giant amoebal viruses are visible under a light microscope and display many phenotypic and genomic features not found in other viruses, while they share other characteristics with parasitic microbes. Moreover, these organisms appear to be common inhabitants of our biosphere, and mimiviruses and marseilleviruses were isolated from human samples and associated to diseases. In the present review, we describe the main features and recent findings on these giant amoebal viruses and virophages. PMID:27047465

  4. Giant viruses of amoebas: an update

    Directory of Open Access Journals (Sweden)

    Sarah eAherfi

    2016-03-01

    Full Text Available During the 12 past years, five new or putative virus families encompassing several members, namely Mimiviridae, Marseilleviridae, pandoraviruses, faustoviruses, and virophages were described. In addition, Pithovirus sibericum and Mollivirus sibericum represent type strains of putative new giant virus families. All these viruses were isolated using amoebal coculture methods. These giant viruses were linked by phylogenomic analyses to other large DNA viruses. They were then proposed to be classified in a new viral order, the Megavirales, on the basis of their common origin, as shown by a set of ancestral genes encoding key viral functions, a common virion architecture, and shared major biological features including replication inside cytoplasmic factories. Megavirales is increasingly demonstrated to stand in the tree of life aside Bacteria, Archaea and Eukarya, and the megavirus ancestor is suspected to be as ancient as cellular ancestors. In addition, giant amoebal viruses are visible under a light microscope and display many phenotypic and genomic features not found in other viruses, while they share other characteristics with parasitic microbes. Moreoever, these organisms appear to be common inhabitants of our biosphere, and mimiviruses and marseilleviruses were isolated from human samples and associated to diseases. In the present review, we describe the main features and recent findings on these giant amoebal viruses and virophages.

  5. Bacteria isolated from amoebae/bacteria consortium

    Science.gov (United States)

    Tyndall, Richard L.

    1995-01-01

    New protozoan derived microbial consortia and method for their isolation are provided. Consortia and bacteria isolated therefrom are useful for treating wastes such as trichloroethylene and trinitrotoluene. Consortia, bacteria isolated therefrom, and dispersants isolated therefrom are useful for dispersing hydrocarbons such as oil, creosote, wax, and grease.

  6. Efecto de la estructuración por macrófitas y por recursos alimentarios en la distribución horizontal de tecamebas y rotíferos en un lago andino patagónico Effect of macrophytes and food resources on the horizontal distribution of testate amoebae and rotifers in an Andean-Patagonian lake

    Directory of Open Access Journals (Sweden)

    MARCELA BASTIDAS-NAVARRO

    2007-09-01

    con el aumento de la abundancia de la cianofita Coelosphaerium kuetzingianum. Las diferencias señaladas indican que los recursos alimentarios serían un factor determinante en la distribución de especies de tecamebas y rotíferos en el lago Escondido. Para estos zoopláncteres de pequeño tamaño las macrófitas litorales brindarían alimento al favorecer el incremento del fitoplancton de redThe presence of macrophytes in the littoral zone of lakes produces particular conditions including higher resource availability for consumers. For this reason, the littoral zone is generally the area with the highest diversity of lakes and rivers. In this work we studied the horizontal distribution of testate amoebae and rotifers in Lago Escondido (Argentina in relation to food resources availability. The study was carried out along a north-south transect that includes the littoral and the pelagic zone of the lake. Phytoplankton and zooplankton were sampled during summer and spring (2001-2003 in five sampling stations: one pelagic and four littoral. Rotifers and testate amoebae, as well as phytoplanktonic algae abundance and biomass were estimated. Food resources were classified as nanoplankton ( 20 μm and the biovolume of these fractions varied significantly within the pelagic and littoral zones of the lake. Nanoplankon dominated the pelagic zone and was mainly composed by nanoflagellates while net phytoplankton prevailed in the littoral zone and was composed by diatoms, cyanophytes and chlorophytes. The highest number of species and diversity of testate amoebae and rotifers were observed in the littoral stations; nevertheless, no significant differences between the zones colonized by different macrophytes were observed. The CCA analysis showed four different groups. Keratella cochlearis, Synchaeta spp., Polyarthra vulgaris and Collotheca mutabilis characterized the pelagic samples and were related with a high abundance of nanoplankton. On the other hand, rotifers like

  7. Species richness of testate amoebae in different environments from the upper Paraná river floodplain (PR/MS = Riqueza de amebas testáceas em diferentes ambientes da planície de inundação do alto rio Paraná (PR/MS

    Directory of Open Access Journals (Sweden)

    Deise de Morais Costa

    2011-07-01

    Full Text Available This study evaluated the species richness of testate amoebae in the plankton from different environments of the upper Parana river floodplain. Samplings were performed at subsurface of pelagic region from twelve environments using motorized pump and plankton net (68 ƒÝm, during four hydrological periods. We identified 67 taxa, distributed in seven families and Arcellidae, Difflugiidae and Centropyxidae were the most representative families. Higher values of species richness were observed in the lakes (connected and isolated during the flood pulses. Centropyxis aculeata, Difflugia gramem and D.pseudogramem were frequent throughout the study period. Seasonal variability of species in the channels and isolated lakes was evidenced by beta diversity. Besides that, in the rivers, extreme changes in species composition were verified during the high-water period. Our results highlight the importance of the present study to improve the knowledge about the diversity and geographic distribution of these organisms in Brazil and emphasize the importance of current flow in the displacement of testate amoebae from their preferredhabitats, marginal vegetation and sediment.Este estudo objetivou avaliar a riqueza de taxons de amebas testaceas no plancton de diferentes ambientes da planicie de inundacao do alto rio Parana. Foram amostrados 12 pontos da regiao pelagica em diferentes ambientes (rios, canais e lagoas e em quatro periodos hidrologicos. Foram identificados 67 taxons, distribuidos em sete familias. Arcellidae, Difflugiidae e Centropyxidae foram as familiasmais especiosas. Nas lagoas (abertas e fechadas, durante os pulsos de inundacao, foram observados os maiores valores para a riqueza de especies. Centropyxis aculeata, Difflugia gramem e D. pseudogramem foram frequentes durante todo o periodo estudado. Os dados obtidos pela diversidade beta evidenciaram a variabilidade sazonal das especies nos canais e lagoas fechadas. Nos rios, as alteracoes

  8. Abundância de tecamebas no plâncton de reservatórios do Estado do Paraná- DOI: 10.4025/actascibiolsci.v26i4.1522 Testate amoebae abundance in plankton samples from Paraná State reservoirs - DOI: 10.4025/actascibiolsci.v26i4.1522

    Directory of Open Access Journals (Sweden)

    Claudia Costa Bonecker

    2004-04-01

    Full Text Available Este trabalho teve o objetivo de investigar os padrões de distribuição espacial e temporal da abundância de tecamebas (Rhizopoda no plâncton de diferentes reservatórios do Estado do Paraná bem como a importância de fatores hidrodinâmicos e morfométricos na determinação desses padrões. Os 30 reservatórios estudados estão localizados em seis diferentes bacias, incluindo ambientes com áreas, morfometrias e idades variáveis. As amostragens foram realizadas em julho e novembro de 2001, períodos de estiagem e chuvoso, respectivamente. As amostras foram obtidas à superfície dos reservatórios, na região lacustre, utilizando-se uma bomba (600 litros por amostra e uma rede de plâncton com malhagem de 68 um. As tecamebas foram registradas em 23 reservatórios. Maiores densidades foram encontradas nos reservatórios JMF, Salto do Meio, Melissa, Mourão e Salto do Vau, durante o período de estiagem, e JMF, Salto Osório, Salto do Meio e Melissa, durante o período chuvoso. Esses reservatórios apresentam características similares, como reduzidas profundidades e dimensões morfométricas. Além disso, a maioria deles têm características hidrodinâmicas similares a de ambientes lóticos, por apresentarem alta velocidade de corrente. Por outro lado, as tecamebas foram ausentes ou presentes em baixas densidades, em geral, nos reservatórios com maiores dimensões e profundidade. Ao contrário do esperado, sazonalmente, maiores densidades foram observadas durante o período de estiagem, para a maioria dos reservatórios. Esses resultados podem estar relacionados com o fato de os reservatórios, nesse período hidrológico, apresentarem uma nítida redução de suas dimensões (área e profundidade, determinando uma maior influência de organismos bentônicos para a composição e abundância da comunidade protozooplanctônica δThis study aimed to investigate patterns of spatial and temporal distribution of testate amoebae (Rhizopoda

  9. Testate amoebae (Protozoa, Rhizopoda) succession on abandoned fields

    Czech Academy of Sciences Publication Activity Database

    Balík, Vladimír

    České Budějovice : ISB, 1999. s. 52-52. [Central European Workshop on Soil Zoology /5./. 27.04.1999-30.04.1999, České Budějovice] R&D Projects: GA ČR GA526/97/0631 Subject RIV: EH - Ecology, Behaviour

  10. Testate amoebae (Protozoa,Rhizopoda) succession on abandoned fields

    Czech Academy of Sciences Publication Activity Database

    Balík, Vladimír

    České Budějovice : ISB, 1999, s. 7-11 [Soil Zoology in Central Europe. České Budějovice (CZ), 27.04.1999-30.04.1999] R&D Projects: GA ČR GA526/97/0631; GA AV ČR KSK2005601 Subject RIV: EH - Ecology, Behaviour

  11. Indecisive Behavior of Amoeba Crossing AN Environmental Barrier

    Science.gov (United States)

    Takagi, S.; Nishiura, Y.; Nakagaki, T.; Ueda, T.; Ueda, K.-I.

    2007-07-01

    We report here a new kind of behavior that seems to be 'indecisive' in an amoeboid organism, the Physarum plasmodium of true slime mold. The plasmodium migrating in a narrow lane stops moving for a period of time (several hours but the duration differs for each plasmodium) when it encounters the presence of a chemical repellent, quinine. After stopping period, the organism suddenly begins to move again in one of three different ways as the concentration of repellent increases: going through the repulsive place (penetration), splitting into two fronts of going throught it and turning (splitting) and turning back (rebound). In relation to the physiological mechanism for tip migration in the plasmodium, we found that the frontal tip is capable of moving further although the tip is divided from a main body of organism. This means that a motive force of front locomotion is produced by a local process at the tip. Based on this finding, a mathematical model for front locomotion is considered in order to understand the dynamics for both the long period of stopping and three kinds of behavior. A model based on reaction-diffusion equations succeeds to reproduce the experimental observation. The origin of long-time stopping and three different outputs may be reduced to the hidden instabilities of internal dynamics of the pulse, which may be a skeleton structure extracted from much more complex dynamics imbedded in the Physarum plasmodium.

  12. Survival of taylorellae in the environmental amoeba Acanthamoeba castellanii

    OpenAIRE

    Allombert, Julie; Vianney, Anne; Laugier, Claire; Petry, Sandrine; Hébert, Laurent

    2014-01-01

    Background Taylorella equigenitalis is the causative agent of contagious equine metritis, a sexually-transmitted infection of Equidae characterised in infected mares by abundant mucopurulent vaginal discharge and a variable degree of vaginitis, cervicitis or endometritis, usually resulting in temporary infertility. The second species of the Taylorella genus, Taylorella asinigenitalis, is considered non-pathogenic, although mares experimentally infected with this bacterium can develop clinical...

  13. Dimer Models from Mirror Symmetry and Quivering Amoebae

    CERN Document Server

    Feng, B; Kennaway, K D; Vafa, C; Feng, Bo; He, Yang-Hui; Kennaway, Kristian D.; Vafa, Cumrun

    2005-01-01

    Dimer models are 2-dimensional combinatorial systems that have been shown to encode the gauge groups, matter content and tree-level superpotential of the world-volume quiver gauge theories obtained by placing D3-branes at the tip of a singular toric Calabi-Yau cone. In particular the dimer graph is dual to the quiver graph. However, the string theoretic explanation of this was unclear. In this paper we use mirror symmetry to shed light on this: the dimer models live on a T^2 subspace of the T^3 fiber that is involved in mirror symmetry and is wrapped by D6-branes. These D6-branes are mirror to the D3-branes at the singular point, and geometrically encode the same quiver theory on their world-volume.

  14. Migration of amoeba cells in an electric field

    Science.gov (United States)

    Guido, Isabella; Bodenschatz, Eberhard

    2015-03-01

    Exogenous and endogenous electric fields play a role in cell physiology as a guiding mechanism for the orientation and migration of cells. Electrotaxis of living cells has been observed for several cell types, e.g. neurons, fibroblasts, leukocytes, neural crest cells, cancer cells. Dictyostelium discoideum (Dd), an intensively investigated chemotactic model organism, also exhibits a strong electrotactic behavior moving toward the cathode under the influence of electric fields. Here we report experiments on the effects of DC electric fields on the directional migration of Dd cells. We apply the electric field to cells seeded into microfluidic devices equipped with agar bridges to avoid any harmful effects of the electric field on the cells (ions formation, pH changes, etc.) and a constant flow to prevent the build-up of chemical gradient that elicits chemotaxis. Our results show that the cells linearly increase their speed over time when a constant electric field is applied for a prolonged duration (2 hours). This novel phenomenon cannot be attributed to mechanotaxis as the drag force of the electroosmotic flow is too small to produce shear forces that can reorient cells. It is independent of the cellular developmental stage and to our knowledge, it was not observed in chemotaxis. This work is supported by MaxSynBio project of the Max Planck Society.

  15. Lysophosphatidic acid is a chemoattractant for Dictyostelium discoideum amoebae.

    OpenAIRE

    Jalink, K.; Moolenaar, W H; Duijn, B., Van

    1993-01-01

    The naturally occurring phospholipid lysophosphatidic acid (LPA) can induce a number of physiological responses in vertebrate cells, including platelet aggregation, smooth muscle contraction, and fibroblast proliferation. LPA is thought to activate a specific G-protein-coupled receptor, thereby triggering classic second messenger pathways such as stimulation of phospholipase C and inhibition of adenylate cyclase. Here we report that 1-oleoyl-LPA, at submicromolar concentrations, evokes a chem...

  16. Monitoring for the Presence of Parasitic Protozoa and Free-living Amoebae in Drinking Water Plants

    OpenAIRE

    Amany Saad Amer.

    2012-01-01

    Contamination of drinking water by microorganisms represents a major human health hazard in many parts of the world. The main objective of drinking water treatment is to provide microbiologically safe drinking water. The conventional drinking water treatment and disinfection has proved to be one of the major public health advances in modern times. A number of processes; namely water treatment, disinfection and changes influence the quality of drinking water delivered to the customer’s tap dur...

  17. Is Swimming Safe in Areas with the Freshwater 'Brain-Eating' Amoeba?

    Science.gov (United States)

    ... a 2015 study in the Journal of the Pediatric Infectious Diseases Society said. "Considering the millions of times that ... low risk," agreed Dr. Sunil Sood, chair of Pediatrics-Infectious Disease at Southside Hospital, in Bay Shore, N.Y. ...

  18. Charles Darwin meets Amoeba economicus: why natural selection cannot explain rationality

    OpenAIRE

    Elias L. Khalil

    2006-01-01

    Advocates of natural selection usually regard rationality as redundant, i.e., as a mere linguistic device to describe natural selection. But this “Redundancy Thesis” faces the anomaly that rationality differs from natural selection. One solution is to conceive rationality as a trait selected by the neo-Darwinian mechanism of natural selection as . But this “Rationality-qua-Trait Thesis” faces a problem as well: Following neo-Darwinism, one cannot classify one allele of, e.g., eyesight as bett...

  19. Variation, sex, and social cooperation: molecular population genetics of the social amoeba Dictyostelium discoideum.

    Directory of Open Access Journals (Sweden)

    Jonathan M Flowers

    2010-07-01

    Full Text Available Dictyostelium discoideum is a eukaryotic microbial model system for multicellular development, cell-cell signaling, and social behavior. Key models of social evolution require an understanding of genetic relationships between individuals across the genome or possibly at specific genes, but the nature of variation within D. discoideum is largely unknown. We re-sequenced 137 gene fragments in wild North American strains of D. discoideum and examined the levels and patterns of nucleotide variation in this social microbial species. We observe surprisingly low levels of nucleotide variation in D. discoideum across these strains, with a mean nucleotide diversity (pi of 0.08%, and no strong population stratification among North American strains. We also do not find any clear relationship between nucleotide divergence between strains and levels of social dominance and kin discrimination. Kin discrimination experiments, however, show that strains collected from the same location show greater ability to distinguish self from non-self than do strains from different geographic areas. This suggests that a greater ability to recognize self versus non-self may arise among strains that are more likely to encounter each other in nature, which would lead to preferential formation of fruiting bodies with clonemates and may prevent the evolution of cheating behaviors within D. discoideum populations. Finally, despite the fact that sex has rarely been observed in this species, we document a rapid decay of linkage disequilibrium between SNPs, the presence of recombinant genotypes among natural strains, and high estimates of the population recombination parameter rho. The SNP data indicate that recombination is widespread within D. discoideum and that sex as a form of social interaction is likely to be an important aspect of the life cycle.

  20. Effect of disinfectants on pathogenic free-living amoebae: in axenic conditions.

    OpenAIRE

    Cursons, R T; Brown, T J; Keys, E A

    1980-01-01

    The amoebicidal properties of chlorine, chlorine dioxide, ozone, and deciquam 222 were examined in axenic conditions. Naegleria spp. were found to be more sensitive to chlorine and chlorine dioxide than Acanthamoeba spp. No marked difference in sensitivity to ozone or deciquam 222 could be detected between the pathogenic (A-1) and nonpathogenic (1501) strains of Acanthamoeba and the pathogenic (MsT) and nonpathogenic (P1200f) strains of Naegleria. Methods of disinfection are discussed with re...

  1. Electrophoretic isoenzyme patterns of the pathogenic and non-pathogenic intestinal amoebae of man.

    Science.gov (United States)

    Sargeaunt, P G; Williams, J E

    1979-01-01

    Cultured stocks of Entamoeba hartmanni, Endolimax nana, Iodamoeba buetschlli and Dientamoeba fragilis were compared with the four Entamoeba histolytical groups already described (SARGEAUNT et al., 1978), by the electrophoretic patterns of three enzymes: glucose phosphate isomerase (GPI), phosphoglucomutase (PGM) and L-malate: NADP+ oxidoreductase (oxalacetate-decarboxylating) (ME). All the species were easily distinguished by their characteristic patterns. PMID:473310

  2. Propensity of heavier halides for the water/vapor interface revisited using the Amoeba force field

    Czech Academy of Sciences Publication Activity Database

    Tůma, L.; Jeníček, D.; Jungwirth, Pavel

    2005-01-01

    Roč. 411, - (2005), s. 70-74. ISSN 0009-2614 R&D Projects: GA MŠk(CZ) LC512 Grant ostatní: NSF(US) CHE0431312; NSF(US) CHE0209719 Institutional research plan: CEZ:AV0Z4055905 Keywords : halide anions * water/vapor interface * molecular dynamics Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.438, year: 2005

  3. Amitochondriate amoebae and the evolution of DNA-dependent RNA polymerase II

    OpenAIRE

    Stiller, John W.; Duffield, Ellen C. S.; Hall, Benjamin D.

    1998-01-01

    Unlike parasitic protist groups that are defined by the absence of mitochondria, the Pelobiontida is composed mostly of free-living species. Because of the presence of ultrastructural and cellular features that set them apart from all other eukaryotic organisms, it has been suggested that pelobionts are primitively amitochondriate and may represent the earliest-evolved lineage of extant protists. Analyses of rRNA genes, however, have suggested that the group arose well after the diversificati...

  4. Living together: The marine amoeba Thecamoeba hilla Schaeffer, 1926 and its endosymbiont Labyrinthula sp

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Fiala, Ivan; Dvořáková, Helena; Pecková, Hana

    2008-01-01

    Roč. 44, č. 4 (2008), s. 308-316. ISSN 0932-4739 R&D Projects: GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Thecamoeba hilla * Labyrinthula sp. * Symbiotic association Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.000, year: 2008

  5. Pseudomonas aeruginosa uses type III secretion system to kill biofilm-associated amoebae

    DEFF Research Database (Denmark)

    Matz, Carsten; Moreno, Ana Maria; Alhede, Morten;

    2008-01-01

    Bacteria and protozoa coexist in a wide range of biofilm communities of natural, technical and medical importance. Generally, this interaction is characterized by the extensive grazing activity of protozoa on bacterial prey populations. We hypothesized that the close spatial coexistence in biofilms...... findings suggest that conserved virulence pathways and specifically the T3SS play a central role in bacteria- protozoa interactions in biofilms and may be instrumental for the environmental persistence and evolution of opportunistic bacterial pathogens....

  6. Does buckling instability of the pseudopodium limit how well an amoeba can climb?

    OpenAIRE

    Ghosal, Sandip; Fukui, Yoshio

    2012-01-01

    The maximum force that a crawling cell can exert on a substrate is a quantity of interest in cell biomechanics. One way of quantifying this force is to allow the cell to crawl against a measurable and adjustable restraining force until the cell is no longer able to move in a direction opposite to the applied force. Fukui et al.[1] reported on an experiment where amoeboid cells were imaged while they crawled against an artificial gravity field created by a centrifuge. An unexpected observation...

  7. Polarizable molecular dynamics simulation of Zn(II) in water using the AMOEBA force field

    OpenAIRE

    Wu, Johnny C.; Piquemal, Jean-Philip; Chaudret, Robin; Reinhardt, Peter; Ren, Pengyu

    2010-01-01

    The hydration free energy, structure, and dynamics of the zinc divalent cation are studied using a polarizable force field in molecular dynamics simulations. Parameters for the Zn2+ are derived from gas-phase ab initio calculation of Zn2+-water dimer. The Thole-based dipole polarization is adjusted based on the Constrained Space Orbital Variations (CSOV) calculation while the Symmetry Adapted Perturbation Theory (SAPT) approach is also discussed. The vdW parameters of Zn2+ have been obtained ...

  8. Species of Naked Amoebae (Protista new for the Fauna of Ukraine

    Directory of Open Access Journals (Sweden)

    Patsyuk M. K.

    2015-10-01

    Full Text Available Представлены сведения об обнаружении новых для фауны Украины голых амеб: Rhizamoeba sp., Thecamoeba quadrilineata (Carter, 1856, Thecamoeba verrucosa (Ehrenberg, 1838, Flamella sp., Penardia mutabilis Cash, 1904

  9. Genetic Structure of Two Protist Species (Myxogastria, Amoebozoa) Suggests Asexual Reproduction in Sexual Amoebae

    OpenAIRE

    Fiore-Donno, Anna Maria; Novozhilov, Yuri K.; Meyer, Marianne; Schnittler, Martin

    2011-01-01

    Plasmodial slime molds (Myxogastria or Myxomycetes) are common and widespread unicellular organisms that are commonly assumed to have a sexual life cycle culminating with the formation of often macroscopic fruiting bodies that efficiently disseminate spores. However, laboratory studies based on mating compatibility revealed the coexistence of asexual as well as sexual strains. To test this hypothesis in natural populations, we investigated the genetic variability of two species of the genus L...

  10. Did terrestrial diversification of amoebas (amoebozoa occur in synchrony with land plants?

    Directory of Open Access Journals (Sweden)

    Omar Fiz-Palacios

    Full Text Available Evolution of lineage diversification through time is an active area of research where much progress has been made in the last decade. Contrary to the situation in animals and plants little is known about how diversification rates have evolved in most major groups of protist. This is mainly due to uncertainty about phylogenetic relationships, scarcity of the protist fossil record and the unknown diversity within these lineages. We have analyzed the evolutionary history of the supergroup Amoebozoa over the last 1000 million years using molecular dating and species number estimates. After an origin in the marine environment we have dated the colonization of terrestrial habitats by three distinct lineages of Amoebozoa: Dictyostelia, Myxogastria and Arcellinida. The common ancestor of the two sister taxa, Dictyostelia and Myxogastria, appears to have existed before the colonization of land by plants. In contrast Arcellinida seems to have diversify in synchrony with land plant radiation, and more specifically with that of mosses. Detection of acceleration of diversification rates in Myxogastria and Arcellinida points to a co-evolution within the terrestrial habitats, where land plants and the amoebozoans may have interacted during the evolution of these new ecosystems.

  11. Testate amoebae (Protozoa: Rhizopoda of Deepor Beel (a Ramsar site, Assam, northeastern India

    Directory of Open Access Journals (Sweden)

    B.K. Sharma

    2011-07-01

    Full Text Available Twenty-one species of Rhizopoda belonging to eight genera and six families were documented from Deepor Beel, an important floodplain lake of the Brahmaputra River basin, showing the richest diversity of testaceans known to date from any freshwater ecosystem in India. Two species are new records from Assam, while all species are new to this Ramsar site. Our results show a Lobosea/Filosea ratio of 2.0, qualitative importance of Euglyphidae and Centropyxidae = Difflugidae and species richness of Difflugia a; Centropyxis.

  12. Isolation of amoebae and Pseudomonas and Legionella spp. from eyewash stations.

    OpenAIRE

    Paszko-Kolva, C.; Yamamoto, H.; Shahamat, M; Sawyer, T K; Morris, G.; Colwell, R. R.

    1991-01-01

    Forty eyewash units were sampled for protozoa, bacteria, and fungi. Total heterotrophic bacterial counts on nutrient agar and R2A agar (Difco Laboratories, Detroit, Mich.) ranged from 0 to 10(5) CFU/ml, with Pseudomonas spp. being the most frequently isolated. Total counts of 10(4) and 10(8) cells per ml were obtained with the acridine orange staining procedure. All samples were examined for Legionella spp. by direct fluorescent-antibody staining and by culturing on buffered charcoal-yeast ex...

  13. Deficiency of huntingtin has pleiotropic effects in the social amoeba Dictyostelium discoideum.

    Science.gov (United States)

    Myre, Michael A; Lumsden, Amanda L; Thompson, Morgan N; Wasco, Wilma; MacDonald, Marcy E; Gusella, James F

    2011-04-01

    Huntingtin is a large HEAT repeat protein first identified in humans, where a polyglutamine tract expansion near the amino terminus causes a gain-of-function mechanism that leads to selective neuronal loss in Huntington's disease (HD). Genetic evidence in humans and knock-in mouse models suggests that this gain-of-function involves an increase or deregulation of some aspect of huntingtin's normal function(s), which remains poorly understood. As huntingtin shows evolutionary conservation, a powerful approach to discovering its normal biochemical role(s) is to study the effects caused by its deficiency in a model organism with a short life-cycle that comprises both cellular and multicellular developmental stages. To facilitate studies aimed at detailed knowledge of huntingtin's normal function(s), we generated a null mutant of hd, the HD ortholog in Dictyostelium discoideum. Dictyostelium cells lacking endogenous huntingtin were viable but during development did not exhibit the typical polarized morphology of Dictyostelium cells, streamed poorly to form aggregates by accretion rather than chemotaxis, showed disorganized F-actin staining, exhibited extreme sensitivity to hypoosmotic stress, and failed to form EDTA-resistant cell-cell contacts. Surprisingly, chemotactic streaming could be rescued in the presence of the bivalent cations Ca(2+) or Mg(2+) but not pulses of cAMP. Although hd(-) cells completed development, it was delayed and proceeded asynchronously, producing small fruiting bodies with round, defective spores that germinated spontaneously within a glassy sorus. When developed as chimeras with wild-type cells, hd(-) cells failed to populate the pre-spore region of the slug. In Dictyostelium, huntingtin deficiency is compatible with survival of the organism but renders cells sensitive to low osmolarity, which produces pleiotropic cell autonomous defects that affect cAMP signaling and as a consequence development. Thus, Dictyostelium provides a novel haploid organism model for genetic, cell biological, and biochemical studies to delineate the functions of the HD protein. PMID:21552328

  14. Deficiency of huntingtin has pleiotropic effects in the social amoeba Dictyostelium discoideum.

    Directory of Open Access Journals (Sweden)

    Michael A Myre

    2011-04-01

    Full Text Available Huntingtin is a large HEAT repeat protein first identified in humans, where a polyglutamine tract expansion near the amino terminus causes a gain-of-function mechanism that leads to selective neuronal loss in Huntington's disease (HD. Genetic evidence in humans and knock-in mouse models suggests that this gain-of-function involves an increase or deregulation of some aspect of huntingtin's normal function(s, which remains poorly understood. As huntingtin shows evolutionary conservation, a powerful approach to discovering its normal biochemical role(s is to study the effects caused by its deficiency in a model organism with a short life-cycle that comprises both cellular and multicellular developmental stages. To facilitate studies aimed at detailed knowledge of huntingtin's normal function(s, we generated a null mutant of hd, the HD ortholog in Dictyostelium discoideum. Dictyostelium cells lacking endogenous huntingtin were viable but during development did not exhibit the typical polarized morphology of Dictyostelium cells, streamed poorly to form aggregates by accretion rather than chemotaxis, showed disorganized F-actin staining, exhibited extreme sensitivity to hypoosmotic stress, and failed to form EDTA-resistant cell-cell contacts. Surprisingly, chemotactic streaming could be rescued in the presence of the bivalent cations Ca(2+ or Mg(2+ but not pulses of cAMP. Although hd(- cells completed development, it was delayed and proceeded asynchronously, producing small fruiting bodies with round, defective spores that germinated spontaneously within a glassy sorus. When developed as chimeras with wild-type cells, hd(- cells failed to populate the pre-spore region of the slug. In Dictyostelium, huntingtin deficiency is compatible with survival of the organism but renders cells sensitive to low osmolarity, which produces pleiotropic cell autonomous defects that affect cAMP signaling and as a consequence development. Thus, Dictyostelium provides a novel haploid organism model for genetic, cell biological, and biochemical studies to delineate the functions of the HD protein.

  15. Identification of Pif1 helicases with novel accessory domains in various amoebae.

    Science.gov (United States)

    Harman, Ashley; Manna, Sam

    2016-10-01

    Pif1 helicases are a conserved family of eukaryotic proteins involved in the maintenance of both nuclear and mitochondrial DNA. These enzymes possess a number of known and putative functions, which facilitate overall genome integrity. Here we have identified multiple subtypes of Pif1 proteins in various pathogenic and non-pathogenic amoeboid species which possess additional domains not present in other Pif1 helicases. These helicases each possess one of five different accessory domains, which have roles in ubiquitination, origin of DNA replication recognition or single-stranded nucleic acid binding activity. Using a robust phylogenetic approach we examined each Pif1 class, which revealed that gene duplication, fusion and horizontal gene transfer events have all contributed to the evolution of these enzymes. This study has identified the first collection of Pif1 helicases to contain additional domains, which likely confer novel enzymatic activity, or improve existing functionality. Furthermore, the potential functions of these helicases may shed further light on the overall role the Pif1 family plays in genome maintenance. PMID:27421564

  16. Testate Amoebae (Protozoa) in soils of restored flowery meadows in the Bílé Karpaty Mts. (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Balík, Vladimír

    České Budějovice : Institute of Soil Biology AS CR, 2001. s. 37. [Central European Workshop on Soil Zoology /6./. 23.04.2001-25.04.2001, České Budějovice] Institutional research plan: CEZ:AV0Z6066911 Subject RIV: EH - Ecology, Behaviour

  17. The abundant free-living amoeba, Acanthamoeba polyphaga, increases the survival of Campylobacter jejuni in milk and orange juice

    OpenAIRE

    Olofsson, Jenny; Griekspoor Berglund, Petra; Olsen, Björn; Ellström, Patrik; Axelsson-Olsson, Diana

    2015-01-01

    Background: Campylobacter jejuni is a common cause of human bacterial diarrhea in most parts of the world. Most C. jejuni infections are acquired from contaminated poultry, milk, and water. Due to health care costs and human suffering, it is important to identify all possible sources of infection. Unpasteurized milk has been associated with several outbreaks of C. jejuni infection. Campylobacter has been identified on fresh fruit, and other gastrointestinal pathogens such as Salmonella, E. co...

  18. Ménage-a-trois: The amoeba Nuclearia sp. from Lake Zurich with its ecto- and endosymbiotic bacteria

    Czech Academy of Sciences Publication Activity Database

    Dirren, S.; Salcher, Michaela M.; Blom, J. F.; Schweikert, M.; Posch, T.

    2014-01-01

    Roč. 165, č. 5 (2014), s. 745-758. ISSN 1434-4610 Institutional support: RVO:60077344 Keywords : bacteria-protist symbioses * ectosymbionts * endosymbionts * feeding * Nucleariidae * Paucibacter toxinivorans Subject RIV: DA - Hydrology ; Limnology Impact factor: 3.045, year: 2014

  19. Testate amoebae as water quality indicators in lakes: development of a modern distributional dataset from the Greater Toronto Area

    OpenAIRE

    Roe, Helen

    2012-01-01

    Thecamoebians were examined from 123 surface sediment samplescollected from 45 lakes in the Greater Toronto Area (GTA) and thesurrounding region to i) elucidate the controls on faunal distribution inmodern lake environments; and ii) to consider the utility of thecamoebiansin quantitative studies of water quality change. This area waschosen because it includes a high density of lakes that are threatened byurban development and where water quality has deteriorated locally asa result of contamin...

  20. The free-living amoeba Willaertia magna, is particularly resistant to infection by the pathogenic bacteria Legionella pneumophila

    OpenAIRE

    Dey, Rafik; Cavalié, Laurent; Vernet, Christine; Bodennec, Jacques; Pernin, Pierre

    2008-01-01

    Legionella pneumophila, the causative agent of Legionnaire's disease, is well characterized as a bacteria surviving and developing, almost exclusively, as intracellular parasite within freshwater protozoa. Several species of protozoa and ciliae have been shown to support the growth of the pathogenic bacteria. In the present study, we report for the first time the behaviour of the protozoan Willaertia magna towards L. pneumophila and compared it with Acanthamoeba castellanii and Hartmannella v...

  1. The CRISPR-Associated Gene cas2 of Legionella pneumophila Is Required for Intracellular Infection of Amoebae

    OpenAIRE

    Felizza F Gunderson; Cianciotto, Nicholas P.

    2013-01-01

    ABSTRACT Recent studies have shown that the clustered regularly interspaced palindromic repeats (CRISPR) array and its associated (cas) genes can play a key role in bacterial immunity against phage and plasmids. Upon analysis of the Legionella pneumophila strain 130b chromosome, we detected a subtype II-B CRISPR-Cas locus that contains cas9, cas1, cas2, cas4, and an array with 60 repeats and 58 unique spacers. Reverse transcription (RT)-PCR analysis demonstrated that the entire CRISPR-Cas loc...

  2. Amoebae as potential environmental hosts for Mycobacterium ulcerans and other mycobacteria, but doubtful actors in Buruli ulcer epidemiology

    OpenAIRE

    Gryseels, Sophie; Amissah, Diana; Durnez, Lies; Vandelannoote, Koen; Leirs, Herwig; De Jonckheere, Johan; Silva, Manuel T.; Portaels, Françoise; Ablordey, Anthony; Eddyani, Miriam

    2012-01-01

    BACKGROUND: The reservoir and mode of transmission of Mycobacterium ulcerans, the causative agent of Buruli ulcer, remain unknown. Ecological, genetic and epidemiological information nonetheless suggests that M. ulcerans may reside in aquatic protozoa. METHODOLOGY/PRINCIPAL FINDINGS: We experimentally infected Acanthamoeba polyphaga with M. ulcerans and found that the bacilli were phagocytised, not digested and remained viable for the duration of the experiment. Furthermore, we collected 13 ...

  3. Morphotypes in Naked Amoebas (Protista: Distribution in Water Bodies of Zhytomyr and Volyn Polissia (Ukraine and Possible Ecological Significance

    Directory of Open Access Journals (Sweden)

    Patsyuk M. K.

    2014-12-01

    Full Text Available Проанализированы биотопическое и сезонное распределения видов голых амёб, принадлежащих к определённым мор- фотипам, на территории Житомирского и Волынского Полесья. Показано, что политактический и в некоторой степени ругозный и разветвлённый морфотипы имеют адаптивное значение и могли сформироваться в результате адаптации к условиям, которые характерны для олиготрофных озёр. В свою очередь, формирование ланцетообразного морфотипа может быть связано с адаптацией к низким температурам воды, а фламельного - к высоким.

  4. Effects of temporally persistent ant nests of soil protozoan communities and the abundance of morphological types of amoeba

    Science.gov (United States)

    We compared soil protozoan communities near ant nests with soil protozoans in reference soils 5m from the edge of any mounds. We sampled three species of Chihuahuan Desert ants that construct nests that persist for more than a decade: a seed harvester, Pogonomymex rugosus, a liquid feeding honey-po...

  5. Molecular differentiation of Entamoeba histolytica and Entamoeba dispar from Tunisian food handlers with amoeba infection initially diagnosed by microscopy

    Directory of Open Access Journals (Sweden)

    Ben Ayed S.

    2008-03-01

    Full Text Available The purpose of the study was to obtain more reliable epidemiological data concerning Entamoeba (E. histolytica infection in Tunisian food handlers using established molecular tools able to differentiate E. histolytica from E. dispar. From 2002 to 2005, 4,266 fresh stools specimens received in the setting of the National program of food handlers’ control were analysed by optical microscopy. Twelve (2.8 ‰ were positive for the presence of four nuclei cysts identified as E. histolytica/E. dispar. Extraction of DNA from the 12 samples, followed by specific amplifications of E. histolytica and E. dispar SSU rDNA, showed that 11 samples (92% were positive for E. dispar and negative for E. histolytica. Sequencing analysis of 8 PCR products permitted to verify the results obtained with conventional PCR. The remaining sample was negative by PCR amplifying E. histolytica DNA or E. dispar DNA specifically, although it did not show any inhibition. It probably contains protozoan cysts genetically distinct from these two species but morphological similar. Estimation of relative proportions between E. histolytica and E. dispar in cyst carriers showed that all explored individuals harboured the non pathogenic E. dispar strains. This result highlights the need of use in this population of complementary tests that allow specific diagnosis and obviate unnecessary chemotherapy.

  6. Molecular differentiation of Entamoeba histolytica and Entamoeba dispar from Tunisian food handlers with amoeba infection initially diagnosed by microscopy.

    OpenAIRE

    Ben Ayed S.; Ben Abdallah R.; Mousli M.; Aoun K.; Thellier M.; Bouratbine A.

    2008-01-01

    The purpose of the study was to obtain more reliable epidemiological data concerning Entamoeba (E.) histolytica infection in Tunisian food handlers using established molecular tools able to differentiate E. histolytica from E. dispar. From 2002 to 2005, 4,266 fresh stools specimens received in the setting of the National program of food handlers' control were analysed by optical microscopy. Twelve (2.8 per thousand) were positive for the presence of four nuclei cysts identified as E. histolyt...

  7. Bacterivory: a novel dual role for thraustochytrids in the sea

    Digital Repository Service at National Institute of Oceanography (India)

    Raghukumar, S.

    in the presence of bacteria, both species produced amoebae, which moved using pseudopodia and phagocytosed bacterial cells. Several amoebae were produced in 'sporangia', or isolated vegetative cells transformed directly into amoebae. These findings were confirmed...

  8. Checklist of the soil and moss testate amoebae (Protozoa, Rhizopoda) from the National Nature Reserve Voděradské bučiny (Czech Republic)

    Czech Academy of Sciences Publication Activity Database

    Balík, Vladimír

    2001-01-01

    Roč. 170, 1-4 (2001), s. 91-104. ISSN 0139-9543 R&D Projects: GA AV ČR IAA6066702 Institutional research plan: CEZ:AV0Z6066911 Keywords : Testacea * faunistic * Voděradské bučiny National Nature Reserve Subject RIV: EH - Ecology, Behaviour

  9. Evidence for an amoeba-like infectious stage of ichthyophonus sp. and description of a circulating blood stage: a probable mechanism for dispersal within the fish host

    Science.gov (United States)

    Kocan, Richard; LaPatra, Scott; Hershberger, Paul

    2013-01-01

    Small amoeboid cells, believed to be the infectious stage of Ichthyophonus sp., were observed in the bolus (stomach contents) and tunica propria (stomach wall) of Pacific staghorn sculpins and rainbow trout shortly after they ingested Ichthyophonus sp.–infected tissues. By 24–48 hr post-exposure (PE) the parasite morphed from the classically reported multinucleate thick walled schizonts to 2 distinct cell types, i.e., a larger multinucleate amoeboid cell surrounded by a narrow translucent zone and a smaller spherical cell surrounded by a “halo” and resembling a small schizont. Both cell types also appeared in the tunica propria, indicating that they had recently penetrated the columnar epithelium of the stomach. No Ichthyophonus sp. pseudo-hyphae (“germination tubes”) were observed in the bolus or penetrating the stomach wall. Simultaneously, Ichthyophonus sp. was isolated in vitro from aortic blood, which was consistently positive from 6 to 144 hr PE, then only intermittently for the next 4 wk. Small PAS-positive cells observed in blood cultures grew into colonies consisting of non-septate tubules (pseudo-hyphae) terminating in multinucleated knob-like apices similar to those seen in organ explant cultures. Organ explants were culture positive every day; however, typical Ichthyophonus sp. schizonts were not observed histologically until 20–25 days PE. From 20 to 60 days PE, schizont diameter increased from ≤25 μm to ≥82 μm. Based on the data presented herein, we are confident that we have resolved the life cycle of Ichthyophonus sp. within the piscivorous host.

  10. Nuclearia pattersoni sp. n. (Filosea), a new species of amphizoic amoeba isolated from gills of roach (Rutilus rutilus), and its rickettsial endosymbiont

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Veverková, Marie; Fiala, Ivan; Macháčková, Blanka; Pecková, Hana

    2003-01-01

    Roč. 50, č. 3 (2003), s. 161-170. ISSN 0015-5683 R&D Projects: GA AV ČR IAA6022202 Institutional research plan: CEZ:AV0Z6022909; CEZ:MSM 123100003 Keywords : Filosea * Nuclearia pattersoni * rickettsial endosymbiont Subject RIV: EA - Cell Biology Impact factor: 0.469, year: 2003

  11. Use of Multiplex PCR and PCR Restriction Enzyme Analysis for Detection and Exploration of the Variability in the Free-Living Amoeba Naegleria in the Environment

    OpenAIRE

    Pélandakis, Michel; Pernin, Pierre

    2002-01-01

    A multiplex PCR was developed to simultaneously detect Naegleria fowleri and other Naegleria species in the environment. Multiplex PCR was also capable of identifying N. fowleri isolates with internal transcribed spacers of different sizes. In addition, restriction fragment length polymorphism analysis of the PCR product distinguished the main thermophilic Naegleria species from the sampling sites.

  12. The amoeba-to-flagellate transformation test is not reliable for the diagnosis of the genus Naegleria. Description of three new Naegleria spp.

    Science.gov (United States)

    De Jonckheere, J F; Brown, S; Dobson, P J; Robinson, B S; Pernin, P

    2001-07-01

    Trophozoites of several isolates from one location in Australia have failed consistently to transform into flagellates, although they display all other characteristics of the genus Naegleria. When changing the standard transformation test, flagellates were produced. In phylogenetic trees derived from partial small subunit ribosomal DNA (SSUrDNA) sequences, one of these strains branches close to a cluster comprising N. clarki, N. australiensis, N. italica and N. jadini. It is proposed that these Australian isolates represent a new species, named N. fultoni (strain NG885). Failing to form flagellates since their isolation, even when different transformation procedures are used, are two Naegleria strains from Chile and Indonesia. In SSUrDNA-based phylogenetic trees the Chilean strain clusters with N. pussardi and the Indonesian strain clusters with N. galeacystis, but the degree of sequence difference from these described species (3.5% and 2.2%, respectively) is sufficient to propose that both of the strains represent new species, named N. chilensis (strain NG946) and N. indonesiensis (strain NG945), respectively. The close relationships between each of the new species and the Naegleria species with which they cluster in SSUrDNA-based trees were confirmed by ribosomal internal transcribed spacer region (ITS) sequence comparisons. In France, several non-flagellating N. fowleri strains were isolated from one location. ITS rDNA sequence comparisons indicated that they correspond to a 'type' of N. fowleri found in both Europe and the USA. A redefinition of the genus Naegleria is proposed as a consequence of these and previous findings. PMID:11545434

  13. Use of multiplex PCR and PCR restriction enzyme analysis for detection and exploration of the variability in the free-living amoeba Naegleria in the environment.

    Science.gov (United States)

    Pélandakis, Michel; Pernin, Pierre

    2002-04-01

    A multiplex PCR was developed to simultaneously detect Naegleria fowleri and other Naegleria species in the environment. Multiplex PCR was also capable of identifying N. fowleri isolates with internal transcribed spacers of different sizes. In addition, restriction fragment length polymorphism analysis of the PCR product distinguished the main thermophilic Naegleria species from the sampling sites. PMID:11916734

  14. Microscopic isolation and characterization of free living amoebae (FLA from surface water sources.in Birjand, the capital city of the South Khorasan

    Directory of Open Access Journals (Sweden)

    Mahmoodreza Behravan

    2015-07-01

    Conclusion: The results indicated that a significant percentage of surface water sources in Birjand city was contaminated with Acanthamoeba spp. It is necessary for physicians, therefore, to take into account the diseases caused by these infectious agents. Besides, local regional health professionals should take into consideration the potential role of surface stagnant water sources in transferring these infectious agents. Placing warning signs in areas contaminated with these infectious agents seems a useful measure.

  15. Interaction of rheumatoid factor and Entamoeba histolytica

    Directory of Open Access Journals (Sweden)

    P.G. Kremsner

    1989-08-01

    Full Text Available The amoebae's cytotoxicity test and the amoebae's lysis test were used to show possible interactions between rheumatoid factor (RF and Entamoeba histolytica. Amoebae's cytotoxic activity (ACA was inhibited by affinity chromatography purified antiamoebae rabbit IgG (RIgG. Enhanced inhibition could be demonstrated with RIgG plus RF. But the same marked inhibition of ACA could be seen when replacing RF by heat inactivated normal human serum as a control. About 50% amoebae's lysis occurred when amoebae were brought together with native normal human serum (NNHS as a source of complement. Amoebae's lysis increased to 60% when incubated with NHS plus human antiamoebae antibodies. No further augmentation could be obtained by the addition of RF. Using RIgG instead of human antibodies the lysis rate did not increase. Incubation of amoebae, NNHS, RIgG and RF even reduced amoebae's lysis. RF neither has an effect on ACA nor on complement mediated AL in vitro.

  16. Compositions and methods for pathogen transport

    Energy Technology Data Exchange (ETDEWEB)

    El-Etr, Sahar; Farquar, George R.

    2016-01-26

    This disclosure provides a method for transporting a pathogen under ambient conditions, by culturing the pathogen with an amoeba under conditions that favor the incorporation of the pathogen into a trophozoite, starving the amoeba until it encysts, then culturing under conditions that favor conversion of the amoeba back to a trophozoite. In one aspect, the conditions that favor incorporation of the pathogen into the cyst of the amoeba comprises contacting the pathogen with the amoeba in an iron rich environment. Virus and/or bacteria are pathogens that can be transported by the disclosed method. Amoeba that are useful in the disclosed methods include, without limitation Acanthamoeba castellanii, Hartmannella vermiformis and Naegleria gruberi. The disclosed methods have utility in: transporting pathogens from military field hospitals and clinics to the laboratory; transporting pathogens from global satellite laboratories to clinical laboratories; long term storage of pathogens; enriching contaminated patient samples for pathogens of interest; biosurveillance and detection efforts.

  17. Assessing the Risk of Primary Amoebic Meningoencephalitis from Swimming in the Presence of Environmental Naegleria fowleri

    OpenAIRE

    Cabanes, Pierre-André; Wallet, France; Pringuez, Emmanuelle; Pernin, Pierre

    2001-01-01

    Free-living Naegleria fowleri amoebae cause primary amoebic meningoencephalitis (PAM). Because of the apparent conflict between their ubiquity and the rarity of cases observed, we sought to develop a model characterizing the risk of PAM after swimming as a function of the concentration of N. fowleri. The probability of death from PAM as a function of the number of amoebae inhaled is modeled according to results obtained from animals infected with amoeba strains. The calculation of the probabi...

  18. Endocannabinoids Inhibit the Growth of Free-Living Amoebae▿

    OpenAIRE

    Dey, Rafik; Pernin, Pierre; Bodennec, Jacques

    2010-01-01

    The cannabinoid Δ9-tetrahydrocannabinol inhibits the growth of some pathogenic amoebae in vitro and exacerbates amoebic encephalitis in animal models. However, the effects of endogenous cannabinoids on amoebae remain unknown. Therefore, we tested several endocannabinoids (N-acyl ethanolamines and 2-O-acyl glycerol) on different genera of amoebae. The results showed that all of the endocannabinoids tested inhibit amoebic growth at subpharmacological doses, with 50% inhibitory concentrations ra...

  19. Optimized methods for Legionella pneumophila release from its Acanthamoeba hosts

    OpenAIRE

    Dietersdorfer, Elisabeth; Cervero-Aragó, Sílvia; Sommer, Regina; Kirschner, Alexander K.; Walochnik, Julia

    2016-01-01

    Background Free-living amoebae (FLA) and particularly acanthamoebae serve as vehicles and hosts for Legionella pneumophila, among other pathogenic microorganisms. Within the amoebae, L. pneumophila activates a complex regulatory pathway that enables the bacteria to resist amoebal digestion and to replicate. Moreover, the amoebae provide the bacteria protection against harsh environmental conditions and disinfectants commonly used in engineered water systems. To study this ecological relations...

  20. Susceptibility of pathogenic and nonpathogenic Naegleria ssp

    Energy Technology Data Exchange (ETDEWEB)

    Whiteman, L.Y.

    1988-01-01

    The susceptibility of four species of Naegleria amoebae to complement-mediated lysis was determined. The amoebicidal activity of normal human serum (NHS) and normal guinea pig serum (NGPS) for Naegleria amoebae was measured by an in vitro cytotoxicity assay. Release of radioactivity from amoebae labeled with {sup 3}H-uridine and visual observation with a compound microscope were used as indices of lysis. Susceptibility or resistance to complement-mediated lysis in vitro correlated with the in vivo pathogenic potential. Nonpathogenic Naegleria amoebae were lysed at a faster rate and at higher cell concentrations than were pathogenic amoebae. Electrophoretic analysis of NHS incubated with pathogenic or nonpathogenic Naegleria spp. demonstrated that amoebae activate the complement cascade resulting in the production of C3 and C5 complement cleavage products. Treatment with papain or trypsin for 1 h, but not with sialidase, increase the susceptibility of highly pathogenic, mouse-passaged N. fowleri to lysis. Treatment with actinomycin D, cycloheximide or various protease inhibitors for 4 h did not increase susceptibility to lysis. Neither a repair process involving de novo protein synthesis nor a complement-inactivating protease appear to account for the increase resistance of N. fowleri amoebae to complement-mediated lysis. A binding study with {sup 125}I radiolabeled C9 indicated that the terminal complement component does not remain stably bound to the membrane of pathogenic amoebae.

  1. Assessing the risk of primary amoebic meningoencephalitis from swimming in the presence of environmental Naegleria fowleri.

    Science.gov (United States)

    Cabanes, P A; Wallet, F; Pringuez, E; Pernin, P

    2001-07-01

    Free-living Naegleria fowleri amoebae cause primary amoebic meningoencephalitis (PAM). Because of the apparent conflict between their ubiquity and the rarity of cases observed, we sought to develop a model characterizing the risk of PAM after swimming as a function of the concentration of N. fowleri. The probability of death from PAM as a function of the number of amoebae inhaled is modeled according to results obtained from animals infected with amoeba strains. The calculation of the probability of inhaling one or more amoebae while swimming is based on a double hypothesis: that the distribution of amoebae in the water follows a Poisson distribution and that the mean quantity of water inhaled while swimming is 10 ml. The risk of PAM for a given concentration of amoebae is then obtained by summing the following products: the probability of inhaling n amoebae x the probability of PAM associated with inhaling these n amoebae. We chose the lognormal model to assess the risk of PAM because it yielded the best analysis of the studentized residuals. Nonetheless, the levels of risk thereby obtained cannot be applied to humans without correction, because they are substantially greater than those indicated by available epidemiologic data. The curve was thus adjusted by a factor calculated with the least-squares method. This provides the PAM risk in humans as a function of the N. fowleri concentration in the river. For example, the risk is 8.5 x 10(-8) at a concentration of 10 N. fowleri amoebae per liter. PMID:11425704

  2. Endocannabinoids Inhibit the Growth of Free-Living Amoebae▿

    Science.gov (United States)

    Dey, Rafik; Pernin, Pierre; Bodennec, Jacques

    2010-01-01

    The cannabinoid Δ9-tetrahydrocannabinol inhibits the growth of some pathogenic amoebae in vitro and exacerbates amoebic encephalitis in animal models. However, the effects of endogenous cannabinoids on amoebae remain unknown. Therefore, we tested several endocannabinoids (N-acyl ethanolamines and 2-O-acyl glycerol) on different genera of amoebae. The results showed that all of the endocannabinoids tested inhibit amoebic growth at subpharmacological doses, with 50% inhibitory concentrations ranging from 15 to 20 μM. A nonhydrolyzable endocannabinoid had similar effects, showing that the inhibition seen results from endocannabinoids per se rather than from a catabolic product. PMID:20479202

  3. The Importance of Three Protozoa in Corn Straw Decomposition and Nutrient Transformation

    Institute of Scientific and Technical Information of China (English)

    LIU Hai-ming; ZHAO Xiao-rong; LI Gui-tong; LIN Qi-mei

    2003-01-01

    Three typical soil protozoa of Bodo edax, Colpoda cucullus and Amoeba proteus were inoculated into the soil amended with corn straw. The soils were then incubated at 25℃for 60 days. It was found that the protozoa, particularly Bodo edax, significantly reduced soil microbial biomass C. However, the decomposition of corn straw was accelerated by the protozoa. Colpoda cucullus significantly enhanced soil available P content, but Amoeba proteus decreased soil available P content. Colpoda cucullus and Bodo edax did not obviously influence NH+4-N and NO-3-N contents. In contrast, Amoeba proteus significantly increased both NH+4-N and NO-3-N contents.

  4. GEM*: A Molecular Electronic Density-Based Force Field for Molecular Dynamics Simulations.

    Science.gov (United States)

    Duke, Robert E; Starovoytov, Oleg N; Piquemal, Jean-Philip; Cisneros, G Andrés

    2014-04-01

    GEM*, a force field that combines Coulomb and Exchange terms calculated with Hermite Gaussians with the polarization, bonded, and modified van der Waals terms from AMOEBA is presented. GEM* is tested on an initial water model fitted at the same level as AMOEBA. The integrals required for the evaluation of the intermolecular Coulomb interactions are efficiently evaluated by means of reciprocal space methods. The GEM* water model is tested by comparing energies and forces for a series of water oligomers and MD simulations. Timings for GEM* compared to AMOEBA are presented and discussed. PMID:26580355

  5. Disentangling the effects of water chemistry and substratum structure on moss-dwelling unicellular and multicellular micro-organisms in spring-fens

    Czech Academy of Sciences Publication Activity Database

    Hájková, P.; Bojková, J.; Fránková, Markéta; Opravilová, V.; Hájek, M.; Kintrová, K.; Horsák, M.

    2011-01-01

    Roč. 70, suppl.1 (2011), s. 54-64. ISSN 1129-5767 Institutional research plan: CEZ:AV0Z60050516 Keywords : diatoms * rotifers * testate amoebae Subject RIV: EF - Botanics Impact factor: 1.207, year: 2011

  6. Isolation, morphologic, serologic and molecular identification of Acanthamoeba T4 genotype from the liver of a Temminck's tragopan (Tragopan temminckii).

    Science.gov (United States)

    Visvesvara, Govinda S; Shoff, Megan E; Sriram, Rama; Booton, Gregory C; Crary, Monica; Fuerst, Paul A; Hanley, Christopher S; Garner, Michael M

    2010-06-24

    Members of the genus Acanthamoeba are usually free-living amoebae that are found in a variety of ecological niches including soil, fresh and brackish water, dust in the air, heating, ventilating, and air conditioning filters, swimming pools and hot tubs. Occasionally they are also known to cause central nervous system infections in humans and animals. We isolated into culture an amoeba from the liver of a Temminck's tragopan (horned pheasant) (Tragopan temminckii) that died of amoebic infection. We identified the infecting amoeba as Acanthamoeba sp. based on culture characteristics, cyst morphology and immunofluorescence assays. Additionally, we identified the amoeba as Acanthamoeba, genotype T4, by sequencing a diagnostic region of the nuclear small subunit ribosomal RNA gene. PMID:20347228

  7. Arcellaceans and pollen/spores of a late Harappan settlement near Porbandar, west coast of India: Implications for palaeoecology and environmental monitoring

    Digital Repository Service at National Institute of Oceanography (India)

    Farooqui, A.; Gaur, A.S.

    . This communication also elucidates the role of Arcellaceans (testate amoebae) for analysing palaeoecological and climatic hydroperiods during the human settlement (early to mid 2nd millennium BC) around Porbandar region....

  8. Entamoeba histolytica in male homosexuals.

    OpenAIRE

    Sargeaunt, P G; Oates, J K; Maclennan, I.; Oriel, J D; Goldmeier, D

    1983-01-01

    The mobility patterns of four enzymes using cultured trophozoites of Entamoeba histolytica were examined by electrophoresis. By this means the stocks of amoebae isolated from male homosexuals were characterised into zymodemes. No amoebic stock isolated corresponded to a pathogenic zymodeme.

  9. MORPHOLOGY AND BIOMETRY OF ARCELLA INTERMEDIA (DEFLANDRE, 1928) COMB. NOV. FROM RUSSIA AND A REVIEW OF HEMISPHERIC SPECIES OF THE GENUS ARCELLA (TESTCEALOBOSEA, ARCELLINIDA)

    OpenAIRE

    Tsyganov, Andrey; Mazei, Yuri

    2006-01-01

    Morphology and biometry of the testate amoeba Arcella intermedia (Deflandre, 1928) comb. nov. (formerly Arcella hemisphaerica intermedia undulata Deflandre, 1928) isolated from different microbiotopes in Russia were investigated. Size frequency distribution analysis showed that A. intermedia is a size monomorphic species characterised by a main size and a small size range. Comparison of A. intermedia and two testate amoebae with a similar hemispheric shell, A. gibbosa and A. hemisphaerica, de...

  10. The costs and benefits of being a chimera.

    OpenAIRE

    Foster, Kevin R.; Fortunato, Angelo; Strassmann, Joan E.; Queller, David C

    2002-01-01

    Most multicellular organisms are uniclonal. This is hypothesized to be because uniclonal organisms function better than chimeras (non-clonal organisms), owing to reduced levels of internal genetic conflict. We tested this idea using the social amoeba or slime mold Dictyostelium discoideum. When starving, the normally solitary amoebae aggregate to form a differentiated multicellular slug that migrates towards light and forms a fruiting body, facilitating the dispersal of spores. We added 10(7)...

  11. Cellulose degradation: a therapeutic strategy in the improved treatment of Acanthamoeba infections

    OpenAIRE

    Lakhundi, Sahreena; Siddiqui, Ruqaiyyah; Khan, Naveed Ahmed

    2015-01-01

    Acanthamoeba is an opportunistic free-living amoeba that can cause blinding keratitis and fatal brain infection. Early diagnosis, followed by aggressive treatment is a pre-requisite in the successful treatment but even then the prognosis remains poor. A major drawback during the course of treatment is the ability of the amoeba to enclose itself within a shell (a process known as encystment), making it resistant to chemotherapeutic agents. As the cyst wall is partly made of cellulose, thus cel...

  12. Uptake and Replication of Salmonella enterica in Acanthamoeba rhysodes

    OpenAIRE

    Tezcan-Merdol, Dilek; Ljungström, Marianne; Winiecka-Krusnell, Jadwiga; Linder, Ewert; Engstrand, Lars; Rhen, Mikael

    2004-01-01

    The ability of salmonellae to become internalized and to survive and replicate in amoebae was evaluated by using three separate serovars of Salmonella enterica and five different isolates of axenic Acanthamoeba spp. In gentamicin protection assays, Salmonella enterica serovar Dublin was internalized more efficiently than Salmonella enterica serovar Enteritidis or Salmonella enterica serovar Typhimurium in all of the amoeba isolates tested. The bacteria appeared to be most efficiently internal...

  13. Current Status of Protein Force Fields for Molecular Dynamics

    Science.gov (United States)

    Lopes, Pedro E.M.; Guvench, Olgun

    2015-01-01

    Summary The current status of classical force fields for proteins is reviewed. These include additive force fields as well as the latest developments in the Drude and AMOEBA polarizable force fields. Parametrization strategies developed specifically for the Drude force field are described and compared with the additive CHARMM36 force field. Results from molecular simulations of proteins and small peptides are summarized to illustrate the performance of the Drude and AMOEBA force fields. PMID:25330958

  14. Current Status of Protein Force Fields for Molecular Dynamics

    OpenAIRE

    Lopes, Pedro E. M.; Guvench, Olgun; MacKerell, Alexander D.

    2015-01-01

    The current status of classical force fields for proteins is reviewed. These include additive force fields as well as the latest developments in the Drude and AMOEBA polarizable force fields. Parametrization strategies developed specifically for the Drude force field are described and compared with the additive CHARMM36 force field. Results from molecular simulations of proteins and small peptides are summarized to illustrate the performance of the Drude and AMOEBA force fields.

  15. Current status of protein force fields for molecular dynamics simulations.

    Science.gov (United States)

    Lopes, Pedro E M; Guvench, Olgun; MacKerell, Alexander D

    2015-01-01

    The current status of classical force fields for proteins is reviewed. These include additive force fields as well as the latest developments in the Drude and AMOEBA polarizable force fields. Parametrization strategies developed specifically for the Drude force field are described and compared with the additive CHARMM36 force field. Results from molecular simulations of proteins and small peptides are summarized to illustrate the performance of the Drude and AMOEBA force fields. PMID:25330958

  16. Bacterial Alkaloids Prevent Amoebal Predation.

    Science.gov (United States)

    Klapper, Martin; Götze, Sebastian; Barnett, Robert; Willing, Karsten; Stallforth, Pierre

    2016-07-25

    Bacterial defense mechanisms have evolved to protect bacteria against predation by nematodes, predatory bacteria, or amoebae. We identified novel bacterial alkaloids (pyreudiones A-D) that protect the producer, Pseudomonas fluorescens HKI0770, against amoebal predation. Isolation, structure elucidation, total synthesis, and a proposed biosynthetic pathway for these structures are presented. The generation of P. fluorescens gene-deletion mutants unable to produce pyreudiones rendered the bacterium edible to a variety of soil-dwelling amoebae. PMID:27294402

  17. Eumycetozoa = Amoebozoa?: SSUrDNA phylogeny of protosteloid slime molds and its significance for the amoebozoan supergroup.

    Directory of Open Access Journals (Sweden)

    Lora L Shadwick

    Full Text Available Amoebae that make fruiting bodies consisting of a stalk and spores and classified as closely related to the myxogastrids have classically been placed in the taxon Eumycetozoa. Traditionally, there are three groups comprising Eumycetozoa: myxogastrids, dictyostelids, and the so-called protostelids. Dictyostelids and myxogastrids both make multicellular fruiting bodies that may contain hundreds of spores. Protostelids are those amoebae that make simple fruiting bodies consisting of a stalk and one or a few spores. Protostelid-like organisms have been suggested as the progenitors of the myxogastrids and dictyostelids, and they have been used to formulate hypotheses on the evolution of fruiting within the group. Molecular phylogenies have been published for both myxogastrids and dictyostelids, but little molecular phylogenetic work has been done on the protostelids. Here we provide phylogenetic trees based on the small subunit ribosomal RNA gene (SSU that include 21 protostelids along with publicly available sequences from a wide variety of amoebae and other eukaryotes. SSU trees recover seven well supported clades that contain protostelids but do not appear to be specifically related to one another and are often interspersed among established groups of amoebae that have never been reported to fruit. In fact, we show that at least two taxa unambiguously belong to amoebozoan lineages where fruiting has never been reported. These analyses indicate that we can reject a monophyletic Eumycetozoa, s.l. For this reason, we will hereafter refer to those slime molds with simple fruiting as protosteloid amoebae and/or protosteloid slime molds, not as protostelids. These results add to our understanding of amoebozoan biodiversity, and demonstrate that the paradigms for understanding both nonfruiting and sporulating amoebae must be integrated. Finally, we suggest strategies for future research on protosteloid amoebae and nonfruiting amoebae, and discuss the

  18. Exploring Anti-Bacterial Compounds against Intracellular Legionella

    OpenAIRE

    Christopher F Harrison; Sébastien Kicka; Valentin Trofimov; Kathrin Berschl; Hajer Ouertatani-Sakouhi; Nikolaus Ackermann; Christian Hedberg; Pierre Cosson; Thierry Soldati; Hubert Hilbi

    2013-01-01

    Legionella pneumophila is a ubiquitous fresh-water bacterium which reproduces within its erstwhile predators, environmental amoeba, by subverting the normal pathway of phagocytosis and degradation. The molecular mechanisms which confer resistance to amoeba are apparently conserved and also allow replication within macrophages. Thus, L. pneumophila can act as an ‘accidental’ human pathogen and cause a severe pneumonia known as Legionnaires’ disease. The intracellular localisation of L. pneumop...

  19. What Entamoeba histolytica and Giardia lamblia tell us about the evolution of eukaryotic diversity

    Indian Academy of Sciences (India)

    J Samuelson

    2002-11-01

    Entamoeba histolytica and Giardia lamblia are microaerophilic protists, which have long been considered models of ancient pre-mitochondriate eukaryotes. As transitional eukaryotes, amoebae and giardia appeared to lack organelles of higher eukaryotes and to depend upon energy metabolism appropriate for anaerobic conditions, early in the history of the planet. However, our studies have shown that amoebae and giardia contain splicoeosomal introns, ras-family signal-transduction proteins, ATP-binding casettes (ABC)-family drug transporters, Golgi, and a mitochondrion-derived organelle (amoebae only). These results suggest that most of the organelles of higher eukaryotes were present in the common ancestor of all eukaryotes, and so dispute the notion of transitional eukaryotic forms. In addition, phylogenetic studies suggest many of the genes encoding the fermentation enzymes of amoebae and giardia derive from prokaryotes by lateral gene transfer (LGT). While LGT has recently been shown to be an important determinant of prokaryotic evolution, this is the first time that LGT has been shown to be an important determinant of eukaryotic evolution. Further, amoebae contain cyst wall-associated lectins, which resemble, but are distinct from lectins in the walls of insects (convergent evolution). Giardia have a novel microtubule-associated structure which tethers together pairs of nuclei during cell division. It appears then that amoebae and giardia tell us less about the origins of eukaryotes and more about the origins of eukaryotic diversity.

  20. The interplay between Entamoeba and enteropathogenic bacteria modulates epithelial cell damage.

    Directory of Open Access Journals (Sweden)

    José Manuel Galván-Moroyoqui

    Full Text Available BACKGROUND: Mixed intestinal infections with Entamoeba histolytica, Entamoeba dispar and bacteria with exacerbated manifestations of disease are common in regions where amoebiasis is endemic. However, amoeba-bacteria interactions remain largely unexamined. METHODOLOGY: Trophozoites of E. histolytica and E. dispar were co-cultured with enteropathogenic bacteria strains Escherichia coli (EPEC, Shigella dysenteriae and a commensal Escherichia coli. Amoebae that phagocytosed bacteria were tested for a cytopathic effect on epithelial cell monolayers. Cysteine proteinase activity, adhesion and cell surface concentration of Gal/GalNAc lectin were analyzed in amoebae showing increased virulence. Structural and functional changes and induction of IL-8 expression were determined in epithelial cells before and after exposure to bacteria. Chemotaxis of amoebae and neutrophils to human IL-8 and conditioned culture media from epithelial cells exposed to bacteria was quantified. PRINCIPAL FINDINGS: E. histolytica digested phagocytosed bacteria, although S. dysenteriae retained 70% viability after ingestion. Phagocytosis of pathogenic bacteria augmented the cytopathic effect of E. histolytica and increased expression of Gal/GalNAc lectin on the amoebic surface and increased cysteine proteinase activity. E. dispar remained avirulent. Adhesion of amoebae and damage to cells exposed to bacteria were increased. Additional increases were observed if amoebae had phagocytosed bacteria. Co-culture of epithelial cells with enteropathogenic bacteria disrupted monolayer permeability and induced expression of IL-8. Media from these co-cultures and human recombinant IL-8 were similarly chemotactic for neutrophils and E. histolytica. CONCLUSIONS: Epithelial monolayers exposed to enteropathogenic bacteria become more susceptible to E. histolytica damage. At the same time, phagocytosis of pathogenic bacteria by amoebae further increased epithelial cell damage. SIGNIFICANCE

  1. On the effects of cycloheximide on cell motility and polarisation in Dictyostelium discoideum

    Directory of Open Access Journals (Sweden)

    Traynor David

    2006-01-01

    Full Text Available Abstract Background Cycloheximide is a protein synthesis inhibitor that acts specifically on the 60S subunit of eukaryotic ribosomes. It has previously been shown that a short incubation of Dictyostelium discoideum amoebae in cycloheximide eliminates fluid phase endocytosis. Results We found that treatment with cycloheximide also causes the amoebae to retract their pseudopodia, round up and cease movement. Furthermore, fluid phase endocytosis, phagocytosis and capping cease in the presence of 2 mM cycloheximide, although membrane uptake, as measured using FM1-43, is unaffected. In the presence of cycloheximide, aggregation-competent amoebae sensitive to cAMP, although round, can still localise CRAC, ABP120, PI3K and actin polymerisation in response to a micropipette filled with cAMP. The behaviour of wild-type amoebae in the presence of cycloheximide is surprisingly similar to that of amoebae having a temperature-sensitive version of NSF at the restrictive temperature. Conclusion Our results may suggest that, upon cycloheximide treatment, either a labile protein required for polarised membrane recycling is lost, or a control mechanism linking protein synthesis to membrane recycling is activated.

  2. Polarizable atomic multipole X-ray refinement: application to peptide crystals.

    Science.gov (United States)

    Schnieders, Michael J; Fenn, Timothy D; Pande, Vijay S; Brunger, Axel T

    2009-09-01

    Recent advances in computational chemistry have produced force fields based on a polarizable atomic multipole description of biomolecular electrostatics. In this work, the Atomic Multipole Optimized Energetics for Biomolecular Applications (AMOEBA) force field is applied to restrained refinement of molecular models against X-ray diffraction data from peptide crystals. A new formalism is also developed to compute anisotropic and aspherical structure factors using fast Fourier transformation (FFT) of Cartesian Gaussian multipoles. Relative to direct summation, the FFT approach can give a speedup of more than an order of magnitude for aspherical refinement of ultrahigh-resolution data sets. Use of a sublattice formalism makes the method highly parallelizable. Application of the Cartesian Gaussian multipole scattering model to a series of four peptide crystals using multipole coefficients from the AMOEBA force field demonstrates that AMOEBA systematically underestimates electron density at bond centers. For the trigonal and tetrahedral bonding geometries common in organic chemistry, an atomic multipole expansion through hexadecapole order is required to explain bond electron density. Alternatively, the addition of interatomic scattering (IAS) sites to the AMOEBA-based density captured bonding effects with fewer parameters. For a series of four peptide crystals, the AMOEBA-IAS model lowered R(free) by 20-40% relative to the original spherically symmetric scattering model. PMID:19690373

  3. Basic features of slime mould motility

    Science.gov (United States)

    Shirakawa, Tomohiro

    2015-03-01

    The plasmodium of Physarum polycephalum is a unicellular and multi-nuclear giant amoeba that is formed by fusions of myriads of uninucleate microscopic amoebae at a point in the life cycle of the organism. The very large unicellular form of the plasmodium is very uncommon in nature; on the contrary, almost all of the other higher organisms have multi-cellular bodies. Therefore, the plasmodium has an exceptional property: although the plasmodium is a unicellular organism, the size of the amoeba is variable. The smallest plasmodium consists of the fusion of two amoebae, so the smallest size is twice that of a usual amoeba. There is no upper limit to the largest size of the plasmodium, in principle. There is a record of very large plasmodium of more than a few metres. A more interesting point is that despite the variety in the size, the plasmodium can move, feed and form complex structures and adapt itself to the environment in an intelligent manner...

  4. The impact of the fungicide fenpropimorph (Corbel) on bacterivorous and fungivorous protozoa in soil

    DEFF Research Database (Denmark)

    Ekelund, Flemming

    1999-01-01

    concentrations increasing from 0 to 60mgL-1. Naked amoebae and ciliates were present at all fenpropimorph concentrations. The 50-mg soil portions initially contained 19×103 heterotrophic flagellates, 14×103 naked amoebae and about 5 ciliates. The presence of the two latter groups even at concentrations of 60mg...... systems with glucose only; however, soil respiration was significantly impeded in microcosm systems with a low pesticide content and stimulated in systems with a high pesticide content. 4. Bacterivorous protozoa (naked amoebae and heterotrophic flagellates) were affected at all tested concentrations (074......1. The ability of indigenous soil protozoa to survive and multiply when exposed to various concentrations of the fungicide fenpropimorph was investigated. The number of protozoan taxa in relation to biocide concentration was examined in enrichment cultures. The population dynamics of bacterivorous...

  5. In vitro culture, serologic and molecular analysis of Acanthamoeba isolated from the liver of a keel-billed toucan (Ramphastos sulfuratus).

    Science.gov (United States)

    Visvesvara, Govinda S; Booton, Gregory C; Kelley, Darryl J; Fuerst, Paul; Sriram, Rama; Finkelstein, Ariana; Garner, Michael M

    2007-01-19

    Members of the genus Acanthamoeba are usually free-living amebae and are found in a variety of ecological niches including soil, fresh and brackish water, dust in air, filters of heating, ventilating, and air conditioning units, swimming pools and hot tubs, etc. Occasionally, they are also known to cause central nervous system infections in humans and other animals. We isolated into culture an amoeba from the liver tissue of a keel-billed toucan and identified it as Acanthamoeba sp. based on culture characteristics and immunofluorescent analysis. Further, we characterized the cultured amoeba and also the amoeba in the liver tissue as Acanthamoeba, genotype T4, by sequencing a diagnostic region of the nuclear small subunit ribosomal RNA gene. PMID:16962705

  6. Molecular dynamics simulations of methane hydrate using polarizable force fields.

    Science.gov (United States)

    Jiang, H; Jordan, K D; Taylor, C E

    2007-06-14

    Molecular dynamics simulations of methane hydrate have been carried out using the polarizable AMOEBA and COS/G2 force fields. Properties calculated include the temperature dependence of the lattice constant, the OC and OO radial distribution functions, and the vibrational spectra. Both the AMOEBA and COS/G2 force fields are found to successfully account for the available experimental data, with overall somewhat better agreement with experiment being found for the AMOEBA model. Comparison is made with previous results obtained using TIP4P and SPC/E effective two-body force fields and the polarizable TIP4P-FQ force field, which allows for in-plane polarization only. Significant differences are found between the properties calculated using the TIP4P-FQ model and those obtained using the other models, indicating an inadequacy of restricting explicit polarization to in-plane only. PMID:17511493

  7. Molecular dynamics simulations of methane hydrate using polarizable force fields

    Energy Technology Data Exchange (ETDEWEB)

    Jiang, H.N.; Jordan, K.D.; Taylor, C.E.

    2007-06-14

    Molecular dynamics simulations of methane hydrate have been carried out using the polarizable AMOEBA and COS/G2 force fields. Properties calculated include the temperature dependence of the lattice constant, the OC and OO radial distribution functions, and the vibrational spectra. Both the AMOEBA and COS/G2 force fields are found to successfully account for the available experimental data, with overall somewhat better agreement with experiment being found for the AMOEBA model. Comparison is made with previous results obtained using TIP4P and SPC/E effective two-body force fields and the polarizable TIP4P-FQ force field, which allows for in-plane polarization only. Significant differences are found between the properties calculated using the TIP4P-FQ model and those obtained using the other models, indicating an inadequacy of restricting explicit polarization to in-plane onl

  8. The theory and effect of solvent environment on biomolecules

    Science.gov (United States)

    Schnieders, Michael J.

    This dissertation describes the theory and effect of solvent environment on biomolecules using a computational model known as a force field. Force fields are based on formulating an efficient, empirical function of atomic coordinates designed to reproduce the potential energy surface predicted by the more rigorous, but also intractably expensive Schrodinger equation. In particular, this work is novel due to use of an Atomic Multipole Optimized Energetics for Biomolecular Applications (AMOEBA) force field that represents charge density using polarizable atomic multipoles. Polarizable Multipole Poisson-Boltzmann (PMPB) and generalized Kirkwood (GK) continuum electrostatics models are described that interact self-consistently with AMOEBA biomolecules. In conjunction with a novel apolar estimator, the PMPB and GK models are used to construct two implicit solvents for solutes represented by the AMOEBA force field. The effect of solvent environment on the electrostatic moments of a large set of folded proteins is examined.

  9. Meningoencephalitis due to the amoeboflagellate Naegleria fowleri in ruminants in Algeria

    Science.gov (United States)

    Benterki, Mohamed Seghir; Ayachi, Ammar; Bennoune, Omar; Régoudis, Estelle; Pélandakis, Michel

    2016-01-01

    Primary amoebic meningoencephalitis (PAM) is a fatal infection in most cases, caused by the amoeba flagellate Naegleria fowleri. This report describes the first cases of PAM in Algeria, in a cow and a ewe from Batna, north-eastern Algeria. The death of both ruminants occurred a week after the first clinical manifestations. The cerebrospinal fluid, after staining with May-Grünwald-Giemsa, showed the presence of amoebae cells. Histological sections revealed numerous amoebae in all parts of the brain. The presence of N. fowleri was confirmed using a species-specific real-time PCR in histological tissue sections. The two PAM cases were reported during the hot season, and the source of infection is very likely the water where the cattle came to drink. Particular attention should be focused on this type of infection in aquatic environments when the temperature is high and preventive measures must be taken to avoid the proliferation of N. fowleri. PMID:26979770

  10. Polarization and charge transfer in the hydration of chloride ions

    International Nuclear Information System (INIS)

    A theoretical study of the structural and electronic properties of the chloride ion and water molecules in the first hydration shell is presented. The calculations are performed on an ensemble of configurations obtained from molecular dynamics simulations of a single chloride ion in bulk water. The simulations utilize the polarizable AMOEBA force field for trajectory generation and MP2-level calculations are performed to examine the electronic structure properties of the ions and surrounding waters in the external field of more distant waters. The ChelpG method is employed to explore the effective charges and dipoles on the chloride ions and first-shell waters. The quantum theory of atoms in molecules (QTAIM) is further utilized to examine charge transfer from the anion to surrounding water molecules. The clusters extracted from the AMOEBA simulations exhibit high probabilities of anisotropic solvation for chloride ions in bulk water. From the QTAIM analysis, 0.2 elementary charges are transferred from the ion to the first-shell water molecules. The default AMOEBA model overestimates the average dipole moment magnitude of the ion compared to the quantum mechanical value. The average magnitude of the dipole moment of the water molecules in the first shell treated at the MP2-level, with the more distant waters handled with an AMOEBA effective charge model, is 2.67 D. This value is close to the AMOEBA result for first-shell waters (2.72 D) and is slightly reduced from the bulk AMOEBA value (2.78 D). The magnitude of the dipole moment of the water molecules in the first solvation shell is most strongly affected by the local water-water interactions and hydrogen bonds with the second solvation shell, rather than by interactions with the ion.

  11. Polarization and charge transfer in the hydration of chloride ions

    Science.gov (United States)

    Zhao, Zhen; Rogers, David M.; Beck, Thomas L.

    2010-01-01

    A theoretical study of the structural and electronic properties of the chloride ion and water molecules in the first hydration shell is presented. The calculations are performed on an ensemble of configurations obtained from molecular dynamics simulations of a single chloride ion in bulk water. The simulations utilize the polarizable AMOEBA force field for trajectory generation and MP2-level calculations are performed to examine the electronic structure properties of the ions and surrounding waters in the external field of more distant waters. The ChelpG method is employed to explore the effective charges and dipoles on the chloride ions and first-shell waters. The quantum theory of atoms in molecules (QTAIM) is further utilized to examine charge transfer from the anion to surrounding water molecules. The clusters extracted from the AMOEBA simulations exhibit high probabilities of anisotropic solvation for chloride ions in bulk water. From the QTAIM analysis, 0.2 elementary charges are transferred from the ion to the first-shell water molecules. The default AMOEBA model overestimates the average dipole moment magnitude of the ion compared to the quantum mechanical value. The average magnitude of the dipole moment of the water molecules in the first shell treated at the MP2-level, with the more distant waters handled with an AMOEBA effective charge model, is 2.67 D. This value is close to the AMOEBA result for first-shell waters (2.72 D) and is slightly reduced from the bulk AMOEBA value (2.78 D). The magnitude of the dipole moment of the water molecules in the first solvation shell is most strongly affected by the local water-water interactions and hydrogen bonds with the second solvation shell, rather than by interactions with the ion.

  12. Survival of the fattest

    DEFF Research Database (Denmark)

    Morgani, Sophie M; Brickman, Joshua M

    2013-01-01

    Experiments on the social amoeba Dictyostelium discoideum show that the origins of lineage bias in this system lie in the nutritional history of individual cells. Clues to the molecular basis for this process suggest similar forces may be at work in early mammalian development.......Experiments on the social amoeba Dictyostelium discoideum show that the origins of lineage bias in this system lie in the nutritional history of individual cells. Clues to the molecular basis for this process suggest similar forces may be at work in early mammalian development....

  13. Ribosomal RNA genes challenge the monophyly of the Hyalospheniidae (Amoebozoa: Arcellinida)

    DEFF Research Database (Denmark)

    Lara, Enrique; Heger, Thierry J; Ekelund, Flemming; Lamentowicz, Mariusz; Mitchell, Edward A D

    2008-01-01

    To date only five partial and two complete SSU rRNA gene sequences are available for the lobose testate amoebae (Arcellinida). Consequently, the phylogenetic relationships among taxa and the definition of species are still largely dependant on morphological characters of uncertain value, which...... causes confusion in the phylogeny, taxonomy and the debate on cosmopolitanism of free-living protists. Here we present a SSU rRNA-based phylogeny of the Hyalospheniidae including the most common species. Similar to the filose testate amoebae of the order Euglyphida the most basal clades have a terminal...

  14. Characterization of Entamoeba histolytica-induced dephosphorylation in Jurkat cells

    Indian Academy of Sciences (India)

    J E Teixeira; B J Mann

    2002-11-01

    Entamoeba histolytica killing of host cells is contact dependent and mediated by a Gal/GalNAc lectin. Upon contact with amoeba a rapid and extensive dephosphorylation of tyrosine phosphorylated host cell proteins is observed. This effect is mediated by the Gal/GalNAc lectin. However, it requires intact cells, as purified lectin failed to induce dephosphorylation in Jurkat cells. The nonpathogenic, but morphologically identical amoeba, Entamoeba moshkovskii also did not induce dephosphorylation in target cells. Treatment of Jurkat cells with phosphotyrosine phosphatase inhibitors has shown that a host phosphatase is responsible for dephosphorylation. However, it was found that the CD45 phosphotase was not necessary for dephosphorylation of host cell proteins.

  15. Effects of time-variant extremely low-frequency (ELF) electromagnetic fields (EMF) on cholinesterase activity in Dictyostelium discoideum (Protista).

    Science.gov (United States)

    Amaroli, Andrea; Trielli, Francesca; Bianco, Bruno; Giordano, Stefano; Moggia, Elsa; Corrado, Maria U Delmonte

    2005-12-15

    Recently, we detected propionylcholinesterase (PrChE) activity in single-cell amoebae of Dictyostelium discoideum using cytochemical, electrophoretic, and spectrophotometric methods. The involvement of this enzyme activity in cell-cell and cell-environment interactions was suggested. In this work, we found that exposure of single-cell amoebae to an extremely low-frequency electromagnetic fields (ELF-EMF) of 300 microT, 50 Hz, from 1 h up to 48 h at 21 +/- 1 degrees C affected PrChE activity. PMID:16425446

  16. More Cooperative and Fitness Activities on Scooters

    Science.gov (United States)

    Sterling, Mark A.

    2005-01-01

    This article describes both individual and team cooperative and fitness activities that can be played with scooters. The activities include but are not limited to: (1) Traffic Jam; (2) Chariot; (3) Crab Walk; (4) Pom Pom Pull Away; (5) Clothespin Hustle; (6) Four Corners; (7) Spider; (8) Carousel; (9) Amoeba; (10) Caterpillar; (11) Centipede; (12)…

  17. Půdní mikrofauna, krytenky (Protozoa: Testacea) a půdní hlístice (Nematoda), vybraných lokalit CHKO a BR Křivoklátsko

    Czech Academy of Sciences Publication Activity Database

    Háněl, Ladislav

    2011-01-01

    Roč. 31, - (2011), s. 209-214. ISSN 0231-5807 R&D Projects: GA ČR(CZ) GA206/93/0276; GA ČR(IO) GA526/06/1348 Institutional research plan: CEZ:AV0Z60660521 Keywords : Křivoklátsko Protected Landscape Area * deciduous forest * testate amoebae Subject RIV: EH - Ecology, Behaviour

  18. Evidence That Hyaluronidase Is Not Involved in Tissue Invasion of the Protozoan Parasite Entamoeba histolytica

    OpenAIRE

    Nickel, Rosa; Stern, Robert; Leippe, Matthias

    2000-01-01

    As previous reports suggested that a hyaluronidase is involved in tissue invasion of Entamoeba histolytica, we searched for such an activity in trophozoite extracts. A hyaluronidase activity was not detectable in long-term cultures or in amoebae freshly passaged through a gerbil liver, as evidenced by four different techniques.

  19. Formation, succession and landscape history of Central-European summit raised bogs: A multiproxy study from the Hrubý Jeseník Mountains

    Czech Academy of Sciences Publication Activity Database

    Dudová, Lydie; Hájková, Petra; Buchtová, H.; Opravilová, V.

    2013-01-01

    Roč. 23, č. 2 (2013), s. 230-242. ISSN 0959-6836 R&D Projects: GA ČR GA206/08/0389 Institutional support: RVO:67985939 Keywords : bog succession * Larix * testate amoebae Subject RIV: EF - Botanics Impact factor: 3.794, year: 2013

  20. Polarizable atomic multipole X-ray refinement: application to peptide crystals

    International Nuclear Information System (INIS)

    A method to accelerate the computation of structure factors from an electron density described by anisotropic and aspherical atomic form factors via fast Fourier transformation is described for the first time. Recent advances in computational chemistry have produced force fields based on a polarizable atomic multipole description of biomolecular electrostatics. In this work, the Atomic Multipole Optimized Energetics for Biomolecular Applications (AMOEBA) force field is applied to restrained refinement of molecular models against X-ray diffraction data from peptide crystals. A new formalism is also developed to compute anisotropic and aspherical structure factors using fast Fourier transformation (FFT) of Cartesian Gaussian multipoles. Relative to direct summation, the FFT approach can give a speedup of more than an order of magnitude for aspherical refinement of ultrahigh-resolution data sets. Use of a sublattice formalism makes the method highly parallelizable. Application of the Cartesian Gaussian multipole scattering model to a series of four peptide crystals using multipole coefficients from the AMOEBA force field demonstrates that AMOEBA systematically underestimates electron density at bond centers. For the trigonal and tetrahedral bonding geometries common in organic chemistry, an atomic multipole expansion through hexadecapole order is required to explain bond electron density. Alternatively, the addition of interatomic scattering (IAS) sites to the AMOEBA-based density captured bonding effects with fewer parameters. For a series of four peptide crystals, the AMOEBA–IAS model lowered Rfree by 20–40% relative to the original spherically symmetric scattering model

  1. Protozoa: a novel Campylobacter reservoir?

    Science.gov (United States)

    In previous in vitro studies we found that Campylobacter jejuni remained viable for longer periods of time when they were cultivated in the presence of Tetrahymena pyriformis (ciliate) and Acanthamoeba castellanii (amoeba) than when they were in an independent planktonic state. Increased survival t...

  2. The revised classification of eukaryotes

    Czech Academy of Sciences Publication Activity Database

    Adl, S.; Simpson, A. G. B.; Lane, C. E.; Lukeš, Julius; Bass, D.; Bowser, S. S.; Brown, M W.; Burki, F.; Dunthorn, M.; Hampl, V.; Heiss, A.; Hoppenrath, M.; Lara, E.; Gall, L. L.; Lynn, D. H.; McManus, H.; Mitchell, E. A. D.; Mozley-Stanridge, S. E.; Parfrey, L. W.; Pawlowski, J.; Rueckert, S.; Shadwick, L.; Schoch, C.L.; Smirnov, A.; Spiegel, F. W.

    2012-01-01

    Roč. 59, č. 5 (2012), s. 429-514. ISSN 1066-5234 Institutional support: RVO:60077344 Keywords : Algae * amoebae * biodiversity * ciliates * flagellates * fungi * parasites * protozoa * systematics * taxonomy Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.162, year: 2012 http://onlinelibrary.wiley.com/doi/10.1111/j.1550-7408.2012.00644.x/pdf

  3. Fish-isolated strains of Hartmannella vermiformis Page, 1967: morphology, phylogeny and molecular diagnosis of the species in tissue lesions

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Pindová, Z.; Fiala, Ivan; Dvořáková, Helena; Macháčková, Blanka

    2005-01-01

    Roč. 52, č. 4 (2005), s. 295-303. ISSN 0015-5683 R&D Projects: GA AV ČR IAA6022202 Institutional research plan: CEZ:AV0Z60220518 Keywords : amphizoic amoeba e * Hartmannella vermiformis * morphology Subject RIV: EA - Cell Biology Impact factor: 1.138, year: 2005

  4. Experimental study on pathogenic potential of six Acanthamoeba strains isolated from fish

    Czech Academy of Sciences Publication Activity Database

    Veverková, Marie; Dyková, Iva; Pecková, Hana

    2002-01-01

    Roč. 49, č. 3 (2002), s. 243-245. ISSN 0015-5683 R&D Projects: GA AV ČR KSK6005114 Institutional research plan: CEZ:AV0Z6022909 Keywords : amoeba * fish * pathology Subject RIV: EA - Cell Biology Impact factor: 0.515, year: 2002

  5. Protacanthamoeba bohemica n. sp., isolated from the liver of tench, Tinca tinca (Linnaeus, 1758)

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Veverková-Fialová, M.; Fiala, Ivan; Dvořáková, Helena

    2005-01-01

    Roč. 44, č. 4 (2005), s. 369-376. ISSN 0065-1583 R&D Projects: GA AV ČR IAA6022202 Institutional research plan: CEZ:AV0Z60220518 Keywords : amphizoic amoeba e * Protacanthamoeba bohemica * morphology Subject RIV: EA - Cell Biology Impact factor: 0.987, year: 2005

  6. Polarizable atomic multipole X-ray refinement: application to peptide crystals

    Energy Technology Data Exchange (ETDEWEB)

    Schnieders, Michael J. [Department of Chemistry, Stanford, CA 94305 (United States); Fenn, Timothy D. [Department of Molecular and Cellular Physiology, Stanford, CA 94305 (United States); Howard Hughes Medical Institute (United States); Pande, Vijay S., E-mail: pande@stanford.edu [Department of Chemistry, Stanford, CA 94305 (United States); Brunger, Axel T., E-mail: pande@stanford.edu [Department of Molecular and Cellular Physiology, Stanford, CA 94305 (United States); Howard Hughes Medical Institute (United States); Department of Chemistry, Stanford, CA 94305 (United States)

    2009-09-01

    A method to accelerate the computation of structure factors from an electron density described by anisotropic and aspherical atomic form factors via fast Fourier transformation is described for the first time. Recent advances in computational chemistry have produced force fields based on a polarizable atomic multipole description of biomolecular electrostatics. In this work, the Atomic Multipole Optimized Energetics for Biomolecular Applications (AMOEBA) force field is applied to restrained refinement of molecular models against X-ray diffraction data from peptide crystals. A new formalism is also developed to compute anisotropic and aspherical structure factors using fast Fourier transformation (FFT) of Cartesian Gaussian multipoles. Relative to direct summation, the FFT approach can give a speedup of more than an order of magnitude for aspherical refinement of ultrahigh-resolution data sets. Use of a sublattice formalism makes the method highly parallelizable. Application of the Cartesian Gaussian multipole scattering model to a series of four peptide crystals using multipole coefficients from the AMOEBA force field demonstrates that AMOEBA systematically underestimates electron density at bond centers. For the trigonal and tetrahedral bonding geometries common in organic chemistry, an atomic multipole expansion through hexadecapole order is required to explain bond electron density. Alternatively, the addition of interatomic scattering (IAS) sites to the AMOEBA-based density captured bonding effects with fewer parameters. For a series of four peptide crystals, the AMOEBA–IAS model lowered R{sub free} by 20–40% relative to the original spherically symmetric scattering model.

  7. Microfaunal primary succession on the volcanic island Surtsey

    DEFF Research Database (Denmark)

    Frederiksen, Helle B.; Kraglund, H. O.; Ekelund, F.

    2001-01-01

    , ciliates and nematodes were absent and only amoebae and heterotrophic flagellates were found. Most of the protozoan populations we examined were unable to survive salinity levels corresponding to seawater. We therefore conclude that many of soil protozoa populations on Surtsey arrived to the island as...

  8. Comparing the Dictyostelium and Entamoeba Genomes Reveals an Ancient Split in the Conosa Lineage.

    Directory of Open Access Journals (Sweden)

    2005-12-01

    Full Text Available The Amoebozoa are a sister clade to the fungi and the animals, but are poorly sampled for completely sequenced genomes. The social amoeba Dictyostelium discoideum and amitochondriate pathogen Entamoeba histolytica are the first Amoebozoa with genomes completely sequenced. Both organisms are classified under the Conosa subphylum. To identify Amoebozoa-specific genomic elements, we compared these two genomes to each other and to other eukaryotic genomes. An expanded phylogenetic tree built from the complete predicted proteomes of 23 eukaryotes places the two amoebae in the same lineage, although the divergence is estimated to be greater than that between animals and fungi, and probably happened shortly after the Amoebozoa split from the opisthokont lineage. Most of the 1,500 orthologous gene families shared between the two amoebae are also shared with plant, animal, and fungal genomes. We found that only 42 gene families are distinct to the amoeba lineage; among these are a large number of proteins that contain repeats of the FNIP domain, and a putative transcription factor essential for proper cell type differentiation in D. discoideum. These Amoebozoa-specific genes may be useful in the design of novel diagnostics and therapies for amoebal pathologies.

  9. Microbial diversities (16S and 18S rDNA gene pyrosequencing) and environmental pathogens within drinking water biofilms grown on the common premise plumbing materials unplasticized polyvinylchloride and copper

    Science.gov (United States)

    Drinking water (DW) biofilm communities influence the survival of opportunistic pathogens, e.g. Legionella pneumophila, via parasitization of free-living amoebae such as Acanthamoebae. Yet knowledge about the microbial composition of DW biofilms developed on common in-premise pl...

  10. Meeting on the Microbiology of Soils, Autumn 2001: Estimation of protozoan diversity in soil

    DEFF Research Database (Denmark)

    Ekelund, Flemming

    2002-01-01

    Different methods of estimating protozoan diversity in soil are discussed in this paper, with the major emphasis on heterotrophic flagellates. Although many species of ciliates and testate amoebae seem to be unique to the soil environment, the communities of heterotrophic flagellates and naked am...

  11. Identification of a pterin as the acrasin of the cellular slime mold Dictyostelium lacteum

    NARCIS (Netherlands)

    Haastert, Peter J.M. van; Wit, René J.W. de; Grijpma, Yvonne; Konijn, Theo M.

    1982-01-01

    Cell aggregation in Dictyostelium discoideum is mediated by chemotaxis to cyclic AMP. Aggregative cells of the simpler species D. lacteum are not attracted by this cyclic nucleotide. We describe how the cell aggregation-inducing factor, or acrasin, of D. lacteum was purified from aggregating amoebae

  12. Amoebozoa possess lineage-specific globin gene repertoires gained by individual horizontal gene transfers.

    Science.gov (United States)

    Dröge, Jasmin; Buczek, Dorota; Suzuki, Yutaka; Makałowski, Wojciech

    2014-01-01

    The Amoebozoa represent a clade of unicellular amoeboid organisms that display a wide variety of lifestyles, including free-living and parasitic species. For example, the social amoeba Dictyostelium discoideum has the ability to aggregate into a multicellular fruiting body upon starvation, while the pathogenic amoeba Entamoeba histolytica is a parasite of humans. Globins are small heme proteins that are present in almost all extant organisms. Although several genomes of amoebozoan species have been sequenced, little is known about the phyletic distribution of globin genes within this phylum. Only two flavohemoglobins (FHbs) of D. discoideum have been reported and characterized previously while the genomes of Entamoeba species are apparently devoid of globin genes. We investigated eleven amoebozoan species for the presence of globin genes by genomic and phylogenetic in silico analyses. Additional FHb genes were identified in the genomes of four social amoebas and the true slime mold Physarum polycephalum. Moreover, a single-domain globin (SDFgb) of Hartmannella vermiformis, as well as two truncated hemoglobins (trHbs) of Acanthamoeba castellanii were identified. Phylogenetic evidence suggests that these globin genes were independently acquired via horizontal gene transfer from some ancestral bacteria. Furthermore, the phylogenetic tree of amoebozoan FHbs indicates that they do not share a common ancestry and that a transfer of FHbs from bacteria to amoeba occurred multiple times. PMID:25013378

  13. How amoeboids self-organize into a fruiting body: Multicellular coordination in Dictyostelium discoideum

    NARCIS (Netherlands)

    Marée, A.F.M.; Hogeweg, P.

    2002-01-01

    When individual amoebae of the cellular slime mold Dictyostelium discoideum are starving, they aggregate to form a multicellular migrating slug, which moves toward a region suitable for culmination. The culmination of the morphogenesis involves complex cell movements that transform a mound of cells

  14. An Acrasin-Like Attractant from Yeast Extract Specific for Dictyostelium lacteum

    NARCIS (Netherlands)

    Mato, José M.; Haastert, Peter J.M. van; Krens, Frans A.; Konijn, Theo M.

    1977-01-01

    The transition of the unicellular to the multicellular stage in Dictyostelium lacteum is not mediated by cyclic AMP. The attractant for aggregative amoebae of this cellular slime mold species was isolated from yeast extract and purified more than 1000-fold without a significant loss of activity. Sev

  15. The pathogenesis of Acanthamoeba infections: current status and future implications

    OpenAIRE

    Khan, Naveed Ahmed

    2004-01-01

    Acanthamoeba are opportunistic protozoan parasites that can cause painful, visionthreatening keratitis. However the pathogenesis and pathophysiology of Acanthamoeba keratitis remain incompletely understood. Most cases of Acanthamoeba keratitis develop as a result of poor hygiene in contact lens care but it is unclear how amoebae transmigrate from the environment into the cornea leading to inflammation, photophobia and blindness. Acanthamoeba keratitis has become increasingly...

  16. AcEST: BP917499 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000101_E12 418 Adiantum capillus-veneris mRNA. clone: YMU001_000101_E12. BP917499 CL1539C ... ctin binding protein interacting with anti-filamin antibody ... OS=Amoeba proteus PE=2 SV=1 Length = 878 Score = 3 ...

  17. Francisella tularensis type A Strains Cause the Rapid Encystment of Acanthamoeba castellanii and Survive in Amoebal Cysts for Three Weeks post Infection

    Energy Technology Data Exchange (ETDEWEB)

    El-Etr, S H; Margolis, J; Monack, D; Robison, R; Cohen, M; Moore, E; Rasley, A

    2009-07-28

    Francisella tularensis, the causative agent of the zoonotic disease tularemia, has recently gained increased attention due to the emergence of tularemia in geographical areas where the disease has been previously unknown, and the organism's potential as a bioterrorism agent. Although F. tularensis has an extremely broad host range, the bacterial reservoir in nature has not been conclusively identified. In this study, the ability of virulent F. tularensis strains to survive and replicate in the amoeba Acanthamoeba castellanii was explored. We observe that A. castellanii trophozoites rapidly encyst in response to F. tularensis infection and that this rapid encystment phenotype (REP) is caused by factor(s) secreted by amoebae and/or F. tularensis into the co-culture media. Further, our results indicate that in contrast to LVS, virulent strains of F. tularensis can survive in A. castellanii cysts for at least 3 weeks post infection and that induction of rapid amoeba encystment is essential for survival. In addition, our data indicate that pathogenic F. tularensis strains block lysosomal fusion in A. castellanii. Taken together, these data suggest that the interactions between F. tularensis strains and amoeba may play a role in the environmental persistence of F. tularensis.

  18. Fatal Granulomatous Amebic Encephalitis Due to Balamuthia mandrillaris in New Mexico: A Case Report.

    Science.gov (United States)

    Pindyck, Talia N; Dvorscak, Lauren E; Hart, Blaine L; Palestine, Michael D; Gallant, Joel E; Allen, Sarah E; SantaCruz, Karen S

    2014-09-01

    Balamuthia mandrillaris is a free-living amoeba that can cause granulomatous amebic encephalitis (GAE). We report a case in an individual with a history of alcohol abuse, cocaine use, and ditch water exposure. This is the first reported case of GAE due to B mandrillaris in New Mexico. PMID:25734132

  19. Fatal Granulomatous Amebic Encephalitis Due to Balamuthia mandrillaris in New Mexico: A Case Report

    OpenAIRE

    Pindyck, Talia N.; Dvorscak, Lauren E.; Hart, Blaine L.; Palestine, Michael D.; Gallant, Joel E.; Allen, Sarah E; SantaCruz, Karen S.

    2014-01-01

    Balamuthia mandrillaris is a free-living amoeba that can cause granulomatous amebic encephalitis (GAE). We report a case in an individual with a history of alcohol abuse, cocaine use, and ditch water exposure. This is the first reported case of GAE due to B mandrillaris in New Mexico.

  20. Amoebic Gill Disease in the marine environment

    Czech Academy of Sciences Publication Activity Database

    Nowak, B. F.; Carson, J.; Powell, M. D.; Dyková, Iva

    2002-01-01

    Roč. 22, č. 2 (2002), s. 144-147. ISSN 0108-0288 Institutional research plan: CEZ:AV0Z6022909 Keywords : amoebae * gill disease * fish Subject RIV: EA - Cell Biology Impact factor: 0.670, year: 2002

  1. Isolation of pathogenic Naegleria from artificially heated waters

    Energy Technology Data Exchange (ETDEWEB)

    Tyndall, R L; Willaert, E; Stevens, A R; Coutant, C C

    1977-01-01

    Investigations were undertaken to determine whether heated waters facilitate the proliferation of free-living amoeba that cause primary amoebic meningoencephalitis. Water samples were taken close to the discharges of power plants situated on lakes or rivers in Florida and Texas and from cooling towers in Tennessee. The water temperatures ranged from 29 to 42/sup 0/C. Water samples were also taken from several lakes in Florida and Texas without associated power plants. The water temperatures of these ranged from 30/sup 0/ to 34/sup 0/C. Twenty-five-250-ml samples were filtered through membranes. Samples taken from the control lakes and cooling towers showed no growth of pathogenic amoeba, whereas growth was obtained from 2 of the 8 lakes and rivers in Florida and from 1 of the 7 man-made lakes in Texas that were artificially heated. The amoebae were identified as belonging to the genus Naegleria from their trophozoite and cyst structure, ability to grow at 45/sup 0/C, to transform into flagellates, and to produce primary amebic meningoencephalitis (PAME) in mice after intranasal instillation. Their identification as N. fowleri was confirmed by indirect immunofluorescent analysis with antiserum produced against N. fowleri. These findings indicate that artificial heating of waters may facilitate the growth of pathogenic free living amoeba.

  2. Role of Contact Lens Wear, Bacterial Flora, and Mannose-Induced Pathogenic Protease in the Pathogenesis of Amoebic Keratitis

    Science.gov (United States)

    Alizadeh, Hassan; Neelam, Sudha; Hurt, Michael; Niederkorn, Jerry Y.

    2005-01-01

    The ocular surface is continuously exposed to potential pathogens, including free-living amoebae. Acanthamoeba species are among the most ubiquitous amoebae, yet Acanthamoeba keratitis is remarkably rare. The pathogenesis of Acanthamoeba keratitis is a complex, sequential process. Here we show that Acanthamoeba keratitis is profoundly affected by mannosylated proteins on the ocular surface, which stimulate the amoebae to elaborate a 133-kDa pathogenic protease. The mannose-induced protease (MIP133) mediates apoptosis of the corneal epithelium, facilitates corneal invasion, and degrades the corneal stroma. We show that contact lens wear upregulates mannosylated proteins on the corneal epithelium, stimulates MIP133 secretion, and exacerbates corneal disease. Corynebacterium xerosis, a constituent of the ocular flora, contains large amounts of mannose and is associated with Acanthamoeba keratitis. The present results show that amoebae exposed to C. xerosis produce increased amounts of MIP133 and more severe corneal disease. Oral immunization with MIP133 mitigates Acanthamoeba keratitis and demonstrates the feasibility of antidisease vaccines for pathogens that resist immune elimination. PMID:15664950

  3. Dicty_cDB: Contig-U10930-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available fwd CAPG Naegleria gruberi amoeba stage ... 68 1e-27 4 ( EC999675 ) ROE00003646 Rhizopus oryzae Company...luyveromyces lactis sdh1 gene for flavoprotein s... 48 3e-24 10 ( EE006748 ) ROE00001916 Rhizopus oryzae Company...4 ( EE009154 ) ROE00005159 Rhizopus oryzae Company Rhizopus oryz... 62 1e-20 4 (

  4. Acanthamoeba and Fusarium interactions: A possible problem in keratitis.

    Science.gov (United States)

    Nunes, Thais Esther Teixeira; Brazil, Nathalya Tesch; Fuentefria, Alexandre Meneghello; Rott, Marilise Brittes

    2016-05-01

    The incidence of Acanthamoeba and Fusarium species has increased in contact lens-related infectious keratitis. They share several environments and cases of co-infection have been reported. The interaction between the amoebae and other microorganisms may result in significant changes for both, like increased virulence in mammalian hosts. In this study, we evaluated the interaction of three Acanthamoeba castellanii strains with Fusarium conidia and the possible implications on keratitis. F. conidia were internalized by A. castellanii strains and were able to germinate inside the amoebae. The co-culture with the live amoebae, as well as the amoebal culture supernatant and lysate, increased the fungal growth significantly. Moreover, live F. solani and its culture supernatant enhanced the survival of amoebae, but in a different way in each amoebal strain. The encystment of the A. castellanii strain re-isolated from rat lung was increased by the fungus. These results show that A. castellanii and F. solani interaction may have an important influence on survival of both, and specially indicate a possible effect on virulence characteristics of these microorganisms. These data suggest that the A. castellanii-F. solani interaction may cause severe impacts on keratitis. PMID:26851515

  5. Caspase exploitation by Legionella pneumophila

    OpenAIRE

    Kathrin eKrause; Amer, Amal O.

    2016-01-01

    Legionella pneumophila remains a major health concern, especially for hospitalized patients. L. pneumophila in the environment can survive extracellular or as protozoan parasite within amoeba. After human infection it efficiently replicates in alveolar macrophages without activating inflammasome assembly and cleavage of caspase-1. In contrast murine macrophages actively recognize intracellular L. pneumophila via inflammasome components which initiate pro-inflammatory cytokine secretion, phago...

  6. Caspase Exploitation by Legionella pneumophila

    OpenAIRE

    Krause, Kathrin; Amer, Amal O.

    2016-01-01

    Legionella pneumophila remains a major health concern, especially for hospitalized patients. L. pneumophila in the environment can survive extracellular or as protozoan parasite within amoeba. After human infection it efficiently replicates in alveolar macrophages without activating inflammasome assembly and cleavage of caspase-1. In contrast murine macrophages actively recognize intracellular L. pneumophila via inflammasome components which initiate pro-inflammatory cytokine secretion, phago...

  7. Comparing the Dictyostelium and Entamoeba genomes reveals an ancient split in the Conosa lineage.

    Directory of Open Access Journals (Sweden)

    Jie Song

    2005-12-01

    Full Text Available The Amoebozoa are a sister clade to the fungi and the animals, but are poorly sampled for completely sequenced genomes. The social amoeba Dictyostelium discoideum and amitochondriate pathogen Entamoeba histolytica are the first Amoebozoa with genomes completely sequenced. Both organisms are classified under the Conosa subphylum. To identify Amoebozoa-specific genomic elements, we compared these two genomes to each other and to other eukaryotic genomes. An expanded phylogenetic tree built from the complete predicted proteomes of 23 eukaryotes places the two amoebae in the same lineage, although the divergence is estimated to be greater than that between animals and fungi, and probably happened shortly after the Amoebozoa split from the opisthokont lineage. Most of the 1,500 orthologous gene families shared between the two amoebae are also shared with plant, animal, and fungal genomes. We found that only 42 gene families are distinct to the amoeba lineage; among these are a large number of proteins that contain repeats of the FNIP domain, and a putative transcription factor essential for proper cell type differentiation in D. discoideum. These Amoebozoa-specific genes may be useful in the design of novel diagnostics and therapies for amoebal pathologies.

  8. Structure and function of a unique pore-forming protein from a pathogenic acanthamoeba

    NARCIS (Netherlands)

    Michalek, M.; Sönnichsen, F.D.; Wechselberger, R.W.; Wienk, H.L.J.; Leippe, M.; et al., [No Value

    2013-01-01

    Human pathogens often produce soluble protein toxins that generate pores inside membranes, resulting in the death of target cells and tissue damage. In pathogenic amoebae, this has been exemplified with amoebapores of the enteric protozoan parasite Entamoeba histolytica. Here we characterize acantha

  9. Entamoeba histolytica-Secreted Products Degrade Colonic Mucin Oligosaccharides

    OpenAIRE

    Moncada, Darcy; Keller, Kathy; Chadee, Kris

    2005-01-01

    Degradation of the mucus layer by Entamoeba histolytica is a prerequisite for invasion of the colonic mucosa. In this study, we demonstrate that amoeba-secreted products degrade 3H-labeled and native colonic mucin oligosaccharides independently of proteolytic activity. We conclude that E. histolytica degrades mucin oligosaccharides, which may facilitate parasite invasion of the colon.

  10. Entamoeba histolytica meningoencephalitis diagnosed by trophozoites in cerebrospinal fluid

    OpenAIRE

    Goh, L M L; Marrone, J R

    2013-01-01

    Entamoeba histolytica meningoencephalitis has not been described in the modern literature, which is distinct from that caused by free-living amoebae. We report the first case of E. histolytica meningoencephalitis without liver or brain abscesses. Cerebrospinal fluid revealed 2 + very motile trophozoites. Our patient was successfully treated with intravenous metronidazole.

  11. Ecological paradigm of legionella: a revision. New strategy and its implication in public health

    Directory of Open Access Journals (Sweden)

    José Bernardo Ferrer Simó

    2008-12-01

    Full Text Available Some aspects difficultly explained by the ecological model described by Rowbothan in 1980, as the abnormally low infectious dose, the long distances in which bacteria remains viable in the aerosol, the difficulty of growth in the standard culture media, the low efficiency of the antilegionela disinfectants, in the control of the outbreaks, the reinfection or the absence of 'person to person' transmission, are analyzed from an ecological microbiology standpoint. Focused on the bacterium-protozoo relationship , several studies suggest that bacterial growth might take place in two functionally different phases or stages, according to the proportion or ratio bacterium-amoeba (MOI-multiplicity of infection. In the first phase of rapid growth, in which this relationship is substantially low, the entry of Legionella bacterium in the amoeba would originate a unique vacuole, which after amebian lyses, it would liberate free infectants forms for other amoebae. During the second stage, of dissemination or settling of other ecological niches, with high MOI ratios, several growth vesicles are produced inside the amoeba and are expelled without lyses. The deadlock of the amoeba in this phase, is produced after the massive liberation of the vesicles. Some authors suggest that these vesicles are the infectant nuclei of the legionelosis transmission because of his resistance and alive-legionela packing characteristics. The presence of a specific biofilm might be determinant in this process. Keeping in mind this amoeba-legionela relationship-interaction system, the preventive measures should go directed to supporting the MOI relation low, always in conjunction with low levels of biofilm. In this respect, the addition of in continue antilegionela disinfectants substances seems to be indispensable. Reached the phase of dissemination (only fits the cleanliness is the unique measure of action. The research on specific mechanisms of legionela-amoeba invasion would be

  12. United polarizable multipole water model for molecular mechanics simulation

    Energy Technology Data Exchange (ETDEWEB)

    Qi, Rui; Wang, Qiantao; Ren, Pengyu, E-mail: pren@mail.utexas.edu [Department of Biomedical Engineering, The University of Texas at Austin, Austin, Texas 78712 (United States); Wang, Lee-Ping; Pande, Vijay S. [Department of Chemistry, Stanford University, Stanford, California 94305 (United States)

    2015-07-07

    We report the development of a united AMOEBA (uAMOEBA) polarizable water model, which is computationally 3–5 times more efficient than the three-site AMOEBA03 model in molecular dynamics simulations while providing comparable accuracy for gas-phase and liquid properties. In this coarse-grained polarizable water model, both electrostatic (permanent and induced) and van der Waals representations have been reduced to a single site located at the oxygen atom. The permanent charge distribution is described via the molecular dipole and quadrupole moments and the many-body polarization via an isotropic molecular polarizability, all located at the oxygen center. Similarly, a single van der Waals interaction site is used for each water molecule. Hydrogen atoms are retained only for the purpose of defining local frames for the molecular multipole moments and intramolecular vibrational modes. The parameters have been derived based on a combination of ab initio quantum mechanical and experimental data set containing gas-phase cluster structures and energies, and liquid thermodynamic properties. For validation, additional properties including dimer interaction energy, liquid structures, self-diffusion coefficient, and shear viscosity have been evaluated. The results demonstrate good transferability from the gas to the liquid phase over a wide range of temperatures, and from nonpolar to polar environments, due to the presence of molecular polarizability. The water coordination, hydrogen-bonding structure, and dynamic properties given by uAMOEBA are similar to those derived from the all-atom AMOEBA03 model and experiments. Thus, the current model is an accurate and efficient alternative for modeling water.

  13. Relevance of the bioavailable fraction of DDT and its metabolites in freshwater sediment toxicity: New insight into the mode of action of these chemicals on Dictyostelium discoideum.

    Science.gov (United States)

    Sforzini, Susanna; Governa, Daniela; Boeri, Marta; Oliveri, Laura; Oldani, Alessandro; Vago, Fabio; Viarengo, Aldo; Borrelli, Raffaella

    2016-10-01

    In this work, the toxicity of lake sediments contaminated with DDT and its metabolites DDD and DDE (collectively, DDX) was evaluated with widely used toxicity tests (i.e., Vibrio fischeri, Daphnia magna, Pseudokirchneriella subcapitata, and Lumbriculus variegatus) and with the social amoeba Dictyostelium discoideum, a model organism that is also suitable for studying pollutant-induced alterations at the molecular and cellular levels. Although the DDX concentration in the sediments was high (732.5 ppb), the results suggested a minimal environmental risk; in fact, no evidence of harmful effects was found using the different bioassays or when we considered the results of more sensitive sublethal biomarkers in D. discoideum amoebae. In line with the biological results, the chemical data showed that the concentration of DDX in the pore water (in general a highly bioavailable phase) showed a minimal value (0.0071ppb). To confirm the importance of the bioavailability of the toxic chemicals in determining their biological effects and to investigate the mechanisms of DDX toxicity, we exposed D. discoideum amoebae to 732.5ppb DDX in water solution. DDX had no effect on cell viability; however, a strong reduction in amoebae replication rate was observed, which depended mainly on a reduction in endocytosis rate and on lysosomal and mitochondrial alterations. In the presence of a moderate and transient increase in reactive oxygen species, the glutathione level in DDX-exposed amoebae drastically decreased. These results highlight that studies of the bioavailability of pollutants in environmental matrices and their biological effects are essential for site-specific ecological risk assessment. Moreover, glutathione depletion in DDX-exposed organisms is a new finding that could open the possibility of developing new pesticide mixtures that are more effective against DDT-resistant malaria vectors. PMID:27340883

  14. United polarizable multipole water model for molecular mechanics simulation

    International Nuclear Information System (INIS)

    We report the development of a united AMOEBA (uAMOEBA) polarizable water model, which is computationally 3–5 times more efficient than the three-site AMOEBA03 model in molecular dynamics simulations while providing comparable accuracy for gas-phase and liquid properties. In this coarse-grained polarizable water model, both electrostatic (permanent and induced) and van der Waals representations have been reduced to a single site located at the oxygen atom. The permanent charge distribution is described via the molecular dipole and quadrupole moments and the many-body polarization via an isotropic molecular polarizability, all located at the oxygen center. Similarly, a single van der Waals interaction site is used for each water molecule. Hydrogen atoms are retained only for the purpose of defining local frames for the molecular multipole moments and intramolecular vibrational modes. The parameters have been derived based on a combination of ab initio quantum mechanical and experimental data set containing gas-phase cluster structures and energies, and liquid thermodynamic properties. For validation, additional properties including dimer interaction energy, liquid structures, self-diffusion coefficient, and shear viscosity have been evaluated. The results demonstrate good transferability from the gas to the liquid phase over a wide range of temperatures, and from nonpolar to polar environments, due to the presence of molecular polarizability. The water coordination, hydrogen-bonding structure, and dynamic properties given by uAMOEBA are similar to those derived from the all-atom AMOEBA03 model and experiments. Thus, the current model is an accurate and efficient alternative for modeling water

  15. Disentangling the effects of water chemistry and substratum structure on moss-dwelling unicellular and multicellular micro-organisms in spring-fens

    Directory of Open Access Journals (Sweden)

    Michal HORSÁK

    2011-09-01

    Full Text Available Water chemistry is known to be one of the most important factors controlling species composition of many macro-organisms in wetlands. It is unclear to what extent micro-organisms respond to water chemistry as compared to chemistry-mediated substratum structure. We explored how the assemblages of different groups of micro-organisms in bryophyte tufts of spring-fens were determined by water chemistry and substratum structure. The aim was to compare unicellular autotrophic diatoms, unicellular heterotrophic testate amoebae and multicellular heterotrophic monogonont rotifers. Assemblages of all three groups showed a strong compositional gradient correlated with water pH and conductivity, calcium concentration and dominance of Sphagnum. While a second strong gradient in species composition of diatoms and testate amoebae was explained by factors such as substratum structure and water content, that of rotifers remained unexplained. Unlike the other two groups, testate amoeba assemblages were significantly determined by phosphates. Nitrates and iron were important species composition determinants for diatoms. Rotifers differed from the other groups in that they did not respond significantly to silica, iron or nutrients. When variation caused by substratum characteristics and water chemistry were partitioned out, testate amoebae were controlled more by substratum, while rotifers and diatoms were controlled more by water chemistry. Variation explained by individual effects of substratum or water chemistry, as compared to shared effects, was much lower for rotifers than for testate amoebae and diatoms. Our results show that, in semi-terrestrial ecosystems, pH and calcium concentrations are generally the main drivers of variation in species composition of unicellular and multicellular microorganisms, mirroring well described patterns for macro-organisms, providing support for general ecological hypotheses. Other water chemistry variables differed between

  16. Catecholamines in Entamoebae: recent (re)discoveries

    Indian Academy of Sciences (India)

    Dan Eichinger; Alida Coppi; Jesse Frederick; Salim Merali

    2002-11-01

    Free-living and enteric amoebae have similar two-stage life cycles, and both organisms depend on being able to monitor environmental conditions to determine whether to continue multiplying as trophozoites, or to differentiate into dormant or transmissible cysts. Conditions that support high trophozoite densities might also be expected to select for mechanisms of information exchange between these cells. We recently determined that trophozoites of at least one species of Entamoeba release and respond to catecholamine compounds during differentiation from the trophozoite stage into the cyst stage. It turns out that this is not an entirely novel finding, as a number of previous studies have demonstrated parts of this story in free-living or enteric amoebae. We briefly review here major points of the previous studies and describe some of our recent results that have extended them.

  17. First Report of Hartmannella keratitis in a Cosmetic Soft Contact Lens Wearer in Iran

    Directory of Open Access Journals (Sweden)

    Hoda Abedkhojasteh

    2013-09-01

    Full Text Available Background: Poor hygiene will provide good condition for corneal infections by opportunistic free-living amoebae (FLA in soft contact lens wearers. In the present study an amoebic keratitis due to Hartmannella has been recognized in a 22-year-old girl with a history of improper soft contact lens use. She had unilateral keratitis on her left eye. Her clinical signs were eye pain, redness, blurred vision and photopho­bia. The round cysts of free-living amoebae were identified in non-nutrient agar medium by light microscopy. These cysts were suspected to be Hartmannella using morphological criteria. A PCR assay has been confirmed that the round cysts were belonged to H. vermiformis.

  18. The epidemiology of Entamoeba histolytica in Mexico City. A pilot survey I.

    Science.gov (United States)

    Sargeaunt, P G; Williams, J E; Kumate, J; Jimenez, E

    1980-01-01

    Stocks of intestinal amoebae isolated from hospital patients in Mexico City and grown in monoxenic culture were compared among themselves and with those already described (SARGEAUNT & WILLIAMS, 1979), using the electrophoretic patterns of four enzymes: glucose phosphate isomerase (GPI), phosphoglucomutase (PGM), L-malate:NADP+ oxido-reductase (oxalacetate-decarboxylating) (ME) and hexokinase (HK). New isoenzyme groups (SARGEAUNT & WILLIAMS, 1979) of all the amoebae, including Entamoeba histolytica have been demonstrated. Amongst these have been found seven more groups of E. histolytica, two new groups of E. hartmanni, one new group of Dientamoeba fragilis and one new group of E. coli. Of the seven new groups of E. histolytica three are known to originate from patients with clinical amoebiasis whilst the remainder are from asymptomatic subjects. Only 11.2% of the 125 isolations were associated with clinical amoebiasis, and these are clearly distinguished from the isolations from asymptomatic patients by their electrophoretic isoenzyme pattern. PMID:6259779

  19. [Report on a fungus parasitizing Entamoeba histolytica].

    Science.gov (United States)

    Cao, C Q; Feng, Y S

    1989-01-01

    Infection of Entamoeba histolytica with chytridiaceous fungus Sphaerita was observed in some specimens obtained from a farmer and stained with iron-haematoxylin. The fungi were found in 78% of the cysts, mostly immature ones. Within the amoebae this parasite occurred singly, in groups, or in the form of a sporangium. It was located in the cytoplasm, the glycogen mass or the chromatoidal bars. In the same specimen, the parasitic fungus was also found in 18% of E. coli cysts; in 11% of E. nana cysts; while only one of 16 E. hartmanni cysts was parasitized. It is an interesting case of superimposed parasitism so far reported in China as well as a rare case of several species of amoebae being heavily involved with the same in the scientific literature. PMID:2548767

  20. Non-tuberculous mycobacteria and microbial populations in drinking water distribution systems

    Directory of Open Access Journals (Sweden)

    Rossella Briancesco

    2010-01-01

    Full Text Available Data on the occurrence of non-tuberculous mycobacteria (NTM, in parallel with those obtained for bacterial indicators and amoebae, are presented with the aim to collect information on the spread of NTM in drinking water distribution systems in Italy. Samples were collected from taps of hospitals and households in Central and Southern Italy. The concentration values obtained for the more traditional microbial parameters complied with the mandatory requirements for drinking water. Conversely, moderate-to-high microbial loads (till 300 CFU/L were observed for the NTM. Positive samples were obtained from 62% of the investigated water samples. Analogous results were observed for amoebae showing a higher percentage of positive samples (76%. In terms of public health, the presence of mycobacteria in water distribution systems may represent a potential risk especially for vulnerable people such as children, the elderly or immunocompromised individuals.

  1. New technology in laboratory wave test tank

    Energy Technology Data Exchange (ETDEWEB)

    Martins, Joao Alcino de Andrade [Universidade de Sao Paulo (USP), SP (Brazil). Dept. de Engenharia Naval e Oceanica; Osaka University, Suita (Japan). Naval Architects and Ocean Engineers (NAOE); FAPESP-Fundacao de Amparo a Pesquisa do Estado de Sao Paulo (FAPESP), SP (Brazil)

    2008-07-01

    This paper presents a new technology in testing tank for Naval and Ocean Engineering research. This tank is based on active wave makers all around the perimeter concept (AMOEBA -Advanced Multiple Organized Experimental Basin - Naito et al., 1998) creating a wave field similar to open waters conditions. Measurements have shown that the wave field is homogeneous (R.A.O. +10%) inside 45% diameter and can keep irregular wave amplitude and phase more than 20 minutes, for frequencies from 1.6 Hz up to 3.0 Hz. The experimental results for the diffraction force measured is within {+-}2% deviation band among tests and repetitions and within {+-}7% among present tests and those performed 10 years ago. These results of wave elevations and model force measurements have proved the AMOEBA new wave tank concept usefulness and reliability. (author)

  2. Primary amoebic meningoencephalitis: first reported case from Rohtak, North India

    Directory of Open Access Journals (Sweden)

    Naveen Gupta

    2009-06-01

    Full Text Available A fatal case of primary amoebic encephalitis (PAM in a 20 year old boy, a proven case of acute leukemic leukemia (ALL type L2, in remission is described. No history of swimming could be elicited. The clinical presentation, the isolation of the amoeba from the cerebrospinal fluid (CSF, the poor response to amphotericin B, and the ultimately fatal outcome are all consistent with the diagnosis of PAM. On the basis of its ability to grow at temperature 42ºC and 45ºC, morphology of trophozoite, and the presence of flagellate forms in CSF, the amoeba was identified as Naegleria fowleri. Other drugs used in combination with amphotericin B are tetracycline, rifampicin, and miconazole. A possibility of PAM should always be considered in all cases of acute purulent meningoencephalitis in which no bacteria or fungus are found.

  3. Dicty_cDB: Contig-U15517-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1.6 2 ( FE232126 ) CAPG1586.fwd CAPG Naegleria gruberi amoeba stage ... 32 1.6 4 ( AC115612 ) Dictyostelium disco...3, 3' ... 38 2.4 3 ( FE261861 ) CAZO2260.fwd CAZO Naegleria gruberi Flagellate St... 34 2.5 3 ( BJ354590 ) Dictyostelium disco...nus cDNA... 38 8.0 2 ( FE236533 ) CAPG3936.rev CAPG Naegleria gruberi amoeba stage ... 40 8.0 2 ( AC116956 ) Dictyostelium disco...sta Subtracted E... 44 0.18 2 ( AF362373 ) Dictyostelium discoideum histidine kinase DhkL (d... 34 0.18 5 ( DL131077 ) Bax-res...oideum kinesin family member 6 ... 38 0.75 4 ( AC115684 ) Dictyostelium disco

  4. [Molecular diagnosis of a fatal primary amoebic meningoencephalitis in Guadeloupe (French West Indies)].

    Science.gov (United States)

    Nicolas, M; De Jonckheere, J F; Pernin, P; Bataille, H; Le Bris, V; Herrmann-Storck, C

    2010-02-01

    We report the first case of primary amoebic meningoencephalitis in a 9-year-old boy in Guadeloupe. The outcome was rapidly fatal in 7 days. The patient presumably acquired the infection by swimming and diving in a basin supplied by natural thermal water 1 week before onset of the disease. The possibility of a free-living amoeba infection was suspected both on the negativity of all bacterial and viral initial tests and on the observation of peculiar cells in stained cerebrospinal fluid samples. Although the amoeba was not isolated, Naegleria fowleri could be identified by polymerase chain reaction with specific primers on DNA extracted from frozen cerebrospinal fluid samples. Furthermore, as the internal transcribed spacer (ITS1) region of DNA is variable in length between the different strains of N. fowleri, sequencing of the amplified ITS1 demonstrated that the responsible N. fowleri strain belongs to a common genotype present in the American and European continent. PMID:20099054

  5. Viral metagenomics: are we missing the giants?

    Science.gov (United States)

    Halary, S; Temmam, S; Raoult, D; Desnues, C

    2016-06-01

    Amoeba-infecting giant viruses are recently discovered viruses that have been isolated from diverse environments all around the world. In parallel to isolation efforts, metagenomics confirmed their worldwide distribution from a broad range of environmental and host-associated samples, including humans, depicting them as a major component of eukaryotic viruses in nature and a possible resident of the human/animal virome whose role is still unclear. Nevertheless, metagenomics data about amoeba-infecting giant viruses still remain scarce, mainly because of methodological limitations. Efforts should be pursued both at the metagenomic sample preparation level and on in silico analyses to better understand their roles in the environment and in human/animal health and disease. PMID:26851442

  6. A multipole-based water potential with implicit polarization for biomolecular simulations.

    Science.gov (United States)

    Walsh, T R; Liang, T

    2009-04-30

    A new water potential, DMIP (distributed multipoles, implicit polarization), is constructed using distributed multipoles to describe the electrostatic interactions, while accounting for polarization implicitly. In this procedure, small clusters are randomly sampled from atomistic simulations of bulk water using the AMOEBA (Ren and Ponder, J Comput Chem 2002, 23, 1497) potential. The multipole moments of the central water in each cluster are obtained from ab initio densities for each cluster, and the moments are then averaged over all clusters. Properties of bulk water calculated using DMIP compare favorably with existing data from AMOEBA simulations and experiment, with a conservative estimate of reduction in compute time of roughly 40%. The implicit force-field is also shown to work compatibly with existing polarizable multipole-based force-fields for biomolecules. PMID:18785240

  7. Novel Path Towards Colistin Resistance In Pseudomonas Aeruginosa During Chronic Infection Involves Polymorphisms In Uncharacterized Glycosyltransferase Gene

    DEFF Research Database (Denmark)

    Hermansen, Grith Miriam Maigaard; Jelsbak, Lars

    2015-01-01

    Introduction: Antibiotic resistance development in the gram-negative bacterium Pseudomonas aeruginosa is an increasing problem. The effect of colistin, one of the few last resort drugs commonly given to cystic fibrosis (CF) patients, is dependent on the lipopolysaccharide (LPS) structure. We have...... identified a novel gene cluster, which is involved in colistin susceptibility in chronically infecting P. aeruginosa strains. The gene cluster contains two uncharacterized glycosyltransferases and a gene of unknown function. During chronic infection of CF patients one of the glycosyltransferase genes is...... inhibitory concentration by microbroth dilution, virulence in an amoebae model and LPS structure by visualization in a silver-stained gel. Results: Reversion of the SNP to reference genotype resulted in increased colistin susceptibility, reduced virulence in an amoebae model and altered LPS structure. The...

  8. Lack of ecological context can create the illusion of social success in Dictyostelium discoideum

    CERN Document Server

    Martinez-Garcia, Ricardo

    2016-01-01

    Studies of cooperation in microbes often focus on one fitness component, with little information about or attention to the ecological context, and this can lead to paradoxical results. The life cycle of the social amoeba Dictyostelium discoideum includes a multicellular stage in which not necessarily clonal amoebae aggregate upon starvation to form a possibly chimeric (genetically heterogeneous) fruiting body made of dead stalk and spores. The lab-measured reproductive skew in the spores of chimeras indicates strong social antagonism; this should result in low genotypic diversity, which is inconsistent with observations from nature. Two studies have suggested that this inconsistency stems from the one-dimensional assessment of fitness (spore production) and that the solution lies in tradeoffs between multiple traits, e.g.: spore size versus viability; and staying vegetative versus becoming dormant. We theoretically explore different tradeoff-implementing mechanisms and provide a unifying ecological framework ...

  9. Accurate Evaluation of Ion Conductivity of the Gramicidin A Channel Using a Polarizable Force Field without Any Corrections.

    Science.gov (United States)

    Peng, Xiangda; Zhang, Yuebin; Chu, Huiying; Li, Yan; Zhang, Dinglin; Cao, Liaoran; Li, Guohui

    2016-06-14

    Classical molecular dynamic (MD) simulation of membrane proteins faces significant challenges in accurately reproducing and predicting experimental observables such as ion conductance and permeability due to its incapability of precisely describing the electronic interactions in heterogeneous systems. In this work, the free energy profiles of K(+) and Na(+) permeating through the gramicidin A channel are characterized by using the AMOEBA polarizable force field with a total sampling time of 1 μs. Our results indicated that by explicitly introducing the multipole terms and polarization into the electrostatic potentials, the permeation free energy barrier of K(+) through the gA channel is considerably reduced compared to the overestimated results obtained from the fixed-charge model. Moreover, the estimated maximum conductance, without any corrections, for both K(+) and Na(+) passing through the gA channel are much closer to the experimental results than any classical MD simulations, demonstrating the power of AMOEBA in investigating the membrane proteins. PMID:27171823

  10. Searching Simkania negevensis in environmental waters.

    Science.gov (United States)

    Pérez, Leonardo Martín; Codony, Francesc; Ríos, Karina; Peñuela, Gustavo; Adrados, Bárbara; Fittipaldi, Mariana; de Dios, Gregori; Morató, Jordi

    2012-01-01

    Simkania negevensis is an obligate intracellular bacterium grouped into the order Chlamydiales. This new amoeba-resistant bacterium represents a novel aetiologic agent of bronchiolitis and community-acquired pneumonia in both adults and children. It has been suggested that Simkania could be an ubiquitous microorganism presented in water environments. In the natural history of infections with amoeba-related bacteria encountered in aquatic habitats, the transmissions by environmental aerosols or contaminated water/air systems have been extensively recognized. Therefore, understanding the feasibility of Simkania infection by these or similar routes is relevant. In the present work, we investigated the prevalence of this novel disease-associated microorganism in water samples from different sources by real-time PCR (qPCR). Our results show Simkania detection in 5 of 185 water analyzed samples (2.7%: 2 of 88 cooling towers and 3 of 8 waste water samples). However, no Simkania was detected in a drinking water. PMID:22135095

  11. Systemic acanthamoebiasis associated with canine distemper in dogs in the semiarid region of Paraíba, Brazil

    Directory of Open Access Journals (Sweden)

    Maria T.S. Frade

    2015-02-01

    Full Text Available Infections by free-living amoebae can cause systemic disease in animals and humans. We describe the epidemiological, clinical and pathological aspects of disseminated acanthamoebiasis associated with canine distemper in three dogs of the semiarid region of Paraíba, Northeastern Brazil. Affected dogs developed progressive neurological and respiratory signs that progressed to death within in two to 20 days. Gross lesions were irregular and with yellow-reddish nodules randomly distributed in the lungs, heart, kidneys, spleen, lymph nodes, adrenals, and intestine. One dog had foci of malacia in the parietal cortex and another one in nucleus of brain basis. Histologically, pyogranulomas with areas of necrosis and hemorrhage in all organs affected were observed, associated with myriads of intralesional amoebic trophozoites. All three cases were concomitant canine distemper, that possibly triggered immunosuppression in the dogs. The diagnosis was performed through microscopic findings of infection by free-living amoebae and confirmed Acanthamoeba sp. by immunohistochemistry

  12. Effects of industrial chemicals and radioactive materials in biological systems

    International Nuclear Information System (INIS)

    Much has been written on the effects of radiation and toxic chemicals on biological systems. In this communication general considerations regarding these topics will be discussed very briefly; the major emphasis will be focused on the effects of chemicals, namely ethyl methane sulfonate (EMS) on Amoeba, Advantages to the use of amoeba for studying the effects of radiation and chemicals include the following: large mononucleate unicellular organisms having a long generation time; opportunity to study cellular organelles and biochemical and genetic alterations in a single cell system; and a long cell cycle, the stages of which can be synchronized without resorting to chemical treatment or temperature shock and thereby readily permitting study at defined stages of the cell's life cycle. This, in turn, is discussed in light of current disposal methods for this type of waste and how it might be safely disposed of

  13. Entamoeba histolytica cysteine proteases cleave the MUC2 mucin in its C-terminal domain and dissolve the protective colonic mucus gel

    OpenAIRE

    Lidell, Martin E.; Moncada, Darcy M.; Chadee, Kris; Hansson, Gunnar C.

    2006-01-01

    In order for the protozoan parasite Entamoeba histolytica (E.h.) to cause invasive intestinal and extraintestinal infection, which leads to significant morbidity and mortality, it must disrupt the protective mucus layer by a previously unknown mechanism. We hypothesized that cysteine proteases secreted from the amoeba disrupt the mucin polymeric network, thereby overcoming the protective mucus barrier. The MUC2 mucin is the major structural component of the colonic mucus gel. Heavily O-glycos...

  14. How a Sphagnum fuscum-dominated bog changed into a calcareous fen: the unique Holocene history of a Slovak spring-fed mire

    OpenAIRE

    Hajkova, Petra; Grootjans, A. B.; Lamentowicz, Mariusz; Rybnickova, Eliska; Madaras, Mikulas; Opravilova, Vera; Michaelis, Dierk; Hajek, Michal; Joosten, Hans; Wolejko, Leslaw; Rybníčková, Eliška; Madaras, Mikuláš; Opravilová, Věra; Wołejko, Lesław; Hajkova, T.

    2012-01-01

    In general, mires develop by autogenic succession from more groundwater-fed to more rainwater-fed. This study from a calcareous mire in the West Carpathians (Slovakia) describes a similar development in the Early Holocene, followed by a reverse development in the Middle and Late Holocene. Pollen, macrofossil and testate amoeba analyses show that the site started as a minerotrophic open fen woodland. After 10 700 cal a BP autogenic succession led to the accumulation of at least 1 m of Sphagnum...

  15. Segregate or cooperate- a study of the interaction between two species of Dictyostelium

    OpenAIRE

    Jones Emily I; Mehdiabadi Natasha J; Ridgeway Julia G; Jack Chandra N; Edwards Tracy A; Queller David C; Strassmann Joan E.

    2008-01-01

    Abstract Background A major challenge for evolutionary biology is explaining altruism, particularly when it involves death of one party and occurs across species. Chimeric fruiting bodies of Dictyostelium discoideum and Dictyostelium purpureum develop from formerly independent amoebae, and some die to help others. Here we examine co-aggregation between D. discoideum and D. purpureum, determine its frequency and which party benefits, and the extent of fair play in contribution to the altruisti...

  16. Polarizable atomic multipole X-ray refinement: application to peptide crystals

    OpenAIRE

    Schnieders, Michael J.; Fenn, Timothy D.; Pande, Vijay S.; Brunger, Axel T.

    2009-01-01

    Recent advances in computational chemistry have produced force fields based on a polarizable atomic multipole description of biomolecular electrostatics. In this work, the Atomic Multipole Optimized Energetics for Biomolecular Applications (AMOEBA) force field is applied to restrained refinement of molecular models against X-ray diffraction data from peptide crystals. A new formalism is also developed to compute anisotropic and aspherical structure factors using fast Fourier transformation (F...

  17. Systemic acanthamoebiasis associated with canine distemper in dogs in the semiarid region of Paraíba, Brazil

    OpenAIRE

    Maria T.S. Frade; Luiza F. de Melo; Clarice R.M Pessoa; Jeann L. de Araújo; Rafael A Fighera; Almir P. Souza; Francisco Uzal; Antonio F.M. Dantas

    2015-01-01

    Infections by free-living amoebae can cause systemic disease in animals and humans. We describe the epidemiological, clinical and pathological aspects of disseminated acanthamoebiasis associated with canine distemper in three dogs of the semiarid region of Paraíba, Northeastern Brazil. Affected dogs developed progressive neurological and respiratory signs that progressed to death within in two to 20 days. Gross lesions were irregular and with yellow-reddish nodules randomly distributed in the...

  18. Molecular pharmacology in a simple model system: Implicating MAP kinase and phosphoinositide signalling in bipolar disorder

    OpenAIRE

    Ludtmann, Marthe H. R.; Boeckeler, Katrina; Williams, Robin S.B.

    2011-01-01

    Understanding the mechanisms of drug action has been the primary focus for pharmacological researchers, traditionally using rodent models. However, non-sentient model systems are now increasingly being used as an alternative approach to better understand drug action or targets. One of these model systems, the social amoeba Dictyostelium, enables the rapid ablation or over-expression of genes, and the subsequent use of isogenic cell culture for the analysis of cell signalling pathways in pharm...

  19. Introduction of Monochloramine into a Municipal Water System: Impact on Colonization of Buildings by Legionella spp.

    OpenAIRE

    Moore, Matthew R.; Pryor, Marsha; Fields, Barry; Lucas, Claressa; Phelan, Maureen; Besser, Richard E.

    2006-01-01

    Legionnaires' disease (LD) outbreaks are often traced to colonized potable water systems. We collected water samples from potable water systems of 96 buildings in Pinellas County, Florida, between January and April 2002, during a time when chlorine was the primary residual disinfectant, and from the same buildings between June and September 2002, immediately after monochloramine was introduced into the municipal water system. Samples were cultured for legionellae and amoebae using standard me...

  20. Coupling of cytoskeleton functions for fibroblast locomotion

    DEFF Research Database (Denmark)

    Couchman, J R; Lenn, M; Rees, D A

    1985-01-01

    Using a chick cell phenotype specialised for locomotion with morphometric measurements made possible by modern instrumentation technology, we have reinvestigated motile functions in fibroblast locomotion. Quantitative analysis of rapid fluctuations in cell form and organelle distribution during l...... function of microtubules to direct the flow towards multiple foci on the leading edge, and so determine cell polarity. Such a mechanism of locomotion for fibroblasts has many features consistent with evidence for other cell types, especially amoebae and leukocytes....

  1. New data on aetiology of nodular gill disease in rainbow trout, Oncorhynchus mykiss

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Kostka, Martin; Wortberg, F.; Nardy, E.; Pecková, Hana

    2010-01-01

    Roč. 57, č. 3 (2010), s. 157-163. ISSN 0015-5683 R&D Projects: GA ČR GA524/09/0137; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : nodular gill disease * aetiological study * amoeba e * Naegleria sp. * fish diseases * aquaculture * Oncorhynchus mykiss Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 1.533, year: 2010

  2. Didymium-like myxogastrids (class Mycetozoa) as endocommensals of sea urchins (Sphaerechinus granularis)

    Czech Academy of Sciences Publication Activity Database

    Dyková, Iva; Lom, Jiří; Dvořáková, Helena; Pecková, Hana; Fiala, Ivan

    2007-01-01

    Roč. 54, č. 1 (2007), s. 1-12. ISSN 0015-5683 R&D Projects: GA ČR GA206/05/2384; GA MŠk LC522 Institutional research plan: CEZ:AV0Z60220518 Keywords : Didymium-like myxogastrids * Myxogastrea * sea-urchin amoeba strains * SSU rDNA * flagellar apparatus * phylogeny Subject RIV: EA - Cell Biology Impact factor: 1.000, year: 2007

  3. Solvation structure and dynamics of Ni{sup 2+}(aq) from a polarizable force field

    Energy Technology Data Exchange (ETDEWEB)

    Mareš, Jiří, E-mail: jiri.mares@oulu.fi; Vaara, Juha

    2014-10-31

    Highlights: • We parameterize the Ni{sup 2+} ion within the AMOEBA polarizable forcefield. • Besides vdW parameters, we fit also polarizability, Thole damping and charge. • We use an empirical adjustment to account for the transition into condensed phase. • Very good structural and dynamical properties of Ni{sup 2+}(aq) are demonstrated. - Abstract: An aqueous solution of Ni{sup 2+} has often been used as a prototypic transition-metal system for experimental and theoretical studies in nuclear and electron-spin magnetic resonance (NMR and ESR). Molecular dynamics (MD) simulation of Ni{sup 2+}(aq) has been a part of many of these studies. As a transition metal complex, its MD simulation is particularly difficult using common force fields. In this work, we parameterize the Ni{sup 2+} ion for a simulation of the aqueous solution within the modern polarizable force field AMOEBA. We show that a successful parameterization is possible for this specific case when releasing the physical interpretation of the electrostatic and polarization parameters of the force field. In doing so, particularly the Thole damping parameter and also the ion charge and polarizability were used as fitting parameters. The resulting parameterizations give in a MD simulation good structural and dynamical properties of the [Ni(H{sub 2}O){sub 6}]{sup 2+} complex, along with the expected excellent performance of AMOEBA for the water solvent. The presented parameterization is appropriate for high-accuracy simulations of both structural and dynamic properties of Ni{sup 2+}(aq). This work documents possible approaches of parameterization of a transition metal within the AMOEBA force field.

  4. Properties of Solutions for a Nonlinear Parabolic-Elliptic System Modelling Chemotaxis

    Institute of Scientific and Technical Information of China (English)

    钟新华

    2002-01-01

    @@ In 1970 Keller and Segel[1] proposed a mathematical model describing chemotactic aggregation of cellular slime molds which move preferentially towards relatively high concentraions of a chemical secreted by the amoebae themselves. With the cell density of the cellular slime molds u(x, t) and the concentration of the chemical substance v(x, t) at place x and time t, a simplified Keller-Segel model is described as the system

  5. Plant hairy root cultures as plasmodium modulators of the slime mold emergent computing substrate Physarum polycephalum

    OpenAIRE

    Vincent eRicigliano; Javed eChitaman; Jingjing eTong; Andrew eAdamatzky; Howarth, Dianella G.

    2015-01-01

    Roots of the medicinal plant Valeriana officinalis are well studied for their various biological activities. We applied genetically transformed V. officinalis root cultures to exert control of Physarum polycephalum, an amoeba-based emergent computing substrate. The plasmodial stage of the P. polycephalum life cycle constitutes a single, multinucleate cell visible by unaided eye. The plasmodium modifies its network of oscillating protoplasm in response to spatial configurations of attractants ...

  6. Plant hairy root cultures as plasmodium modulators of the slime mold emergent computing substrate Physarum polycephalum

    OpenAIRE

    Ricigliano, Vincent; Chitaman, Javed; Tong, Jingjing; Adamatzky, Andrew; Howarth, Dianella G.

    2015-01-01

    Roots of the medicinal plant Valeriana officinalis are well-studied for their various biological activities. We applied genetically transformed V. officinalis root biomass to exert control of Physarum polycephalum, an amoeba-based emergent computing substrate. The plasmodial stage of the P. polycephalum life cycle constitutes a single, multinucleate cell visible by unaided eye. The plasmodium modifies its network of oscillating protoplasm in response to spatial configurations of attractants a...

  7. Dictyostelium discoideum: a model for testing novel inhibitors of urokinase-type plasminogen activator

    OpenAIRE

    Thompson, Elinor

    2013-01-01

    The social amoeba Dictyostelium discoideum is a useful non-animal eukaryote for testing novel compounds and dissecting cell regulatory molecular networks. We used this model organism to investigate the effect of a series of arylboronic acids and pinacol esters on development, chemotaxis and viability. These compounds were studied in parallel by collaborators for serine protease and urokinase-type plasminogen activator (uPA) inhibition, both in vitro and in vivo. In those biochemical assays, t...

  8. Acanthamoeba castellanii induces host cell death via a phosphatidylinositol 3-kinase-dependent mechanism

    OpenAIRE

    Sissons, James; Kim, Kwang Sik; Stins, Monique; Jayasekera, Samantha; Alsam, Selwa; Khan, Naveed Ahmed

    2005-01-01

    Granulomatous amoebic encephalitis due to Acanthamoeba castellanii is a serious human infection with fatal consequences, but it is not clear how the circulating amoebae interact with the blood-brain barrier and transmigrate into the central nervous system. We studied the effects of an Acanthamoeba encephalitis isolate belonging to the T1 genotype on human brain microvascular endothelial cells, which constitute the blood-brain barrier. Using an apoptosis-specific enzyme-linked immunosorbent as...

  9. An update on Acanthamoeba keratitis: diagnosis, pathogenesis and treatment

    OpenAIRE

    Lorenzo-Morales Jacob; Khan Naveed A.; Walochnik Julia

    2015-01-01

    Free-living amoebae of the genus Acanthamoeba are causal agents of a severe sight-threatening infection of the cornea known as Acanthamoeba keratitis. Moreover, the number of reported cases worldwide is increasing year after year, mostly in contact lens wearers, although cases have also been reported in non-contact lens wearers. Interestingly, Acanthamoeba keratitis has remained significant, despite our advances in antimicrobial chemotherapy and supportive care. In part, this is due to an inc...

  10. Acanthamoeba spp. in Contact Lenses from Healthy Individuals from Madrid, Spain

    OpenAIRE

    Gomes, Thiago dos Santos; Magnet, Angela; Izquierdo, Fernando; Vaccaro, Lucianna; Redondo, Fernando; Bueno, Sara; Sánchez, Maria Luisa; Angulo, Santiago; Fenoy, Soledad; Hurtado, Carolina; del Aguila, Carmen

    2016-01-01

    Purpose Acanthamoeba keratitis (AK) is a painful and potentially blinding corneal infection caused by Acanthamoeba spp. In Madrid, environmental studies have demonstrated a high presence of these free-living amoebae in tap water. Since most of AK cases occur in contact lenses (CL) wearers with inadequate hygiene habits, the presence of Acanthamoeba in discarded CL has been studied and compared with other common etiological agents of keratitis, such as Pseudomonas aeruginosa and Staphylococcus...

  11. Effect of Temperature and Prey Availability on Growth of Paramoeba invadens in Monoxenic Culture

    OpenAIRE

    Jellett, Joanne F.; Scheibling, Robert E.

    1988-01-01

    Paramoeba invadens Jones 1985 is a pathogenic marine amoeba responsible for mass mortalities of sea urchins (Strongylocentrotus droebachiensis) of Nova Scotia between 1980 and 1983. A direct relationship between temperature and sea urchin paramoebiasis has been shown in previous laboratory and field studies. This study examined the effect of prey availability and temperature on the growth of P. invadens in monoxenic culture (with the marine bacterium Pseudomonas nautica). At 15°C, the specifi...

  12. Rapid Detection and Enumeration of Naegleria fowleri in Surface Waters by Solid-Phase Cytometry

    OpenAIRE

    Pougnard, Claire; Catala, Philippe; Drocourt, Jean-Louis; Legastelois, Stephane; Pernin, Pierre; Pringuez, Emmanuelle; Lebaron, Philippe

    2002-01-01

    A new method for the rapid and accurate detection of pathogenic Naegleria fowleri amoebae in surface environmental water was developed. The method is based on an immunofluorescent assay combined with detection by solid-phase cytometry. In this study we developed and compared two protocols using different reporter systems conjugated to antibodies. The monoclonal antibody Ac5D12 was conjugated with biotin and horseradish peroxidase, and the presence of cells was revealed with streptavidin conju...

  13. Use of monoclonal antibodies to distinguish pathogenic Naegleria fowleri (cysts, trophozoites, or flagellate forms) from other Naegleria species.

    OpenAIRE

    Sparagano, O.; Drouet, E.; Brebant, R; Manet, E; Denoyel, G A; Pernin, P.

    1993-01-01

    Monoclonal antibodies (MAbs) reactive to the pathogenic amoeba Naegleria fowleri were analyzed by enzyme-linked immunosorbent assay (ELISA), indirect immunofluorescence assay, Western blotting (immunoblotting), and radioimmunoprecipitation assay (RIPA). Two MAbs (3A4 and 5D12) showed reactivity by ELISA with all N. fowleri strains tested and no reactivity with the five other Naegleria species, N. lovaniensis, N. gruberi, N. australiensis, N. jadini, and N. andersoni. These MAbs reacted with t...

  14. Virulence phenotypes of Legionella pneumophila associated with noncoding RNA lpr0035.

    Science.gov (United States)

    Jayakumar, Deepak; Early, Julie V; Steinman, Howard M

    2012-12-01

    The Philadelphia-1 strain of Legionella pneumophila, the causative organism of Legionnaires' disease, contains a recently discovered noncoding RNA, lpr0035. lpr0035 straddles the 5' chromosomal junction of a 45-kbp mobile genetic element, pLP45, which can exist as an episome or integrated in the bacterial chromosome. A 121-bp deletion was introduced in strain JR32, a Philadelphia-1 derivative. The deletion inactivated lpr0035, removed the 49-bp direct repeat at the 5' junction of pLP45, and locked pLP45 in the chromosome. Intracellular multiplication of the deletion mutant was decreased by nearly 3 orders of magnitude in Acanthamoeba castellanii amoebae and nearly 2 orders of magnitude in J774 mouse macrophages. Entry of the deletion mutant into amoebae and macrophages was decreased by >70%. The level of entry in both hosts was restored to that in strain JR32 by plasmid copies of two open reading frames immediately downstream of the 5' junction and plasmid lpr0035 driven by its endogenous promoter. When induced from a tac promoter, plasmid lpr0035 completely reversed the intracellular multiplication defect in macrophages but was without effect in amoebae. These data are the first evidence of a role for noncoding RNA lpr0035, which has homologs in six other Legionella genomes, in entry of L. pneumophila into amoebae and macrophages and in host-specific intracellular multiplication. The data also demonstrate that deletion of a direct-repeat sequence restricts the mobility of pLP45 and is a means of studying the role of pLP45 mobility in Legionella virulence phenotypes. PMID:22966048

  15. GxcDD, a putative RacGEF, is involved in Dictyostelium development

    OpenAIRE

    Rivero Francisco; Neelamegan Dhamodharan; Mondal Subhanjan; Noegel Angelika A

    2007-01-01

    Abstract Background Rho subfamily GTPases are implicated in a large number of actin-related processes. They shuttle from an inactive GDP-bound form to an active GTP-bound form. This reaction is catalysed by Guanine nucleotide exchange factor (GEFs). GTPase activating proteins (GAPs) help the GTPase return to the inactive GDP-bound form. The social amoeba Dictyostelium discoideum lacks a Rho or Cdc42 ortholog but has several Rac related GTPases. Compared to our understanding of the downstream ...

  16. Detection of Balamuthia mandrillaris DNA by real-time PCR targeting the RNase P gene

    OpenAIRE

    Lewin Astrid; Radam Elke; Kiderlen Albrecht F

    2008-01-01

    Abstract Background The free-living amoeba Balamuthia mandrillaris may cause fatal encephalitis both in immunocompromised and in – apparently – immunocompetent humans and other mammalian species. Rapid, specific, sensitive, and reliable detection requiring little pathogen-specific expertise is an absolute prerequisite for a successful therapy and a welcome tool for both experimental and epidemiological research. Results A real-time polymerase chain reaction assay using TaqMan® probes (real-ti...

  17. Potential role of bacteria packaging by protozoa in the persistence and transmission of pathogenic bacteria

    OpenAIRE

    Alix M Denoncourt; Paquet, Valérie E.; Charette, Steve J.

    2014-01-01

    Many pathogenic bacteria live in close association with protozoa. These unicellular eukaryotic microorganisms are ubiquitous in various environments. A number of protozoa such as amoebae and ciliates ingest pathogenic bacteria, package them usually in membrane structures, and then release them into the environment. Packaged bacteria are more resistant to various stresses and are more apt to survive than free bacteria. New evidence indicates that protozoa and not bacteria control the packaging...

  18. Molecular comparison of cultivable protozoa from a pristine and a polycyclic aromatic hydrocarbon polluted site

    OpenAIRE

    Lara, Enrique; Berney, Cédric; Ekelund, Flemming; Harms, Hauke; Chatzinotas, Antonis

    2010-01-01

    We compared the abundance and diversity of cultivable protozoa (flagellates and amoebae) in a polycyclic aromatic hydrocarbon (PAH) polluted soil and an unpolluted control, by isolating and cultivating clonal strains. The number of cultivable protozoa was higher in the polluted soil; however, the polluted soil displayed an impoverished community, dominated by certain taxa, such as Acanthamoeba sp. We isolated a total of 31 protozoan strains to characterize them morphologically and by 18S rRNA...

  19. Gradient sensing in defined chemotactic fields

    OpenAIRE

    Skoge, Monica; Adler, Micha; Groisman, Alex; Levine, Herbert; Loomis, William F.; Rappel, Wouter-Jan

    2010-01-01

    Cells respond to a variety of secreted molecules by modifying their physiology, growth patterns, and behavior. Motile bacteria and eukaryotic cells can sense extracellular chemoattractants and chemorepellents and alter their movement. In this way fibroblasts and leukocytes can find their ways to sites of injury and cancer cells can home in on sites that are releasing growth factors. Social amoebae such as Dictyostelium are chemotactic to cAMP which they secrete several hours after they have i...

  20. A bacterial symbiont is converted from an inedible producer of beneficial molecules into food by a single mutation in the gacA gene

    OpenAIRE

    Stallforth, Pierre; Brock, Debra A.; Cantley, Alexandra M.; Tian, Xiangjun; Queller, David C; Strassmann, Joan E.; Clardy, Jon

    2013-01-01

    Stable multipartite mutualistic associations require that all partners benefit. We show that a single mutational step is sufficient to turn a symbiotic bacterium from an inedible but host-beneficial secondary metabolite producer into a host food source. The bacteria’s host is a “farmer” clone of the social amoeba Dictyostelium discoideum that carries and disperses bacteria during its spore stage. Associated with the farmer are two strains of Pseudomonas fluorescens, only one of which serves a...

  1. Theoretical study of the hydrated Gd3+ ion: Structure, dynamics, and charge transfer

    OpenAIRE

    Clavaguéra, C.; Calvo, Florent; Dognon, J.-P.

    2006-01-01

    The dynamical processes taking place in the first coordination shells of the gadolinium (III) ion are important for improving the contrast agent efficiency in magnetic-resonance imaging. An extensive study of the gadolinium (III) ion solvated by a water cluster is reported, based on molecular dynamics simulations. The AMOEBA force field [P. Y. Ren and J. W. Ponder, J. Phys. Chem. B 107, 5933 (2003)] that includes many-body polarization effects is used to describe the interactions among water ...

  2. Modelling the structure and IR spectra of micro-hydrated ions

    OpenAIRE

    Jana, Chandramohan

    2014-01-01

    Ion micro-hydration has been modeled by a combination of classical and quantum methods. The structures, dynamics and IR spectra of micro-hydrated cluster ions ranging from 1 to 216 water molecules have been considered with special emphasis on the comparison to recent experimental data. Quantum modeling has been used to provide reference values against which the polarizable AMOEBA force field could be calibrated. Extension of the parameter set was carried out in some cases, in particular when ...

  3. Molecular Dynamics of β-Hairpin Models of Epigenetic Recognition Motifs

    OpenAIRE

    Zheng, Xiange; Wu, Chuanjie; Ponder, Jay W.; Marshall, Garland R.

    2012-01-01

    The conformations and stabilities of the β-hairpin model peptides of Waters1,2 have been experimentally characterized as a function of lysine ε-methylation. These models were developed to explore molecular recognition of known epigenetic recognition motifs. This system offered an opportunity to computationally examine the role of cation-π interactions, desolvation of the ε-methylated ammonium groups, and aromatic/aromatic interactions on the observed differences in NMR spectra. AMOEBA, a seco...

  4. Hydration Free Energy from Orthogonal Space Random Walk and Polarizable Force Field

    OpenAIRE

    Abella, Jayvee R.; Cheng, Sara Y.; Wang, Qiantao; Yang, Wei; Ren, Pengyu

    2014-01-01

    The orthogonal space random walk (OSRW) method has shown enhanced sampling efficiency in free energy calculations from previous studies. In this study, the implementation of OSRW in accordance with the polarizable AMOEBA force field in TINKER molecular modeling software package is discussed and subsequently applied to the hydration free energy calculation of 20 small organic molecules, among which 15 are positively charged and five are neutral. The calculated hydration free energies of these ...

  5. Polarization and Charge Transfer in the Hydration of Chloride Ions

    OpenAIRE

    Zhao, Zhen; Rogers, David M.; Beck, Thomas L.

    2009-01-01

    A theoretical study of the structural and electronic properties of the chloride ion and water molecules in the first hydration shell is presented. The calculations are performed on an ensemble of configurations obtained from molecular dynamics simulations of a single chloride ion in bulk water. The simulations utilize the polarizable AMOEBA force field for trajectory generation, and MP2-level calculations are performed to examine the electronic structure properties of the ions and surrounding...

  6. Quasi-Chemical and Structural Analysis of Polarizable Anion Hydration

    OpenAIRE

    Rogers, David M.; Beck, Thomas L.

    2009-01-01

    Quasi-chemical theory is utilized to analyze the roles of solute polarization and size in determining the structure and thermodynamics of bulk anion hydration for the Hofmeister series Cl$^-$, Br$^-$, and I$^-$. Excellent agreement with experiment is obtained for whole salt hydration free energies using the polarizable AMOEBA force field. The quasi-chemical approach exactly partitions the solvation free energy into inner-shell, outer-shell packing, and outer-shell long-ranged contributions by...

  7. Investigation of Multipole Electrostatics in Hydration Free Energy Calculations

    OpenAIRE

    Shi, Yue; Wu, Chuanjie; Ponder, Jay W.; Ren, Pengyu

    2010-01-01

    Hydration free energy (HFE) is generally used for evaluating molecular solubility, which is an important property for pharmaceutical and chemical engineering processes. Accurately predicting HFE is also recognized as one fundamental capability of molecular mechanics force field. Here we present a systematic investigation on HFE calculations with AMOEBA polarizable force field at various parameterization and simulation conditions. The HFEs of seven small organic molecules have been obtained al...

  8. Polarizable Atomic Multipole X-Ray Refinement: Hydration Geometry and Application to Macromolecules

    OpenAIRE

    Fenn, Timothy D.; Schnieders, Michael J; Brunger, Axel T.; Pande, Vijay S.

    2010-01-01

    We recently developed a polarizable atomic multipole refinement method assisted by the AMOEBA force field for macromolecular crystallography. Compared to standard refinement procedures, the method uses a more rigorous treatment of x-ray scattering and electrostatics that can significantly improve the resultant information contained in an atomic model. We applied this method to high-resolution lysozyme and trypsin data sets, and validated its utility for precisely describing biomolecular elect...

  9. Solvation structure and dynamics of Ni2+(aq) from a polarizable force field

    International Nuclear Information System (INIS)

    Highlights: • We parameterize the Ni2+ ion within the AMOEBA polarizable forcefield. • Besides vdW parameters, we fit also polarizability, Thole damping and charge. • We use an empirical adjustment to account for the transition into condensed phase. • Very good structural and dynamical properties of Ni2+(aq) are demonstrated. - Abstract: An aqueous solution of Ni2+ has often been used as a prototypic transition-metal system for experimental and theoretical studies in nuclear and electron-spin magnetic resonance (NMR and ESR). Molecular dynamics (MD) simulation of Ni2+(aq) has been a part of many of these studies. As a transition metal complex, its MD simulation is particularly difficult using common force fields. In this work, we parameterize the Ni2+ ion for a simulation of the aqueous solution within the modern polarizable force field AMOEBA. We show that a successful parameterization is possible for this specific case when releasing the physical interpretation of the electrostatic and polarization parameters of the force field. In doing so, particularly the Thole damping parameter and also the ion charge and polarizability were used as fitting parameters. The resulting parameterizations give in a MD simulation good structural and dynamical properties of the [Ni(H2O)6]2+ complex, along with the expected excellent performance of AMOEBA for the water solvent. The presented parameterization is appropriate for high-accuracy simulations of both structural and dynamic properties of Ni2+(aq). This work documents possible approaches of parameterization of a transition metal within the AMOEBA force field

  10. The evaluation of Computed Tomography hard- and software tools for micropaleontologic studies on foraminifera

    OpenAIRE

    Van Loo, Denis; Speijer, Robert; Masschaele, Bert; Dierick, Manuel; Cnudde, Veerle; Boone, Matthieu; De Witte, Yoni; Dewanckele, Jan; Van Hoorebeke, Luc; Jacobs, Patric

    2009-01-01

    Foraminifera (Forams) are single-celled amoeba-like organisms in the sea, which build a tiny calcareous multi-chambered shell for protection. Their enormous abundance, great variation of shape through time and their presence in all marine deposits made these tiny microfossils the oil companies’ best friend by facilitating the detection of new oil wells. Besides the success of forams in the oil and gas industry, they are also a most powerful tool for reconstructing climate change in the past. ...

  11. A Case of Non-Contact Lens related Acanthamoeba keratitis in Malaysia

    OpenAIRE

    Mohamed Kamel, A. G.; Faridah, H.; Yusof, S; Norazah, A.; Nakisah, M. A.

    2005-01-01

    Acanthamoeba is a ubiquitous free-living amoeba and is responsible for an uncommon yet increasingly diagnosed keratitis in humans. Acanthamoeba keratitis is perhaps the most challenging ocular infection to manage successfully and it can result in permanently impaired vision or blindness. Although contact lens use is the principal risk factor, about 10% of cases occur following trauma and exposure to contaminated soil or water. Cases of Acanthamoeba keratitis involving contact lens wearers hav...

  12. Soil Protists Diversity, Distribution and Ecological Functioning

    OpenAIRE

    Geisen, Stefan

    2014-01-01

    Soil protists occupy key nodes in soil food webs due to their high abundance, fast turnover and functional importance as bacterial grazers. However, methodological drawbacks obscure the knowledge of soil protists, so that many taxa remain unknown. The structure of natural protist communities and taxa-specific ecological functions are also largely unknown. This thesis aims to increase the knowledge on soil protists using a variety of approaches. In the first part, naked amoebae being pres...

  13. Real-time PCR assay in differentiating Entamoeba histolytica, Entamoeba dispar, and Entamoeba moshkovskii infections in Orang Asli settlements in Malaysia

    OpenAIRE

    Lau, Yee Ling; Anthony, Claudia; Fakhrurrazi, Siti Aminah; Ibrahim, Jamaiah; Ithoi, Init; Mahmud, Rohela

    2013-01-01

    Background Amebiasis caused by Entamoeba histolytica is the third leading cause of death worldwide. This pathogenic amoeba is morphologically indistinguishable from E. dispar and E. moshkovskii, the non-pathogenic species. Polymerase chain reaction is the current method of choice approved by World Health Organization. Real-time PCR is another attractive molecular method for diagnosis of infectious diseases as post-PCR analyses are eliminated and turnaround times are shorter. The present work ...

  14. Cooling systems

    International Nuclear Information System (INIS)

    Progress on the thermal effects project is reported with regard to physiology and distribution of Corbicula; power plant effects studies on burrowing mayfly populations; comparative thermal responses of largemouth bass from northern and southern populations; temperature selection by striped bass in Cherokee Reservoir; fish population studies; and predictive thermoregulation by fishes. Progress is also reported on the following; cause and ecological ramifications of threadfin shad impingement; entrainment project; aquaculture project; pathogenic amoeba project; and cooling tower drift project

  15. Distributed computer systems theory and practice

    CERN Document Server

    Zedan, H S M

    2014-01-01

    Distributed Computer Systems: Theory and Practice is a collection of papers dealing with the design and implementation of operating systems, including distributed systems, such as the amoeba system, argus, Andrew, and grapevine. One paper discusses the concepts and notations for concurrent programming, particularly language notation used in computer programming, synchronization methods, and also compares three classes of languages. Another paper explains load balancing or load redistribution to improve system performance, namely, static balancing and adaptive load balancing. For program effici

  16. Entrained rhythmic activities of neuronal ensembles as perceptual memory of time interval

    OpenAIRE

    Sumbre, Germán; Muto, Akira; Baier, Herwig; Poo, Mu-Ming

    2008-01-01

    The ability to process temporal information is fundamental to sensory perception, cognitive processing and motor behaviour of all living organisms, from amoebae to humans1–4. Neural circuit mechanisms based on neuronal and synaptic properties have been shown to process temporal information over the range of tens of microseconds to hundreds of milliseconds5–7. How neural circuits process temporal information in the range of seconds to minutes is much less understood. Studies of working memory ...

  17. A novel nested multiplex polymerase chain reaction (PCR) assay for differential detection of Entamoeba histolytica, E. moshkovskii and E. dispar DNA in stool samples

    OpenAIRE

    Parija Subhash C; Khairnar Krishna

    2007-01-01

    Abstract Background E. histolytica, a pathogenic amoeba, is indistinguishable in its cyst and trophozoite stages from those of non-pathogenic E. moshkovskii and E. dispar by light microscopy. We have developed a nested multiplex PCR targeting a 16S-like rRNA gene for differential detection of all the three morphologically similar forms of E. histolytica, E. moshkovskii and E. dispar simultaneously in stool samples. Results The species specific product size for E. histolytica, E. moshkovskii a...

  18. KAJIAN EPIDEMIOLOGI PENYAKIT INFEKSI SALURAN PENCERNAAN YANG DISEBABKAN OLEH AMUBA DI INDONESIA

    OpenAIRE

    Anorital -; Lelly Andayasari

    2012-01-01

    The intestinal infection caused by amoeba is one of the three diarrhea causes appears to be a public health problem with high incidence in the community. Amebiasis is caused by Entamoeba histolytica, can be differentiated from non pathogen Entamoeba hartmanni and Entamoeba coli. Morphologically of Entamoeba histolytica and Entamoeba dispar are very similar. However, based on the diagnosis utilizing molecular examination technique, in fact, the main cause of amebiasis is Entamoeba dispar. Amoe...

  19. DISTRIBUSI PARASIT USUS PROTOZOA DI KABUPATEN HULU SUNGAI UTARA KALIMANTAN SELATAN

    OpenAIRE

    Anorital Anorital; Dewi, Rita M; Sahat Ompusunggu

    2012-01-01

    The intestinal infection disease caused by protozoa: amoeba is one of the public health problem with high incidence in the community. From the research activity conducted in Hulu Sungai Utara Regency in the year 2002, to obtain of prevalence of protozoa infection from stool examination from resident in 6 villages at 3 subdistrict in Hulu Sungai Utara Regency. The research has conducted to be carry out survey parasite to the community. Sample size will be examination are 230 persons per villag...

  20. Sounds Synthesis with Slime Mould of Physarum Polycephalum

    OpenAIRE

    Miranda, Eduardo R.; Adamatzky, Andrew; Jones, Jeff

    2012-01-01

    Physarum polycephalum is a huge single cell with thousands of nuclei, which behaves like a giant amoeba. During its foraging behaviour this plasmodium produces electrical activity corresponding to different physiological states. We developed a method to render sounds from such electrical activity and thus represent spatio-temporal behaviour of slime mould in a form apprehended by humans. We show to control behaviour of slime mould to shape it towards reproduction of required range of sounds.

  1. Resistance of Dictyostelium discoideum membranes to saponin permeabilization

    OpenAIRE

    Cosson Pierre; Mercanti Valentina

    2010-01-01

    Abstract Background Saponin is a mild detergent commonly used to permeabilize cells prior to immunofluorescence labeling of intracellular proteins. It has previously been used to that effect in Dictyostelium discoideum amoebae. Findings We show that saponin, contrary to Triton X-100 or alcohol, permeabilizes at best incompletely membranes of Dictyostelium. In cells exposed to osmotic stress, almost complete resistance to saponin permeabilization was observed. Conclusions Saponin should be use...

  2. Biosynthesis of Dictyostelium discoideum differentiation-inducing factor by a hybrid type I fatty acid–type III polyketide synthase

    OpenAIRE

    Austin, Michael B; Saito, Tamao; Bowman, Marianne E.; Haydock, Stephen; Kato, Atsushi; Moore, Bradley S.; Kay, Robert R.; Noel, Joseph P.

    2006-01-01

    Differentiation-inducing factors (DIFs) are well known to modulate formation of distinct communal cell types from identical Dictyostelium discoideum amoebas, but DIF biosynthesis remains obscure. We report complimentary in vivo and in vitro experiments identifying one of two ~3,000-residue D. discoideum proteins, termed ‘steely’, as responsible for biosynthesis of the DIF acylphloroglucinol scaffold. Steely proteins possess six catalytic domains homologous to metazoan type I fatty acid syntha...

  3. First Isolation of a Giant Virus from Wild Hirudo medicinalis Leech: Mimiviridae isolation in Hirudo medicinalis

    OpenAIRE

    Mondher Boughalmi; Isabelle Pagnier; Sarah Aherfi; Philippe Colson; Didier Raoult; Bernard La Scola

    2013-01-01

    Giant viruses and amoebae are common in freshwater, where they can coexist with other living multicellular organisms. We screened leeches from the species Hirudo medicinalis for giant viruses. We analyzed five H. medicinalis obtained from Tunisia (3) and France (2). The leeches were decontaminated and then dissected to remove internal parts for co-culture with Acanthamoeba polyphaga. The genomes of isolated viruses were sequenced on a 454 Roche instrument, and a comparative genomics analysis ...

  4. Dicty_cDB: Contig-U12403-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ( FE238027 ) CAPG4655.rev CAPG Naegleria gruberi amoeba stage ... 54 1e-10 4 ( EE009210 ) ROE00005223 Rhizopus oryzae Company...( DV159505 ) KP1B.037J14F.050628T7 KP1B Nicotiana tabacum cDNA... 52 9e-06 2 ( EE005562 ) ROE00012099 Rhizopus oryzae Company...... 56 3e-04 2 ( EE002521 ) ROE00012003 Rhizopus oryzae Company Rhizopus oryz...

  5. The Life History of Flabellula baltica Smirnov (Gymnamoebae, Rhizopoda): Adaptations to a Spatially and Temporally Heterogeneous Environment

    DEFF Research Database (Denmark)

    Fenchel, Tom

    2010-01-01

    The polymorphic life history of the marine naked amoeba Flabellula baltica was studied. It can be interpreted in terms of adaptations to an environment that is patchy in time and space and it represents trade-off between longevity during starvation and the ability to initiate multiplication soon...... after food resource become available. The life history also represents bet hedging in that different cells within a clonal culture may respond in different ways when food is depleted....

  6. Disease: H00360 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available s approximately 50 million people each year and is responsible for 40 to 100 thousand deaths. People living in Central and Sou...inated with Entamoeba histolytica, an extracellular parasitic amoeba causes amoeb... contains blood. Entamoeba histolytica is a human-specific pathogen. Infectious disease hsa05146 Amoebiasis ...ic colitis and amoebic liver abscess. Amoebic colitis is characterized by devastating dysentery that usually...H00360 Amoebiasis Amoebiasis is the infection of gastrointestinal tract that affect

  7. Ciliate Paramecium is a natural reservoir of Legionella pneumophila

    OpenAIRE

    Kenta Watanabe; Ryo Nakao; Masahiro Fujishima; Masato Tachibana; Takashi Shimizu; Masahisa Watarai

    2016-01-01

    Legionella pneumophila, the causative agent of Legionnaires’ disease, replicates within alveolar macrophages and free-living amoebae. However, the lifestyle of L. pneumophila in the environment remains largely unknown. Here we established a novel natural host model of L. pneumophila endosymbiosis using the ciliate Paramecium caudatum. We also identified Legionella endosymbiosis-modulating factor A (LefA), which contributes to the change in life stage from endosymbiosis to host lysis, enabling...

  8. Anchors for Effectors: Subversion of Phosphoinositide Lipids by Legionella

    OpenAIRE

    Hilbi, Hubert; Weber, Stephen; Finsel, Ivo

    2011-01-01

    The facultative intracellular pathogen Legionella pneumophila replicates in free-living amoebae and macrophages within a distinct compartment, the “Legionella-containing vacuole” (LCV). LCV formation involves phosphoinositide (PI) glycerolipids, which are key factors controlling vesicle trafficking pathways and membrane dynamics of eukaryotic cells. To govern the interactions with host cells, L. pneumophila employs the Icm/Dot type IV secretion system and more than 250 translocated “effector ...

  9. Characterisation of the Legionella pneumophila effector RidL

    OpenAIRE

    Finsel, Ivo

    2014-01-01

    The Gram-negative bacterium Legionella pneumophila naturally parasitises environmental amoebae, but is also able to infect human alveolar macrophages in a mechanistically similar manner. This can result in the mild "Pontiac fever", a flu-like illness, or a potentially lethal pneumonia termed Legionnaires' disease". Crucial for establishing an intracellular replication niche is the Icm/Dot type IV secretion system (T4SS), which translocates approximately 300 different "effector" proteins into ...

  10. Evidence that the intra-amoebal Legionella drancourtii acquired a sterol reductase gene from eukaryotes

    Directory of Open Access Journals (Sweden)

    Fournier Pierre-Edouard

    2009-03-01

    Full Text Available Abstract Background Free-living amoebae serve as a natural reservoir for some bacteria that have evolved into «amoeba-resistant» bacteria. Among these, some are strictly intra-amoebal, such as Candidatus "Protochlamydia amoebophila" (Candidatus "P. amoebophila", whose genomic sequence is available. We sequenced the genome of Legionella drancourtii (L. drancourtii, another recently described intra-amoebal bacterium. By comparing these two genomes with those of their closely related species, we were able to study the genetic characteristics specific to their amoebal lifestyle. Findings We identified a sterol delta-7 reductase-encoding gene common to these two bacteria and absent in their relatives. This gene encodes an enzyme which catalyses the last step of cholesterol biosynthesis in eukaryotes, and is probably functional within L. drancourtii since it is transcribed. The phylogenetic analysis of this protein suggests that it was acquired horizontally by a few bacteria from viridiplantae. This gene was also found in the Acanthamoeba polyphaga Mimivirus genome, a virus that grows in amoebae and possesses the largest viral genome known to date. Conclusion L. drancourtii acquired a sterol delta-7 reductase-encoding gene of viridiplantae origin. The most parsimonious hypothesis is that this gene was initially acquired by a Chlamydiales ancestor parasite of plants. Subsequently, its descendents transmitted this gene in amoebae to other intra-amoebal microorganisms, including L. drancourtii and Coxiella burnetii. The role of the sterol delta-7 reductase in prokaryotes is as yet unknown but we speculate that it is involved in host cholesterol parasitism.

  11. Occurrence and Control of Legionella in Recycled Water Systems

    OpenAIRE

    Jjemba, Patrick K.; William Johnson; Zia Bukhari; LeChevallier, Mark W.

    2015-01-01

    Legionella pneumophila is on the United States Environmental Protection Agency (USEPA) Candidate Contaminant list (CCL) as an important pathogen. It is commonly encountered in recycled water and is typically associated with amoeba, notably Naegleria fowleri (also on the CCL) and Acanthamoeba sp. No legionellosis outbreak has been linked to recycled water and it is important for the industry to proactively keep things that way. A review was conducted examine the occurrence of Legionella and it...

  12. Nuclease Activity of Legionella pneumophila Cas2 Promotes Intracellular Infection of Amoebal Host Cells

    Science.gov (United States)

    Gunderson, Felizza F.; Mallama, Celeste A.; Fairbairn, Stephanie G.

    2014-01-01

    Legionella pneumophila, the primary agent of Legionnaires' disease, flourishes in both natural and man-made environments by growing in a wide variety of aquatic amoebae. Recently, we determined that the Cas2 protein of L. pneumophila promotes intracellular infection of Acanthamoeba castellanii and Hartmannella vermiformis, the two amoebae most commonly linked to cases of disease. The Cas2 family of proteins is best known for its role in the bacterial and archeal clustered regularly interspaced short palindromic repeat (CRISPR)–CRISPR-associated protein (Cas) system that constitutes a form of adaptive immunity against phage and plasmid. However, the infection event mediated by L. pneumophila Cas2 appeared to be distinct from this function, because cas2 mutants exhibited infectivity defects in the absence of added phage or plasmid and since mutants lacking the CRISPR array or any one of the other cas genes were not impaired in infection ability. We now report that the Cas2 protein of L. pneumophila has both RNase and DNase activities, with the RNase activity being more pronounced. By characterizing a catalytically deficient version of Cas2, we determined that nuclease activity is critical for promoting infection of amoebae. Also, introduction of Cas2, but not its catalytic mutant form, into a strain of L. pneumophila that naturally lacks a CRISPR-Cas locus caused that strain to be 40- to 80-fold more infective for amoebae, unequivocally demonstrating that Cas2 facilitates the infection process independently of any other component encoded within the CRISPR-Cas locus. Finally, a cas2 mutant was impaired for infection of Willaertia magna but not Naegleria lovaniensis, suggesting that Cas2 promotes infection of most but not all amoebal hosts. PMID:25547789

  13. Anchors for effectors: subversion of phosphoinositide lipids by Legionella

    OpenAIRE

    Hubert eHilbi; Stephen eWeber; Ivo eFinsel

    2011-01-01

    The facultative intracellular pathogen Legionella pneumophila replicates in free-living amoebae and macrophages within a distinct compartment, the Legionella-containing vacuole (LCV). LCV formation involves phosphoinositide (PI) glycerolipids, which are key factors controlling vesicle trafficking pathways and membrane dynamics of eukaryotic cells. To govern the interactions with host cells, L. pneumophila employs the Icm/Dot type IV secretion system and more than 250 translocated effector pro...

  14. From Social Network (Centralized vs. Decentralized) to Collective Decision-Making (Unshared vs. Shared Consensus)

    OpenAIRE

    Cédric Sueur; Jean-Louis Deneubourg; Odile Petit

    2012-01-01

    Relationships we have with our friends, family, or colleagues influence our personal decisions, as well as decisions we make together with others. As in human beings, despotism and egalitarian societies seem to also exist in animals. While studies have shown that social networks constrain many phenomena from amoebae to primates, we still do not know how consensus emerges from the properties of social networks in many biological systems. We created artificial social networks that represent the...

  15. (SI) Reorganization free energies and quantum corrections for a model electron self-exchange reaction: Comparison of polarizable and nonpolarizable solvent models

    OpenAIRE

    Blumberger, Jochen; Lamoureux, Guillaume

    2008-01-01

    Abstract The solvent contribution to the reorganization free energy for electron self-exchange in aqueous Ru(II)-Ru(III) is computed for two recently developed polarizable water models, AMOEBA and SWM4-NDP, and for the earlier POL3 model, and compared to the reorganization free energy of nonpolarizable water models. The ``solute'', defined as the two ions and their first hydration shells, is treated as nonpolarizable. We find that the solvent (``outer sphere'') ...

  16. Dynamics of zoomicrobial complexes upon decomposition of plant litter in spruce forests of the southern taiga

    Science.gov (United States)

    Rakhleeva, A. A.; Semenova, T. A.; Striganova, B. R.; Terekhova, V. A.

    2011-01-01

    Comparative studies of the composition and abundance of soil-dwelling invertebrates (microarthropods, nematodes, and testate amoebas) and micromycetes in the course of leaf and needle litter decomposition were conducted in two types of spruce forests on white-podzolic and brown forest soils in a field experiment. The analysis of the destruction dynamics has revealed a correlation between the rate of the litter mass loss and the abundance of microarthropods and testate amoebas in the decomposing plant residues. The highest amplitude of the seasonal fluctuations in the number of invertebrates was found for the micromycetes and nematodes as compared to that for the testate amoebas and microarthropods. In the complexes of micromycetes and invertebrates, changes in the dominants were revealed at the different stages of the decomposition. The litter's composition was found to be the main factor affecting the composition and abundance of the zoomicrobial complex of the destroyers. The type of biogeocenosis less influenced the abundance of pedobionts, but it determined their taxonomic composition to a greater extent. A significant inverse correlation was revealed between the number of micromycetes and that of small soil invertebrates.

  17. KAJIAN EPIDEMIOLOGI PENYAKIT INFEKSI SALURAN PENCERNAAN YANG DISEBABKAN OLEH AMUBA DI INDONESIA

    Directory of Open Access Journals (Sweden)

    Anorital -

    2012-07-01

    Full Text Available The intestinal infection caused by amoeba is one of the three diarrhea causes appears to be a public health problem with high incidence in the community. Amebiasis is caused by Entamoeba histolytica, can be differentiated from non pathogen Entamoeba hartmanni and Entamoeba coli. Morphologically of Entamoeba histolytica and Entamoeba dispar are very similar. However, based on the diagnosis utilizing molecular examination technique, in fact, the main cause of amebiasis is Entamoeba dispar. Amoeba dysentry can be found arround the world, having cosmopolite characteristic with incidences varying between 3-10%. In the developed countries with relatively better hygiene and sanitation, amoebiasis incidence is between 2-11%. In Indonesia, the amoebiasis incidence is`quite high, in the range of 10-18%. Whereas the mortality caused by amoebiasis is high enough between 1.9—9.1%, second rank after malaria. Several kinds of amoeba dysentri medicines were used, but Metronidazole is proven as the effective drug of choice for Entamoeba histolytica, both the cyste and trophozoite forms with minor side effect to the patients. Good personal hygiene and environmental sanitation practices are the major factors of this disease prevention. The main principle to prevent the spreading of amoebiasis infection is to cut the link of infection sources to human beings. Personal hygiene is focused on the management of individual behaviour, meanwhile environmental sanitation prevention focus lies on the better environmental management to cut the link of disease cycle.

  18. Micropaleontology of the 2013 Typhoon Haiyan overwash sediments from the Leyte Gulf, Philippines

    Science.gov (United States)

    Pilarczyk, Jessica E.; Horton, Benjamin P.; Soria, Janneli Lea A.; Switzer, Adam D.; Siringan, Fernando; Fritz, Hermann M.; Khan, Nicole S.; Ildefonso, Sorvigenaleon; Doctor, Angelique A.; Garcia, Mikko L.

    2016-06-01

    Coastal geologic records allow for the assessment of long-term patterns of tropical cyclone variability. However, the accuracy of geologic reconstructions of tropical cyclones is limited by the lack of modern analogues. We describe the microfossil (foraminifera and testate amoebae) assemblages contained within overwash sediments deposited by Typhoon Haiyan when it made landfall on the islands of Leyte and Samar in the Philippines on 7 November 2013 as a Category 5 super typhoon. The overwash sediments were transported up to 1.7 km inland at four study sites. The sediments consisted of light brown medium sand in a layer < 1 to 8 cm thick. We used Partitioning Around a Medoid (PAM) cluster analysis to identify lateral and vertical changes in the foraminiferal and testate amoebae data. The presence of intertidal and subtidal benthic, and planktic foraminifera that were variably unaltered and abraded identify the microfossil signature of the overwash sediments. Agglutinated mangrove foraminifera and testate amoebae were present within the overwash sediments at many locations and indicate terrestrial scouring by Haiyan's storm surge. PAM cluster analysis subdivided the Haiyan microfossil dataset into two assemblages based on depositional environment: (1) a low-energy mixed-carbonate tidal flat located on Samar Island (Basey transect); and (2) a higher-energy clastic coastline near Tanauan on Leyte Island (Santa Cruz, Solano, and Magay transects). The assemblages and the taphonomy suggest a mixed provenance, including intertidal and subtidal sources, as well as a contribution of sediment sourced from deeper water and terrestrial environments.

  19. F. novicida-Infected A. castellanii Does Not Enhance Bacterial Virulence in Mice

    Science.gov (United States)

    Ozanic, Mateja; Gobin, Ivana; Brezovec, Martin; Marecic, Valentina; Trobonjaca, Zlatko; Abu Kwaik, Yousef; Santic, Marina

    2016-01-01

    Francisella tularensis is a facultative intracellular bacterium that causes tularemia in humans and animals. Epidemiology of tularemia worldwide is often associated with water-borne transmission, which includes mosquitoes and amoebae as the potential host reservoirs of the bacteria in water environment. In vitro studies showed intracellular replication of F. tularensis within Acanthamoeba castellanii and Hartmanella vermiformis cells. While infection of amoeba by Legionella pneumophila has been shown to enhance infectivity of L. pneumophila the role of F. tularensis-infected protozoa in the pathogenesis of tularemia is not known. We used 6 h coculture of A. castellanii and F. novicida for investigation of the effect of inhaled amoeba on the pathogenesis of tularemia on in vivo model. Balb/c mice were infected intratracheally with F. novicida or with F. novicida-infected A. castellanii. Surprisingly, infection with F. novicida-infected A. castellanii did not lead to bronchopneumonia in Balb/c mice, and Francisella did not disseminate into the liver and spleen. Upon inhalation, F. novicida infects a variety of host cells, though neutrophils are the predominant cells early during infection in the lung infiltrates of pulmonary tularemia. The numbers of neutrophils in the lungs of Balb/c mice were significantly lower in the infection of mice with F. novicida-infected A. castellanii in comparison to group of mice infected only with F. novicida. These results demonstrate that following inoculation of mice with F. novicida-infected A. castellanii, mice did not develop tularemia. PMID:27242974

  20. Isolation and genotyping of Acanthamoeba spp. from recreational soil of parks in Tehran, Iran

    Directory of Open Access Journals (Sweden)

    M Niyyati

    2013-11-01

    Full Text Available Background & aim: Acanthamoeba is a genus of free-living amoebae found in environmental sources. These amphizoic amoebae can lead to severe human disease such as encephalitis and keratitis. Acanthamoeba transmits to humans through contact with soil and dust from scratching the skin. The aim of the present study was to identify the genotypes of Acanthamoeba in parks of the city of Tehran using molecular and morphological - based methods. Methods: In this study, 52 samples of soil were collected from 17 parks in Tehran. Samples were then filtered and cultured on 1.5% non-nutrient agar. DNA extraction and PCR amplification was performed using genus specific primers. Sequencing analysis and BLAST search were done for genotype identification. Results: Out of 52 soil samples, 14 strain (26.9% were positive for Acanthamoeba amoebae by microscopic observation. Out Of 14 positive isolates, 9 (17.3% were positive for Acanthamoeba using genus specific primer pairs. Of 14 strains, 9 were sequenced successfully. Genotype identification was revealed that all strains were belonged to T4 type. T4 genotypes among strains are human pathogens. Conclusions: Identification of pathogenic Acanthamoeba belonging to T4 genotype in recreational parks could be of utmost importance. Results of this study show that soil contamination, particularly in parks where children play and assemble is a sanitary risk for them. Key words: Acanthamoeba, Genotypes, Soil, Park

  1. Isolation of amoebic-bacterial consortia capable of degrading trichloroethylene

    International Nuclear Information System (INIS)

    Groundwater from a waste disposal site contaminated with chlorinated alkenes was examined for the presence of amoebic-bacterial consortia capable of degrading the suspected carcinogen, trichloroethylene (TCE). Consortia were readily isolated from all of four test wells. They contained free-living amoebae, and heterotrophic and methylotrophic bacteria. Electron microscopic examination showed bacteria localized throughout the amoebic cytoplasm and an abundance of hyphomicrobium, but not Type I methanotrophs. The presence of Type II methanotrophs was indirectly indicated by lipid analysis of one consortium. The consortia have been passaged for over two years on mineral salts media in a methane atmosphere, which would not be expected to maintain the heterotrophs or amoebae separately. The methanotrophic bacteria apparently provided a stable nutrient source, allowing the persistence of the various genera. By use of 14C-radiotracer techniques, the degradation of TCE by the consortia was observed with 14C eventuating predominantly in CO2 and water-soluble products. In a more detailed examination of one consortia, the amoebae and heterotrohic components did not degrade TCE, while a mixed culture of heterotrophs and methanotrophs did degrade TCE, suggesting the latter component was the primary cause for the consortium's ability to degrade TCE. Amoebic-bacterial consortia may play a role in stabilizing and preserving methylotrophic bacteria in hostile environments

  2. Swedish isolates of Vibrio cholerae enhance their survival when interacted intracellularly with Acanthamoeba castellanii

    Directory of Open Access Journals (Sweden)

    Salah Shanan

    2016-04-01

    Full Text Available Vibrio cholerae is a Gram-negative bacterium that occurs naturally in aquatic environment. Only V. cholerae O1 and V. cholerae O139 produce cholera toxin and cause cholera, other serogroups can cause gastroenteritis, open wounds infection, and septicaemia. V. cholerae O1 and V. cholerae O139 grow and survive inside Acanthamoeba castellanii. The aim of this study is to investigate the interactions of the Swedish clinical isolates V. cholerae O3, V. cholerae O4, V. cholerae O5, V. cholerae O11, and V. cholerae O160 with A. castellanii. The interaction between A. castellanii and V. cholerae strains was studied by means of amoeba cell counts, viable counts of the bacteria in the absence or presence of amoebae, and of the intracellularly growing bacteria, visualised by electron microscopy. These results show that all V. cholerae can grow and survive outside and inside the amoebae, disclosing that V. cholerae O3, V. cholerae O4, V. cholerae O5, V. cholerae O11, and V. cholerae O160 all can be considered as facultative intracellular bacteria.

  3. Surviving within the amoebal exocyst: the Mycobacterium avium complex paradigm

    Directory of Open Access Journals (Sweden)

    Drancourt Michel

    2010-04-01

    Full Text Available Abstract Background Most of environmental mycobacteria have been previously demonstrated to resist free-living amoeba with subsequent increased virulence and resistance to antibiotics and biocides. The Mycobacterium avium complex (MAC comprises of environmental organisms that inhabit a wide variety of ecological niches and exhibit a significant degree of genetic variability. We herein studied the intra-ameobal location of all members of the MAC as model organisms for environmental mycobacteria. Results Type strains for M. avium, Mycobacterium intracellulare, Mycobacterium chimaera, Mycobacterium colombiense, Mycobacterium arosiense, Mycobacterium marseillense, Mycobacterium timonense and Mycobacterium bouchedurhonense were co-cultivated with the free-living amoeba Acanthamoeba polyphaga strain Linc-AP1. Microscopic analyses demonstrated the engulfment and replication of mycobacteria into vacuoles of A. polyphaga trophozoites. Mycobacteria were further entrapped within amoebal cysts, and survived encystment as demonstrated by subculturing. Electron microscopy observations show that, three days after entrapment into A. polyphaga cysts, all MAC members typically resided within the exocyst. Conclusions Combined with published data, these observations indicate that mycobacteria are unique among amoeba-resistant bacteria, in residing within the exocyst.

  4. Phosphorylation of proteins in Dictyostelium discoideum during development

    International Nuclear Information System (INIS)

    The phosphoproteins in D. discoideum were studied with respect to their formation, metabolic stability, cellular and subcellular distribution. Special emphasis was on the role of cAMP on the pattern of phosphorylation. Amoebae were metabolically labeled with 32P/sub i/; subsequently proteins of the total lysate, nuclei and membranes were resolved by SDS-polyacrylamide gel electrophoresis and subjected to autoradiography. Numerous changes in the profile of phosphoproteins were observed during development. Functions were assigned to four membranal phosphoproteins; only one protein, the heavy chain of myosin, was susceptible to phosphorylation in vitro when purified membranes and 32P-ATP were used. A comparison between the time of protein synthesis and phosphorylation, as examined in vivo using 35S-methionine and 32P/sub i/ labeling of amoebae and two-dimensional gel electrophoresis, indicated that phosphorylation is concurrent with synthesis. It appears then that there are two classes of membranal phosphoproteins in D. discoideum which differ with respect to the stability of the phosphate moiety. It is evident that the turnover of the phosphate moiety in myosin heavy chain plays a crucial role in the function of myosin; a role for the metabolically inert phosphate of other membranal proteins remains to be established. The G protein which couples occupancy of hormone receptor to stimulation of adenylate cyclase in higher multicellular eukaryotes was detected in D. discoideum. The G protein is present in approximately equal amounts in vegetative and in developing amoebae

  5. Tug-Of-War Model for Two-Bandit Problem

    Science.gov (United States)

    Kim, Song-Ju; Aono, Masashi; Hara, Masahiko

    The amoeba of the true slime mold Physarum polycephalum shows high computational capabilities. In the so-called amoeba-based computing, some computing tasks including combinatorial optimization are performed by the amoeba instead of a digital computer. We expect that there must be problems living organisms are good at solving. The “multi-armed bandit problem” would be the one of such problems. Consider a number of slot machines. Each of the machines has an arm which gives a player a reward with a certain probability when pulled. The problem is to determine the optimal strategy for maximizing the total reward sum after a certain number of trials. To maximize the total reward sum, it is necessary to judge correctly and quickly which machine has the highest reward probability. Therefore, the player should explore many machines to gather much knowledge on which machine is the best, but should not fail to exploit the reward from the known best machine. We consider that living organisms follow some efficient method to solve the problem.

  6. Characterization of Intracellular Streaming and Traction Forces in Migrating Physarum Plasmodia

    Science.gov (United States)

    Zhang, Shun; Del Alamo, Juan C.; Guy, Robert D.; Lasheras, Juan C.

    2012-11-01

    Physarum plasmodium is a model organism for cell migration that exhibits fast intracellular streaming. Motile amoeboid physarum plasmodia were obtained from dish cultures of Physarum Polycephalum, a slime mold that inhabits shady cool moist areas in the wild, such as decaying vegetable material. The migrating amoebae were obtained by cutting successively smaller pieces from the growing tips of the cultured parent mold, and their size ranged 0.2 to 0.5 mm. Single amoebae were seeded and let adhere on flexible polyacrilamide gels that were functionalized with collagen, contained 0.2-micron fluorescent beads, and were embedded in an aqueous medium. Soon after adhering to the gel, the amoeabe began crawling at about 1mm/hr. Joint time-lapse sequences of intracellular streaming and gel deformation were acquired respectively in the bright and fluorescent fields of a confocal microscope at 20X magnification. These images were analyzed using particle-tracking algorithms, and the traction stresses applied by the amoebae on the surface were computed by solving the elastostatic equation for the gel using the measured bead displacements as boundary conditions. These measurements provide, for the first time, a joint characterization of intracellular mass transport and the forces driving this transport in motile amoeboid cells.

  7. The costs and benefits of being a chimera.

    Science.gov (United States)

    Foster, Kevin R; Fortunato, Angelo; Strassmann, Joan E; Queller, David C

    2002-11-22

    Most multicellular organisms are uniclonal. This is hypothesized to be because uniclonal organisms function better than chimeras (non-clonal organisms), owing to reduced levels of internal genetic conflict. We tested this idea using the social amoeba or slime mold Dictyostelium discoideum. When starving, the normally solitary amoebae aggregate to form a differentiated multicellular slug that migrates towards light and forms a fruiting body, facilitating the dispersal of spores. We added 10(7) amoebae to Petri plates containing 1, 2, 5 or 10 clones mixed together. We found an intrinsic cost to chimerism: chimeric slugs moved significantly less far than uniclonal slugs of the same size. However, in nature, joining with other clones to form a chimera should increase slug size, and larger slugs travel further. We incorporated this size effect into a second experiment by giving chimeras more cells than single clones (single clones had 10(6) cells, two-clone chimeras had 2 x 10(6) cells and so on). The uniclonal treatments then simulated a clone in a mixture that refuses to form chimeras. In this experiment, chimeras moved significantly further than the uniclonal slugs, in spite of the intrinsic cost. Thus, chimerism is costly, which may be why it evolves so seldom, but in D. discoideum the benefits of large size appear to compensate. PMID:12495504

  8. Viable Species of Flamella (Amoebozoa: Variosea) Isolated from Ancient Arctic Permafrost Sediments.

    Science.gov (United States)

    Shmakova, Lyubov; Bondarenko, Natalya; Smirnov, Alexey

    2016-02-01

    Six viable strains of amoebae belonging to the genus Flamella (Amoebozoa, Variosea) were isolated from permafrost sediments sampled in the Russian Arctic region. Two of them are from late Pleistocene permafrost in North-East Siberia, and four--from Holocene and late Pleistocene in North-West Siberia. Light- and electron-microscopic study and molecular phylogeny show that these isolates represent two new species belonging to the genus Flamella. Both species are cyst-forming. This is a remarkable case of high resistance of protozoan cysts, allowing them to survive and recover an amoebae population after a very long, geologically significant period of rest; a "snapshot" of evolution in time. This study directly shows for the first time that amoeba cysts can be conserved not only for years and decades but for many thousand years and then recover, contributing to the formation of an active microbial community. We propose to name the new species as Flamella pleistocenica n.sp. and Flamella beringiania n.sp. Phylogenetic analysis shows that the genus Flamella is a robust and potentially species-rich group of Variosea. PMID:26735346

  9. Unusual Vermamoeba Vermiformis Strain Isolated from Snow in Mount Teide, Tenerife, Canary Islands, Spain

    Directory of Open Access Journals (Sweden)

    Maria Reyes-Batlle

    2015-10-01

    Full Text Available Background: Free-living amoebae (FLA are protozoa that are widely distributed in the environment mainly in water and soil related habitats. Thermophilic amoebae are among the most common FLA in water bodies, being Vermamoeba vermiformis one of the most common species reported worldwide from these sources. Interestingly, V. vermiformis has often been reported to survive at high temperatures and osmotic pressure worldwide.Materials and Methods: In this study, snow samples were collected from Mount Teide, Tenerife, Canary Islands during the winter season of 2014. The samples were culture on non nutrient agar plates and checked daily for the presence of FLA. After a week, V. vermiformis amoebae were observed in the plates incubated at room temperature and 37ºC.Results: Molecular characterization was carried out by amplifying the 18S rDNA gene and DNA sequencing, confirmed that the isolated strain belonged to Vermamoeba vermiformis species.Conclusion: To the best of our knowledge, this is the first report of Vermamoeba vermiformis isolation from such an inusual habitat (low temperatures and high altitude and the first report of these species in the Canary islands.

  10. Solvation structure and dynamics of Ni2+(aq) from a polarizable force field

    Science.gov (United States)

    Mareš, Jiří; Vaara, Juha

    2014-10-01

    An aqueous solution of Ni2+ has often been used as a prototypic transition-metal system for experimental and theoretical studies in nuclear and electron-spin magnetic resonance (NMR and ESR). Molecular dynamics (MD) simulation of Ni2+(aq) has been a part of many of these studies. As a transition metal complex, its MD simulation is particularly difficult using common force fields. In this work, we parameterize the Ni2+ ion for a simulation of the aqueous solution within the modern polarizable force field AMOEBA. We show that a successful parameterization is possible for this specific case when releasing the physical interpretation of the electrostatic and polarization parameters of the force field. In doing so, particularly the Thole damping parameter and also the ion charge and polarizability were used as fitting parameters. The resulting parameterizations give in a MD simulation good structural and dynamical properties of the [Ni(H2O)6 ] 2 + complex, along with the expected excellent performance of AMOEBA for the water solvent. The presented parameterization is appropriate for high-accuracy simulations of both structural and dynamic properties of Ni2+(aq). This work documents possible approaches of parameterization of a transition metal within the AMOEBA force field.

  11. Three-Dimensional RISM Integral Equation Theory for Polarizable Solute Models.

    Science.gov (United States)

    Hoffgaard, Franziska; Heil, Jochen; Kast, Stefan M

    2013-11-12

    Modeling solute polarizability is a key ingredient for improving the description of solvation phenomena. In recent years, polarizable molecular mechanics force fields have emerged that circumvent the limitations of classical fixed charge force fields by the ability to adapt their electrostatic potential distribution to a polarizing environment. Solvation phenomena are characterized by the solute's excess chemical potential, which can be computed by expensive fully atomistic free energy simulations. The alternative is to employ an implicit solvent model, which poses a challenge to the formulation of the solute-solvent interaction term within a polarizable framework. Here, we adapt the three-dimensional reference interaction site model (3D RISM) integral equation theory as a solvent model, which analytically yields the chemical potential, to the polarizable AMOEBA force field using an embedding cluster (EC-RISM) strategy. The methodology is analogous to our earlier approach to the coupling of a quantum-chemical solute description with a classical 3D RISM solvent. We describe the conceptual physical and algorithmic basis as well as the performance for several benchmark cases as a proof of principle. The results consistently show reasonable agreement between AMOEBA and quantum-chemical free energies in solution in general and allow for separate assessment of energetic and solvation-related contributions. We find that, depending on the parametrization, AMOEBA reproduces the chemical potential in better agreement with reference quantum-chemical calculations than the intramolecular energies, which suggests possible routes toward systematic improvement of polarizable force fields. PMID:26583390

  12. Detection of Balamuthia mandrillaris DNA in the storage case of contact lenses in Germany.

    Science.gov (United States)

    Balczun, Carsten; Scheid, Patrick L

    2016-05-01

    Acanthamoeba spp. are frequently the etiological agents of a severe form of sight-threatening keratitis, called Acanthamoeba keratitis. The contact lens storage solution of a patient with keratitis of unknown genesis was screened using our diagnostic tools to detect potentially pathogenic free-living amoebae (FLA). Culture methods and a triplex quantitative real-time polymerase chain reaction (qPCR) targeting Acanthamoeba spp., Naegleria fowleri, and Balamuthia mandrillaris were used in context of this routine screening. While no amoebae were detected by culture, qPCR specifically detected DNA of B. mandrillaris. This FLA is known as the etiological agent of a fatal form of encephalitis in humans and other mammals, Balamuthia amoebic encephalitis (BAE). A fragment of the 18S rDNA gene was amplified from the sample and showed 99 % sequence identity to B. mandrillaris sequences from GenBank. To the best of our knowledge, this is the first report of B. mandrillaris found in association with contact lenses. Although no viable amoeba was obtained by culturing efforts, the verification of B. mandrillaris DNA in the contact lens storage solution demonstrates how easily this pathogen might come into close contact with humans. PMID:26965426

  13. Motile activities of Dictyostelium discoideum differ from those in Protista or vertebrate animal cells.

    Science.gov (United States)

    Waligórska, Agnieszka; Wianecka-Skoczeń, Magdalena; Korohoda, Włodzimierz

    2007-01-01

    Cell movement in the amoebae Dictyostelium discoideum has been examined in media differing in monovalent cation concentration (i.e. Na+ and K+). Under isotonic or even slightly hypertonic conditions, the cells move equally well in solutions in which either potassium or sodium ions dominate. However, in strongly hypertonic solutions the amoebae showed motility in a 2% potassium chloride solution, but remained motionless in a hypertonic 2% sodium chloride solution. This inhibition of D. discoideum amoebae movement in a hypertonic sodium chloride solution was fully reversible. Such behaviour corresponds to that of plant, fungi, and some invertebrate animal cells rather than protozoan or vertebrate cells. These observations suggest that studies using D. discoideum as a model for cell motility in vertebrate animal tissue cells should be considered with caution, and would seem to confirm the classification of cellular slime moulds as related rather to Fungi than to Protista. This also shows that the cell membrane models should consider the asymmetry in sodium/potassium ion concentrations found in vertebrate animal cells as one of various possibilities. PMID:18274250

  14. Lack of Outer Membrane Protein A Enhances the Release of Outer Membrane Vesicles and Survival of Vibrio cholerae and Suppresses Viability of Acanthamoeba castellanii

    Directory of Open Access Journals (Sweden)

    Soni Priya Valeru

    2014-01-01

    Full Text Available Vibrio cholerae, the causative agent of the diarrhoeal disease cholera, survives in aquatic environments. The bacterium has developed a survival strategy to grow and survive inside Acanthamoeba castellanii. It has been shown that V. cholerae expresses outer membrane proteins as virulence factors playing a role in the adherence to interacted host cells. This study examined the role of outer membrane protein A (OmpA and outer membrane vesicles (OMVs in survival of V. cholerae alone and during its interaction with A. castellanii. The results showed that an OmpA mutant of V. cholerae survived longer than wild-type V. cholerae when cultivated alone. Cocultivation with A. castellanii enhanced the survival of both bacterial strains and OmpA protein exhibited no effect on attachment, engulfment, and survival inside the amoebae. However, cocultivation of the OmpA mutant of V. cholerae decreased the viability of A. castellanii and this bacterial strain released more OMVs than wild-type V. cholerae. Surprisingly, treatment of amoeba cells with OMVs isolated from the OmpA mutant significantly decreased viable counts of the amoeba cells. In conclusion, the results might highlight a regulating rule for OmpA in survival of V. cholerae and OMVs as a potent virulence factor for this bacterium towards eukaryotes in the environment.

  15. Peroxynitrite and Peroxiredoxin in the Pathogenesis of Experimental Amebic Liver Abscess

    Directory of Open Access Journals (Sweden)

    Judith Pacheco-Yepez

    2014-01-01

    Full Text Available The molecular mechanisms by which Entamoeba histolytica causes amebic liver abscess (ALA are still not fully understood. Amebic mechanisms of adherence and cytotoxic activity are pivotal for amebic survival but apparently do not directly cause liver abscess. Abundant evidence indicates that chronic inflammation (resulting from an inadequate immune response is probably the main cause of ALA. Reports referring to inflammatory mechanisms of liver damage mention a repertoire of toxic molecules by the immune response (especially nitric oxide and reactive oxygen intermediates and cytotoxic substances released by neutrophils and macrophages after being lysed by amoebas (e.g., defensins, complement, and proteases. Nevertheless, recent evidence downplays these mechanisms in abscess formation and emphasizes the importance of peroxynitrite (ONOO−. It seems that the defense mechanism of amoebas against ONOO−, namely, the amebic thioredoxin system (including peroxiredoxin, is superior to that of mammals. The aim of the present text is to define the importance of ONOO− as the main agent of liver abscess formation during amebic invasion, and to explain the superior capacity of amoebas to defend themselves against this toxic agent through the peroxiredoxin and thioredoxin system.

  16. Detection of Balamuthia mandrillaris DNA by real-time PCR targeting the RNase P gene

    Directory of Open Access Journals (Sweden)

    Lewin Astrid

    2008-12-01

    Full Text Available Abstract Background The free-living amoeba Balamuthia mandrillaris may cause fatal encephalitis both in immunocompromised and in – apparently – immunocompetent humans and other mammalian species. Rapid, specific, sensitive, and reliable detection requiring little pathogen-specific expertise is an absolute prerequisite for a successful therapy and a welcome tool for both experimental and epidemiological research. Results A real-time polymerase chain reaction assay using TaqMan® probes (real-time PCR was established specifically targeting the RNase P gene of B. mandrillaris amoebae. The assay detected at least 2 (down to 0.5 genomes of B. mandrillaris grown in axenic culture. It did not react with DNA from closely related Acanthamoeba (3 species, nor with DNA from Toxoplasma gondii, Leishmania major, Pneumocystis murina, Mycobacterium bovis (BCG, human brain, various mouse organs, or from human and murine cell lines. The assay efficiently detected B. mandrillaris DNA in spiked cell cultures, spiked murine organ homogenates, B. mandrillaris-infected mice, and CNS tissue-DNA preparations from 2 patients with proven cerebral balamuthiasis. This novel primer set was successfully combined with a published set that targets the B. mandrillaris 18S rRNA gene in a duplex real-time PCR assay to ensure maximum specificity and as a precaution against false negative results. Conclusion A real-time PCR assay for B. mandrillaris amoebae is presented, that is highly specific, sensitive, and reliable and thus suited both for diagnosis and for research.

  17. Pathway analysis using (13) C-glycerol and other carbon tracers reveals a bipartite metabolism of Legionella pneumophila.

    Science.gov (United States)

    Häuslein, Ina; Manske, Christian; Goebel, Werner; Eisenreich, Wolfgang; Hilbi, Hubert

    2016-04-01

    Amino acids represent the prime carbon and energy source for Legionella pneumophila, a facultative intracellular pathogen, which can cause a life-threatening pneumonia termed Legionnaires' disease. Genome, transcriptome and proteome studies indicate that L. pneumophila also utilizes carbon substrates other than amino acids. We show here that glycerol promotes intracellular replication of L. pneumophila in amoeba or macrophages (but not extracellular growth) dependent on glycerol-3-phosphate dehydrogenase, GlpD. An L. pneumophila mutant strain lacking glpD was outcompeted by wild-type bacteria upon co-infection of amoeba, indicating an important role of glycerol during infection. Isotopologue profiling studies using (13) C-labelled substrates were performed in a novel minimal defined medium, MDM, comprising essential amino acids, proline and phenylalanine. In MDM, L. pneumophila utilized (13) C-labelled glycerol or glucose predominantly for gluconeogenesis and the pentose phosphate pathway, while the amino acid serine was used for energy generation via the citrate cycle. Similar results were obtained for L. pneumophila growing intracellularly in amoeba fed with (13) C-labelled glycerol, glucose or serine. Collectively, these results reveal a bipartite metabolism of L. pneumophila, where glycerol and carbohydrates like glucose are mainly fed into anabolic processes, while serine serves as major energy supply. PMID:26691313

  18. Entamoeba histolytica Trophozoites and Lipopeptidophosphoglycan Trigger Human Neutrophil Extracellular Traps.

    Science.gov (United States)

    Ávila, Eva E; Salaiza, Norma; Pulido, Julieta; Rodríguez, Mayra C; Díaz-Godínez, César; Laclette, Juan P; Becker, Ingeborg; Carrero, Julio C

    2016-01-01

    Neutrophil defense mechanisms include phagocytosis, degranulation and the formation of extracellular traps (NET). These networks of DNA are triggered by several immune and microbial factors, representing a defense strategy to prevent microbial spread by trapping/killing pathogens. This may be important against Entamoeba histolytica, since its large size hinders its phagocytosis. The aim of this study was to determine whether E. histolytica and their lipopeptidophosphoglycan (EhLPPG) induce the formation of NETs and the outcome of their interaction with the parasite. Our data show that live amoebae and EhLPPG, but not fixed trophozoites, induced NET formation in a time and dose dependent manner, starting at 5 min of co-incubation. Although immunofluorescence studies showed that the NETs contain cathelicidin LL-37 in close proximity to amoebae, the trophozoite growth was only affected when ethylene glycol tetra-acetic acid (EGTA) was present during contact with NETs, suggesting that the activity of enzymes requiring calcium, such as DNases, may be important for amoeba survival. In conclusion, E. histolytica trophozoites and EhLPPG induce in vitro formation of human NETs, which did not affect the parasite growth unless a chelating agent was present. These results suggest that NETs may be an important factor of the innate immune response during infection with E. histolytica. PMID:27415627

  19. Polarizable Atomic Multipole X-Ray Refinement: Particle Mesh Ewald Electrostatics for Macromolecular Crystals.

    Science.gov (United States)

    Schnieders, Michael J; Fenn, Timothy D; Pande, Vijay S

    2011-04-12

    Refinement of macromolecular models from X-ray crystallography experiments benefits from prior chemical knowledge at all resolutions. As the quality of the prior chemical knowledge from quantum or classical molecular physics improves, in principle so will resulting structural models. Due to limitations in computer performance and electrostatic algorithms, commonly used macromolecules X-ray crystallography refinement protocols have had limited support for rigorous molecular physics in the past. For example, electrostatics is often neglected in favor of nonbonded interactions based on a purely repulsive van der Waals potential. In this work we present advanced algorithms for desktop workstations that open the door to X-ray refinement of even the most challenging macromolecular data sets using state-of-the-art classical molecular physics. First we describe theory for particle mesh Ewald (PME) summation that consistently handles the symmetry of all 230 space groups, replicates of the unit cell such that the minimum image convention can be used with a real space cutoff of any size and the combination of space group symmetry with replicates. An implementation of symmetry accelerated PME for the polarizable atomic multipole optimized energetics for biomolecular applications (AMOEBA) force field is presented. Relative to a single CPU core performing calculations on a P1 unit cell, our AMOEBA engine called Force Field X (FFX) accelerates energy evaluations by more than a factor of 24 on an 8-core workstation with a Tesla GPU coprocessor for 30 structures that contain 240 000 atoms on average in the unit cell. The benefit of AMOEBA electrostatics evaluated with PME for macromolecular X-ray crystallography refinement is demonstrated via rerefinement of 10 crystallographic data sets that range in resolution from 1.7 to 4.5 Å. Beginning from structures obtained by local optimization without electrostatics, further optimization using AMOEBA with PME electrostatics improved

  20. Trophozoites of Entamoeba histolytica epigenetically silenced in several genes are virulence-attenuated

    Directory of Open Access Journals (Sweden)

    Mirelman D.

    2008-09-01

    Full Text Available The human intestinal parasite Entamoeba histolytica causes amoebic colitis and amoebic liver abscesses. Three classes of amoebic molecules have been identified as the major virulence factors, the Gal/GalNAc inhibitable lectin that mediates adherence to mammalian cells, the amoebapores which cause the formation of membrane ion channels in the target cells and the cysteine proteinases which degrade the matrix proteins, the intestinal mucus and secretory IgA. Transcriptional silencing of the amoebapore (Ehap-a gene occurred after transfection of trophozoites with a plasmid containing a segment of the 5’ upstream region of the gene. Transcriptional silencing of the Ehap-a gene continued even after the removal of the plasmid and the cloned amoebae were termed G3. Transfection of G3 trophozoites with a plasmid construct containing the cysteine proteinase (EhCP-5 gene and the light subunit of the Gal- lectin (Ehlgl1 gene, each under the 5’ upstream sequences of the amoebapore gene, caused the simultaneous epigenetic silencing of expression of these two genes. The resulting trophozoites, termed RB-9, were cured from the plasmid and they do not express the three types of virulent genes. The RB-9 amoeba are virulence attenuated and are incapable of killing mammalian cells, they can not induce the formation of liver abscesses and they do not cause ulcerations in the cecum of experimental animals. The gene-silenced amoebae express the same surface antigens which are present in virulent strains and following intra peritoneal inoculation of live trophozoites into hamsters they evoked a protective immune response. Further studies are needed to find out if RB-9 trophozoites could be used for vaccination against amoebaisis.

  1. The Entamoeba histolytica genome: primary structure and expression of proteolytic enzymes

    Directory of Open Access Journals (Sweden)

    Tannich Egbert

    2007-06-01

    Full Text Available Abstract Background A number of studies have shown that peptidases and in particular cysteine peptidases constitute major pathogenicity factors in Entamoeba histolytica. Recent studies have suggested that a considerable number of genes coding for proteolytic enzymes are present within the E. histolytica genome and questions remain about the mode of expression of the various molecules. Results By homology search within the recently published amoeba genome, we identified a total of 86 E. histolytica genes coding for putative peptidases, including 46 recently described peptidase genes. In total these comprise (i 50 cysteine peptidases of different families but most of which belong to the C1 papain superfamily, (ii 22 different metallo peptidases from at least 11 different families, (iii 10 serine peptidases belonging to 3 different families, and (iv 4 aspartic peptidases of only one family. Using an oligonucleotide microarray, peptidase gene expression patterns of 7 different E. histolytica isolates as well as of heat stressed cells were analysed. A total of 21 out of 79 amoeba peptidase genes analysed were found to be significantly expressed under standard axenic culture conditions whereas the remaining are not expressed or at very low levels only. In heat-stressed cells the expression of 2 and 3 peptidase genes, respectively, were either decreased or increased. Only minor differences were observed between the various isolates investigated, despite the fact that these isolates were originated from asymptomatic individuals or from patients with various forms of amoebic diseases. Conclusion Entamoeba histolytica possesses a large number of genes coding for proteolytic enzymes. Under standard culture conditions or upon heat-stress only a relatively small number of these genes is significantly expressed and only very few variations become apparent between various clinical E. histolytica isolates, calling into question the importance of these enzymes

  2. Nebela jiuhuensis nov. sp. (Amoebozoa; Arcellinida; Hyalospheniidae): A New Member of the Nebela saccifera - equicalceus - ansata Group Described from Sphagnum Peatlands in South-Central China.

    Science.gov (United States)

    Qin, Yangmin; Man, Baiying; Kosakyan, Anush; Lara, Enrique; Gu, Yansheng; Wang, Hongmei; Mitchell, Edward A D

    2016-09-01

    Hyalospheniids are among the most common and conspicuous testate amoebae in high-latitude peatlands and forest humus. These testate amoebae were widely studied as bioindicators and are increasingly used as models in microbial biogeography. However, data on their diversity and ecology are still very unevenly distributed geographically: notably, data are lacking for low-latitude peatlands. We describe here a new species, Nebela jiuhuensis, from peatlands near the Middle Yangtze River reach of south-central China with characteristic morphology. The test (shell) has hollow horn-like lateral extensions also found in N. saccifera, N. equicalceus (=N. hippocrepis), and N. ansata, three large species restricted mostly to Sphagnum peatlands of Eastern North America. Mitochondrial cytochrome oxidase (COI) data confirm that N. jiuhuensis is closely related to the morphologically very similar North American species N. saccifera and more distantly to N. ansata within the N. penardiana group. These species are all found in wet mosses growing in poor fens. Earlier reports of morphologically similar specimens found in South Korea peatlands suggest that N. jiuhuensis may be distributed in comparable peatlands in Eastern Asia (China and Korea). The discovery of such a conspicuous new species in Chinese peatlands suggests that many new testate amoebae species are yet to be discovered, including potential regional endemics. Furthermore, human activities (e.g., drainage, agriculture, and pollution) have reduced the known habitat of N. jiuhuensis, which can thus be considered as locally endangered. We, therefore, suggest that this very conspicuous micro-organism with a probably limited geographical distribution and specific habitat requirement should be considered as a flagship species for microbial biogeography as well as local environmental conservation and management. PMID:27593700

  3. Acanthamoeba spp. in Contact Lenses from Healthy Individuals from Madrid, Spain

    Science.gov (United States)

    Gomes, Thiago dos Santos; Magnet, Angela; Izquierdo, Fernando; Vaccaro, Lucianna; Redondo, Fernando; Bueno, Sara; Sánchez, Maria Luisa; Angulo, Santiago; Fenoy, Soledad; Hurtado, Carolina; del Aguila, Carmen

    2016-01-01

    Purpose Acanthamoeba keratitis (AK) is a painful and potentially blinding corneal infection caused by Acanthamoeba spp. In Madrid, environmental studies have demonstrated a high presence of these free-living amoebae in tap water. Since most of AK cases occur in contact lenses (CL) wearers with inadequate hygiene habits, the presence of Acanthamoeba in discarded CL has been studied and compared with other common etiological agents of keratitis, such as Pseudomonas aeruginosa and Staphylococcus aureus. Methods One hundred and seventy-seven healthy individuals from Madrid contributed their discarded CL and answered a questionnaire on hygiene habits. DNA was extracted from the CL solution and analyzed by real-time PCR for Acanthamoeba, Pseudomonas aeruginosa and Staphylococcus aureus. These CL and their solutions were also cultured on non-nutrient agar to isolate Acanthamoeba. Results Among the 177 samples, Acanthamoeba DNA was detected in 87 (49.2%), P. aeruginosa DNA in 14 (7.9%) and S. aureus DNA in 19 (10.7%). Cultivable amoebae, however, were observed in only one sample (0.6%). This isolate was genotyped as T4. The habits reported by this CL owner included some recognized risk factors for AK, but in this study only the practice of “not cleaning the CL case” presented some statistical significant association with Acanthamoeba DNA presence. Detection of the investigated bacterial DNA did not demonstrate statistical significant association with the studied practices, but the presence of P. aeruginosa revealed a possible inhibition of Acanthamoeba in these samples. Conclusions The PCR results suggest a high presence of Acanthamoeba spp. in healthy CL wearers from Madrid, but we can assume that CL solutions are properly disinfecting the CL since only 1.1% of the positive PCR samples correspond to viable amoebae and, after four years, only one participant reported stronger ocular problems. Nevertheless, more studies are necessary to corroborate this hypothesis. PMID

  4. Polarizable Atomic Multipole Solutes in a Generalized Kirkwood Continuum.

    Science.gov (United States)

    Schnieders, Michael J; Ponder, Jay W

    2007-11-01

    The generalized Born (GB) model of continuum electrostatics is an analytic approximation to the Poisson equation useful for predicting the electrostatic component of the solvation free energy for solutes ranging in size from small organic molecules to large macromolecular complexes. This work presents a new continuum electrostatics model based on Kirkwood's analytic result for the electrostatic component of the solvation free energy for a solute with arbitrary charge distribution. Unlike GB, which is limited to monopoles, our generalized Kirkwood (GK) model can treat solute electrostatics represented by any combination of permanent and induced atomic multipole moments of arbitrary degree. Here we apply the GK model to the newly developed Atomic Multipole Optimized Energetics for Biomolecular Applications (AMOEBA) force field, which includes permanent atomic multipoles through the quadrupole and treats polarization via induced dipoles. A derivation of the GK gradient is presented, which enables energy minimization or molecular dynamics of an AMOEBA solute within a GK continuum. For a series of 55 proteins, GK electrostatic solvation free energies are compared to the Polarizable Multipole Poisson-Boltzmann (PMPB) model and yield a mean unsigned relative difference of 0.9%. Additionally, the reaction field of GK compares well to that of the PMPB model, as shown by a mean unsigned relative difference of 2.7% in predicting the total solvated dipole moment for each protein in this test set. The CPU time needed for GK relative to vacuum AMOEBA calculations is approximately a factor of 3, making it suitable for applications that require significant sampling of configuration space. PMID:26636202

  5. Faustovirus-Like Asfarvirus in Hematophagous Biting Midges and Their Vertebrate Hosts.

    Science.gov (United States)

    Temmam, Sarah; Monteil-Bouchard, Sonia; Sambou, Masse; Aubadie-Ladrix, Maxence; Azza, Saïd; Decloquement, Philippe; Khalil, Jacques Y Bou; Baudoin, Jean-Pierre; Jardot, Priscilla; Robert, Catherine; La Scola, Bernard; Mediannikov, Oleg Y; Raoult, Didier; Desnues, Christelle

    2015-01-01

    Faustovirus, a new Asfarviridae-related giant virus, was recently isolated in Vermamoeba vermiformis, a protist found in sewage water in various geographical locations and occasionally reported in human eye infection cases. As part of a global metagenomic analysis of viral communities existing in biting midges, we report here for the first time the identification and isolation of a Faustovirus-like virus in hematophagous arthropods and its detection in their animal hosts. The DNA virome analysis of three pools of Culicoides sp., engorged female Culicoides imicola and non-engorged male/female C. imicola biting midges collected in Senegal, revealed the presence of amoeba-infecting giant viruses and, among them, a majority of sequences related to Faustovirus. Phylogenetic analyses conducted on several structural genes of Faustovirus confirmed the clustering of the arthropod-borne Faustovirus with sewage-borne Faustoviruses, with a distinct geographical clustering of Senegalese Faustovirus strains. Transmission electron microscopy identified viral particles with morphologies and diameters which were compatible with Faustovirus. The presence of infectious arthropod-borne Faustovirus was finally confirmed by successful isolation on V. vermiformis amoeba. Global proteomic analysis of biting midges identified that arthropods' blood meal originating from cattle, rodents and humans. Further screening of cattle sera and rodent tissue resulted in prevalence of Faustovirus being estimated at 38% in rodents and 14% in cattle, suggesting a possible origin of Faustovirus presence in arthropods via the ingestion of contaminated blood meal. Viral loads were the highest in rodents' urine and kidney samples, suggesting a possible excretion of viral particles into the environment. Faustovirus DNA polymerase-related sequences were also detected in more than 9 and 11% of febrile patients and healthy Senegalese human sera, respectively. Our study thus, highlights the need to investigate

  6. Last millennium multiproxy high-resolution palaeoenvironmental study based on a subalpine peatland

    Science.gov (United States)

    Lamentowicz, Mariusz; van der Knaap, Willem O.; van Leeuwen, Jacqueline F. N.; Hangartner, Sarah; Lamentowicz, Łukasz; Mitchell, Edward A. D.; Mauquoy, Dmitri; Kamenik, Christian; Goslar, Tomasz

    2010-05-01

    Subfossil testate amoebae (Protists) and stable oxygen isotopes supported by pollen were used to reconstruct the hydrological history of the last 1000 years from Mauntschas mire in the south-eastern Swiss Alps (Upper Engadin valley; 1818 m a.s.l.). This peatland, located at the bottom of an Alpine valley, recorded local hydrological changes that could be related to precipitation/temperature changes since AD 1000. Using a testate-amoeba training set, which was developed from samples collected in 2007 from peatlands in the same valley, we reconstructed depth to the water table (DWT) in Mauntschas mire. During the instrumental period (starting AD 1864), DWT were correlated with measured temperatures and winter precipitation. Over the last millennium the following changes were inferred: (i) since AD 1000 the presence of Archerella flavum indicated wet conditions; (ii) the habitat became moistest towards AD 1300; (iii) after AD 1300 testate amoebae indicated a gradual decrease of the water table; (iv) during AD 1580-1630 A. flavum indicated increased moisture - this wet period coincided with a cold anomaly recorded in the Alps; (v) between AD 1670 and 1715 the water table decreased again; (vi) another pronounced wet phase was recorded AD 1715-1850 with the maximum water table ca. AD 1780; (vii) during the instrumental period (1864-2003) the water table decreased gradually, following the trend of increasing temperatures. Among the pollen, the maximum wetness during the Little Ice Age (ca AD 1800) was reflected by pollen maxima of Cyperaceae and Selaginella. When climate became warmer and drier after AD 1850 (end of the Little Ice Age), Sphagnum spores were abundant. There was good agreement between DWT and the Pinus non-cembra pollen, suggesting temperature as the common driving factor. The stable oxygen isotopes (d18O) from Sphagnum stems showed similarities with DWT, with an anti-correlated phase at the end of the 19th century.

  7. Perilipin-related protein regulates lipid metabolism in C. elegans

    OpenAIRE

    Chughtai, Ahmed Ali; Kaššák, Filip; Kostrouchová, Markéta; Novotný, Jan Philipp; Krause, Michael W.; Saudek, Vladimír; Kostrouch, Zdenek; Kostrouchová, Marta

    2015-01-01

    Perilipins are lipid droplet surface proteins that contribute to fat metabolism by controlling the access of lipids to lipolytic enzymes. Perilipins have been identified in organisms as diverse as metazoa, fungi, and amoebas but strikingly not in nematodes. Here we identify the protein encoded by the W01A8.1 gene in Caenorhabditis elegans as the closest homologue and likely orthologue of metazoan perilipin. We demonstrate that nematode W01A8.1 is a cytoplasmic protein residing on lipid drople...

  8. Vannellid Species Isolated from Freshwater Source in a Park in Jamaica, West Indies.

    Science.gov (United States)

    Todd, Cheridah D; Reyes-Batlle, María; Valladares, Basilio; Lindo, John F; Lorenzo-Morales, Jacob

    2015-01-01

    Free-living amoebae (FLA) occupy a wide range of freshwater, marine, and soil habitats, and are opportunistic pathogens in human beings. While Acanthamoeba spp., Naegleria fowleri, and Balamuthia mandrillaris are well-known opportunistic organisms, Vannella epipetala is nonpathogenic. Sediments were collected from a freshwater source from a park in Jamaica to investigate the presence of FLA. Acanthamoeba and Naegleria spp. were not recovered; however, a Vannellid species identified by microscopy and PCR analysis as V. epipetala was isolated. These nonpathogens pose a threat to human beings as they may act as Trojan horses for microsporidian parasites and other pathogens, thereby facilitating their transmission to human beings. PMID:26512204

  9. A multi-proxy, high-resolution record of peatland development and its drivers during the last millennium from the subalpine Swiss Alps

    OpenAIRE

    van der Knaap, W.O.; Lamentowicz, Mariucz; van Leeuwen, J.F.N.; Hangartner, S.; Leuenberger, M.; Mauquoy, D.; Goslar, T.; Mitchell, Edward A. D.; Lamentowicz, Ł.; Kamenikg, C.

    2011-01-01

    We present a record of peatland development during the last 1000 years from Mauntschas mire in the eastern Swiss Alps (Upper Engadine valley; 1818 m a.s.l.) inferred from testate amoebae (pH and depth to the water table (DWT) reconstructions), stable oxygen isotopes in Sphagnum (δ18O; proxy for water vapour pressure) and carbon isotopes in Sphagnum (δ13C; proxy for mire surface wetness), peat accumulation rates, charcoal (indicating local burning), pollen and spores (proxies for human impact)...

  10. A zymodeme study of Entamoeba histolytica in a group of South African schoolchildren.

    Science.gov (United States)

    Sargeaunt, P G; Williams, J E; Jackson, T F; Simjee, A E

    1982-01-01

    Using a biphasic culture medium, stocks of intestinal amoebae were isolated from a group of children attending school in Durban, South Africa. These were compared with stocks collected in other areas of the world already characterized using the electrophoretic patterns of four enzymes: glucose phosphate isomerase (GPI), phosphoglucomutase (PGM) L-malate: NADP+ oxido-reductase (oxalacetate-decarboxylating) (ME) and hexokinase (HK). 33% of 94 samples grew Entamoeba histolytica, only one of which gave a pattern indicative of a pathogenic stock. Entamoeba hartmanni, Dientamoeba fragilis and Entamoeba coli were also grown from some samples, increasing the total positive samples for all species isolated to 40%. PMID:6287686

  11. Safety and efficacy of diphetarsone in the treatment of amoebiasis, non-pathogenic amoebiasis and trichuriasis.

    Science.gov (United States)

    Keystone, J S; Proctor, E; Glenn, C; McIntyre, L

    1983-01-01

    Eighty-nine patients infected with Entamoeba histolytica, non-pathogenic amoebae or Trichuris trichiura were studied prospectively to determine the safety and efficacy of diphetarsone therapy. An additional 75 patients were studied retrospectively to assess further the efficacy of diphetarsone in the treatment of E. histolytica cyst passers. Side effects were noted in 9% and included gastrointestinal upset, lightheadedness and headache. Transient liver function abnormalities were recorded in 5.6%. diphetarsone was completely effective in the treatment of Dientamoeba fragilis, Entamoeba hartmanni, Iodamoeba buetschlii and Trichuris trichiura. 99% of the patients with E. histolytica, 97% of those with E. coli and 98% of those with Endolimax nana were cured. PMID:6304952

  12. Molecular comparison of cultivable protozoa from a pristine and a polycyclic aromatic hydrocarbon polluted site

    DEFF Research Database (Denmark)

    Lara, E; Berney, C; Ekelund, Flemming;

    2007-01-01

    We compared the abundance and diversity of cultivable protozoa (flagellates and amoebae) in a polycyclic aromatic hydrocarbon (PAH) polluted soil and an unpolluted control, by isolating and cultivating clonal strains. The number of cultivable protozoa was higher in the polluted soil; however, the...... polluted soil displayed an impoverished community, dominated by certain taxa, such as Acanthamoeba sp. We isolated a total of 31 protozoan strains to characterize them morphologically and by 18S rRNA gene sequence analysis. This approach, i.e. combining morphological and molecular information had the...

  13. Morphology and distribution of heterotrophic protists along 75゜E in the Southern Ocean

    OpenAIRE

    Hara,Shigemitsu/Tanoue,Eiichiro

    1986-01-01

    Seawater samples were collected from the 0 and 50m layers along the transect of 75°E in the Indian sector of the Southern Ocean in the austral summer of 1983-84 during the BIOMASS SIBEX I cruise of the R. V. KAIYO MARU of Japan Fisheries Agency. Distribution and taxonomy of heterotrophic protists were investigated. Naked amoebae and choanoflagellates were the dominant heterotrophic protists in the Indian sector of the Southern Ocean. The total cell volume of heterotrophic protists was larger ...

  14. Detección y diferenciación de Entamoeba histolytica y Entamoeba dispar mediante reacción en cadena de la polimerasa en individuos de una comunidad del Estado Zulia, Venezuela Detection and differentiation of Entamoeba histolytica and Entamoeba dispar by polymerase chain reaction in a community in Zulia State, Venezuela

    Directory of Open Access Journals (Sweden)

    Zulbey Rivero

    2009-01-01

    Full Text Available La identificación diferencial de Entamoeba histolytica y Entamoeba dispar es esencial para un tratamiento adecuado del paciente y con fines epidemiológicos. Para determinar la prevalencia de E. histolytica y E. dispar se estandarizó y aplicó un ensayo de PCR, utilizando oligonucleótidos específicos para cada especie. 204 muestras de heces de individuos de la comunidad de Santa Rosa de Agua (Municipio Maracaibo, Estado Zulia, Venezuela, fueron analizadas a través del examen directo con SSF (0,85% y lugol, concentrado de formol-éter y PCR. Al examen microscópico, 42 individuos (20,58% presentaron formas evolutivas del complejo E. histolytica/E. dispar; mientras que la técnica de PCR evidenció un total de 47 casos positivos a estas amibas; de los cuales 22 eran portadores de E. histolytica (10,78%, 16 (7,84% de E. dispar y 9 (4,41% presentaron infección mixta. No hubo diferencia significativa al relacionar las variables sexo y presencia de E. histolytica y/o E. dispar, ni con los grupos etarios. No existieron casos de estas amibas, en los menores de 2 años. La frecuencia observada de E. histolytica (31/204, demuestra el carácter endémico de la amibiasis en esta comunidad.Differential identification of Entamoeba histolytica and Entamoeba dispar is essential for both appropriate patient treatment and epidemiological purposes. To determine the prevalence of these amoeba infections in Santa Rosa de Agua (Maracaibo, Zulia State, Venezuela, a PCR assay using specific primers for each species was standardized and applied. 204 stool samples were analyzed through direct microscopic examination with SSF (0.85% and lugol, formol-ether concentration, and PCR. Under direct microscopy, 42 individuals (20.58% presented the E. histolytica/E. dispar complex. Meanwhile PCR showed 47 positive cases for these amoebas: 22 E. histolytica (10.78%, 16 E. dispar (7.84%, and 9 (4.41% mixed infections. There was no significant difference in the presence of E

  15. Presencia de Malameba locustae (Protozoa: Rhizopoda en acridios (Orthoptera: Acrididae de la provincia de Misiones, Argentina Presence of Malameba locustae (Protozoa: Rhizopoda in grasshoppers (Orthoptera: Acrididae of Misiones province, Argentina

    Directory of Open Access Journals (Sweden)

    Carlos E. Lange

    2004-07-01

    Full Text Available La ameba patógena Malameba locustae King y Taylor fue detectada parasitando ejemplares del acridio Ronderosia bergi (Stal recolectados en las cercanías del Parque Nacional Iguazú, Misiones. El hallazgo constituye el segundo registro de M. locustae para acridios sudamericanos.Individuals of the grasshopper Ronderosia bergi (Stal collected in the surroundings of Iguazú National Park, Misiones, were found to be parasitized by the pathogenic amoeba Malameba locustae King & Taylor. The finding constitutes the second record of M. locustae for southamerican grasshoppers.

  16. Dicty_cDB: Contig-U16322-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NTNG22TF Entamoeba histolytica Sheared DNA Entam... 40 3e-06 3 ( DL003884 ) Surrogate Markers of Neur...tnstrwrsrw*rcsng*gcsrr wpsrcwwktitncc*tssttiktnckstlrl*ckfn**iii*rr*yhfyrskr*wwldsr *ikigqkgwaptnylqyn**kk own update...opathic Pain. 66 4e-06 3 ( DL003670 ) Surrogate Markers of Neuropathic Pain. 66 4e-06 3 ... M76598 |pid:none) Mouse alpha cardiac myosin heavy chain... 323 2e-86 AF136711_1( AF136711 |pid:none) Amoeba proteu...vkclsllhfsmkilvpfkrk dqpqlvsklkqvlvn**kpfhnvhhiifvvlnqmkpkkpkigkihvlnikfniwvf*rml eleeqvspteihliky*nvtrnfqvk

  17. Flow Rate Driven by Peristaltic Movement in Plasmodial Tube of Physarum Polycephalum

    Science.gov (United States)

    Yamada, Hiroyasu; Nakagaki, Toshiyuki

    2008-07-01

    We report a theoretical analysis of protoplasmic streaming driven by peristaltic movement in an elastic tube of an amoeba-like organism. The Plasmodium of Physarum polycephalum, a true slime mold, is a large amoeboid organism that adopts a sheet-like form with a tubular network. The network extends throughout the Plasmodium and enables the transport and circulation of chemical signals and nutrients. This tubular flow is driven by periodically propagating waves of active contraction of the tube cortex, a process known as peristaltic movement. We derive the relationship between the phase velocity of the contraction wave and the flow rate, and we discuss the physiological implications of this relationship.

  18. A RabGAP protein and BEACH Family proteins regulate contractile vacuole formation and activity and chemotaxis in Dictyostelium

    OpenAIRE

    Du, Fei

    2007-01-01

    The contractile vacuole (CV) system is the osmoregulatory organelle of free-living amoebae and protozoa. I present data showing that the RabGAP RabGAP1 acts as a switch for discharging the CVs into the extracellular medium in Dictyostelium. rabgap1 null (rabgap1⁻) cells have highly enlarged CVs whose structure and activity are aberrant. In rabgap1- cells, the dynamic fusion of the CV with the plasma membrane is absent and the discharge of CV content is inefficient. RabGAP1 localizes to the CV...

  19. A cell's sense of direction.

    Science.gov (United States)

    Parent, C A; Devreotes, P N

    1999-04-30

    In eukaryotic cells directional sensing is mediated by heterotrimeric guanine nucleotide-binding protein (G protein)-linked signaling pathways. In Dictyostelium discoideum amoebae and mammalian leukocytes, the receptors and G-protein subunits are uniformly distributed around the cell perimeter. Chemoattractants induce the transient appearance of binding sites for several pleckstrin homology domain-containing proteins on the inner face of the membrane. In gradients of attractant these sites are persistently present on the side of the cell facing the higher concentration, even in the absence of a functional actin cytoskeleton or cell movement. Thus, the cell senses direction by spatially regulating the activity of the signal transduction pathway. PMID:10221901

  20. FDG PET/CT Findings in Multiple Splenic Amebomas (Amebic Granulomas).

    Science.gov (United States)

    Dong, Aisheng; Wang, Yang; Zuo, Changjing; Zhu, Huaimin

    2016-05-01

    Splenic ameboma (amebic granuloma) is rare. A 38-year-old man with a severe pneumonia due to inhalation of swimming pool water 18 months ago complained of night sweat, tiredness, and anorexia for 1 month. Abdominal ultrasound showed multiple nodules in the spleen. These nodules showed slight enhancement on enhanced CT and intense FDG uptake on PET/CT. Splenectomy was performed. Multiple splenic amebomas were confirmed by pathology. Free-living amoebae were also detected in samples of pleural effusion and blood. Splenic ameboma, although rare, should be included in the differential diagnosis with isolated focally increased FDG activity in the spleen. PMID:26505858

  1. Surface relaxation in water clusters: Evidence from theoretical analysis of the oxygen 1s photoelectron spectrum

    Science.gov (United States)

    Abu-samha, M.; Børve, K. J.

    2008-04-01

    We present a theoretical interpretation of the oxygen 1s photoelectron spectrum published by Öhrwall et al. [J. Chem. Phys. 123, 054310 (2005)]. A water cluster that contains 200molecules was simulated at 215K using the polarizable AMOEBA force field. The force field predicts longer O⋯O distances at the cluster surface than in the bulk. Comparisons to ab initio molecular dynamics (MD) simulations indicate that the force field underestimates the degree of surface relaxation. By comparing cluster lineshape models, computed from MD simulations, to the experimental spectrum we find further evidence of surface relaxation.

  2. Coarse-grained simulations for organic molecular liquids based on Gay-Berne and electric multipole potentials.

    Science.gov (United States)

    Xu, Peijun; Shen, Hujun; Yang, Lu; Ding, Yang; Li, Beibei; Shao, Ying; Mao, Yingchen; Li, Guohui

    2013-02-01

    Coarse-grained studies of CH(3)SH, CH(3)CHO and CHCl(3) liquids, based on anisotropic Gay-Berne (GB) and electric multipole potentials (EMP), demonstrate that the coarse-grained model is able to qualitatively reproduce the results obtained from the atomistic model (AMOEBA polarizable force field) and allows for significant saving in computation time. It should be pointed out that the accuracy of the coarse-grained model is very sensitive to how well the anisotropic GB particle is defined and how satisfactorily the EMP sites are chosen. PMID:22961621

  3. Hydration Gibbs free energies of open and closed shell trivalent lanthanide and actinide cations from polarizable molecular dynamics.

    Science.gov (United States)

    Marjolin, Aude; Gourlaouen, Christophe; Clavaguéra, Carine; Ren, Pengyu Y; Piquemal, Jean-Philip; Dognon, Jean-Pierre

    2014-10-01

    The hydration free energies, structures, and dynamics of open- and closed-shell trivalent lanthanide and actinide metal cations are studied using molecular dynamics simulations (MD) based on a polarizable force field. Parameters for the metal cations are derived from an ab initio bottom-up strategy. MD simulations of six cations solvated in bulk water are subsequently performed with the AMOEBA polarizable force field. The calculated first-and second shell hydration numbers, water residence times, and free energies of hydration are consistent with experimental/theoretical values leading to a predictive modeling of f-elements compounds. PMID:25296890

  4. Finite Temperature Infrared Spectra from Polarizable Molecular Dynamics Simulations.

    Science.gov (United States)

    Semrouni, David; Sharma, Ashwani; Dognon, Jean-Pierre; Ohanessian, Gilles; Clavaguéra, Carine

    2014-08-12

    Infrared spectra of biomolecules are obtained from molecular dynamics simulations at finite temperature using the AMOEBA force field. Diverse examples are presented such as N-methylacetamide and its derivatives and a helical peptide. The computed spectra from polarizable molecular dynamics are compared in each case to experimental ones at various temperatures. The role of high-level electrostatic treatment and explicit polarization, including parameters improvements, is highlighted for obtaining spectral sensitivity to the environment including hydrogen bonds and water molecules and a better understanding of the observed experimental bands. PMID:26588289

  5. Galactose/N-acetylgalactosamine lectin: the coordinator of host cell killing

    Indian Academy of Sciences (India)

    Douglas R Boettner; Christopher Huston; William A Petri Jr

    2002-11-01

    Entamoeba histolytica is an enteric parasite that can kill host cells via a contact-dependent mechanism. This killing involves the amoebic surface protein referred to as the Gal/GalNAc lectin. The Gal/GalNAc lectin binds galactose and N-acetylgalactosamine allowing the adherence of amoebas to host cells. Involvement of the lectin in the pathogenesis of E. histolytica infection will be reviewed in this paper. The lectin has been shown to have very specific and substantial effects on adherence, cytotoxicity, and encystation. There is also possible involvement of the lectin in phagocytosis and caspase activation in host cells.

  6. Changing the internal health and safety organization through organizational learning and change management

    DEFF Research Database (Denmark)

    Hasle, Peter; Jensen, P.L.

    2006-01-01

    successful changes; 5 were partially successful; 3 were nonperformers. The more successful outcomes seem to depend on the abilities of change agents to handle a complex and unpredictable project. Based on these case studies, it has been possible to deduce some strategies change agents must follow to fulfill...... such a process. Such strategies require the ability to be able to identify opportunities for change, establish a sustainable problem definition, and build coalitions. An amoeba model is suggested as a metaphor for this type of development project....

  7. Společenstva půdních krytenek (Protozoa, Rhizopoda) z Národní přírodní rezervace Žofínský prales (Novohradské hory, Česká republika)

    Czech Academy of Sciences Publication Activity Database

    Balík, Vladimír

    České Budějovice: Jihočeská univerzita, 2002, s. 183-186. [Biodiverzita a přírodní podmínky Novohradských hor. České Budějovice (CZ), 10.01.2002-11.01.2002] R&D Projects: GA AV ČR IAA6066702 Institutional research plan: CEZ:AV0Z6066911 Keywords : testate amoebae * assemblages * Žofínský prales Subject RIV: EH - Ecology, Behaviour

  8. Jeans type instability for a chemotactic model of cellular aggregation

    CERN Document Server

    Chavanis, Pierre-Henri

    2008-01-01

    We consider an inertial model of chemotactic aggregation generalizing the Keller-Segel model and we study the linear dynamical stability of an infinite and homogeneous distribution of cells (bacteria, amoebae, endothelial cells,...) when inertial effects are accounted for. These inertial terms model cells directional persistance. We determine the condition of instability and the growth rate of the perturbation as a function of the cell density and the wavelength of the perturbation. We discuss the differences between overdamped (Keller-Segel) and inertial models. Finally, we show the analogy between the instability criterion for biological populations and the Jeans instability criterion in astrophysics.

  9. Generalized Keller-Segel models of chemotaxis. Analogy with nonlinear mean field Fokker-Planck equations

    CERN Document Server

    Chavanis, Pierre-Henri

    2008-01-01

    We consider a generalized class of Keller-Segel models describing the chemotaxis of biological populations (bacteria, amoebae, endothelial cells, social insects,...). We show the analogy with nonlinear mean field Fokker-Planck equations and generalized thermodynamics. As an illustration, we introduce a new model of chemotaxis incorporating both effects of anomalous diffusion and exclusion principle (volume filling). We also discuss the analogy between biological populations described by the Keller-Segel model and self-gravitating Brownian particles described by the Smoluchowski-Poisson system.

  10. Occurrence and Control of Legionella in Recycled Water Systems

    Science.gov (United States)

    Jjemba, Patrick K.; Johnson, William; Bukhari, Zia; LeChevallier, Mark W.

    2015-01-01

    Legionella pneumophila is on the United States Environmental Protection Agency (USEPA) Candidate Contaminant list (CCL) as an important pathogen. It is commonly encountered in recycled water and is typically associated with amoeba, notably Naegleria fowleri (also on the CCL) and Acanthamoeba sp. No legionellosis outbreak has been linked to recycled water and it is important for the industry to proactively keep things that way. A review was conducted examine the occurrence of Legionella and its protozoa symbionts in recycled water with the aim of developing a risk management strategy. The review considered the intricate ecological relationships between Legionella and protozoa, methods for detecting both symbionts, and the efficacy of various disinfectants. PMID:26140674

  11. Host tissue destruction by Entamoeba histolytica: molecules mediating adhesion, cytolysis, and proteolysis

    Directory of Open Access Journals (Sweden)

    Rolf D. Horstmann

    1992-01-01

    Full Text Available Entamoeba histolytica, the protozoan parasite causing human amoebisis, has recently been found to comprise two genetically distinct forms, potentially pathogenic and constitutively nonpathogenic ones. Host tissue destruction by pathogenic forms is belived to result from cell functions mediaed by a lectin-type adherence receptor, a pore-forming peptide involved in host cell lysis, and abundant expression of cysteine proteinase(s. Isolation and molecular cloning of these amoeba products have provided the tools for structural analyses and manipulations of cell functions including comparisons between pathogenic and nonpathogenic forms.

  12. Neglected waterborne parasitic protozoa and their detection in water.

    Science.gov (United States)

    Plutzer, Judit; Karanis, Panagiotis

    2016-09-15

    Outbreak incidents raise the question of whether the less frequent aetiological agents of outbreaks are really less frequent in water. Alternatively, waterborne transmission could be relevant, but the lack of attention and rapid, sensitive methods to recover and detect the exogenous stages in water may keep them under-recognized. High quality information on the prevalence and detection of less frequent waterborne protozoa, such as Cyclospora cayetanensis, Toxoplasma gondii, Isospora belli, Balantidium coli, Blastocystis hominis, Entamoeba histolytica and other free-living amoebae (FLA), are not available. This present paper discusses the detection tools applied for the water surveillance of the neglected waterborne protozoa mentioned above and provides future perspectives. PMID:27281375

  13. Free-living protozoa in the gastrointestinal tract and feces of pigs: Exploration of an unknown world and towards a protocol for the recovery of free-living protozoa.

    Science.gov (United States)

    Chavatte, N; Lambrecht, E; Van Damme, I; Sabbe, K; Houf, K

    2016-07-30

    Associations with free-living protozoa (FLP) have been implicated in the persistence of foodborne pathogenic bacteria in food-related environments. To date however no information is available on the presence of FLP in the gastrointestinal tract (GIT) of pigs, which represents an important reservoir for zoonotic foodborne bacteria and hence a potential location for associations with FLP. This is at least partly due to the lack of adequate protocols to recover FLP from intestinal content and feces. In the present study different protocols to recover FLP from the porcine GIT and feces were tested. The most effective protocols were then applied to explore the presence of live FLP in the pig GIT and feces. A filtration based protocol was identified as the most suitable method to recover viable FLP from the porcine GIT and feces. Cultivable FLP were recovered from different parts of the GIT, suggesting at least a transient presence of FLP in this habitat. Free-living amoebae species (Acanthamoeba spp., Hyperamoeba sp., Vannella sp., Vermamoeba vermiformis, hartmannellids and vahlkampfiids) but also ciliates (Colpoda sp. and Tetrahymena/Glaucoma lookalike) and flagellates (cercomonads, bodonids and glissomonads) were recovered and cultured from pig intestinal content. Acanthamoeba hatchetti and Filamoeba sinensis were isolated for the first time from pig intestinal content. Despite high gastric acidity, non-cyst forming amoeba species were also detected which suggests survival of their trophozoites in the animal GIT. PMID:27369581

  14. Linkages between Holocene paleoclimate and paleohydrogeology preserved in a Yucatan underwater cave

    Science.gov (United States)

    van Hengstum, Peter J.; Reinhardt, Eduard G.; Beddows, Patricia A.; Gabriel, Jeremy J.

    2010-09-01

    Three sediment cores spanning the last 4200 years from Aktun Ha Cave on the Yucatan Peninsula (Mexico) demonstrate that underwater caves can document changes to regional hydrogeology and climate. Benthic microfossils (testate amoebae, foraminifera), organic matter geochemistry (δ 13C, δ 15N, C/N), and particle size distributions were analyzed. However, microfossil paleoecology proved the most useful for indicating three salinity phases in the Aktun Ha sediment cores. Phase 1 (>4300 yr BP) contains predominantly foraminifera ( Physalidia simplex, 78%) that indicate the meteoric lens flooding the cave was initially brackish (salinity >3.5 g L -1). Phase 2 (2800-4300 Cal yr BP) has both freshwater testate amoebae ( Centropyxis spp. 40%) and P. simplex (42%), which indicates a slight freshening of the meteoric lens to 1.5-2 g L -1. Phase 3 (cenote. The δ 15N values ranged from 1.5 to 3.5‰ with observed cycles likely from intervals of increased terrestrial OM input into the cave during high rainfall events (e.g., hurricanes). The observed paleoenvironmental shifts in the cave correlate well with regional precipitation patterns, aquifer recharge, and storm activity caused by southward migration of the Intertropical Convergence Zone. Therefore, regional climate change impacted eastern Yucatan groundwater during the mid to late Holocene. However, decelerating Holocene sea-level rise and aquifer occlusion are likely contributing factors. These results demonstrate that underwater cave sediments and microfossils can be useful proxies for aquifer evolution and climate change.

  15. Isolation and identification of Acanthamoeba spp. from thermal swimming pools and spas in Southern Brazil.

    Science.gov (United States)

    Fabres, Laura Fuhrich; Rosa Dos Santos, Sayonara Peixoto; Benitez, Lisianne Brittes; Rott, Marilise Brittes

    2016-06-01

    Free-living amoebae (FLA) are widely distributed in soil and water. A few number of them are implicated in human disease: Acanthamoeba spp., Naegleria fowleri, Balamuthia mandrillaris and Sappinia diploidea. Species of Acanthamoeba can cause keratitis and brain infections. In this study, 72 water samples were taken from both hot tubs and thermal swimming pools in the city of Porto Alegre, RS, Brazil, to determine the presence of Acanthamoeba in the water as well as perform the phenotypic and genotypic characterization of the isolates. The identification of the isolates was based on the cysts morphology and PCR amplification using genus-specific oligonucleotides. When the isolates were submitted to PCR reaction only 8 were confirmed as belonging to the genus Acanthamoeba. The sequences analysis when compared to the sequences in the GenBank, showed genotype distribution in group T3 (12,5%), T5 (12,5%), T4 (25%) and T15 (50%). The results of this study confirmed the presence of potentially pathogenic isolates of free living amoebae in hot swimming pool and spas which can present risks to human health. PMID:27078644

  16. Modulation of the reaction rate of regulating protein induces large morphological and motional change of amoebic cell.

    Science.gov (United States)

    Nishimura, Shin I; Sasai, Masaki

    2007-03-21

    Morphologies of moving amoebae are categorized into two types. One is the "neutrophil" type in which the long axis of cell roughly coincides with its moving direction. This type of cell extends a leading edge at the front and retracts a narrow tail at the rear, whose shape has been often drawn as a typical amoeba in textbooks. The other one is the "keratocyte" type with widespread lamellipodia along the front side arc. Short axis of cell in this type roughly coincides with its moving direction. In order to understand what kind of molecular feature causes conversion between two types of morphologies, and how two typical morphologies are maintained, a mathematical model of amoebic cells is developed. This model describes movement of cell and intracellular reactions of activator, inhibitor and actin filaments in a unified way. It is found that the producing rate of activator is a key factor of conversion between two types. This model also explains the observed data that the keratocyte type cells tend to rapidly move along a straight line. The neutrophil type cells move along a straight line when the moving velocity is small, but they show fluctuated motions deviating from a line when they move as fast as the keratocyte type cells. Efficient energy consumption in the neutrophil type cells is predicted. PMID:17113108

  17. Acanthamoeba species in Swimming Pools of Cairo, Egypt.

    Directory of Open Access Journals (Sweden)

    Ahmad Al-Herrawy

    2014-06-01

    Full Text Available The free-living amoebae Acanthamoeba spp. have been recognized as etiologic agents of amoebic encephalitis, keratitis, otitis, lung lesions and other skin infections mainly in immuno-compromised individuals. The purpose of this study is to detect the presence of Acanthamoeba in swimming pools in Egypt using a polymerase chain reaction (PCR method.Water samples were collected from 10 different swimming pools in Cairo, Egypt. Samples were cultured on non-nutrient agar for the detection of Acanthamoeba isolates that were confirmed by PCR amplification using genus specific primers. The molecularly confirmed Acanthamoeba isolates were morphologically identified to the species level.Members of genus Acanthamoeba were detected in 49.2% of the examined swimming-pool water samples. Morphologically, six Acanthamoeba species were isolated from the examined swimming pool water namely A. polyphaga, A.castellanii, A. rhysodes, A. mauritaniensis, A. royreba and A. triangularis. All the identified species of Acanthamoeba were molecularly confirmed to be related to the genus Acanthamoeba.The isolated species of Acanthamoeba could provoke variable degrees of infections to the swimmers. The culture method is cheaper and easier than PCR techniques that are faster for the detection of free-living amoebae.

  18. Promiscuous and specific bacterial symbiont acquisition in the amoeboid genus Nuclearia (Opisthokonta).

    Science.gov (United States)

    Dirren, Sebastian; Posch, Thomas

    2016-08-01

    We isolated 17 strains of the amoeboid genus Nuclearia (Opisthokonta) from five Swiss lakes. Eight of these nucleariid isolates were associated with bacterial endosymbionts and/or ectosymbionts. Amoebae were characterized morphologically and by their 18S rRNA genes. Phylogeny based on molecular data resulted in four established monophyletic branches and two new clusters. A heterogeneous picture emerged by highlighting nucleariids with associated bacteria. Apart from one cluster which consisted of only isolates with and three groups of amoebae without symbionts, we also found mixed clusters. The picture got even more 'blurred' by regarding the phylogeny of symbiotic bacteria. Although seven different bacterial strains could be identified, it seems that we still are only scratching the surface of symbionts' diversity. Furthermore, types of symbioses might be different depending on host species. Strains of Nuclearia thermophila harboured the same endosymbiont even when isolated from different lakes. This pointed to a specific and obligate interaction. However, two isolates of N. delicatula were associated with different endosymbiotic bacteria. Here the symbiont acquisition seemed to be rather promiscuous. This behaviour regarding symbiotic associations is especially remarkable considering the phylogenetic position of these basal opisthokonts. PMID:27199347

  19. Quasichemical analysis of the cluster-pair approximation for the thermodynamics of proton hydration

    Energy Technology Data Exchange (ETDEWEB)

    Pollard, Travis [Department of Chemistry, University of Cincinnati, Cincinnati, Ohio 45221 (United States); Beck, Thomas L. [Department of Chemistry, University of Cincinnati, Cincinnati, Ohio 45221 (United States); Department of Physics, University of Cincinnati, Cincinnati, Ohio 45221 (United States)

    2014-06-14

    A theoretical analysis of the cluster-pair approximation (CPA) is presented based on the quasichemical theory of solutions. The sought single-ion hydration free energy of the proton includes an interfacial potential contribution by definition. It is shown, however, that the CPA involves an extra-thermodynamic assumption that does not guarantee uniform convergence to a bulk free energy value with increasing cluster size. A numerical test of the CPA is performed using the classical polarizable AMOEBA force field and supporting quantum chemical calculations. The enthalpy and free energy differences are computed for the kosmotropic Na{sup +}/F{sup −} ion pair in water clusters of size n = 5, 25, 105. Additional calculations are performed for the chaotropic Rb{sup +}/I{sup −} ion pair. A small shift in the proton hydration free energy and a larger shift in the hydration enthalpy, relative to the CPA values, are predicted based on the n = 105 simulations. The shifts arise from a combination of sequential hydration and interfacial potential effects. The AMOEBA and quantum chemical results suggest an electrochemical surface potential of water in the range −0.4 to −0.5 V. The physical content of single-ion free energies and implications for ion-water force field development are also discussed.

  20. Isolation and Genotyping of Acanthamoeba Strains from Envi-ron¬mental Sources in Ahvaz City, Khuzestan Province, South-ern Iran

    Directory of Open Access Journals (Sweden)

    M Rahdar

    2012-12-01

    Full Text Available Background: Acanthamoeba spp. are free-living amoebae commonly found in the environmental sources such as water, soil, and air. This ubiquitous amoeba is the causative agent of amoebic kerati­tis (AK. The objective of the present study was to investigate the presence of Acanthamoeba spp. in water and soil sources in Ahvaz City, Khuzestan Province, southern Iran.Methods: In general, 110 samples of water and soil were taken from different localities of Ahvaz including agricultural canals, rivers, and swimming pools. Filtration and cultivation were carried out on non-nutrient agar medium (NNA. Axenic cultivation was performed for all of positive isolates. PCR analysis was conducted on positive samples. Sequencing was done for 15 PCR products. Geno­types were identified by Blast search and homology analysis.Result: Acanthamoeba spp. was found in 43 (71.6% of samples of water and 13 (26% soil samples. Genotyping of 15 samples proved that Acanthamoeba belonged to T4 (86.6%, T2 (6.6%, and T5 (6.6% genotypes.Conclusion: TYI-S-33 medium could be better than PYG medium for Acanthamoeba axenic culture.

  1. Isolation and identification of naegleria species from environmental water in changchun, northeastern china.

    Directory of Open Access Journals (Sweden)

    Wei Wang

    2014-06-01

    Full Text Available Naegleria is a free-living amoeba, and pathogenic Naegleria may pose a health risk to people exposed to recreational water. Our objective in this study was to determine if there are pathogenic amoebae in environmental water samples from Changchun, Northeastern China.During July to September 2012, a total of 70 water samples were collected from Changchun, Northeastern China, and Naegleria was enriched by in vitro culture and detected by PCR using Naegleria genus-specific primers. Resulting PCR products were sequenced and phylogenetically analyzed to identify Naegleria species.Naegleria was detected in 65 (92.9% of 70 water samples. DNA sequence and phylogenetic analyses based on the internal transcribed spacer (ITS rDNA sequences revealed four Naegleria species, including N. pagei (n = 24 and N. Australiensis (n = 18, N. clarki (n = 13 and N. gruberi (n = 10, in which N. australiensis is pathogenic to mice. But the pathogenic species N. fowleri was not detected.This is the first report on Naegleria species in Northeastern China, showing that almost all environmental water samples were contaminated with Naegleria, including N. pagei, N. Australiensis, N. clarki and N. gruberi, which should be considered a potential public health threat.

  2. Encephalon Condition in Chronic Alcohol Intoxication and the Role of Amoebic Invasion of this Organ in the Development of Ethanol Attraction in Men

    Directory of Open Access Journals (Sweden)

    Sergey V. Shormanov

    2013-12-01

    Full Text Available This presentation reviews data from studies on the encephalon in 27 men ranging in age from 21 to 51 years, showing signs of chronic alcohol intoxication and who died from causes other than skull injury and 14 control subjects. The specimens were fixed in formalin or Karnua liquid, filled with paraffin and then examined, utilizing a variety of histological, histochemical and morphometric techniques. The data refers to the structural changes in the various tissue components of the brain (nervous, glia-cells, arteries, veins, as well as pertinent information concerning the presence of Protozoa in all the sections examined which according to their morphological signs and behavioral reactions indicate that amoeba had been present. The degree of cerebral tissue insemination by these parasites has been demonstrated. The condition of the membranes of these microorganisms, their cytoplasm, nucleus and nucleoli as well as the chromatoid corpuscles has been assessed and recorded. The ability of these microorganisms to split, migrate within the CNS limits, to trigger incitement and dystrophic changes and in the case of death – calcification or exulceration is shown. Further, the issue of species characteristics of amoeba occurring in the patients’ brains is discussed. The hypothesis of a possible link of amebic invasion with the development of alcohol dependence in humans is proposed.

  3. Characterization of a Trifunctional Mimivirus mRNA Capping Enzyme and Crystal Structure of the RNA Triphosphatase Domain

    Energy Technology Data Exchange (ETDEWEB)

    Benarroch,D.; Smith, P.; Shuman, S.

    2008-01-01

    The RNA triphosphatase (RTPase) components of the mRNA capping apparatus are a bellwether of eukaryal taxonomy. Fungal and protozoal RTPases belong to the triphosphate tunnel metalloenzyme (TTM) family, exemplified by yeast Cet1. Several large DNA viruses encode metal-dependent RTPases unrelated to the cysteinyl-phosphatase RTPases of their metazoan host organisms. The origins of DNA virus RTPases are unclear because they are structurally uncharacterized. Mimivirus, a giant virus of amoeba, resembles poxviruses in having a trifunctional capping enzyme composed of a metal-dependent RTPase module fused to guanylyltransferase (GTase) and guanine-N7 methyltransferase domains. The crystal structure of mimivirus RTPase reveals a minimized tunnel fold and an active site strikingly similar to that of Cet1. Unlike homodimeric fungal RTPases, mimivirus RTPase is a monomer. The mimivirus TTM-type RTPase-GTase fusion resembles the capping enzymes of amoebae, providing evidence that the ancestral large DNA virus acquired its capping enzyme from a unicellular host.

  4. Study of displacement efficiency and flow behavior of foamed gel in non-homogeneous porous media.

    Science.gov (United States)

    Wang, Yanling; Jin, Jiafeng; Bai, Baojun; Wei, Mingzhen

    2015-01-01

    Field trials have demonstrated that foamed gel is a very cost-effective technology for profile modification and water shut-off. However, the mechanisms of profile modification and flow behavior of foamed gel in non-homogeneous porous media are not yet well understood. In order to investigate these mechanisms and the interactions between foamed gel and oil in porous media, coreflooding and pore-scale visualization waterflooding experiments were performed in the laboratory. The results of the coreflooding experiment in non-homogeneous porous media showed that the displacement efficiency improved by approximately 30% after injecting a 0.3 pore volume of foamed gel, and was proportional to the pore volumes of the injected foamed gel. Additionally, the mid-high permeability zone can be selectively plugged by foamed gel, and then oil located in the low permeability zone will be displaced. The visualization images demonstrated that the amoeba effect and Jamin effect are the main mechanisms for enhancing oil recovery by foamed gel. Compared with conventional gel, a unique benefit of foamed gel is that it can pass through micropores by transforming into arbitrary shapes without rupturing, this phenomenon has been named the amoeba effect. Additionally, the stability of foam in the presence of crude oil also was investigated. Image and statistical analysis showed that these foams boast excellent oil resistance and elasticity, which allows them to work deep within formations. PMID:26030282

  5. Study of displacement efficiency and flow behavior of foamed gel in non-homogeneous porous media.

    Directory of Open Access Journals (Sweden)

    Yanling Wang

    Full Text Available Field trials have demonstrated that foamed gel is a very cost-effective technology for profile modification and water shut-off. However, the mechanisms of profile modification and flow behavior of foamed gel in non-homogeneous porous media are not yet well understood. In order to investigate these mechanisms and the interactions between foamed gel and oil in porous media, coreflooding and pore-scale visualization waterflooding experiments were performed in the laboratory. The results of the coreflooding experiment in non-homogeneous porous media showed that the displacement efficiency improved by approximately 30% after injecting a 0.3 pore volume of foamed gel, and was proportional to the pore volumes of the injected foamed gel. Additionally, the mid-high permeability zone can be selectively plugged by foamed gel, and then oil located in the low permeability zone will be displaced. The visualization images demonstrated that the amoeba effect and Jamin effect are the main mechanisms for enhancing oil recovery by foamed gel. Compared with conventional gel, a unique benefit of foamed gel is that it can pass through micropores by transforming into arbitrary shapes without rupturing, this phenomenon has been named the amoeba effect. Additionally, the stability of foam in the presence of crude oil also was investigated. Image and statistical analysis showed that these foams boast excellent oil resistance and elasticity, which allows them to work deep within formations.

  6. Developmental Cycle and Genome Analysis of "Rubidus massiliensis," a New Vermamoeba vermiformis Pathogen.

    Science.gov (United States)

    Bou Khalil, Jacques Y; Benamar, Samia; Baudoin, Jean-Pierre; Croce, Olivier; Blanc-Tailleur, Caroline; Pagnier, Isabelle; Raoult, Didier; La Scola, Bernard

    2016-01-01

    The study of amoeba-associated Chlamydiae is a dynamic field in which new species are increasingly reported. In the present work, we characterized the developmental cycle and analyzed the genome of a new member of this group associated with Vermamoeba vermiformis, we propose to name "Rubidus massiliensis." This bacterium is well-adapted to its amoeba host and do not reside inside of inclusion vacuoles after phagocytosis. It has a developmental cycle typical of this family of bacteria, with a transition from condensed elementary bodies to hypodense replicative reticulate bodies. Multiplication occurs through binary fission of the reticulate bodies. The genome of "R. massiliensis" consists of a 2.8 Mbp chromosome and two plasmids (pRm1, pRm2) consisting of 39,075 bp and 80,897 bp, respectively, a feature that is unique within this group. The Re-analysis of the Chlamydiales genomes including the one of "R. massiliensis" slightly modified the previous phylogeny of the tlc gene encoding the ADP/ATP translocase. Our analysis suggested that the tlc gene could have been transferred to plant and algal plastids before the transfer to Rickettsiales, and that this gene was probably duplicated several times. PMID:27014641

  7. Characteristics of microfauna and their relationships with the performance of an activated sludge plant in China

    Institute of Scientific and Technical Information of China (English)

    ZHOU Kexin; XU Muqi; LIU Biao; CAO Hong

    2008-01-01

    The occurrence and abundance of the microfauna groups were compared with the physico-chemical and operational parameters of the Baoding Lugang Sewage Treatment Plant in China. Attached and crawling ciliates were the dominant groups of ciliates. Crawling ciliates and testate amoebae showed a strong association with effluent BOD5 (biochemical oxygen demand). Therefore, these two groups are likely to be useful bioindicators since their number decreased as the process produced poor quality effluent. Testate amoebae also had significant negative correlations with effluent TN (total nitrogen), NH4+-N, SS (suspended solids) and SVI (sludge volumetric index), which means that this group of ciliates may be indicators of good performance of the activated sludge system. Carnivorous ciliates and flagellates had significant positive correlations with SVI, suggesting that these two groups may be indicators of bad settlement conditions of sludge. As identification of the microfauna species is difficult and time-consuming, we recommend using microfauna functional groups to evaluate the performance of the activated sludge system.

  8. Acanthamoeba produces disseminated infection in locusts and traverses the locust blood-brain barrier to invade the central nervous system

    Directory of Open Access Journals (Sweden)

    Kirk Ruth

    2010-07-01

    Full Text Available Abstract Background Many aspects of Acanthamoeba granulomatous encephalitis remain poorly understood, including host susceptibility and chronic colonization which represent important features of the spectrum of host-pathogen interactions. Previous studies have suggested locusts as a tractable model in which to study Acanthamoeba pathogenesis. Here we determined the mode of parasite invasion of the central nervous system (CNS. Results Using Acanthamoeba isolates belonging to the T1 and T4 genotypes, the findings revealed that amoebae induced sickness behaviour in locusts, as evidenced by reduced faecal output and weight loss and, eventually, leading to 100% mortality. Significant degenerative changes of various tissues were observed by histological sectioning. Both isolates produced disseminated infection, with viable amoebae being recovered from various tissues. Histological examination of the CNS showed that Acanthamoeba invaded the locust CNS, and this is associated with disruption of the perineurium cell/glial cell complex, which constitutes the locust blood-brain barrier. Conclusions This is the first study to demonstrate that Acanthamoeba invades locust brain by modulating the integrity of the insect's blood-brain barrier, a finding that is consistent with the human infection. These observations support the idea that locusts provide a tractable model to study Acanthamoeba encephalitis in vivo. In this way the locust model may generate potentially useful leads that can be tested subsequently in mammalian systems, thus replacing the use of vertebrates at an early stage, and reducing the numbers of mammals required overall.

  9. Number and regulation of protozoan aquaporins reflect environmental complexity.

    Science.gov (United States)

    Von Bülow, Julia; Beitz, Eric

    2015-08-01

    Protozoa are a diverse group of unicellular eukaryotes. Evidence has accumulated that protozoan aquaporin water and solute channels (AQP) contribute to adaptation in changing environments. Intracellular protozoan parasites live a well-sheltered life. Plasmodium spp. express a single AQP, Toxoplasma gondii two, while Trypanosoma cruzi and Leishamnia spp. encode up to five AQPs. Their AQPs are thought to import metabolic precursors and simultaneously to dispose of waste and to help parasites survive osmotic stress during transmission to and from the insect vector or during kidney passages. Trypanosoma brucei is a protozoan parasite that swims freely in the human blood. Expression and intracellular localization of the three T. brucei AQPs depend on the stage of differentiation during the life cycle, suggesting distinct roles in energy generation, metabolism, and cell motility. Free-living amoebae are in direct contact with the environment, encountering severe and sudden changes in the availability of nutrition, and in the osmotic conditions due to rainfall or drought. Amoeba proteus expresses a single AQP that is present in the contractile vacuole complex required for osmoregulation, whereas Dictyostelium discoideum expresses four AQPs, of which two are present in the single-celled amoeboidal stage and two more in the later multicellular stages preceding spore formation. The number and regulation of protozoan aquaporins may reflect environmental complexity. We highlight the gated AqpB from D. discoideum as an example of how life in the wild is challenged by a complex AQP structure-function relationship. PMID:26338868

  10. A Porous Simulation Experiment of Protozoa Movement with Glass Bead

    Institute of Scientific and Technical Information of China (English)

    LIU Hai-ming; ZHAO Xiao-rong; LI Gui-tong; LIN Qi-mei

    2003-01-01

    Protozoa can move due to their flagella, cilia or pseudopodia, and play an important role in the transformation and cycling of matter and energy in ecosystems. In this study, the glass beads with the diameters of 1.0, 0.5, 0.25 and 0.1 mm were used to simulate soil pores of 0. 292 - 0. 258, 0. 155 - 0.116, 0. 056- 0. 040 and 0. 028 - 0.020 mm respectively. Three typical soil protozoa of Bodo edax, Colpoda cucullus and Amoeba proteus were examined for the relation of their movement to pores. It was found that the smallest protozoan of Bodo edax could be leached through all the pores. However, no more than 26% of the added protozoan was leached out of the column. The leached protozoa were decreased with the pore sizes and leaching duration. The bigger one of Colpoda cucullus was moved out from the column filled with the glass beads of >0.5 mm in diameter. Less than about 15 % of the added protozoa were leached out of the column. The biggest one of Amoeba proteus could not leached out from any of the pores. It is evident that most of the protozoa remained in the column due to their occupation of the pores.

  11. Polarizable atomic multipole x-ray refinement: hydration geometry and application to macromolecules.

    Science.gov (United States)

    Fenn, Timothy D; Schnieders, Michael J; Brunger, Axel T; Pande, Vijay S

    2010-06-16

    We recently developed a polarizable atomic multipole refinement method assisted by the AMOEBA force field for macromolecular crystallography. Compared to standard refinement procedures, the method uses a more rigorous treatment of x-ray scattering and electrostatics that can significantly improve the resultant information contained in an atomic model. We applied this method to high-resolution lysozyme and trypsin data sets, and validated its utility for precisely describing biomolecular electron density, as indicated by a 0.4-0.6% decrease in the R- and R(free)-values, and a corresponding decrease in the relative energy of 0.4-0.8 Kcal/mol/residue. The re-refinements illustrate the ability of force-field electrostatics to orient water networks and catalytically relevant hydrogens, which can be used to make predictions regarding active site function, activity, and protein-ligand interaction energies. Re-refinement of a DNA crystal structure generates the zigzag spine pattern of hydrogen bonding in the minor groove without manual intervention. The polarizable atomic multipole electrostatics model implemented in the AMOEBA force field is applicable and informative for crystal structures solved at any resolution. PMID:20550911

  12. Structural, energetic and dynamical properties of sodiated oligoglycines: relevance of a polarizable force field.

    Science.gov (United States)

    Semrouni, David; Ohanessian, Gilles; Clavaguéra, Carine

    2010-04-14

    Oligoglycine peptides (from two to ten residues) complexed to the sodium ion were studied by quantum chemical and molecular mechanics calculations to understand their structural and energetic properties. Modeling such systems required the use of a polarizable force field and AMOEBA, as developed by Ren and Ponder [J. Comput. Chem., 2002, 23, 1497], was chosen. Some electrostatic and torsional parameters were re-optimized using a rigorous procedure and validated against both geometric and energetic ab initio data in the gas phase. Molecular dynamics simulations were performed on seven sodiated octa-glycine (G(8)) structures. Structural transitions were generally observed (with the notable exception of the a-helix), leading to new structures that were further proved by ab initio calculations to be of low energies. The main result is that for G(8)-Na(+), there is a compromise between sodium peptide interactions and multiple hydrogen bonding. The accuracy achieved with AMOEBA demonstrates the potential of this force field for the realistic modeling of gaseous peptides. PMID:20355287

  13. A Polarizable Multipole-based Force Field for Dimethyl and Trimethyl Phosphate

    Science.gov (United States)

    Zhang, Changsheng; Lu, Chao; Wang, Qiantao; Ponder, Jay W.; Ren, Pengyu

    2016-01-01

    Using quantum mechanical studies and liquid phase simulations, the AMOEBA force field for dimethylphosphate (DMP) ion and trimethylphosphate (TMP) has been developed. Based on ab initio calculations, it was found that ion binding and the solution environment significantly impact both the molecular geometry and the energy differences between conformations. Atomic multipole moments are derived from MP2/cc-pVQZ calculations of methyl phosphates at several conformations with accounting of chemical environments. Many-body polarization is handled via a Thole-style induction model using distributed atomic polarizabilities. Van der Waals parameters of phosphate and oxygen atoms are determined by fitting to the quantum mechanical interaction energy curves for water with DMP or TMP. Additional stretch-torsion and angle-torsion coupling terms were introduced in order to capture asymmetry in P-O bond lengths and angles due to the generalized anomeric effect. The resulting force field for DMP and TMP is able to accurately describe both the molecular structure and conformational energy surface, including bond and angle variations with conformation, as well as interaction of both species with water and metal ions. The force field was further validated for liquid TMP by comparing simulated density and heat of vaporization values with experimental data. Structural insight obtained from MD simulations indicates liquid TMP is stabilized by both nonpolar-nonpolar contacts and hydrogen bonding. The current study is an important step towards developing the AMOEBA model for nucleic acids. PMID:26574325

  14. An Anisotropic Coarse-Grained Model for Proteins Based On Gay-Berne and Electric Multipole Potentials.

    Science.gov (United States)

    Shen, Hujun; Li, Yan; Ren, Pengyu; Zhang, Dinglin; Li, Guohui

    2014-02-10

    Gay-Berne anisotropic potential has been widely used to evaluate the non-bonded interactions between coarse-grained particles being described as elliptical rigid bodies. In this paper, we are presenting a coarse-grained model for twenty kinds of amino acids and proteins, based on the anisotropic Gay-Berne and point electric multipole (EMP) potentials. We demonstrate that the anisotropic coarse-grained model, namely GBEMP model, is able to reproduce many key features observed from experimental protein structures (Dunbrack Library) as well as from atomistic force field simulations (using AMOEBA, AMBER and CHARMM force fields) while saving the computational cost by a factor of about 10~200 depending on specific cases and atomistic models. More importantly, unlike other coarse-grained approaches, our framework is based on the fundamental intermolecular forces with explicit treatment of electrostatic and repulsion-dispersion forces. As a result, the coarse-grained protein model presented an accurate description of non-bonded interactions (particularly electrostatic component) between hetero-/homo-dimers (such as peptide-peptide, peptide-water). In addition, the encouraging performance of the model was reflected by the excellent correlation between GBEMP and AMOEBA models in the calculations of the dipole moment of peptides. In brief, the GBEMP model given here is general and transferable, suitable for simulating complex biomolecular systems. PMID:24659927

  15. Characterization of Intracellular Streaming and Traction Forces in Migrating Physarum Plasmodia

    Science.gov (United States)

    Zhang, Shun; Meili, Ruedi; Guy, Robert; Lasheras, Juan; Del Alamo, Juan C.

    2014-11-01

    Physarum plasmodium is a model organism for cell migration that exhibits fast intracellular streaming. Single amoebae were seeded and allowed to move on polyacrilamide gels that contained 0.5-micron fluorescent beads. Joint time-lapse sequences of intracellular streaming and gel deformation were acquired respectively in the bright and fluorescent fields under microscope. These images were analyzed using particle image velocimetry (PIV) algorithms, and the traction stresses applied by the amoebae on the surface were computed by solving the elastostatic equation for the gel using the measured bead displacements as boundary conditions. These measurements provide, for the first time, a joint characterization of intracellular mass transport and the forces applied on the substrate of motile amoeboid cells with high resolution in both time and space, enables a through study about the locomotive mechanism and the relation between intracellular flow and traction stress, shedding light on related biomimetic research. The results reveal a pronounced auto-oscillation character in intracellular flow, contact area, centroid speed and strain energy, all with the same periodicity about 100 seconds. Locomotion modes that were distinct in flow/ traction stress pattern as well as migration speed have been discovered and studied.

  16. Signaling through the phosphatidylinositol 3-kinase regulates mechanotaxis induced by local low magnetic forces in Entamoeba histolytica.

    Science.gov (United States)

    Rivière, C; Marion, S; Guillén, N; Bacri, J-C; Gazeau, F; Wilhelm, C

    2007-01-01

    In micro-organisms, as well as in metazoan cells, cellular polarization and directed migration are finely regulated by external stimuli, including mechanical stresses. The mechanisms sustaining the transduction of such external stresses into intracellular biochemical signals remain mainly unknown. Using an external magnetic tip, we generated a magnetic field gradient that allows migration analysis of cells submitted to local low-intensity magnetic forces (50 pN). We applied our system to the amoeba Entamoeba histolytica. Indeed, motility and chemotaxis are key activities that allow this parasite to invade and destroy the human tissues during amoebiasis. The magnetic force was applied either inside the cytoplasm or externally at the rear pole of the amoeba. We observed that the application of an intracellular force did not affect cell polarization and migration, whereas the application of the force at the rear pole of the cell induced a persistent polarization and strongly directional motion, almost directly opposed to the magnetic force. This phenomenon was completely abolished when phosphatidylinositol 3-kinase activity was inhibited by wortmanin. This result demonstrated that the applied mechanical stimulus was transduced and amplified into an intracellular biochemical signal, a process that allows such low-intensity force to strongly modify the migration behavior of the cell. PMID:16406381

  17. Quasichemical analysis of the cluster-pair approximation for the thermodynamics of proton hydration

    Science.gov (United States)

    Pollard, Travis; Beck, Thomas L.

    2014-06-01

    A theoretical analysis of the cluster-pair approximation (CPA) is presented based on the quasichemical theory of solutions. The sought single-ion hydration free energy of the proton includes an interfacial potential contribution by definition. It is shown, however, that the CPA involves an extra-thermodynamic assumption that does not guarantee uniform convergence to a bulk free energy value with increasing cluster size. A numerical test of the CPA is performed using the classical polarizable AMOEBA force field and supporting quantum chemical calculations. The enthalpy and free energy differences are computed for the kosmotropic Na+/F- ion pair in water clusters of size n = 5, 25, 105. Additional calculations are performed for the chaotropic Rb+/I- ion pair. A small shift in the proton hydration free energy and a larger shift in the hydration enthalpy, relative to the CPA values, are predicted based on the n = 105 simulations. The shifts arise from a combination of sequential hydration and interfacial potential effects. The AMOEBA and quantum chemical results suggest an electrochemical surface potential of water in the range -0.4 to -0.5 V. The physical content of single-ion free energies and implications for ion-water force field development are also discussed.

  18. Calculations of the electric fields in liquid solutions.

    Science.gov (United States)

    Fried, Stephen D; Wang, Lee-Ping; Boxer, Steven G; Ren, Pengyu; Pande, Vijay S

    2013-12-19

    The electric field created by a condensed-phase environment is a powerful and convenient descriptor for intermolecular interactions. Not only does it provide a unifying language to compare many different types of interactions, but it also possesses clear connections to experimental observables, such as vibrational Stark effects. We calculate here the electric fields experienced by a vibrational chromophore (the carbonyl group of acetophenone) in an array of solvents of diverse polarities using molecular dynamics simulations with the AMOEBA polarizable force field. The mean and variance of the calculated electric fields correlate well with solvent-induced frequency shifts and band broadening, suggesting Stark effects as the underlying mechanism of these key solution-phase spectral effects. Compared to fixed-charge and continuum models, AMOEBA was the only model examined that could describe nonpolar, polar, and hydrogen bonding environments in a consistent fashion. Nevertheless, we found that fixed-charge force fields and continuum models were able to replicate some results of the polarizable simulations accurately, allowing us to clearly identify which properties and situations require explicit polarization and/or atomistic representations to be modeled properly, and to identify for which properties and situations simpler models are sufficient. We also discuss the ramifications of these results for modeling electrostatics in complex environments, such as proteins. PMID:24304155

  19. Quasichemical analysis of the cluster-pair approximation for the thermodynamics of proton hydration

    International Nuclear Information System (INIS)

    A theoretical analysis of the cluster-pair approximation (CPA) is presented based on the quasichemical theory of solutions. The sought single-ion hydration free energy of the proton includes an interfacial potential contribution by definition. It is shown, however, that the CPA involves an extra-thermodynamic assumption that does not guarantee uniform convergence to a bulk free energy value with increasing cluster size. A numerical test of the CPA is performed using the classical polarizable AMOEBA force field and supporting quantum chemical calculations. The enthalpy and free energy differences are computed for the kosmotropic Na+/F− ion pair in water clusters of size n = 5, 25, 105. Additional calculations are performed for the chaotropic Rb+/I− ion pair. A small shift in the proton hydration free energy and a larger shift in the hydration enthalpy, relative to the CPA values, are predicted based on the n = 105 simulations. The shifts arise from a combination of sequential hydration and interfacial potential effects. The AMOEBA and quantum chemical results suggest an electrochemical surface potential of water in the range −0.4 to −0.5 V. The physical content of single-ion free energies and implications for ion-water force field development are also discussed

  20. Prediction of organic molecular crystal geometries from MP2-level fragment quantum mechanical/molecular mechanical calculations

    Science.gov (United States)

    Nanda, Kaushik D.; Beran, Gregory J. O.

    2012-11-01

    The fragment-based hybrid many-body interaction (HMBI) model provides a computationally affordable means of applying electronic structure wavefunction methods to molecular crystals. It combines a quantum mechanical treatment of individual molecules in the unit cell and their short-range pairwise interactions with a polarizable molecular mechanics force-field treatment of long-range and many-body interactions. Here, we report the implementation of analytic nuclear gradients for the periodic model to enable full relaxation of both the atomic positions and crystal lattice parameters. Using a set of five, chemically diverse molecular crystals, we compare the quality of the HMBI MP2/aug-cc-pVDZ-level structures with those obtained from dispersion-corrected periodic density functional theory, B3LYP-D*, and from the Amoeba polarizable force field. The MP2-level structures largely agree with the experimental lattice parameters to within 2%, and the root-mean-square deviations in the atomic coordinates are less than 0.2 Å. These MP2 structures are almost as good as those predicted from periodic B3LYP-D*/TZP and are significantly better than those obtained with B3LYP-D*/6-31G(d,p) or with the Amoeba force field.

  1. The Ste20-like kinase SvkA of Dictyostelium discoideum is essential for late stages of cytokinesis.

    Science.gov (United States)

    Rohlfs, Meino; Arasada, Rajesh; Batsios, Petros; Janzen, Julia; Schleicher, Michael

    2007-12-15

    The genome of the social amoeba Dictyostelium discoideum encodes approximately 285 kinases, which represents approximately 2.6% of the total genome and suggests a signaling complexity similar to that of yeasts and humans. The behavior of D. discoideum as an amoeba and during development relies heavily on fast rearrangements of the actin cytoskeleton. Here, we describe the knockout phenotype of the svkA gene encoding severin kinase, a homolog of the human MST3, MST4 and YSK1 kinases. SvkA-knockout cells show drastic defects in cytokinesis, development and directed slug movement. The defect in cytokinesis is most prominent, leading to multinucleated cells sometimes with >30 nuclei. The defect arises from the frequent inability of svkA-knockout cells to maintain symmetry during formation of the cleavage furrow and to sever the last cytosolic connection. We demonstrate that GFP-SvkA is enriched at the centrosome and localizes to the midzone during the final stage of cell division. This distribution is mediated by the C-terminal half of the kinase, whereas a rescue of the phenotypic changes requires the active N-terminal kinase domain as well. The data suggest that SvkA is part of a regulatory pathway from the centrosome to the midzone, thus regulating the completion of cell division. PMID:18042625

  2. Presence of Acanthamoeba spp.in water purification plants in southern England

    Institute of Scientific and Technical Information of China (English)

    Shanmuganathan V; Khan NA

    2009-01-01

    Objective:To identify the prevalence of Acanthamoeba in drinking water treatment plants during the course of the purification processes.Methods:Samples were taken from two drinking water purification plants and moni-tored for the presence of Acanthamoeba in order to estimate the removal capacity of treatment methods em-ployed.Water samples were collected at each step in the purification,during the one year survey,and ana-lysed for the presence of Acanthamoeba spp.by plating on bacterial-seeded plates.Results:The results showed that amoebae were present in surface raw waters in 100 % of the samples tested.Acanthamoeba spp.were iso-lated from 71 % and 57 % of the water samples collected from post flat-bottom clarifier 1 and post-sedimenta-tion plant respectively.Considering the outflow drinking waters,the removal capacity was 100 % in both puri-fication plants monitored.The occurrence of Acanthamoeba was not associated with seasonality.Conclusion:These findings confirm that water purification plants employing methods of flocculation,sedimentation,and fil-tration in combination with activated charcoal filtration,ozonisation and chlorination exhibited sufficient Acan-thamoeba removal capacity and the presence of amoebae in the tap water may be due to older plumbing,water storage tanks,tap water hygiene,and /or environmental settings.

  3. Response of peatland ecosystem to climatic changes in Central-Eastern Europe: a long-term ecological approach

    Science.gov (United States)

    Slowinska, S.; Marcisz, K.; Slowinski, M. M.; Lamentowicz, M.; Lamentowicz, L.; Mitchell, E. A.

    2013-12-01

    Northern peatlands play a major role in the global carbon cycle, and they are valuable archives of the past environmental change. The functioning of these ecosystems depends on the feedback between biotic and abiotic factors that are still not fully understood. In our study we investigated relationships between hydrological (groundwater level fluctuations, hydrochemistry), meteorological conditions near the ground (air temperature and humidity, photosynthetically active radiation, leaf wetness, temperature and moisture of Sphagnum) and biological factors: vegetation patterns, Sphagnum mosses growth and testate amoebae (Protists) composition. We designed a long-term ecological study site in a Sphagnum mire in Northern Poland that consisted of five meteorological micro stations and eleven piezometers located in two transects at 5,95 ha area. During the growing season 2012 we observed significant differences between plots in terms of micrometeorological and hydrological conditions that resulted in different Sphagnum increments and seasonal dynamics of testate amoebae communities. Our study is very important to better understand how temperate peatlands react to the climatic change and recent warming. Obtained results revealed a high sensitivity of bog ecosystem to e.g. short-term heat waves. Further research will be conducted to model a potential response of Sphagnum peatland to the future climate change. Project supported by Polish National Science Centre grant No. NN306060940 and the grant PSPB-013/2010 from Switzerland through the Swiss Contribution to the enlarged European Union.

  4. Effects of a 50 Hz magnetic field on Dictyostelium discoideum (Protista).

    Science.gov (United States)

    Amaroli, Andrea; Trielli, Francesca; Bianco, Bruno; Giordano, Stefano; Moggia, Elsa; Corrado, Maria Umberta Delmonte

    2006-10-01

    Some studies have demonstrated that a few biological systems are affected by weak, extremely low frequency (ELF) electromagnetic fields (EMFs), lower than 10 mT. However, to date there is scanty evidence of this effect on Protists in the literature. Due to their peculiarity as single-cell eukaryotic organisms, Protists respond directly to environmental stimuli, thus appearing as very suitable experimental systems. Recently, we showed the presence of propionylcholinesterase (PrChE) activity in single-cell amoebae of Dictyostelium discoideum. This enzyme activity was assumed to be involved in cell-cell and cell-environment interactions, as its inhibition affects cell aggregation and differentiation. In this work, we have exposed single-cell amoebae of D. discoideum to an ELF-EMF of about 200 microT, 50 Hz, for 3 h or 24 h at 21 degrees C. A delay in the early phase of the differentiation was observed in 3 h exposed cells, and a significant decrease in the fission rate appeared in 24 h exposed cells. The PrChE activity was significantly lower in 3 h exposed cells than in the controls, whereas 24 h exposed cells exhibited an increase in this enzyme activity. However, such effects appeared to be transient, as the fission rate and PrChE activity values returned to the respective control values after a 24 h stay under standard conditions. PMID:16715524

  5. Effect of Clinoptilolite and Sepiolite Nanoclays on Human and Parasitic Highly Phagocytic Cells

    Science.gov (United States)

    Toledano-Magaña, Yanis; Flores-Santos, Leticia; Montes de Oca, Georgina; González-Montiel, Alfonso; Laclette, Juan-Pedro; Carrero, Julio-César

    2015-01-01

    Nanoclays have potential applications in biomedicine raising the need to evaluate their toxicity in in vitro models as a first approach to its biocompatibility. In this study, in vitro toxicity of clinoptilolite and sepiolite nanoclays (NC) was analyzed in highly phagocytic cultures of amoebas and human and mice macrophages. While amebic viability was significantly affected only by sepiolite NC at concentrations higher than 0.1 mg/mL, the effect on macrophage cultures was dependent on the origin of the cells. Macrophages derived from human peripheral blood monocytes were less affected in viability (25% decrease at 48 h), followed by the RAW 264.7 cell line (40%), and finally, macrophages derived from mice bone marrow monocytes (98%). Moreover, the cell line and mice macrophages die mainly by necrosis, whereas human macrophages exhibit increased apoptosis. Cytokine expression analysis in media of sepiolite NC treated cultures showed a proinflammatory profile (INFγ, IL-1α, IL-8, and IL-6), in contrast with clinoptilolite NC that induced lees cytokines with concomitant production of IL-10. The results show that sepiolite NC is more toxic to amoebas and macrophages than clinoptilolite NC, mostly in a time and dose-dependent manner. However, the effect of sepiolite NC was comparable with talc powder suggesting that both NC have low cytotoxicity in vitro. PMID:26090385

  6. Few apparent short-term effects of elevated soil temperature and increased frequency of summer precipitation on the abundance and taxonomic diversity of desert soil micro- and meso-fauna

    Science.gov (United States)

    Darby, B.J.; Neher, D.A.; Housman, D.C.; Belnap, J.

    2011-01-01

    Frequent hydration and drying of soils in arid systems can accelerate desert carbon and nitrogen mobilization due to respiration, microbial death, and release of intracellular solutes. Because desert microinvertebrates can mediate nutrient cycling, and the autotrophic components of crusts are known to be sensitive to rapid desiccation due to elevated temperatures after wetting events, we studied whether altered soil temperature and frequency of summer precipitation can also affect the composition of food web consumer functional groups. We conducted a two-year field study with experimentally-elevated temperature and frequency of summer precipitation in the Colorado Plateau desert, measuring the change in abundance of nematodes, protozoans, and microarthropods. We hypothesized that microfauna would be more adversely affected by the combination of elevated temperature and frequency of summer precipitation than either effect alone, as found previously for phototrophic crust biota. Microfauna experienced normal seasonal fluctuations in abundance, but the effect of elevated temperature and frequency of summer precipitation was statistically non-significant for most microfaunal groups, except amoebae. The seasonal increase in abundance of amoebae was reduced with combined elevated temperature and increased frequency of summer precipitation compared to either treatment alone, but comparable with control (untreated) plots. Based on our findings, we suggest that desert soil microfauna are relatively more tolerant to increases in ambient temperature and frequency of summer precipitation than the autotrophic components of biological soil crust at the surface.

  7. Microbiological quality in the Zacatepec's aquifer, Morelos, Mexico; Calidad microbiologica del acuifero de Zacatepec, Morelos, Mexico

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez, Elizabeth; Robles, Esperanza; Sainz, Ma. Guadalupe; Ayala, Reynaldo; Campoy, Emelia [Facultad de Estudios Superiores, Iztacala, Universidad Nacional Autonoma de Mexico, Tlalnepantla, Estado de Mexico (Mexico)]. E-mail: erf@servidor.unam.mx

    2009-11-15

    Groundwater is one of the main supply sources of drinking water in Mexico, as they support a poor biological community, because of their low contain of nutrients. However in the recent years, human activities and urban growth are the main factors of aquifer contamination. Therefore, water may contain chemical contaminants and microorganisms that can cause several diseases; such is the case of free-living amoebae (FLA). The objective of this research is to determine the microbiological quality (total coliforms, fecal coliforms and free-living amoebae) of Zacatepec aquifer, in the state of Morelos. Monthly samplings of thirteen wells of the aquifer were carried out during one year. The following physicochemical parameters were measure in situ: pH, dissolved oxygen (DO) and temperature. Total and fecal coliforms were determined by the membrane filter technique. Free-living amoebae were cultured on non-nutritive agar medium (NNE); the identification was carried out taking in account their morphological features. All the wells were polluted with total coliforms, one with a geometric mean of 107 CFU/100 mL. Fecal coliforms were absent in four wells; nevertheless, one presented a geometric mean of 107 CFU/100 mL. The most polluted well was number 3, and the months with more bacteria were April and July. Free-living amoebae were isolated in all the wells, the highest isolation number was found in well number 2, while the lowest were found in wells 4, 5, and 10. December and January were the months with the highest number of amoebae, and April with the lowest. Twenty two species belonging to 16 genera were isolated; the most frequent was Hartmannella with 38 %; this amoeba has not been reported as pathogenic, but it has been associated to ocular and brain infections in humans. Of the pathogenic amoebae, Acanthamoeba was isolated, but with a low frequency (6.7 %). Physicochemical parameters had low seasonal variation, pH was close to neutrality in a range of 6.4 to 7

  8. Current Status of Acanthamoeba in Iran: A Narrative Review Article.

    Directory of Open Access Journals (Sweden)

    Maryam Niyyati

    2015-06-01

    Full Text Available Free-living amoebae belonging to the genus Acanthamoeba have an environmental distribution. Amoebic keratitis due to these protozoan parasites continue to rise in Iran and worldwide. In Iran, there are various researches regarding both morphological and molecular identification of Acanthamoeba spp. in environmental and clinical samples. However, there is no thorough review about Acanthamoeba genotypes and their distribution in environmental sources such as water, dust and biofilm in Iran. Besides, according to increasing cases of Amoebic keratitis in the region awareness regarding the pathogenic potential of these sight-threatening amoebae is of utmost importance.We conducted a thorough review based on the database sources such as MEDLINE, PubMed and Google scholar. No restrictions were placed on study date, study design or language of publication. We searched all valuable and relevant information considering the occurrence of the Acanthamoeba in both environmental and clinical samples.According to our thorough review Acanthamoeba belonging to T4 genotype is the most prevalent type strain in environmental and clinical samples in several regions in Iran and worldwide, however, there are reports regarding Acanthamoeba belonging to other genotypes such as T2, T3, T5, T6 and T11 and the mentioned point could leads us to more researches with the goal of presenting the real genotype dominance of Acanthamoeba and related disease in the country.Overall, the present review will focus on present status of genotypes of Acanthamoeba in Iran during recent years.

  9. 'Dicty dynamics': Dictyostelium motility as persistent random motion

    International Nuclear Information System (INIS)

    We model the motility of Dictyostelium cells in a systematic data-driven manner. We deduce a minimal dynamical model that reproduces the statistical features of experimental trajectories. These are trajectories of the centroid of the cell perimeter, which is more sensitive to pseudopod activity than the usual tracking by centroid or nucleus. Our data account for cell individuality and dictate a model that extends the cell-type specific models recently derived for mammalian cells. Two generalized Langevin equations model stochastic periodic pseudopod motion parallel and orthogonal to the amoeba's direction of motion. This motion propels the amoeba with a random periodic left–right waddle in a direction that has a long persistence time. The model fully accounts for the statistics of the experimental trajectories, including velocity power spectra and auto-correlations, non-Gaussian velocity distributions, and multiplicative noise. Thus, we find neither need nor place in our data for an interpretation in terms of anomalous diffusion. The model faithfully captures cell individuality as different parameter values in the model, and serves as a basis for integrating the local mechanics of cell motion with our observed long-term behavior

  10. Beyond Rab GTPases Legionella activates the small GTPase Ran to promote microtubule polymerization, pathogen vacuole motility, and infection

    Science.gov (United States)

    Hilbi, Hubert; Rothmeier, Eva; Hoffmann, Christine; Harrison, Christopher F

    2014-01-01

    Legionella spp. are amoebae-resistant environmental bacteria that replicate in free-living protozoa in a distinct compartment, the Legionella-containing vacuole (LCV). Upon transmission of Legionella pneumophila to the lung, the pathogens employ an evolutionarily conserved mechanism to grow in LCVs within alveolar macrophages, thus triggering a severe pneumonia termed Legionnaires’ disease. LCV formation is a complex and robust process, which requires the bacterial Icm/Dot type IV secretion system and involves the amazing number of 300 different translocated effector proteins. LCVs interact with the host cell's endosomal and secretory vesicle trafficking pathway. Accordingly, in a proteomics approach as many as 12 small Rab GTPases implicated in endosomal and secretory vesicle trafficking were identified and validated as LCV components. Moreover, the small GTPase Ran and its effector protein RanBP1 have been found to decorate the pathogen vacuole. Ran regulates nucleo-cytoplasmic transport, spindle assembly, and cytokinesis, as well as the organization of non-centrosomal microtubules. In L. pneumophila-infected amoebae or macrophages, Ran and RanBP1 localize to LCVs, and the small GTPase is activated by the Icm/Dot substrate LegG1. Ran activation by LegG1 leads to microtubule stabilization and promotes intracellular pathogen vacuole motility and bacterial growth, as well as chemotaxis and migration of Legionella-infected cells. PMID:25496424

  11. [Electron-microscopic studies on fine structure and enzyme activity in the axenic and conventional strains of Entamoeba histolytica

    Science.gov (United States)

    Yong, Tai Soon; Chung, Pyung Rim; Lee, Keun Tae

    1985-12-01

    The metabolism of Entamoeba histolytica would be affected by various environmental factors, and alteration of the environment was known to affect the fine structure of E. histolytica. The present study was designed electronmicroscopically to investigate the ultrastructure and enzyme activities in the axenic and conventional strains of E. histolytica. The trophozoites of axenically cultivated HK-9 strain and conventional YS-27 and YS-49 strains of E. histolytica were collected and fixed with 4 percent paraformaldehyde/0.1 M cacodylate buffer (pH 7.4). After washing them by centrifugation, 1 percent warm agar was added in the sediment. Solidified agar with the trophozoites was cut into 1 mm(3) cubes, and incubated in the various substrates to observe enzyme activities. Then, the specimen was post-fixed with 3 percent glutaraldehyde/0.1 M cacodylate buffer (pH 7.4) and 1 percent osmium tetroxide/0.1 M cacodylate buffer (pH 7.4), dehydrated in ascending ethanol series and embedded in epoxy resin. These were sectioned on an ultramicrotome and observed with a transmission electron microscope. The procedures for the observation of the fine structure were same as the above, except for the incubation in the substrate. The sections were stained with uranyl scetate and lead citrate. For the observation of the surface of the amoebae, scanning electron microscopy was carried out. The results obtained in the present study are summarized as follows: 1. The fuzzy coat around double-layered plasma membrane of E. histolytica was more irregularly and densely distributed in the conventional strains (YS-27, YS-49 strains) than in the axenic strain (HK-9 strain). 2. The endosomes, button bodies and chromatin material were surrounded by a double-layered nuclear membrane having scattered nuclear pores. The paranuclear body, mono- or double-layered vacuoles, vacuolar membrane whorls, rosette-like cylindrical bodies, aggregation of cylindrical bodies and helical bodies were found in the

  12. Ecological paradigm of legionella: a revision. New strategy and its implication in public health Revisión del paradigma ecológico de la 'legionella'. Estrategia ecológica y su implicación en salud pública

    Directory of Open Access Journals (Sweden)

    José Bernardo Ferrer Simó

    2008-12-01

    Full Text Available Some aspects difficultly explained by the ecological model described by Rowbothan in 1980, as the abnormally low infectious dose, the long distances in which bacteria remains viable in the aerosol, the difficulty of growth in the standard culture media, the low efficiency of the antilegionela disinfectants, in the control of the outbreaks, the reinfection or the absence of 'person to person' transmission, are analyzed from an ecological microbiology standpoint. Focused on the bacterium-protozoo relationship , several studies suggest that bacterial growth might take place in two functionally different phases or stages, according to the proportion or ratio bacterium-amoeba (MOI-multiplicity of infection. In the first phase of rapid growth, in which this relationship is substantially low, the entry of Legionella bacterium in the amoeba would originate a unique vacuole, which after amebian lyses, it would liberate free infectants forms for other amoebae. During the second stage, of dissemination or settling of other ecological niches, with high MOI ratios, several growth vesicles are produced inside the amoeba and are expelled without lyses. The deadlock of the amoeba in this phase, is produced after the massive liberation of the vesicles. Some authors suggest that these vesicles are the infectant nuclei of the legionelosis transmission because of his resistance and alive-legionela packing characteristics. The presence of a specific biofilm might be determinant in this process. Keeping in mind this amoeba-legionela relationship-interaction system, the preventive measures should go directed to supporting the MOI relation low, always in conjunction with low levels of biofilm. In this respect, the addition of in continue antilegionela disinfectants substances seems to be indispensable. Reached the phase of dissemination (only fits the cleanliness is the unique measure of action. The research on specific mechanisms of legionela-amoeba invasion would be

  13. Efficacy of hand held, inexpensive UV light sources on Acanthamoeba, causative organism in amoebic keratitis

    Directory of Open Access Journals (Sweden)

    Ivan Cometa

    2010-01-01

    Full Text Available Ivan Cometa1, Andrew Rogerson1, Scott Schatz21Department of Biology, California State University Fresno, Fresno, CA, USA; 2Arizona College of Optometry, Midwestern University, Glendale, AZ, USAAbstract: Multipurpose lens cleaning solutions (MPS fail to consistently kill or inactivate Acanthamoeba cysts and UV irradiation, while effective at high doses, can damage contact lenses. The present study considered synergy of action between MPS and hand-held inexpensive (ie, relatively weak UV irradiation units. Regardless of disinfection method recently formed cysts (<10 days were far more susceptible to treatment than mature cysts (>14 days. This has important implications for future protocols on testing methods for killing amoebae. The study also showed that cysts of different strains (two tested, FLA2 and P120 are variable in their response to MPS, presumably reflecting differences in cyst wall structure and thus permeability to the disinfectant. On the other hand, the effect of UV irradiation was not wall structure dependent. A 6-hour treatment with MPS alone killed trophic amoebae but failed to kill any mature cysts. Cysts of strain FLA2 were killed after 24 hours with MPS but cysts of strain P120 survived. UV irradiation with the larger 4 W unit killed all cysts after 7 minutes and was more effective than the smaller battery-powered unit (after 10 minutes about 50% of cysts were killed. When the larger unit was used with the MPS disinfection, all trophozoites were killed using UV for 3 minutes and MPS for 1 hour. The resistant P120 cysts remained a challenge but a 2- to 4-minute UV treatment followed by MPS for 3 or 6 hours reduced mature cyst survival by about 50%. The small unit in combination with MPS was less effective but did reduce the time required to kill trophic amoebae in MPS (6 hours MPS alone versus 3 hours MPS with a 1-minute UV treatment. In short, inexpensive UV units do enhance MPS disinfection and future lens cleaning systems

  14. EFEKTIFITAS PENGELOLAAN DAERAH PERLINDUNGAN LAUT (STUDI KASUS DESA MATTIRO LABANGENG KABUPATEN PANGKEP

    Directory of Open Access Journals (Sweden)

    Dafiuddin Salim

    2014-10-01

    Full Text Available Makalah ini menilai efektivitas manajemen di Marine Sanctuary (Daerah Perlindungan Laut atau DPL dari Mattiro Labangeng Kabupaten Village-Pangkep. Hal ini menunjukkan bahwa dampak dan efektivitas proses manajemen dinilai menggunakan indikator, termasuk indikator biofisik, sosial ekonomi dan institusi. Hasil penelitian menunjukkan bahwa ada dampak positif dalam beberapa indikator ekologi (karang, ikan dan benthos, sosio-ekonomi dan institusi. The increasion total persen tutupan karang diikuti oleh kelompok meningkatkan ikan karang (indikator, target dan jurusan dan benthos organisme di DPL. Dari sudut ekonomi ini pandangan, nilai-nilai ekonomi terumbu karang sumber daya dari kegiatan perikanan sebelum dan sesudah DPL adalah Rp 42,635,910.51/ha/tahun dan Rp 52,084,390.18/ha/tahun, masing-masing. Efektivitas DPL ini ditunjukkan oleh grafik teknik Amoeba dan hasil yang disajikan nilai-nilai positif. Ringkasan adalah nilai indikator saat ini lebih besar dari nilai ambang batas kritis / CTV.Kata Kunci: CTV, efektivitas, indikator, perlindungan laut, teknik amubaTHE EFFECTIVITY OF MARINE SANCTUARY MANAGEMENT (CASE STUDY OF MATTIRO VILLAGE OF LABANGENG PANGKEP DISTRICTABSTRAKThis paper is assessing management effectiveness in Marine Sanctuary (Daerah Perlindungan Laut or DPL of Mattiro Labangeng Village-Pangkep Regency. It is showed that impacts and effectiveness of the management process was assessed using indicators, includes biophysical, socio-economic and institution indicators. The results showed that there are positive impacts in some indicators of ecology (corals, fish and benthos, socio-economic and institution. The increasion in percent total of coral cover was followed by the increasing groups of reef fish (indicators, targets, and majors and benthos organisms in DPL. From economic’s point of views, the economic values of coral reefs resource from fisheries activities before and after DPL were Rp 42,635,910.51/ha/year and Rp 52,084,390.18/ha

  15. Development of Polarizable Models for Molecular Mechanical Calculations IV: van der Waals parameterization

    Science.gov (United States)

    Wang, Junmei; Cieplak, Piotr; Li, Jie; Cai, Qin; Hsieh, MengJuei; Luo, Ray; Duan, Yong

    2012-01-01

    In the previous publications of this series, we presented a set of Thole induced dipole interaction models using four types of screening functions. In this work, we document our effort to refine the van der Waals parameters for the Thole polarizable models. Following the philosophy of AMBER force field development, the van der Waals (vdW) parameters were tuned for the Thole model with linear screening function to reproduce both the ab initio interaction energies and the experimental densities of pure liquids. An in-house genetic algorithm was applied to maximize the fitness of “chromosomes” which is a function of the root-mean-square errors (RMSE) of interaction energy and liquid density. To efficiently explore the vdW parameter space, a novel approach was developed to estimate the liquid densities for a given vdW parameter set using the mean residue-residue interaction energies through interpolation/extrapolation. This approach allowed the costly molecular dynamics simulations be performed at the end of each optimization cycle only and eliminated the simulations during the cycle. Test results show notable improvements over the original AMBER FF99 vdW parameter set as indicated by the reduction in errors of the calculated pure liquid density (d), heat of vaporization (Hvap) and hydration energy. The average percent error (APE) of the densities of 59 pure liquids was reduced from 5.33% to 2.97%; the RMSE of Hvap was reduced from 1.98 kcal/mol to 1.38 kcal/mol; the RMSE of solvation free energies of 15 compounds was reduced from 1.56 kcal/mol to 1.38 kcal/mol. For the interaction energies of 1639 dimers, the overall performance of the optimized vdW set is slightly better than the original FF99 vdW set (RMSE of 1.56 versus 1.63 kcal/mol). The optimized vdW parameter set was also evaluated for the exponential screening function used in the Amoeba force field to assess its applicability for different types of screening functions. Encouragingly, comparable

  16. Development of polarizable models for molecular mechanical calculations. 4. van der Waals parametrization.

    Science.gov (United States)

    Wang, Junmei; Cieplak, Piotr; Li, Jie; Cai, Qin; Hsieh, Meng-Juei; Luo, Ray; Duan, Yong

    2012-06-21

    In the previous publications of this series, we presented a set of Thole induced dipole interaction models using four types of screening functions. In this work, we document our effort to refine the van der Waals parameters for the Thole polarizable models. Following the philosophy of AMBER force field development, the van der Waals (vdW) parameters were tuned for the Thole model with linear screening function to reproduce both the ab initio interaction energies and the experimental densities of pure liquids. An in-house genetic algorithm was applied to maximize the fitness of "chromosomes" which is a function of the root-mean-square errors (RMSE) of interaction energy and liquid density. To efficiently explore the vdW parameter space, a novel approach was developed to estimate the liquid densities for a given vdW parameter set using the mean residue-residue interaction energies through interpolation/extrapolation. This approach allowed the costly molecular dynamics simulations be performed at the end of each optimization cycle only and eliminated the simulations during the cycle. Test results show notable improvements over the original AMBER FF99 vdW parameter set, as indicated by the reduction in errors of the calculated pure liquid densities (d), heats of vaporization (H(vap)), and hydration energies. The average percent error (APE) of the densities of 59 pure liquids was reduced from 5.33 to 2.97%; the RMSE of H(vap) was reduced from 1.98 to 1.38 kcal/mol; the RMSE of solvation free energies of 15 compounds was reduced from 1.56 to 1.38 kcal/mol. For the interaction energies of 1639 dimers, the overall performance of the optimized vdW set is slightly better than the original FF99 vdW set (RMSE of 1.56 versus 1.63 kcal/mol). The optimized vdW parameter set was also evaluated for the exponential screening function used in the Amoeba force field to assess its applicability for different types of screening functions. Encouragingly, comparable performance was

  17. A new spore differentiation factor (SDF) secreted by Dictyostelium cells is phosphorylated by the cAMP dependent protein kinase.

    Science.gov (United States)

    Anjard, C; van Bemmelen, M; Véron, M; Reymond, C D

    1997-10-01

    Upon starvation, Dictyostelium discoideum unicellular amoebae form a multicellular organism leading to the development of a fruiting body containing spores. Single cells of sporogenous mutants, unlike wild type cells, are able to differentiate into spores under specific conditions. We show in this report that overexpression of the catalytic subunit of the cAMP dependent protein kinase (PKA), not only renders the cells sporogenous, but is also accompanied by the production/release of a diffusible spore differentiation factor (SDF). SDF is a small, thermostable phospho-polypeptide. In vitro dephosphorylation reduces SDF spore differentiation capacity, which can be regained in vitro by PKA phosphorylation. These results indicate that SDF is a PKA substrate and might be activated in vivo by this protein kinase. Since spore differentiation requires PKA catalytic subunit activation, we conclude that the response of prespore cells to SDF involves an intracellular pathway dependent on PKA. PMID:9373946

  18. U.S. biological experiments in space

    Science.gov (United States)

    Klein, H. P.

    1981-01-01

    The history of biologic experimentation in space is traced. Early balloon and rocket borne animals showed no abnormalities on the macroscale, and biosatellite launches with bacteria and amoebae revealed no microscopic dysfunctions. Adult Drosophila flies on board Cosmos spacecraft died with a shortened lifespan, while their offspring lived full lifespans. Green pepper plants grown in weightlessness showed a different orientation, but no physiological disturbances. Normal bone growth in rats has been found to almost cease after 11 days in space, and the mean life span of red blood cells decreases by four days. A series of experiments designed by U.S. scientists will be performed on primates provided and flown by the U.S.S.R. Finally, experiments on board Spacelab will involve determination of the persistence of circadian rhythms in bacteria and humans.

  19. IN VITRO STUDY OF ENTAMOEBA HISTOLYTICA CAUSATIVE AGENT OF AMOEBIASIS WITH LEMON JUICE AT DIFFERENT CONCENTRATION SHOWED ANTIAMOEBIC PROPERTIES

    Directory of Open Access Journals (Sweden)

    Shrivastava Bhanu

    2011-09-01

    Full Text Available A species of parasite protozoa Entamoeba histolytica causing amoebiasis and amoebic dysentery characteristic include a single nucleus containing a small central karyosome and peripheral chromatin that is finely and regularly beaded. This is a single celled parasitic animal, that infects predominantly humans and other primates. Amoebic infection was first described by Fedor Losch in 1875 in St. Petersburg. In 1890, Sir William Osler reported the first North American case of amoebiasis when he observed amoebae in stool in abscess fluid from physician who previously resided in Panama. So we used the Lemon juice (Citrus at different concentration against Entamoeba histolytica to treat the amoebiasis disease. Entamoeba histolytica shows the variety of growth due to the effect of Lemon juice (Citrus. Lemon juice is ingredient and it has antiamoebic properties against Entamoeba histolytica a causative agent of amoebiasis.

  20. From extracellular to intracellular: the establishment of mitochondria and chloroplasts.

    Science.gov (United States)

    Whatley, J M; John, P; Whatley, F R

    1979-04-11

    Paracoccus and Rhodopseudomonas are unusual among bacteria in having a majority of the biochemical features of mitochondria; blue-green algae have many of the features of chloroplasts. The theory of serial endosymbiosis proposes that a primitive eukaryote successively took up bacteria and blue-green algae to yield mitochondria and chloroplasts respectively. Possible characteristics of transitional forms are indicated both by the primitive amoeba, Pelomyxa, which lacks mitochondria but contains a permanent population of endosymbiotic bacteria, and by several anomalous eukaryotic algae, e.g. Cyanophora, which contain cyanelles instead of chloroplasts. Blue-green algae appear to be obvious precursors of red algal chloroplasts but the ancestry of other chloroplasts is less certain, though the epizoic symbiont, Prochloron, may resemble the ancestral green algal chloroplast. We speculate that the chloroplasts of the remaining algae may have been a eukaryotic origin. The evolution or organelles from endosymbiotic precursors would involve their integration with the host cell biochemically, structurally and numerically. PMID:36620