WorldWideScience

Sample records for amides

  1. Backbone amide linker strategy

    DEFF Research Database (Denmark)

    Shelton, Anne Pernille Tofteng; Jensen, Knud Jørgen

    2013-01-01

    In the backbone amide linker (BAL) strategy, the peptide is anchored not at the C-terminus but through a backbone amide, which leaves the C-terminal available for various modifications. This is thus a very general strategy for the introduction of C-terminal modifications. The BAL strategy was...... assemble the final peptide. One useful application of this strategy is in the synthesis of C-terminal peptide aldehydes. The C-terminal aldehyde is masked as an acetal during synthesis and then conveniently demasked in the final cleavage step to generate the free aldehyde. Another application is in the...

  2. Borate esters as convenient reagents for direct amidation of carboxylic acids and transamidation of primary amides

    OpenAIRE

    Starkov, P.; Sheppard, T. D.

    2011-01-01

    Simple borates serve as effective promoters for amide bond formation with a variety of carboxylic acids and amines. With trimethyl or tris(2,2,2-trifluoroethyl) borate, amides are obtained in good to excellent yield and high purity after a simple work-up procedure. Tris(2,2,2-trifluoroethyl) borate can also be used for the straightforward conversion of primary amides to secondary amides via transamidation.

  3. Hydrogen abstraction reactions by amide electron adducts

    International Nuclear Information System (INIS)

    Electron reactions with a number of peptide model compounds (amides and N-acetylamino acids) in aqueous glasses at low temperature have been investigated using ESR spectroscopy. The radicals produced by electron attachment to amides, RC(OD)NDR', are found to act as hydrogen abstracting agents. For example, the propionamide electron adduct is found to abstract from its parent propionamide. Electron adducts of other amides investigated show similar behavior except for acetamide electron adduct which does not abstract from its parent compound, but does abstract from other amides. The tendency toward abstraction for amide electron adducts are compared to electron adducts of several carboxylic acids, ketones, aldehydes and esters. The comparison suggests the hydrogen abstraction tendency of the various deuterated electron adducts (DEAs) to be in the following order: aldehyde DEA > acid DEA = approximately ester DEA > ketone DEA > amide DEA. In basic glasses the hydrogen abstraction ability of the amide electron adducts is maintained until the concentration of base is increased sufficiently to convert the DEA to its anionic form, RC(O-)ND2. In this form the hydrogen abstracting ability of the radical is greatly diminished. Similar results were found for the ester and carboxylic acid DEA's tested. (author)

  4. Metal extraction by amides of carboxylic acids

    International Nuclear Information System (INIS)

    Extraction ability of various amides was studied. Data on extraction of rare earths, vanadium, molybdenum, rhenium, uranium, niobium, tantalum by N,N-dibutyl-amides of acetic, nonanic acids and fatly synthetic acids of C7-C9 fractions are presented. Effect of salting-out agents, inorganic acid concentrations on extraction process was studied. Potential ability of using amides of carboxylic acids for extractional concentration of rare earths as well as for recovery and separation of iron, rhenium, vanadium, molybdenum, uranium, niobium, and tantalum was shown

  5. Recent developments in amide synthesis: direct amidation of carboxylic acids and transamidation reactions

    OpenAIRE

    Lanigan, R. M.; Sheppard, T. D.

    2013-01-01

    The synthesis of amides is of huge importance in a wide variety of industrial and academic fields and is of particular significance in the synthesis of pharmaceuticals. Many of the well established methods for amide synthesis involve reagents that are difficult to handle and lead to the generation of large quantities of waste products. As a consequence, there has been a considerable amount of interest in the development of new approaches to amide synthesis. Over the past few years a wide rang...

  6. Structure-property relationship of aliphatic segmented poly(ester amide)s

    OpenAIRE

    Garg, Priya

    2010-01-01

    This thesis focuses on the synthesis, characterization and applications of aliphatic segmented poly(ester amide)s (PEA)s for use as potential biomaterials. Three different series of PEAs with different microstructures containing isolated, two and three adjacent amide groups within a polybutylene adipate (PBA) chain have been synthesized. Analytical techniques such as NMR (liquid and solid-state), SEC, DSC, FT-IR, WAXD and microscopy (AFM, SEM, optical) have been extensively used to characteri...

  7. Orthogonal dipolar interactions between amide carbonyl groups

    OpenAIRE

    Fischer, Felix R.; Wood, Peter A.; Allen, Frank H; Diederich, François

    2008-01-01

    Orthogonal dipolar interactions between amide C=O bond dipoles are commonly found in crystal structures of small molecules, proteins, and protein–ligand complexes. We herein present the experimental quantification of such interactions by employing a model system based on a molecular torsion balance. Application of a thermodynamic double-mutant cycle allows for the determination of the incremental energetic contributions attributed to the dipolar contact between 2 amide C=O groups. The stabili...

  8. Convergent synthesis of digitally-encoded poly(alkoxyamine amide)s.

    Science.gov (United States)

    Roy, Raj Kumar; Laure, Chloé; Fischer-Krauser, Diane; Charles, Laurence; Lutz, Jean-François

    2015-11-01

    Binary-encoded poly(alkoxyamine amide)s were prepared by oligomer ligation. These polymers contain digital sequences based on two monomers defined as 0 and 1 bits. A library of oligomers containing all possible dyads 00, 01, 10 and 11 was prepared and used to construct long coded sequences. PMID:26359908

  9. Tuning the thermoresponsive properties of Hyperbranched Poly(ester amide)s based on diisopropanolamine and cyclic dicarboxylic anhydrides

    OpenAIRE

    Kelland, Malcolm

    2011-01-01

    A range of water-soluble hyperbranched poly(ester amide)s has been synthesized with a view to studying their thermoresponsive behavior in water. Poly(ester amide)s with lower critical solution temperature (LCST) values around physiological temperatures are of interest for biological and medical applications, whereas poly(ester amide)s with high LCST values may be useful as kinetic hydrate inhibitors for high salinity produced fluids in the oil and gas industry. The LCST of these p...

  10. Variation of protein backbone amide resonance by electrostatic field

    OpenAIRE

    Sharley, John N.

    2015-01-01

    Amide resonance is found to be sensitive to electrostatic field with component parallel or antiparallel the amide C-N bond. This effect is linear and without threshold in the biologically plausible electrostatic field range -0.005 to 0.005 au. Variation of amide resonance varies Resonance-Assisted Hydrogen Bonding such as occurs in the hydrogen bonded chains of backbone amides of protein secondary structures such as beta sheet and alpha helix, varying the stability of the secondary structure....

  11. Steroids linked with amide bond - extended cholesterol

    Czech Academy of Sciences Publication Activity Database

    Černý, Ivan; Buděšínský, Miloš; Pouzar, Vladimír; Drašar, P.

    2009-01-01

    Roč. 74, č. 1 (2009), s. 88-94. ISSN 0039-128X R&D Projects: GA MŠk(CZ) LC06077; GA AV ČR KAN200200651 Institutional research plan: CEZ:AV0Z40550506 Keywords : synthesis * oligomers * amides Subject RIV: CC - Organic Chemistry Impact factor: 2.905, year: 2009

  12. Efficient Amide Based Halogenide Anion Receptors

    Institute of Scientific and Technical Information of China (English)

    Hong Xing WU; Feng Hua LI; Hai LIN; Shou Rong ZHU; Hua Kuan LIN

    2005-01-01

    In this paper, we present the synthesis and anion recognition properties of the amide based phenanthroline derivatives 1, 2 and 3. In all cases 1:1 receptor: anion complexes were observed. The receptors were found to be selective for fluoride and chloride respectively over other putative anionic guest species.

  13. Metabolism of amino acid amides in Pseudomonas putida ATCC 12633

    NARCIS (Netherlands)

    Hermes, H.F.M.; Croes, L.M.; Peeters, W.P.H.; Peters, P.J.H.; Dijkhuizen, L.

    1993-01-01

    The metabolism of the natural amino acid L-valine, the unnatural amino acids D-valine, and D-, L-phenylglycine (D-, L-PG), and the unnatural amino acid amides D-, L-phenylglycine amide (D, L-PG-NH2) and L-valine amide (L-Val-NH2) was studied in Pseudomonas putida ATCC 12633. The organism possessed c

  14. Uranium extraction with phosphoric acid amides

    International Nuclear Information System (INIS)

    Extraction of uranium by phosphorus acid monobuthylamide (MBA), dibuthylamid (DBA) and hexabuthyltriamide (HBTA) has meen investigated. The concentration constants of the process are reported. The extraction behaviour of the amides was found to be analogous to that of neutral organophosphorus extragents and to depend on the donor properties of the phosphoryl oxygen, i.e. on the number and nature of substituents by the phosphorus atom. The extraction capacity of the amides is higher than that of the phosphorus acid esters. In nitric acid solutions the highest resistance to hydrolysis was shown by HBTA. The extraction capacity of HBTA is almost insensitive to the nature of the diluting agent, be it a fatty or an aromatic hydrocarbon. With hexane used for dilution, a crystalline complex UO2(NO3)2x2HBTA was isolated

  15. Tertiary fatty amides as diesel fuel substitutes

    Energy Technology Data Exchange (ETDEWEB)

    Serdari, Aikaterini; Lois, Euripides; Stournas, Stamoulis [National Technical Univ. of Athens, Dept. of Chemical Engineering, Athens (Greece)

    2000-07-01

    This paper presents experimental results regarding the impact of adding different tertiary amides of fatty acids to mineral diesel fuel; an assessment of the behaviour of these compounds as possible diesel fuel extenders is also included. Measurements of cetane number, cold flow properties (cloud point, pour point and CFPP), density, kinematic viscosity, flash point and distillation temperatures are reported, while initial experiments concerning the effects on particulate emissions are also described. Most of the examined tertiary fatty amides esters have very good performance and they can be easily prepared from fatty acids (biomass). Such compounds or their blends could be used as mineral diesel fuel or even fatty acid methylesters (FAME, biodiesel) substitutes or extenders. (Author)

  16. [Amides of creatine: perspectives of neuroprotection].

    Science.gov (United States)

    Vlasov, T D; Chefu, S G; Baĭsa, A E; Leko, M V; Burov, S V; Veselkina, O S

    2011-07-01

    We evaluated the efficacy of derivatives of creatine and amino acids (CrAA) for decreasing cerebral injury in rats with transient middle cerebral artery occlusion (MCAO). Neuroprotective effects of amides of creatine and glycine (CrGlyOEt), phenylalanine (CrPheNH2), thyrosine (CrTyrNH2), and GABA (CrGABAOEt) were investigated. Brain injury was evaluated on day 2 after transient MCAO using a TTC staining of brain slices. Compared with the MCAO control group, all the CrAms showed decreased cerebral injury (p < 0.05). However CrPheNH2, CrTyrNH2, and CrGABAOEt were toxic after intravenous administration and investigated only after intraperitoneal injection. CrGlyOEt did not show any toxicity at dose of 1 mmol/kg. These data evidenced that creatinyl amides can represent promising candidates for the development of new drugs useful in brain ischemia treatment. PMID:21961295

  17. Poly(ester-amide)s derived from PET containing uniform bisester amide segments

    OpenAIRE

    Ascanio Nuñez, Yanireth

    2013-01-01

    Poly(ethylene terephthalate) has experienced a growth in its demand as a bottle container and food packaging material. However, in order to expand its uses, its barrier properties to gases like carbon dioxide and oxygen, have to be improved. In this way, bisester amide units have been introduced as a third component in the main chain of PET, with the aim to reduce both CO2 and O2 permeability. In this project, poly(ester-amide)s based on PET (PETxMXy) have been synthesized, according to th...

  18. New Umami Amides: Structure-Taste Relationship Studies of Cinnamic Acid Derived Amides and the Natural Occurrence of an Intense Umami Amide in Zanthoxylum piperitum.

    Science.gov (United States)

    Frerot, Eric; Neirynck, Nathalie; Cayeux, Isabelle; Yuan, Yoyo Hui-Juan; Yuan, Yong-Ming

    2015-08-19

    A series of aromatic amides were synthesized from various acids and amines selected from naturally occurring structural frameworks. These synthetic amides were evaluated for umami taste in comparison with monosodium glutamate. The effect of the substitution pattern of both the acid and the amine parts on umami taste was investigated. The only intensely umami-tasting amides were those made from 3,4-dimethoxycinnamic acid. The amine part was more tolerant to structural changes. Amides bearing an alkyl- or alkoxy-substituted phenylethylamine residue displayed a clean umami taste as 20 ppm solutions in water. Ultraperformance liquid chromatography coupled with a high quadrupole-Orbitrap mass spectrometer (UPLC/MS) was subsequently used to show the natural occurrence of these amides. (E)-3-(3,4-Dimethoxyphenyl)-N-(4-methoxyphenethyl)acrylamide was shown to occur in the roots and stems of Zanthoxylum piperitum, a plant of the family Rutaceae growing in Korea, Japan, and China. PMID:26230212

  19. Variation of protein backbone amide resonance by electrostatic field

    CERN Document Server

    Sharley, John N

    2015-01-01

    Amide resonance is found to be sensitive to electrostatic field with component parallel or antiparallel the amide C-N bond. This effect is linear and without threshold in the biologically plausible electrostatic field range -0.005 to 0.005 au. Variation of amide resonance varies Resonance Assisted Hydrogen Bonding such as occurs in the hydrogen bonded chains of backbone amides of protein secondary structures such as beta sheet and non-polyproline helix such as alpha helix, varying the stability of the secondary structure. The electrostatic properties including permittivity of amino acid residue sidegroups influence the electrostatic field component parallel or antiparallel the C-N bond of each amide. The significance of this factor relative to other factors in protein folding depends on the magnitude of electrostatic field component parallel or antiparallel the C-N bond of each amide, and preliminary protein-scale calculations of the magnitude of these components suggest this factor warrants investigation in ...

  20. DNA-Catalyzed Hydrolysis of Esters and Aromatic Amides

    OpenAIRE

    Brandsen, Benjamin M.; Hesser, Anthony R.; Castner, Marissa A.; Chandra, Madhavaiah; Silverman, Scott K.

    2013-01-01

    We previously reported that DNA catalysts (deoxyribozymes) can hydrolyze DNA phosphodiester linkages, but DNA-catalyzed amide bond hydrolysis has been elusive. Here we used in vitro selection to identify DNA catalysts that hydrolyze ester linkages as well as DNA catalysts that hydrolyze aromatic amides, for which the leaving group is an aniline moiety. The aromatic amide-hydrolyzing deoxyribozymes were examined using linear free energy relationship analysis. The hydrolysis reaction is unaffec...

  1. Analytical applications of resins containing amide and polyamine functional groups

    Energy Technology Data Exchange (ETDEWEB)

    Orf, G. M.

    1977-12-01

    A dibutyl amide resin is used for the separation of uranium(VI), thorium(IV), and zirconium(IV) from each other and several other metal ions. Uranium(VI) and thorium(IV) are determined in the presence of large excesses of foreign metal ions and anions. A practical application of the amide resin is studied by determining uranium in low grade uranium ores. The amide resin is also used for the selective concentration of gold(III) from sea water.

  2. Copper-catalyzed oxidative amidation of aldehydes with amine salts: synthesis of primary, secondary, and tertiary amides.

    Science.gov (United States)

    Ghosh, Subhash Chandra; Ngiam, Joyce S Y; Seayad, Abdul M; Tuan, Dang Thanh; Chai, Christina L L; Chen, Anqi

    2012-09-21

    A practical method for the amidation of aldehydes with economic ammonium chloride or amine hydrochloride salts has been developed for the synthesis of a wide variety of amides by using inexpensive copper sulfate or copper(I) oxide as a catalyst and aqueous tert-butyl hydroperoxide as an oxidant. This amidation reaction is operationally straightforward and provides primary, secondary, and tertiary amides in good to excellent yields for most cases utilizing inexpensive and readily available reagents under mild conditions. In situ formation of amine salts from free amines extends the substrate scope of the reaction. Chiral amides are also synthesized from their corresponding chiral amines without detectable racemization. The practicality of this amide formation reaction has been demonstrated in an efficient synthesis of the antiarrhythmic drug N-acetylprocainamide. PMID:22894712

  3. Polymer amide as an early topology.

    Directory of Open Access Journals (Sweden)

    Julie E M McGeoch

    Full Text Available Hydrophobic polymer amide (HPA could have been one of the first normal density materials to accrete in space. We present ab initio calculations of the energetics of amino acid polymerization via gas phase collisions. The initial hydrogen-bonded di-peptide is sufficiently stable to proceed in many cases via a transition state into a di-peptide with an associated bound water molecule of condensation. The energetics of polymerization are only favorable when the water remains bound. Further polymerization leads to a hydrophobic surface that is phase-separated from, but hydrogen bonded to, a small bulk water complex. The kinetics of the collision and subsequent polymerization are discussed for the low-density conditions of a molecular cloud. This polymer in the gas phase has the properties to make a topology, viz. hydrophobicity allowing phase separation from bulk water, capability to withstand large temperature ranges, versatility of form and charge separation. Its flexible tetrahedral carbon atoms that alternate with more rigid amide groups allow it to deform and reform in hazardous conditions and its density of hydrogen bonds provides adhesion that would support accretion to it of silicon and metal elements to form a stellar dust material.

  4. Oxidative activation of dihydropyridine amides to reactive acyl donors

    DEFF Research Database (Denmark)

    Funder, Erik Daa; Trads, Julie Brender; Gothelf, Kurt Vesterager

    2015-01-01

    Amides of 1,4-dihydropyridine (DHP) are activated by oxidation for acyl transfer to amines, alcohols and thiols. In the reduced form the DHP amide is stable towards reaction with amines at room temperature. However, upon oxidation with DDQ the acyl donor is activated via a proposed pyridinium...

  5. Cytotoxic Amides from Fruits of Kawakawa, Macropiper excelsum.

    Science.gov (United States)

    Lei, Jeremy; Burgess, Elaine J; Richardson, Alistair T B; Hawkins, Bill C; Baird, Sarah K; Smallfield, Bruce M; van Klink, John W; Perry, Nigel B

    2015-08-01

    Cytotoxic amides have been isolated from the fruits of the endemic New Zealand medicinal plant kawakawa, Macropiper excelsum (Piperaceae). The main amide was piperchabamide A and this is the first report of this rare compound outside the genus Piper. Eleven other amides were purified including two new compounds with the unusual 3,4-dihydro-1(2H)-pyridinyl group. The new compounds were fully characterized by 2D NMR spectroscopy, which showed a slow exchange between two rotamers about the amide bond, and they were chemically synthesized. In view of the antitumor activity of the related piperlongumine, all of these amides plus four synthetic analogs were tested for cytotoxicity. The most active was the piperine homolog piperdardine, with an IC50 of 14 µM against HT 29 colon cancer cells. PMID:26039266

  6. Naturally occurring antifungal aromatic esters and amides

    International Nuclear Information System (INIS)

    During the search of antifungal natural products from terrestrial plants, a new long chained aromatic ester named grandiflorate along with spatazoate from Portulaca grandiflora and N-[2-methoxy-2-(4-methoxyphenyl) ethyl]-trans-cinnamide and aegeline from Solanum erianthum of Nigeria were isolated and tested against six fungal species. The known constituents have not been reported so far from mentioned investigated plants. Structures of the isolated compounds were elucidated with the aid of spectroscopic techniques including two dimensional NMR experiments. Among the compounds, the esters found more potent than amides against Candida albicans and Aspergillus flavus. The new compound grandiflorate gave response against all tested fungal species while aegeline was found to give lowest inhibition during this study. (author)

  7. SYNTHESIS AND BIOLOGICAL ACTIVITY OF AMIDE DERIVATIVES OF GINKGOLIDE A

    Institute of Scientific and Technical Information of China (English)

    LI-HONG HU; ZHONG-LIANG CHEN; YU-YUAN XIE

    2001-01-01

    Amide derivatives of ginkgolide A were prepared and evaluated for their in vitro ability to inhibit the PAF-induced aggregation of rabbit platelets. They showed less activities than their parent compound ginkgolide A.

  8. Phase space investigation of the lithium amide halides

    Energy Technology Data Exchange (ETDEWEB)

    Davies, Rosalind A. [Hydrogen Storage Chemistry Group, School of Chemistry, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom); Hydrogen and Fuel Cell Group, School of Chemical Engineering, University of Birmingham, Edgbaston B15 2TT (United Kingdom); Hewett, David R.; Korkiakoski, Emma [Hydrogen Storage Chemistry Group, School of Chemistry, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom); Thompson, Stephen P. [Diamond Light Source, Harwell Science and Innovation Campus, Didcot, Oxfordshire OX11 0QX (United Kingdom); Anderson, Paul A., E-mail: p.a.anderson@bham.ac.uk [Hydrogen Storage Chemistry Group, School of Chemistry, University of Birmingham, Edgbaston, Birmingham B15 2TT (United Kingdom)

    2015-10-05

    Highlights: • The lower limits of halide incorporation in lithium amide have been investigated. • The only amide iodide stoichiometry observed was Li{sub 3}(NH{sub 2}){sub 2}I. • Solid solutions were observed in both the amide chloride and amide bromide systems. • A 46% reduction in chloride content resulted in a new phase: Li{sub 7}(NH{sub 2}){sub 6}Cl. • New low-chloride phase maintained improved H{sub 2} desorption properties of Li{sub 4}(NH{sub 2}){sub 3}Cl. - Abstract: An investigation has been carried out into the lower limits of halide incorporation in lithium amide (LiNH{sub 2}). It was found that the lithium amide iodide Li{sub 3}(NH{sub 2}){sub 2}I was unable to accommodate any variation in stoichiometry. In contrast, some variation in stoichiometry was accommodated in Li{sub 7}(NH{sub 2}){sub 6}Br, as shown by a decrease in unit cell volume when the bromide content was reduced. The amide chloride Li{sub 4}(NH{sub 2}){sub 3}Cl was found to adopt either a rhombohedral or a cubic structure depending on the reaction conditions. Reduction in chloride content generally resulted in a mixture of phases, but a new rhombohedral phase with the stoichiometry Li{sub 7}(NH{sub 2}){sub 6}Cl was observed. In comparison to LiNH{sub 2}, this new low-chloride phase exhibited similar improved hydrogen desorption properties as Li{sub 4}(NH{sub 2}){sub 3}Cl but with a much reduced weight penalty through addition of chloride. Attempts to dope lithium amide with fluoride ions have so far proved unsuccessful.

  9. Phase space investigation of the lithium amide halides

    International Nuclear Information System (INIS)

    Highlights: • The lower limits of halide incorporation in lithium amide have been investigated. • The only amide iodide stoichiometry observed was Li3(NH2)2I. • Solid solutions were observed in both the amide chloride and amide bromide systems. • A 46% reduction in chloride content resulted in a new phase: Li7(NH2)6Cl. • New low-chloride phase maintained improved H2 desorption properties of Li4(NH2)3Cl. - Abstract: An investigation has been carried out into the lower limits of halide incorporation in lithium amide (LiNH2). It was found that the lithium amide iodide Li3(NH2)2I was unable to accommodate any variation in stoichiometry. In contrast, some variation in stoichiometry was accommodated in Li7(NH2)6Br, as shown by a decrease in unit cell volume when the bromide content was reduced. The amide chloride Li4(NH2)3Cl was found to adopt either a rhombohedral or a cubic structure depending on the reaction conditions. Reduction in chloride content generally resulted in a mixture of phases, but a new rhombohedral phase with the stoichiometry Li7(NH2)6Cl was observed. In comparison to LiNH2, this new low-chloride phase exhibited similar improved hydrogen desorption properties as Li4(NH2)3Cl but with a much reduced weight penalty through addition of chloride. Attempts to dope lithium amide with fluoride ions have so far proved unsuccessful

  10. Artists with Arthritis Create Beauty amid Pain

    Institute of Scientific and Technical Information of China (English)

    Alan; Mozes; 蔡峥伟

    2000-01-01

    得此来稿,我们曾犹豫再三,是否刊用此文。因为,其内容给人的第一印象颇有点离奇。Artists with Arthritis Create Beauty amid Pain,怎么可能呢?细读之下,你也许会觉得,此文虽是一家之言,但也并非荒唐。尤其是本文的收尾句,笔锋一转,抖出了妙言: ...in addition to the emotional support such stories can give RA patients,there are now new drug options that far surpass the treatment choices Renoir faced. 此句是否可译:除了此类故事能够给患风湿病者一种情感上的支持之外,现在可选的新药要比Renoir(雷诺阿,法国印象派画家。主要作品有《包厢》、《游船上的午餐》、《浴女》等。)时代强得多。

  11. Synthesis of Glycosyl Amides Using Selenocarboxylates as Traceless Reagents for Amide Bond Formation.

    Science.gov (United States)

    Silva, Luana; Affeldt, Ricardo F; Lüdtke, Diogo S

    2016-07-01

    Carbohydrate-derived amides were successfully prepared in good yields from a broad range of substrates, including furanosyl and pyranosyl derivatives. The methodology successfully relied on the in situ generation of lithium selenocarboxylates from Se/LiEt3BH and acyl chlorides or carboxylic acids and their reaction with sugar azides. A key aspect of the present protocol is that we start from elemental selenium; isolation and handling of all reactive and sensitive selenium-containing intermediates is avoided, therefore providing the selenocarboxylate the status of a traceless reagent. PMID:27275515

  12. Biodegradable poly(ester amide)s – A remarkable opportunity for the biomedical area: Review on the synthesis, characterization and

    OpenAIRE

    Fonseca, Ana C.; Gil, Maria H.; Simões, Pedro N.

    2014-01-01

    Poly(ester amide)s have emerged in the last years as an important family of biodegradable synthetic polymers. These polymers present both ester and amide linkages in their structure and they gather in the same entity the good degradability of polyesters with the good thermo-mechanical properties of polyamides. Particularly, poly(ester amide)s containing α-amino acids have risen as important materials in the biomedical field. The presence of the α-amino acid contributes to better cell–polymer ...

  13. Iron(III) Chloride mediated reduction of Bis(1-isoquinolylcarbonyl)amide to an Amide

    Indian Academy of Sciences (India)

    Rojalin Sahu; Papuli Chaliha; Vadivelu Manivannan

    2016-01-01

    In methanol, FeCl3 reacted readily with L1H (L1H = bis(1-isoquinolylcarbonyl)amide) and afforded a complex having the formula [Fe(L2)Cl2] (1) {L2− = -((1-isoquinolyl)(methoxy)methyl)isoquinoline-1-carboxamide ion}. This reaction involves reduction of one of the two carbonyl groups present in L1H to (methoxy)methyl group. A plausible mechanism for the conversion of L1H to L2− has been proposed. Determination of molecular structure of 1 confirmed this conversion. Fe(III) ion is surrounded by three nitrogen atoms of the ligand and two chloride ions, imparting a rare distorted trigonal bipyramidal N3Cl2 coordination environment.

  14. Nickel-catalysed Suzuki-Miyaura coupling of amides

    Science.gov (United States)

    Weires, Nicholas A.; Baker, Emma L.; Garg, Neil K.

    2016-01-01

    The Suzuki-Miyaura coupling has become one of the most important and prevalent methods for the construction of C-C bonds. Although palladium catalysis has historically dominated the field, the use of nickel catalysis has become increasingly widespread because of its unique ability to cleave carbon-heteroatom bonds that are unreactive towards other transition metals. We report the first nickel-catalysed Suzuki-Miyaura coupling of amides, which proceeds by an uncommon cleavage of the amide C-N bond after N-tert-butoxycarbonyl activation. The methodology is mild, functional-group tolerant and can be strategically employed in sequential transition-metal-catalysed cross-coupling sequences to unite heterocyclic fragments. These studies demonstrate that amides, despite classically considered inert substrates, can be harnessed as synthons for use in reactions that form C-C bonds through cleavage of the C-N bond using non-precious metal catalysis.

  15. VCD Robustness of the Amide-I and Amide-II Vibrational Modes of Small Peptide Models.

    Science.gov (United States)

    Góbi, Sándor; Magyarfalvi, Gábor; Tarczay, György

    2015-09-01

    The rotational strengths and the robustness values of amide-I and amide-II vibrational modes of For(AA)n NHMe (where AA is Val, Asn, Asp, or Cys, n = 1-5 for Val and Asn; n = 1 for Asp and Cys) model peptides with α-helix and β-sheet backbone conformations were computed by density functional methods. The robustness results verify empirical rules drawn from experiments and from computed rotational strengths linking amide-I and amide-II patterns in the vibrational circular dichroism (VCD) spectra of peptides with their backbone structures. For peptides with at least three residues (n ≥ 3) these characteristic patterns from coupled amide vibrational modes have robust signatures. For shorter peptide models many vibrational modes are nonrobust, and the robust modes can be dependent on the residues or on their side chain conformations in addition to backbone conformations. These robust VCD bands, however, provide information for the detailed structural analysis of these smaller systems. PMID:26087405

  16. New GABA amides activating GABA A-receptors

    OpenAIRE

    Peter Raster; Andreas Späth; Svetlana Bultakova; Pau Gorostiza; Burkhard König; Piotr Bregestovski

    2013-01-01

    We have prepared a series of new and some literature-reported GABA-amides and determined their effect on the activation of GABAA-receptors expressed in CHO cells. Special attention was paid to the purification of the target compounds to remove even traces of GABA contaminations, which may arise from deprotection steps in the synthesis. GABA-amides were previously reported to be partial, full or superagonists. In our hands these compounds were not able to activate GABAA-receptor channels in wh...

  17. The temperature dependent amide I band of crystalline acetanilide

    International Nuclear Information System (INIS)

    The temperature dependent anomalous peak in the amide I band of crystalline acetanilide is thought to be due to self-trapped states. On the contrary, according to the present model, the anomalous peak comes from the fraction of ACN molecules strongly hydrogen-bonded to a neighboring ACN molecule, and its intensity decreases because, on average, this fraction decreases as temperature increases. This model provides, for the first time, an integrated and theoretically consistent view of the temperature dependence of the full amide I band and a qualitative explanation of some of the features of nonlinear pump–probe experiments.

  18. Iodine-Catalyzed Decarboxylative Amidation of β,γ-Unsaturated Carboxylic Acids with Chloramine Salts Leading to Allylic Amides.

    Science.gov (United States)

    Kiyokawa, Kensuke; Kojima, Takumi; Hishikawa, Yusuke; Minakata, Satoshi

    2015-10-26

    The iodine-catalyzed decarboxylative amidation of β,γ-unsaturated carboxylic acids with chloramine salts is described. This method enables the regioselective synthesis of allylic amides from various types of β,γ-unsaturated carboxylic acids containing substituents at the α- and β-positions. In the reaction, N-iodo-N-chloroamides, generated by the reaction of a chloramine salt with I2 , function as a key active species. The reaction provides an attractive alternative to existing methods for the synthesis of useful secondary allylic amine derivatives. PMID:26493878

  19. Intramolecular Amide Hydrolysis in N-Methylmaleamic Acid Revisited

    Institute of Scientific and Technical Information of China (English)

    2002-01-01

    The intramolecular amide hydrolysis of N-methylmaleamic acid have been revisited by use of density functional theory and inclusion of solvent effects. The results indicate that concerted reaction mechanism is favored over stepwise reaction mechanism. This is in agreement with the previous theoretical study. Sovlent effects have significant influence on the reaction barrier.

  20. Chiral amides via copper-catalysed enantioselective conjugate addition

    NARCIS (Netherlands)

    Schoonen, Anne K.; Fernández-Ibáñez, M. Ángeles; Fañanás-Mastral, Martín; Teichert, Johannes F.; Feringa, Bernard

    2014-01-01

    A highly enantioselective one pot procedure for the synthesis of β-substituted amides was developed starting from the corresponding α,β-unsaturated esters. This new methodology is based on the copper-catalysed enantioselective conjugate addition of Grignard reagents to α,β-unsaturated esters and sub

  1. Insecticidal, repellent and fungicidal properties of novel trifluoromethylphenyl amides

    Science.gov (United States)

    Twenty trifluoromethylphenyl amides were synthesized and evaluated as fungicides and as mosquito toxicants and repellents. Against Aedes aegypti larvae, (trifluoromethyl)phenyl)-3,5-dinitrobenzamide (1e) was the most toxic compound (24 h LC50 1940 nM), while against adults (trifluoromethyl)phenyl)-...

  2. Bovine intermediate pituitary alpha-amidation enzyme: preliminary characterization

    International Nuclear Information System (INIS)

    A secretory granule-associated enzymatic activity that converts mono-[125I]-D-Tyr-Val-Gly into mono-[125I]-D-Tyr-Val-NH2 has been studied. The activity is primarily soluble and shows optimal activity at pH 7 to pH 8. Amidation activity was stimulated 9-fold by addition of optimal amounts of copper (3 microM). In the presence of optimal copper, ascorbate stimulated the reaction 7-fold; none of the other reduced or oxidized cofactors tested was as effective. Taking into account the dependence of the reaction on ascorbate and molecular oxygen and the production of glyoxylate [2], it is suggested that the alpha-amidation enzyme is a monooxygenase. Lineweaver Burk plots with D-Tyr-Val-Gly as the varied substrate demonstrated Michelis-Menten type kinetics with the values of K/sub m/ and V/sub max/ increasing with the addition of ascorbate to the assay. A variety of peptides ending with a COOH-terminal Gly residue act as inhibitors of the reaction. Two synthetic peptides, gamma 2MSH and ACTH(1-14), with carboxyl termini similar to the presumed physiological substrates for the enzyme, act as competitive inhibitors with similar K1 values. It is likely that this secretory granule alpha-amidation activity is involved in the physiological biosynthetic alpha-amidation of a wide range of bioactive peptides

  3. The effect of amidation on the behaviour of antimicrobial peptides.

    Science.gov (United States)

    Mura, Manuela; Wang, Jianping; Zhou, Yuhua; Pinna, Marco; Zvelindovsky, Andrei V; Dennison, Sarah R; Phoenix, David A

    2016-04-01

    Aurein 2.6-COOH and aurein 3.1-COOH were studied along with their naturally occurring C-terminally amidated analogues. Circular dichroism (CD) and molecular dynamic (MD) simulations were used to study the effects of amidation on the interaction of antimicrobial peptides (AMPs) with lipid bilayers. CD measurements and MD analysis suggested that both peptide analogues were predominantly random coil and adopted low levels of [Formula: see text]-helical structure in solution (peptides formed a stable [Formula: see text]-helical structure. In general, amidated analogues have a greater propensity than the non-amidated peptides to form a [Formula: see text]-helical structure. MD simulations predicted that aurein 2.6-COOH and aurein 3.1-CHOOH destabilised lipid bilayers from 1,2-dimyristoyl-sn-glycero-3-phosphocholine and 1,2-dimyristoyl-sn-glycero-3-phosphoserine via angled bilayer penetration. They also showed that aurein 2.6-CONH[Formula: see text] and aurein 3.1-CONH[Formula: see text] formed a helix horizontal to the plane of an asymmetric interface. PMID:26745958

  4. Amide-modified poly(butylene terephthalate): polycondensation

    NARCIS (Netherlands)

    Bennekom, van A.C.M.; Gaymans, R.J.

    1996-01-01

    The synthesis of poly(ester amide) copolymers (PBTA) based on poly(butylene terephthalate) (PBT) and nylon-4,T with the diamide of butanediamine and dimethyl terephthelate (N,N′-bis(p-carbomethoxybenzoyl)butanediamine) has been carried out. Different melt and solid state condensation reactors were u

  5. Use of triphenyl phosphate as risk mitigant for metal amide hydrogen storage materials

    Energy Technology Data Exchange (ETDEWEB)

    Cortes-Concepcion, Jose A.; Anton, Donald L.

    2016-04-26

    A process in a resulting product of the process in which a hydrogen storage metal amide is modified by a ball milling process using an additive of TPP. The resulting product provides for a hydrogen storage metal amide having a coating that renders the hydrogen storage metal amide resistant to air, ambient moisture, and liquid water while improving useful hydrogen storage and release kinetics.

  6. 40 CFR 721.10191 - Amides, coco, N-[3-(dibutylamino)propyl].

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Amides, coco, N- . 721.10191 Section... Substances § 721.10191 Amides, coco, N- . (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as amides, coco, N- (PMN P-06-262; CAS No. 851544-20-2)...

  7. 40 CFR 721.10192 - Amides, coco, N-[3-(dibutylamino)propyl], acrylates.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Amides, coco, N- , acrylates. 721... Substances § 721.10192 Amides, coco, N- , acrylates. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as amides, coco, N- , acrylates (PMN...

  8. FMRF-amide-like immunoreactivity in brain and pituitary of the hagfish Eptatretus burgeri (Cyclostomata)

    DEFF Research Database (Denmark)

    Jirikowski, G; Erhart, G; Grimmelikhuijzen, C J;

    1984-01-01

    the hypothalamus to the olfactory system and caudally to the medulla oblongata. FMRF-amide-like immunoreactivity was also found in cells of the adenohypophysis. These observations suggest that the hagfish possesses a brain FMRF-amide-like transmitter system and pituitary cells containing FMRF-amide-like material...

  9. Adsorption equilibrium of uranium from seawater on chelating resin containing amide oxime group

    International Nuclear Information System (INIS)

    Chelating resins containing amide oxime group were synthesized by radiation-induced graft polymerization. The amount of the amide oxime groups was controlled below about 0.1 mol per kg of base polymer. The adsorption equilibrium of uranium from seawater on this resin was investigated. It was suggested that two neighboring amide oxime groups on the grafted chain captured one uranyl ion, and that single amide oxime ligand had little capacity for the adsorption of uranium. The adsorption equilibrium was correlated by a Langmuir-type equation. The content of neighboring amide oxime groups was 0.406 x 10-3 mol per kg of base polymer, which corresponded to 0.39 % of the total amount of amide oxime groups. The apparent stoichiometric stability constant for the complex of uranyl ion with the neighboring amide oxime groups in seawater was calculated to be 10-21.7. (author)

  10. Cleavage of an amide bond by a ribozyme

    Science.gov (United States)

    Dai, X.; De Mesmaeker, A.; Joyce, G. F.; Miller, S. L. (Principal Investigator)

    1995-01-01

    A variant form of a group I ribozyme, optimized by in vitro evolution for its ability to catalyze magnesium-dependent phosphoester transfer reactions involving DNA substrates, also catalyzes the cleavage of an unactivated alkyl amide when that linkage is presented in the context of an oligodeoxynucleotide analog. Substrates containing an amide bond that joins either two DNA oligos, or a DNA oligo and a short peptide, are cleaved in a magnesium-dependent fashion to generate the expected products. The first-order rate constant, kcat, is 0.1 x 10(-5) min-1 to 1 x 10(-5) min-1 for the DNA-flanked substrates, which corresponds to a rate acceleration of more than 10(3) as compared with the uncatalyzed reaction.

  11. Coumarin amide derivatives as fluorescence chemosensors for cyanide anions

    International Nuclear Information System (INIS)

    Four coumarin amide derivatives with 4-methyl coumarin or pyrene as terminal group have been synthesized. Their photophysical properties and recognition properties for cyanide anions have been examined. The results indicate that the compounds can recognize cyanide anions with obvious absorption and fluorescence spectra change, at the same time, obvious color and fluorescence change can be observed by naked eye. The in situ hydrogen nuclear magnetic resonance spectra and photophysical properties change confirm that Michael additions between the chemosensors and cyanide anions take place at the 4-position of coumarin. - Highlights: • Four coumarin amide derivatives with 4-methyl coumarin or pyrene as terminal group were synthesized. • The compounds can recognize cyanide anions with obvious absorption and fluorescence spectra change. • Michael additions between the chemosensors and cyanide anions take place at the 4-position of coumarin

  12. Toxocara canis: Larvicidal activity of fatty acid amides.

    Science.gov (United States)

    Mata-Santos, Taís; D'Oca, Caroline da Ros Montes; Mata-Santos, Hílton Antônio; Fenalti, Juliana; Pinto, Nitza; Coelho, Tatiane; Berne, Maria Elisabeth; da Silva, Pedro Eduardo Almeida; D'Oca, Marcelo Gonçalves Montes; Scaini, Carlos James

    2016-02-01

    Considering the therapeutic potential of fatty acid amides, the present study aimed to evaluate their in vitro activity against Toxocara canis larvae and their cytotoxicity for the first time. Linoleylpyrrolidilamide was the most potent, with a minimal larvicidal concentration (MLC) of 0.05 mg/mL and 27% cytotoxicity against murine peritoneal macrophages C57BL/6 mice, as assessed by the MTT assay. PMID:26783180

  13. Interacting Blends of Novel Unsaturated Polyester Amide Resin with Styrene

    OpenAIRE

    Hasmukh S. Patel; Panchal, Kumar K.

    2004-01-01

    Novel unsaturated poly (ester-amide) resins (UPEAs) were prepared by the reaction between an epoxy resin, namely diglycidyl ether of bisphenol–A (DGEBA) and unsaturated aliphatic bisamic acids using a base catalyst. These UPEAs were then blended with a vinyl monomer namely, Styrene (STY.) to produce a homogeneous resin syrup. The curing of these UPEAs-STY. resin blends was carried out by using benzoyl peroxide (BPO) as a catalyst and was monitored by using a differential scanning calorimeter ...

  14. Optimization of amide-based EP3 receptor antagonists.

    Science.gov (United States)

    Lee, Esther C Y; Futatsugi, Kentaro; Arcari, Joel T; Bahnck, Kevin; Coffey, Steven B; Derksen, David R; Kalgutkar, Amit S; Loria, Paula M; Sharma, Raman

    2016-06-01

    Prostaglandin E receptor subtype 3 (EP3) antagonism may treat a variety of symptoms from inflammation to cardiovascular and metabolic diseases. Previously, most EP3 antagonists were large acidic ligands that mimic the substrate, prostaglandin E2 (PGE2). This manuscript describes the optimization of a neutral small molecule amide series with improved lipophilic efficiency (LipE) also known as lipophilic ligand efficiency (LLE) ((a) Nat. Rev. Drug Disc.2007, 6, 881; (b) Annu. Rep. Med. Chem.2010, 45, 380). PMID:27107947

  15. On DABAL-Me₃ promoted formation of amides

    OpenAIRE

    Dubois, Nathalie; Glynn, Daniel; McInally, Thomas; Rhodes, Barrie; Woodward, Simon; Irvine, Derek; Dodds, Chris

    2013-01-01

    The range and utility of DABAL-Me3 couplings of methyl esters and free carboxylic acids with primary and secondary amines under a variety of conditions (reflux, sealed tube, microwave) has been compared for a significant range of coupling partners of relevance to the preparation of amides of interest in pharmaceutical chemistry. Commercial microwave reactors promote the fastest couplings and allow the use of significantly sterically hindered amines (primary and secondary) and carboxylic acids...

  16. Total chemical synthesis of lassomycin and lassomycin-amide.

    Science.gov (United States)

    Lear, S; Munshi, T; Hudson, A S; Hatton, C; Clardy, J; Mosely, J A; Bull, T J; Sit, C S; Cobb, S L

    2016-05-11

    Herein we report a practical synthetic route to the lasso peptide lassomycin () and C-terminal variant lassomycin-amide (). The biological evaluation of peptides and against Mycobacterium tuberculosis revealed that neither had any activity against this bacterium. This lack of biological activity has led us to propose that naturally occurring lassomycin may actually exhibit a standard lasso peptide threaded conformation rather than the previously reported unthreaded structure. PMID:27101411

  17. Spectroscopic properties of the nonplanar amide group: A computational study

    Czech Academy of Sciences Publication Activity Database

    Bednárová, Lucie; Maloň, Petr; Bouř, Petr

    2007-01-01

    Roč. 19, č. 10 (2007), s. 775-786. ISSN 0899-0042 R&D Projects: GA ČR GA203/06/0420; GA ČR GA202/07/0732; GA AV ČR IAA400550702 Institutional research plan: CEZ:AV0Z40550506 Keywords : nonplanar amide bond * peptide geometry * proteins * circular dichroism Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.436, year: 2007

  18. Studies on Interactions between Sulfadiazine and Peptide Amides

    OpenAIRE

    Wang Yiwei; Zhang Xiaoqin; Du Jun; Hua Song; Guo Jianmin

    2015-01-01

    In this study, the optimal structures and binding energies of 14 hydrogen bonded complexes, which contained the sulfadiazine, N-methylacetamide, a glycine dipeptide and an alanine dipeptide, were obtained. The sites preference of sulfadiazine hydrogen bonding to peptide amides were explored. The interaction energies of all the complexes were corrected by Basis Set Superposition Error (BSSE). By the analysis interaction energy, charge density and second-order interaction energies E(2) of the c...

  19. Mild Metal-Free Hydrosilylation of Secondary Amides to Amines.

    Science.gov (United States)

    Huang, Pei-Qiang; Lang, Qi-Wei; Wang, Yan-Rong

    2016-05-20

    The combination of amide activation by Tf2O with B(C6F5)3-catalyzed hydrosilylation with TMDS constitutes a method for the one-pot reduction of secondary amides to amines under mild conditions. The method displays a broad applicability for the reduction of many types of substrates, and shows good compatibility and excellent chemoselectivity for many sensitive functional groups. Reductions of a multifunctionalized α,β-unsaturated amide obtained from another synthetic methodology, and a C-H functionalization product produced the corresponding amines in good to excellent yield. Chemoselective reduction of enantiomeric pure (ee >99%) tetrahydro-5-oxo-2-furaneamides yielded 5-(aminomethyl)dihydrofuran-2(3H)-ones in a racemization-free manner. The latter were converted in one pot to N-protected 5-hydroxypiperidin-2-ones, which are building blocks for the synthesis of many natural products. Further elaboration of an intermediate led to a concise four-step synthesis of (-)-epi-pseudoconhydrine. PMID:27100232

  20. Supercritical fluid extraction of uranium and thorium employing dialkyl amides

    International Nuclear Information System (INIS)

    Extraction and purification of actinides from different matrices is of utmost importance to the nuclear industry. In recent decades, supercritical fluid extraction (SFE) has emerged as a promising alternative to solvent extraction owing to its inherent potential of minimization of liquid waste generation. N,N-dialkyl aliphatic amides have been proposed to be an alternative to TBP in the reprocessing of spent nuclear fuel due to several attractive features like innocuous nature of degradation products (mainly carboxylic acids/ amines), possibility of complete incineration of the used extractant leading to reduction in volume of secondary waste. Also, physico-chemical properties of this class of extractants can be tuned by the judicious choice of alkyl groups. In the present work, N,N-dialkyl aliphatic amides with varying alkyl groups viz. N,N-dibutyl-2-ethylhexanamide (DBEHA), N,N-dibutyl-3,3-dimethylbutanamide (DBDMBA), N,N-dihexyloctanamide (DHOA), N,N-disecbutylpentamide (DBPA), N,N-dibutyloctanamide (DBOA), have been evaluated for supercritical fluid extraction (SFE) of uranium and thorium from nitric acid medium as well as tissue paper matrix. Amides were obtained from Department of Chemistry, Delhi University and were used as such. This fact could be exploited for separation of thorium and uranium

  1. First synthesis and anticancer activity of novel naphthoquinone amides.

    Science.gov (United States)

    Pradidphol, Narathip; Kongkathip, Ngampong; Sittikul, Pichamon; Boonyalai, Nonlawat; Kongkathip, Boonsong

    2012-03-01

    Sixteen novel naphthoquinone aromatic amides were synthesized by a new route starting from 1-hydroxy-2-naphthoic acid in nine or ten steps with good to excellent yield. Amide formation reaction was carried out by using 4-(4,6-dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium chloride (DMTMM) as an efficient condensing agent leading to carboxamides in high yield. The key step for converting naphthol to 3-hydroxynaphthoquinone was the Fremy's salt oxidation followed by hydroxylation with tert-butyl hydroperoxide and triton B. Anticancer activity of these new naphthoquinone amides were evaluated and benzamide 22 showed potent inhibition against NCI-H187 cell lines while naphthamides 23 and 43 were the most potent inhibition against KB cells. The decatenation assay revealed that compounds 24 and 43 at 20 μM can inhibit hTopoIIα activity while three other compounds, namely compounds 22, 23, and 45, exhibited hTopoIIα inhibitory activity at final concentration of 50 μM. Docking experiment revealed the same trend as the cytotoxicity and decatenation assay. Therefore, naphthamides 24 and 43 can be promising target molecules for anticancer drug development. PMID:22280818

  2. Synergistic effects of three Piper amides on generalist and specialist herbivores.

    Science.gov (United States)

    Dyer, L A; Dodson, C D; Stireman, J O; Tobler, M A; Smilanich, A M; Fincher, R M; Letourneau, D K

    2003-11-01

    The tropical rainforest shrub Piper cenocladum, which is normally defended against herbivores by a mutualistic ant, contains three amides that have various defensive functions. While the ants are effective primarily against specialist herbivores, we hypothesized that these secondary compounds would be effective against a wider range of insects, thus providing a broad array of defenses against herbivores. We also tested whether a mixture of amides would be more effective against herbivores than individual amides. Diets spiked with amides were offered to five herbivores: a naïve generalist caterpillar (Spodoptera frugiperda), two caterpillar species that are monophagous on P. cenocladum (Eois spp.), leaf-cutting ants (Atta cephalotes), and an omnivorous ant (Paraponera clavata). Amides had negative effects on all insects, whether they were naïve, experienced, generalized, or specialized feeders. For Spodoptera, amide mixtures caused decreased pupal weights and survivorship and increased development times. Eois pupal weights, larval mass gain, and development times were affected by additions of individual amides, but increased parasitism and lower survivorship were caused only by the amide mixture. Amide mixtures also deterred feeding by the two ant species, and crude plant extracts were strongly deterrent to P. clavata. The mixture of all three amides had the most dramatic deterrent and toxic effects across experiments, with the effects usually surpassing expected additive responses, indicating that these compounds can act synergistically against a wide array of herbivores. PMID:14682530

  3. Single-conformation infrared spectra of model peptides in the amide I and amide II regions: Experiment-based determination of local mode frequencies and inter-mode coupling

    Science.gov (United States)

    Buchanan, Evan G.; James, William H.; Choi, Soo Hyuk; Guo, Li; Gellman, Samuel H.; Müller, Christian W.; Zwier, Timothy S.

    2012-09-01

    Single-conformation infrared spectra in the amide I and amide II regions have been recorded for a total of 34 conformations of three α-peptides, three β-peptides, four α/β-peptides, and one γ-peptide using resonant ion-dip infrared spectroscopy of the jet-cooled, isolated molecules. Assignments based on the amide NH stretch region were in hand, with the amide I/II data providing additional evidence in favor of the assignments. A set of 21 conformations that represent the full range of H-bonded structures were chosen to characterize the conformational dependence of the vibrational frequencies and infrared intensities of the local amide I and amide II modes and their amide I/I and amide II/II coupling constants. Scaled, harmonic calculations at the DFT M05-2X/6-31+G(d) level of theory accurately reproduce the experimental frequencies and infrared intensities in both the amide I and amide II regions. In the amide I region, Hessian reconstruction was used to extract local mode frequencies and amide I/I coupling constants for each conformation. These local amide I frequencies are in excellent agreement with those predicted by DFT calculations on the corresponding 13C = 18O isotopologues. In the amide II region, potential energy distribution analysis was combined with the Hessian reconstruction scheme to extract local amide II frequencies and amide II/II coupling constants. The agreement between these local amide II frequencies and those obtained from DFT calculations on the N-D isotopologues is slightly worse than for the corresponding comparison in the amide I region. The local mode frequencies in both regions are dictated by a combination of the direct H-bonding environment and indirect, "backside" H-bonds to the same amide group. More importantly, the sign and magnitude of the inter-amide coupling constants in both the amide I and amide II regions is shown to be characteristic of the size of the H-bonded ring linking the two amide groups. These amide I/I and

  4. Atom-economic catalytic amide synthesis from amines and carboxylic acids activated in situ with acetylenes

    Science.gov (United States)

    Krause, Thilo; Baader, Sabrina; Erb, Benjamin; Gooßen, Lukas J.

    2016-01-01

    Amide bond-forming reactions are of tremendous significance in synthetic chemistry. Methodological research has, in the past, focused on efficiency and selectivity, and these have reached impressive levels. However, the unacceptable amounts of waste produced have led the ACS GCI Roundtable to label ‘amide bond formation avoiding poor atom economy' as the most pressing target for sustainable synthetic method development. In response to this acute demand, we herein disclose an efficient one-pot amide coupling protocol that is based on simple alkynes as coupling reagents: in the presence of a dichloro[(2,6,10-dodecatriene)-1,12-diyl]ruthenium catalyst, carboxylate salts of primary or secondary amines react with acetylene or ethoxyacetylene to vinyl ester intermediates, which undergo aminolysis to give the corresponding amides along only with volatile acetaldehyde or ethyl acetate, respectively. The new amide synthesis is broadly applicable to the synthesis of structurally diverse amides, including dipeptides. PMID:27282773

  5. Atom-economic catalytic amide synthesis from amines and carboxylic acids activated in situ with acetylenes.

    Science.gov (United States)

    Krause, Thilo; Baader, Sabrina; Erb, Benjamin; Gooßen, Lukas J

    2016-01-01

    Amide bond-forming reactions are of tremendous significance in synthetic chemistry. Methodological research has, in the past, focused on efficiency and selectivity, and these have reached impressive levels. However, the unacceptable amounts of waste produced have led the ACS GCI Roundtable to label 'amide bond formation avoiding poor atom economy' as the most pressing target for sustainable synthetic method development. In response to this acute demand, we herein disclose an efficient one-pot amide coupling protocol that is based on simple alkynes as coupling reagents: in the presence of a dichloro[(2,6,10-dodecatriene)-1,12-diyl]ruthenium catalyst, carboxylate salts of primary or secondary amines react with acetylene or ethoxyacetylene to vinyl ester intermediates, which undergo aminolysis to give the corresponding amides along only with volatile acetaldehyde or ethyl acetate, respectively. The new amide synthesis is broadly applicable to the synthesis of structurally diverse amides, including dipeptides. PMID:27282773

  6. Synthesis of Imidates: TFA-Mediated Regioselective Amide Alkylation Using Meerwein's Reagent.

    Science.gov (United States)

    Popov, Kirill; Somfai, Peter

    2016-04-15

    Regioselective O-alkylation of an amide to form the corresponding imidate is a common synthetic problem, often resulting in varying amounts of N-alkylation. Screening existing methods for converting amides to imidates gave inconsistent or irreproducible results, sometimes affording N-alkylamide as the major product. A simple and reliable protocol for amide O-alkylation with complete regioselectivity has been designed, and its scope and efficiency demonstrated on a number of substrates. PMID:27019206

  7. Recent advances in copper-catalyzed C-H bond amidation.

    Science.gov (United States)

    Wan, Jie-Ping; Jing, Yanfeng

    2015-01-01

    Copper catalysis has been known as a powerful tool for its ubiquitous application in organic synthesis. One of the fundamental utilities of copper catalysis is in the C-N bond formation by using carbon sources and nitrogen functional groups such as amides. In this review, the recent progress in the amidation reactions employing copper-catalyzed C-H amidation is summarized. PMID:26664644

  8. Synthesis of new fatty acids amides from aminolysis of fatty acid methyl esters (FAMEs)

    International Nuclear Information System (INIS)

    Recent biochemical and pharmacological studies have led to the characterization of different fatty acid amides as a new family of biologically active lipids. Here, we describe the synthesis of new amides from C16:0, 18:0, 18:1 and 18:1, OH fatty acids (FFA) families with cyclic and acyclic amines and demonstrate for the first time that these compounds produce cytotoxic effects. Application of this method to the synthesis of fatty acid amides was performed using the esters aminolysis as a key step and various carboxylic amides were prepared in good yield from fatty acid methyl esters (FAMEs). (author)

  9. Evaluation of the Ser-His Dipeptide, a Putative Catalyst of Amide and Ester Hydrolysis.

    Science.gov (United States)

    MacDonald, Melissa J; Lavis, Luke D; Hilvert, Donald; Gellman, Samuel H

    2016-08-01

    Efficient hydrolysis of amide bonds has long been a reaction of interest for organic chemists. The rate constants of proteases are unmatched by those of any synthetic catalyst. It has been proposed that a dipeptide containing serine and histidine is an effective catalyst of amide hydrolysis, based on an apparent ability to degrade a protein. The capacity of the Ser-His dipeptide to catalyze the hydrolysis of several discrete ester and amide substrates is investigated using previously described conditions. This dipeptide does not catalyze the hydrolysis of amide or unactivated ester groups in any of the substrates under the conditions evaluated. PMID:27400366

  10. Cloning of a Novel Arylamidase Gene from Paracoccus sp. Strain FLN-7 That Hydrolyzes Amide Pesticides

    OpenAIRE

    Zhang, Jun; Yin, Jin-Gang; Hang, Bao-Jian; Cai, Shu; He, Jian; Zhou, Shun-Gui; Li, Shun-Peng

    2012-01-01

    The bacterial isolate Paracoccus sp. strain FLN-7 hydrolyzes amide pesticides such as diflubenzuron, propanil, chlorpropham, and dimethoate through amide bond cleavage. A gene, ampA, encoding a novel arylamidase that catalyzes the amide bond cleavage in the amide pesticides was cloned from the strain. ampA contains a 1,395-bp open reading frame that encodes a 465-amino-acid protein. AmpA was expressed in Escherichia coli BL21 and homogenously purified using Ni-nitrilotriacetic acid affinity c...

  11. Three new amides from streptomyces sp. H7372

    International Nuclear Information System (INIS)

    Three new amides, methyl phenatate A (1), actiphenamide (2) and actiphenol 1-beta-D-glucopyranoside (3), along with thirteen known compounds, were isolated from the organic extract of a fermentation culture of Streptomyces sp. H7372. The structures were elucidated by spectroscopic methods including 1D- and 2D-NMR techniques, and MS analyses. Cycloheximide (6) and cyclo(ΔAla-L-Val) (8) gave a clear zone of inhibition of Ras-Raf-1 interaction in the yeast two hybrid assay which showed high potency with 10 and 25 mm clear ZOIs on SD His- and inactive on SD His+ at 2.5 mug per disk, respectively. (author)

  12. Two new chlorinated amides from Nicotiana glauca R. Graham.

    Science.gov (United States)

    Backheet, E Y; Sayed, H M

    2002-03-01

    Two new chlorinated amides, N-(2',6'-diethyl phenyl)-2-chloroacetamide (1) and N-(butyloxymethyl)-N-(2',6'-diethyl phenyl)-2-chloroacetamide (2) were isolated for the first time from the ethanolic extract of the leaves of Nicotiana glauca R. Graham in addition to triacontanol (3), scopoletin (4) and stigmasterol-3-beta-O-D-gluco-pyranoside (5). The structures of the isolated compounds were elucidated by spectroscopic analysis (1D, 2D NMR, EIMS, HR-EIMS, IR and UV). PMID:11933854

  13. Chemical Modifications of Hyaluronan using DMTMM-Activated Amidation

    OpenAIRE

    Rydergren, Sara

    2013-01-01

    An alternative approach to chemically modifying hyaluronan (HA) has been investigated. The triazine derivative 4-(4,6-dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium (DMTMM) has been used to activate carboxylic groups on HA, which react further to form stable amide bonds with primary and secondary amines. The reaction can either be used to couple monoamines to HA or to produce hydrogels by using diamines that form crosslinks between the HA chains. The reaction between HA and DMTMM has been...

  14. Antifungal activity of natural and synthetic amides from Piper species

    International Nuclear Information System (INIS)

    The antifungal leaves extract from Piper scutifolium was submitted to bioactivity-guided chromatographic separation against Cladosporium cladosporioides and C. sphaerospermum yielding piperine, piperlonguminine and corcovadine as the active principles which displayed a detection limit of 1 μg. Structure-activity relationships were investigated with the preparation of twelve analogs having differences in the number of unsaturations, aromatic ring substituents and in the amide moiety. Analogs having a single double-bond and no substituent in the aromatic ring displayed higher activity, while N,N,-diethyl analogs displayed higher dose-dependent activity. (author)

  15. Antifungal activity of natural and synthetic amides from Piper species

    Energy Technology Data Exchange (ETDEWEB)

    Marques, Joaquim V.; Oliveira, Alberto de; Kato, Massuo J., E-mail: majokato@iq.usp.b [Universidade de Sao Paulo (IQ/USP), SP (Brazil). Inst. de Quimica; Raggi, Ludmila; Young, Maria C. [Instituto de Botanica, Sao Paulo, SP (Brazil). Secao de Fisiologia e Bioquimica de Plantas

    2010-07-01

    The antifungal leaves extract from Piper scutifolium was submitted to bioactivity-guided chromatographic separation against Cladosporium cladosporioides and C. sphaerospermum yielding piperine, piperlonguminine and corcovadine as the active principles which displayed a detection limit of 1 {mu}g. Structure-activity relationships were investigated with the preparation of twelve analogs having differences in the number of unsaturations, aromatic ring substituents and in the amide moiety. Analogs having a single double-bond and no substituent in the aromatic ring displayed higher activity, while N,N,-diethyl analogs displayed higher dose-dependent activity. (author)

  16. PREPARATION AND CHARACTERIZATION OF AMIDATED PECTIN BASED POLYMER ELECTROLYTE MEMBRANES

    Institute of Scientific and Technical Information of China (English)

    R.K.Mishra; A.Anis; S.Mondal; M.Dutt; A.K.Banthia

    2009-01-01

    The work presents the synthesis and characterization of ami dated pectin(AP)based polymer electrolyte membranes(PEM)crosslinked with glutaraldehyde(GA).The prepared membranes are characterized by Fourier transform infrared spectroscopy(FTIR),organic elemental analysis,X-ray diffraction studies(XRD),thermogravimetric analysis (TGA)and impedance spectroscopy.Mechanical properties of the membranes are evaluated by tensile tests.The degree of amidation(DA),molar and mass reaction yields(YM and YN)are calculated based on the results of organic elemental analysis.FTIR spectroscopy indicated the presence of primary and secondary amide absorption bands.XRD pattern of membranes clearly indicates that there is a considerable increase in crystallinity as compared to parent pectin.TGA studies indicate that AP is less thermally stable than reference pectin.A maximum room temperature conductivity of 1.098×10-3 Scm-1 is obtained in the membrane,which is designated as AP-3.These properties make them good candidates for low cost biopolymer electrolyte membranes for fuel cell applications.

  17. Two enzymes which catalyze the amidation of peptide C-terminals are synthesized by a single mRNA. Peptide C mattan amid ka hanno wo shokubaisuru futatsu no koso wa ippon no mRNA yori goseisareru

    Energy Technology Data Exchange (ETDEWEB)

    Kato, I.; Yonekura, H.; Okamoto, H. (Tohoku Univ., Sendai (Japan))

    1991-10-25

    Recent findings by the authors are reviewed on the amidation that forms amid structure essential to physiological activities in C-terminals of peptide hormones such as oxytocin,VIP,PP. It is noted that the amidation had been considered to be catalyzed by peptidylglycine{alpha} -amidating monooxyganase ( PAM ) and that the authors investigated the PAM function by expression of PAM cDNA isolated from rat pituitary and its deletion mutant into COS-7 cells, reaching to the important findings of a singl PMA mRNA encoding two enzymes, namely one at 5 {prime} side, peptidylglicine {alpha} hydroxylase which catalyses the conversion of C-termianl glycine on peptide to the hydroxylated form ( the first step of amidation ),and another at 3{prime} side, {alpha}- hydroxylglycine amidating dealkylase which catalyzes the conversion of hydroxylated glycine to the amidated form ( the second step of amidation). 19 refs., 4 figs.

  18. Langmuir films of an amide extracted from Piperaceae and its interaction with phospholipids

    Science.gov (United States)

    Antunes, P. A.; Oliveira, O. N.; Aroca, R. F.; Chierice, G. O.; Constantino, C. J. L.

    2005-06-01

    In this work, we investigate Langmuir monolayers from an amide extracted from dried roots of Ottonia propinqua, a native Brazilian plant believed to exhibit anesthetic and hallucinogen activities. In addition to producing monolayers from the amide itself, we probe the molecular-level action of the amide on phospholipids employed as simple membrane models. The surface pressure-molecular area ( π- A) isotherms for the amide were little affected by a number of subphase conditions. Almost no changes were observed upon varying the compression speed, spreading volume onto the surface, ions in the subphase, ionic strength and the solution solvent. However, stronger effects occurred when the subphase temperature and pH were altered, as the isotherms were shifted to larger areas with increasing temperatures and decreasing pHs. These results are discussed in terms of the molecular packing adopted by the amide at the air-water interface. In the mixed films with arachidic acid, the area per molecule varied linearly with the concentration of amide, probably due to phase separation. On the other hand, in the mixed films with dipalmitoyl phosphatidyl choline (DPPC), small amounts of the amide were sufficient to change the π- A isotherms significantly. This points to a strong molecular-level interaction, probably between the phosphate group in the zwitterion of DPPC and the nitrogen from the amidic group.

  19. Catalyst-free synthesis of sodium amide nanoparticles encapsulated in silica gel

    Energy Technology Data Exchange (ETDEWEB)

    Ogilvie, Alexander D., E-mail: alexander.ogilvie@chem.oxon.org [Inorganic Chemistry Laboratory, University of Oxford, South Parks Road, Oxford OX1 3QR (United Kingdom); Makepeace, Joshua W., E-mail: josh.makepeace@chem.ox.ac.uk [Inorganic Chemistry Laboratory, University of Oxford, South Parks Road, Oxford OX1 3QR (United Kingdom); Hore, Katie, E-mail: katie.hore@chem.ox.ac.uk [Inorganic Chemistry Laboratory, University of Oxford, South Parks Road, Oxford OX1 3QR (United Kingdom); Ramirez-Cuesta, Anibal J., E-mail: timmy.ramirez-cuesta@stfc.ac.uk [ISIS Facility, Rutherford Appleton Laboratory, Didcot OX11 0QX (United Kingdom); Neutron Sciences Directorate, Oak Ridge National Laboratory, Oak Ridge, TN (United States); Apperley, David C., E-mail: d.c.apperley@dur.ac.uk [EPSRC UK National Solid-State NMR Service, Department of Chemistry, Durham University, South Road, Durham DH1 3LE (United Kingdom); Mitchels, John M., E-mail: J.M.Mitchels@bath.ac.uk [Microscopy and Analysis Suite, University of Bath, Claverton Down, Bath BA2 7AY (United Kingdom); Edwards, Peter P., E-mail: peter.edwards@chem.ox.ac.uk [Inorganic Chemistry Laboratory, University of Oxford, South Parks Road, Oxford OX1 3QR (United Kingdom); Sartbaeva, Asel, E-mail: a.sartbaeva@bath.ac.uk [Department of Chemistry, University of Bath, Claverton Down, Bath BA2 7AY (United Kingdom)

    2013-12-12

    Highlights: • Catalyst-free formation of nanoparticulate sodium amide encased in silica gel. • In situ ammoniation using Inelastic Neutron Spectroscopy. • Reduced air- and moisture-sensitivity and no pyrophoricity. • An alternative method for nanoparticle synthesis under mild conditions. - Abstract: Crystalline sodium amide nanoparticles encapsulated in an amorphous silica framework were formed by ammoniation of a precursor material, silica gel loaded with metallic sodium, under mild conditions and without catalysis. This ammoniation was performed in situ on TOSCA beamline at ISIS, RAL, using anhydrous gaseous ammonia. The resulting material exhibits no pyrophoricity and much reduced air- and moisture-sensitivity compared to the bulk amide. The nanoparticles formed will offer a greatly increased surface area for chemical reactions where amide is currently used as an important ingredient for industrial applications. We anticipate that this method of sodium amide production will have a diversity of applications.

  20. Synthesis, Structure and Catalytic Activity Comparison of Tris- and Tetracoordinated Lanthanide Amides

    Institute of Scientific and Technical Information of China (English)

    XIE,Mei-Hua(谢美华); LIU,Xin-Yuan(刘心元); WANG,Shao-Wu(王绍武); LIU,Li(刘莉); WU,Yong-Yong(吴勇勇); YANG,Gao-Sheng(杨高升); ZHOU,Shuang-Liu(周双六); SHENG,En-Hong(盛恩宏); HUANG,Zi-Xiang(黄子祥)

    2004-01-01

    Tetracoordinated lanthanide amides [(Me3Si)2N]3Ln (μ-Cl)Li(THF)3 (Ln=La (1), Pr (2)) were synthesized by the reaction of anhydrous lanthanide(Ⅲ) chlorides LnCl3 (Ln=La, Pr) with 3 equiv. of lithium bis(trimethylsilyl)amide (Me3Si)2NLi in THF, followed by recrystallization from toluene. Sublimation of 1 and 2 afforded the triscoordinate lanthanide amides [(Me3Si)2N]3Ln (Ln =La, Pr). The crystal structure of 2 was determined by X-ray diffraction analysis. The catalytic activity studies show that the tetracoordinate amides can be used as single-component MMA (methyl methacrylate) polymerization catalysts, while the triscoordinate amides showed poor activity on MMA polymerization under the same conditions.

  1. Pyrrolic Amide: A New Hydrogen Bond Building Block for Self-assembly

    Institute of Scientific and Technical Information of China (English)

    YIN Zhen-Ming; LI Jian-Feng; HE Jia-Qi; ZHU Xiao-Qing; CHENG Jin-Pei

    2003-01-01

    @@ Molecular self-assembly has emerged as a powerful technology for the synthesis of nanostructured materials. In design of various molecular assemblies, hydrogen bonding is a preferably selected intra- or inter-molecular weak interaction in recent research by virtue of the directionality and specificity. The research for novel hydrogen bond building blocks that self-assembly into well defined structures is great important not only for gaining an understanding of the concepts of self-assembly but also for the design of new molecular materials. Pyrrolic amide moiety has one hydrogen bond acceptor (C =O) and two hydrogen bond donors (pyrrole NH and amide NH). By deliberately design, pyrrolic amide compounds would be new kinds hydrogen bond building blocks. So, pyrrolic amide compounds 1 ~ 6, which bear one, two or three pyrrolic amide moieties respectively, were designed and synthesized.

  2. Catalyst-free synthesis of sodium amide nanoparticles encapsulated in silica gel

    International Nuclear Information System (INIS)

    Highlights: • Catalyst-free formation of nanoparticulate sodium amide encased in silica gel. • In situ ammoniation using Inelastic Neutron Spectroscopy. • Reduced air- and moisture-sensitivity and no pyrophoricity. • An alternative method for nanoparticle synthesis under mild conditions. - Abstract: Crystalline sodium amide nanoparticles encapsulated in an amorphous silica framework were formed by ammoniation of a precursor material, silica gel loaded with metallic sodium, under mild conditions and without catalysis. This ammoniation was performed in situ on TOSCA beamline at ISIS, RAL, using anhydrous gaseous ammonia. The resulting material exhibits no pyrophoricity and much reduced air- and moisture-sensitivity compared to the bulk amide. The nanoparticles formed will offer a greatly increased surface area for chemical reactions where amide is currently used as an important ingredient for industrial applications. We anticipate that this method of sodium amide production will have a diversity of applications

  3. Synthesis and pharmacological evaluation of antiinflammatory mutual amide prodrugs

    Directory of Open Access Journals (Sweden)

    D T Makhija

    2013-01-01

    Full Text Available Nonsteroidal antiinflammatory drugs have been widely used for the management of inflammation, pain and nociception. Gastric intolerance caused by most of the nonsteroidal antiinflammatory drugs used today restricts their use. Several approaches have been proposed to modify the parent nonsteroidal antiinflammatory drugs molecule in order to reduce their gastric toxicity. Oral prodrug approach is one of such approaches. In the present work three nonsteroidal antiinflammatory drugs viz. ibuprofen, diclofenac, and flurbiprofen were conjugated with sulfonamides like sulphamethoxazole and sulphanilamide via amide bond using dicyclohexylcarbodiimide coupling reaction. The synthesized prodrugs were screened for their analgesic and antiinflammatory activity using Eddy′s hot plate, acetic acid-induced writhing and carrageenan-induced rat paw edema method, respectively. These prodrugs were also evaluated for their ulcerogenic potential. All synthesized prodrugs were found to be less ulcerogenic than their parent nonsteroidal antiinflammatory drugs and showed better activity profile in terms of analgesic and antiinflammatory activity as compared to their respective parent drugs.

  4. Small Antimicrobial Agents Based on Acylated Reduced Amide Scaffold.

    Science.gov (United States)

    Teng, Peng; Huo, Da; Nimmagadda, Alekhya; Wu, Jianfeng; She, Fengyu; Su, Ma; Lin, Xiaoyang; Yan, Jiyu; Cao, Annie; Xi, Chuanwu; Hu, Yong; Cai, Jianfeng

    2016-09-01

    Prevalence of drug-resistant bacteria has emerged to be one of the greatest threats in the 21st century. Herein, we report the development of a series of small molecular antibacterial agents that are based on the acylated reduced amide scaffold. These molecules display good potency against a panel of multidrug-resistant Gram-positive and Gram-negative bacterial strains. Meanwhile, they also effectively inhibit the biofilm formation. Mechanistic studies suggest that these compounds kill bacteria by compromising bacterial membranes, a mechanism analogous to that of host-defense peptides (HDPs). The mechanism is further supported by the fact that the lead compounds do not induce resistance in MRSA bacteria even after 14 passages. Lastly, we also demonstrate that these molecules have therapeutic potential by preventing inflammation caused by MRSA induced pneumonia in a rat model. This class of compounds could lead to an appealing class of antibiotic agents combating drug-resistant bacterial strains. PMID:27526720

  5. Lead optimization studies of cinnamic amide EP2 antagonists.

    Science.gov (United States)

    Ganesh, Thota; Jiang, Jianxiong; Yang, Myung-Soon; Dingledine, Ray

    2014-05-22

    Prostanoid receptor EP2 can play a proinflammatory role, exacerbating disease pathology in a variety of central nervous system and peripheral diseases. A highly selective EP2 antagonist could be useful as a drug to mitigate the inflammatory consequences of EP2 activation. We recently identified a cinnamic amide class of EP2 antagonists. The lead compound in this class (5d) displays anti-inflammatory and neuroprotective actions. However, this compound exhibited moderate selectivity to EP2 over the DP1 prostanoid receptor (∼10-fold) and low aqueous solubility. We now report compounds that display up to 180-fold selectivity against DP1 and up to 9-fold higher aqueous solubility than our previous lead. The newly developed compounds also display higher selectivity against EP4 and IP receptors and a comparable plasma pharmacokinetics. Thus, these compounds are useful for proof of concept studies in a variety of models where EP2 activation is playing a deleterious role. PMID:24773616

  6. Catalysis of a Flavoenzyme-Mediated Amide Hydrolysis

    Energy Technology Data Exchange (ETDEWEB)

    Mukherjee, Tathagata; Zhang, Yang; Abdelwahed, Sameh; Ealick, Steven E.; Begley, Tadhg P. (Cornell); (TAM)

    2010-09-13

    A new pyrimidine catabolic pathway (the Rut pathway) was recently discovered in Escherichia coli K12. In this pathway, uracil is converted to 3-hydroxypropionate, ammonia, and carbon dioxide. The seven-gene Rut operon is required for this conversion. Here we demonstrate that the flavoenzyme RutA catalyzes the initial uracil ring-opening reaction to give 3-ureidoacrylate. This reaction, while formally a hydrolysis reaction, proceeds by an oxidative mechanism initiated by the addition of a flavin hydroperoxide to the C4 carbonyl. While peroxide-catalyzed amide hydrolysis has chemical precedent, we are not aware of a prior example of analogous chemistry catalyzed by flavin hydroperoxides. This study further illustrates the extraordinary catalytic versatility of the flavin cofactor.

  7. Three new amides from streptomyces sp. H7372

    Energy Technology Data Exchange (ETDEWEB)

    Cheenpracha, Sarot; Borris, Robert P.; Tran, Tammy T.; Chang, Leng Chee, E-mail: lengchee@hawaii.ed [University of Hawaii Hilo, HI (United States). College of Pharmacy. Dept. of Pharmaceutical Sciences; Jee, Jap Meng; Seow, Heng Fong; Cheah, Hwen-Yee [Universiti Putra Malaysia, Selangor (Malaysia). Faculty of Medicine and Health Sciences. Department of Pathology. bImmunology Unit; Hoc, Coy Choke [University Malaysia Sabah (Malaysia). School of Science and Technology. Biotechnology Program

    2011-07-01

    Three new amides, methyl phenatate A (1), actiphenamide (2) and actiphenol 1-beta-D-glucopyranoside (3), along with thirteen known compounds, were isolated from the organic extract of a fermentation culture of Streptomyces sp. H7372. The structures were elucidated by spectroscopic methods including 1D- and 2D-NMR techniques, and MS analyses. Cycloheximide (6) and cyclo({Delta}Ala-L-Val) (8) gave a clear zone of inhibition of Ras-Raf-1 interaction in the yeast two hybrid assay which showed high potency with 10 and 25 mm clear ZOIs on SD His{sup -} and inactive on SD His{sup +} at 2.5 mug per disk, respectively. (author)

  8. Proposed Chevron Tengiz venture stalls amid Soviet political squabble

    International Nuclear Information System (INIS)

    This paper reports on the status of foreign investment in Soviet oil and gas joint ventures which has reached a critical juncture. Just as the U.S. is considering granting most favored nation trade status to the U.S.S.R., the joint venture petroleum deal seen as the litmus test for such deals-Chevron Corp.'s proposed addition of supergiant Tengiz oil field to its Caspian Sea joint venture-has stalled amid controversy. Unconfirmed reports from Soviet officials and other foreign joint venture participants in the U.S.S.R. have Chevron pulling out of the long negotiated, multibillion dollar project after the Soviets rejected the company's terms. Chevron, however, insists the project is still alive

  9. Sulfonyl fluoride inhibitors of fatty acid amide hydrolase.

    Science.gov (United States)

    Alapafuja, Shakiru O; Nikas, Spyros P; Bharathan, Indu T; Shukla, Vidyanand G; Nasr, Mahmoud L; Bowman, Anna L; Zvonok, Nikolai; Li, Jing; Shi, Xiaomeng; Engen, John R; Makriyannis, Alexandros

    2012-11-26

    Sulfonyl fluorides are known to inhibit esterases. Early work from our laboratory has identified hexadecyl sulfonylfluoride (AM374) as a potent in vitro and in vivo inhibitor of fatty acid amide hydrolase (FAAH). We now report on later generation sulfonyl fluoride analogs that exhibit potent and selective inhibition of FAAH. Using recombinant rat and human FAAH, we show that 5-(4-hydroxyphenyl)pentanesulfonyl fluoride (AM3506) has similar inhibitory activity for both the rat and the human enzyme, while rapid dilution assays and mass spectrometry analysis suggest that the compound is a covalent modifier for FAAH and inhibits its action in an irreversible manner. Our SAR results are highlighted by molecular docking of key analogs. PMID:23083016

  10. Interaction of Thioamides, Selenoamides, and Amides With Diiodine

    Directory of Open Access Journals (Sweden)

    Nick Hadjiliadis

    2006-12-01

    Full Text Available We review the results of our work on the iodine interaction with thioamides, selenoamides, and amides. Complexes with (i “spoke” or “extended spoke” structures, D⋅I2 and D⋅I2⋅I2, respectively, (D is the ligand donor (ii iodonium salts of {[D2−I]+[In]−} (n=3, 7 and {[D2−I]+[FeCl4]−} formulae and (iii disulfides of the categories (a [D-D], (b {[D-DH]+[I3]−} have been isolated and characterized. A compound of formula {[D2−I]+[I3]−[D⋅I2]} containing both types of complexes (i and (ii was also isolated. The interaction of diiodine with selenium analogs of the antithyroid drug 6-n-propyl-2-thiouracil (PTU, of formulae RSeU (6-alkyl-2-Selenouracil results in the formation of complexes with formulae [(RSeUI2]. All these results are correlated with the mechanism of action of antithyroid drugs. Finally, we review here our work on the diiodine interaction with the amides (LO.

  11. Conformational analysis of amide extractants by NMR in organic phase

    International Nuclear Information System (INIS)

    This study deals with nuclear fuel reprocessing. We have essentially used NMR spectroscopy. We want to understand which kind of conformational parameters control selectivity and efficiency of amide extractant. The symmetric monoamides used are DOBA (C3H7 CON (CH2 CH(C2H5) C4H9)2), DOiBA ((CH3)2 CCHON (CH2CH(C2H5)C4H9)2) and DOTA ((CH3)3 CCH2CON(CH2CH(C2H5)C4H9)2). Each gives two quasi equivalent conformers (cis and trans) in organic phases. The selected malonamide DMDBTDMA ((C4H9 (CH3)NCO)2 CHC14H29) has four conformers because of its twice disymmetric amide functions. Weak interactions between monoamides which yield to dimer formation. The malonamide also gives dimers but forms aggregates too. Nitric acid extraction is due to the competitive formation of six species L, L2, L2(HNO3), L(HNO3), L(HNO3)2, L(HNO3)3 (L: monoamide). Complexation between lanthanides (III) and monoamides yields to the stoichiometries L3Ln(NO3)3 and L2Ln(NO3)3. Their ratio depend of steric hindrance on the carbonyl and the metal ionic radius. The same thing is observed of Pu4+ and Th4+ extraction in non acidic media. L2An(NO3)4 is the main stoichiometric except for the Th4+ - DOBA system where the species (DOBA)3 Th(NO3)4 appear. Exchange rates between the ligand and the complex are pointed out. The monoamide conformations obtained with lanthanide and plutonium nitrate can explain the difference in extracting power of this molecule between An4+ and Ln3+. (author). 162 refs., 87 figs., 44 tabs., 7 annexes

  12. New synthesis route for ternary transition metal amides as well as ultrafast amide-hydride hydrogen storage materials.

    Science.gov (United States)

    Cao, Hujun; Santoru, Antonio; Pistidda, Claudio; Richter, Theresia M M; Chaudhary, Anna-Lisa; Gizer, Gökhan; Niewa, Rainer; Chen, Ping; Klassen, Thomas; Dornheim, Martin

    2016-04-14

    K2[Mn(NH2)4] and K2[Zn(NH2)4] were successfully synthesized via a mechanochemical method. The mixture of K2[Mn(NH2)4] and LiH showed excellent rehydrogenation properties. In fact, after dehydrogenation K2[Mn(NH2)4]-8LiH fully rehydrogenates within 60 seconds at ca. 230 °C and 5 MPa of H2. This is one of the fastest rehydrogenation rates in amide-hydride systems known to date. This work also shows a strategy for the synthesis of transition metal nitrides by decomposition of the mixtures of M[M'(NH2)n] (where M is an alkali or alkaline earth metal and M' is a transition metal) and metal hydrides. PMID:26936831

  13. Recent developments in the electronic spectroscopy of amides and alpha-helical polypeptides.

    Science.gov (United States)

    Woody, Robert W; Koslowski, Axel

    2002-12-10

    Recent experimental and theoretical advances in understanding the electronic excited states of simple amides are reviewed. Polarized reflection spectroscopy of single crystals of N-acetylglycine shows that the direction of the first pipi* (NV(1)) transition dipole moment of a secondary amide differs by approximately 15 degrees from that of a primary amide. Ab initio calculations on simple amides support this conclusion. Ab initio studies of di- and tri-amides demonstrate that several inter-amide charge-transfer (CT) transitions occur in the 150-175-nm region, between the NV(1) and NV(2) transitions. When the correct dipole transition moment direction for peptides is used in calculations of the circular dichroism of the alpha-helix, the results are much improved over those from earlier calculations that used the direction for primary amides. Studies that consider the mixing of the NV(1) transition with CT transitions are reviewed. These indicate that such mixing is likely to have a significant effect on the absorption and CD spectra of the alpha-helix and other types of peptide conformation. Nevertheless, the independent systems model gives a reasonable first approximation to the absorption and CD spectra of the alpha-helix. PMID:12488025

  14. Characteristic Conformation of Mosher’s Amide Elucidated Using the Cambridge Structural Database

    Directory of Open Access Journals (Sweden)

    Akio Ichikawa

    2015-07-01

    Full Text Available Conformations of the crystalline 3,3,3-trifluoro-2-methoxy-2-phenylpropanamide derivatives (MTPA amides deposited in the Cambridge Structural Database (CSD were examined statistically as Racid-enantiomers. The majority of dihedral angles (48/58, ca. 83% of the amide carbonyl groups and the trifluoromethyl groups ranged from –30° to 0° with an average angle θ1 of −13°. The other conformational properties were also clarified: (1 one of the fluorine atoms was antiperiplanar (ap to the amide carbonyl group, forming a staggered conformation; (2 the MTPA amides prepared from primary amines showed a Z form in amide moieties; (3 in the case of the MTPA amide prepared from a primary amine possessing secondary alkyl groups (i.e., Mosher-type MTPA amide, the dihedral angles between the methine groups and the carbonyl groups were syn and indicative of a moderate conformational flexibility; (4 the phenyl plane was inclined from the O–Cchiral bond of the methoxy moiety with an average dihedral angle θ2 of +21°; (5 the methyl group of the methoxy moiety was ap to the ipso-carbon atom of the phenyl group.

  15. Synthesis of novel naphthoquinone aliphatic amides and esters and their anticancer evaluation.

    Science.gov (United States)

    Kongkathip, Boonsong; Akkarasamiyo, Sunisa; Hasitapan, Komkrit; Sittikul, Pichamon; Boonyalai, Nonlawat; Kongkathip, Ngampong

    2013-02-01

    Fourteen new naphthoquinone aliphatic amides and seventeen naphthoquinone aliphatic esters were synthesized in nine to ten steps from 1-hydroxy-2-naphthoic acid with 9-25% overall yield for the amides, and 16-21% overall yield for the esters. The key step of the amide synthesis is a coupling reaction between amine and various aliphatic acids using 4-(4,6-dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium chloride (DMTMM) as a coupling agent while for the ester synthesis, DCC/DMAP or CDI was used as the coupling reagent between aliphatic acids and naphthoquinone alcohol. Both naphthoquinone amides and esters were evaluated for their anticancer activity against KB cells. It was found that naphthoquinone aliphatic amides showed stronger anticancer activity than those of the esters when the chains are longer than 7-carbon atoms. The optimum chain of amides is expected to be 16-carbon atoms. In addition, naphthoquinone aliphatic esters with α-methyl on the ester moiety possessed much stronger anticancer activity than the straight chains. Decatenation assay revealed that naphthoquinone amide with 16-carbon atoms chain at 15 μM and 20 μM can completely inhibit hTopoIIα activity while at 10 μM the enzyme activity was moderately inhibited. Molecular docking result also showed the same trend as the cytotoxicity and decatenation assay. PMID:23313636

  16. Mesoporous Niobium Oxide Spheres as an Effective Catalyst for the Transamidation of Primary Amides with Amines

    KAUST Repository

    Ghosh, Subhash Chandra

    2014-02-06

    Mesoporous niobium oxide spheres (MNOS), conveniently prepared by a novel antisolvent precipitation approach, have been shown to be an effective catalyst for the transamidation of primary amides with amines. This novel transamidation can be efficiently carried out under solvent-free conditions and is applicable to a wide range of primary amides and amines to provide N-alkyl amides in good to excellent yields. The catalyst is highly stable and reusable. The application of this transamidation reaction has been demonstrated in the synthesis of antidepressant drug moclobemide and other druglike compounds. © 2014 Wiley-VCH Verlag GmbH&Co. KGaA, Weinheim.

  17. Stereoselective Arene-Forming Aldol Condensation: Synthesis of Axially Chiral Aromatic Amides.

    Science.gov (United States)

    Fäseke, Vincent C; Sparr, Christof

    2016-06-13

    The increasing awareness of the importance of amide atropisomers prompts the development of novel strategies for their selective preparation. Described herein is a method for the enantioselective synthesis of atropisomeric aromatic amides by an amine-catalyzed arene-forming aldol condensation. The high reactivity of the glyoxylic amide substrates enables a remarkably efficient construction of a new aromatic ring, which proceeds within minutes at ambient temperature to afford products with excellent stereoselectivity. The high rotational barriers of the reduced products highlight the utility of this stable, spatially organized chiral scaffold. PMID:27166995

  18. Bifunctional Brønsted Base Catalyzes Direct Asymmetric Aldol Reaction of α-Keto Amides.

    Science.gov (United States)

    Echave, Haizea; López, Rosa; Palomo, Claudio

    2016-03-01

    The first enantioselective direct cross-aldol reaction of α-keto amides with aldehydes, mediated by a bifunctional ureidopeptide-based Brønsted base catalyst, is described. The appropriate combination of a tertiary amine base and an aminal, and urea hydrogen-bond donor groups in the catalyst structure promoted the exclusive generation of the α-keto amide enolate which reacted with either non-enolizable or enolizable aldehydes to produce highly enantioenriched polyoxygenated aldol adducts without side-products resulting from dehydration, α-keto amide self-condensation, aldehyde enolization, and isotetronic acid formation. PMID:26835655

  19. Amide proton transfer of carnosine in aqueous solution studied in vitro by WEX and CEST experiments.

    OpenAIRE

    Bodet, O.; Goerke, S; Behl, N.; Roeloffs, V.; Zaiss, M.; Bachert, P.

    2015-01-01

    Amide protons of peptide bonds induce an important chemical exchange saturation transfer (CEST) contrast in vivo. As a simple in vitro model for a peptide amide proton CEST effect, we suggest herein the dipeptide carnosine. We show that the metabolite carnosine creates a CEST effect and we study the properties of the exchange of the amide proton (-NH) of the carnosine peptide bond (NHCPB) in model solutions for a pH range from 6 to 8.3 and a temperature range from T = 5 degrees C to 43 degree...

  20. Kynurenic acid amides as novel NR2B selective NMDA receptor antagonists.

    Science.gov (United States)

    Borza, István; Kolok, Sándor; Galgóczy, Kornél; Gere, Anikó; Horváth, Csilla; Farkas, Sándor; Greiner, István; Domány, György

    2007-01-15

    A novel series of kynurenic acid amides, ring-enlarged derivatives of indole-2-carboxamides, was prepared and identified as in vivo active NR2B subtype selective NMDA receptor antagonists. The synthesis and SAR studies are discussed. PMID:17074483

  1. A two-step approach to achieve secondary amide transamidation enabled by nickel catalysis

    Science.gov (United States)

    Baker, Emma L.; Yamano, Michael M.; Zhou, Yujing; Anthony, Sarah M.; Garg, Neil K.

    2016-01-01

    A long-standing challenge in synthetic chemistry is the development of the transamidation reaction. This process, which involves the conversion of one amide to another, is typically plagued by unfavourable kinetic and thermodynamic factors. Although some advances have been made with regard to the transamidation of primary amide substrates, secondary amide transamidation has remained elusive. Here we present a simple two-step approach that allows for the elusive overall transformation to take place using non-precious metal catalysis. The methodology proceeds under exceptionally mild reaction conditions and is tolerant of amino-acid-derived nucleophiles. In addition to overcoming the classic problem of secondary amide transamidation, our studies expand the growing repertoire of new transformations mediated by base metal catalysis. PMID:27199089

  2. Syntheses of environmentally friendly amide derivatives for the selective separation of actinides based on oxidation states

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jong Seung; Choi, Jung Kyu; Lee, Yeon Ok; Yoon, Jun Hee [Dankook Univ., Seoul (Korea, Republic of)

    2007-08-15

    Syntheses of environmentally friendly amide derivatives for the selective separation of actinides were studied. As for the ligand, we have synthesized TODGA (N,N-Tetraoctyl diglycolamide), DHOA (N,N-Dihexyloctaneamide), and D2EHBA (N,N-Di(2-ethyl)hexylbutanamide) in high yield. The amide derivative was successfully prepared by chlorination followed by amination method in a good synthetic yield. The structures of all synthetic precursors and final products were confirmed by NMR, IR, and Mass spectrophotometer.

  3. Synthesis and characterization of alternating poly(amide urethane)s

    OpenAIRE

    Sharma, Bhaskar

    2004-01-01

    This thesis deals with the preparation of alternating poly(amide urethane)s which might be of interest for the manufacture of powder coatings. The synthesis of poly(amide urethane)s was performed in environmentally friendly way without using isocyanates or phosgene. The starting materials for the synthesis were e-caprolactam, e-caprolactone, amino alcohols, diamines and carbonic acid derivatives, i.e. diphenyl carbonate and ethylene carbonate as substitutes for phosgene. A new synthesis was d...

  4. Chemical constituents from red algae Bostrychia radicans (Rhodomelaceae): new amides and phenolic compounds

    OpenAIRE

    Ana Lígia Leandrini de Oliveira; Denise B. da Silva; Norberto P. Lopes; Debonsi, Hosana M.; Yokoya, Nair S

    2012-01-01

    This study describes the isolation and structural determination of two amides, isolated for the first time: N,4-dihydroxy-N-(2'-hydroxyethyl)-benzamide (0.019%) and N,4-dihydroxy-N-(2'-hydroxyethyl)-benzeneacetamide (0.023%). These amides, produced by the red macroalgae Bostrychia radicans, had their structures assigned by NMR spectral data and MS analyses. In addition, this chemical study led to the isolation of cholesterol, heptadecane, squalene, trans-phytol, neophytadiene, tetradecanoic a...

  5. Zirconyl chloride promoted highly efficient solid phase synthesis of amide derivatives

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    An efficient solid phase route for the synthesis of amide derivatives by the reaction of carboxylic acids with urea in the presence of catalytic amount of zirconyl chloride under microwave irradiation conditions was described. In this way, a range of interesting amide derivatives was obtained in good to excellent yields. The catalyst was recycled with fresh reactants and it gave almost similar results without significant loss of activity up to the third run.

  6. Studies on supercritical fluid extraction behaviour of uranium and thorium nitrates using amides

    International Nuclear Information System (INIS)

    Supercritical fluid extraction studies of uranyl nitrate and thorium nitrate in mixture were carried out using various amides such as N,N-di(2-ethylhexyl) isobutyramide (D2EHIBA),N,N-dihexyl octanamide (DHOA) and Diisooctyl Butanamide (DiOBA). These studies established a preferential extraction of uranium over thorium. Among the various amides studied, D2EHIBA offered the best rate of preferential extraction of uranium over thorium. (author)

  7. Substituted Amides of Pyrazine-2-carboxylic acids: Synthesis and Biological Activity

    OpenAIRE

    Katarina Kralova; Jiri Kunes; Miroslav Miletin; Martin Dolezal

    2002-01-01

    Condensation of 6-chloro-, 5-tert-butyl- or 6-chloro-5-tert-butylpyrazine-2-carboxylic acid chloride with ring substituted anilines yielded a series of amides, which were tested for their in vitro antimycobacterial, antifungal and photosynthesis-inhibiting activities. The highest antituberculotic activity (72% inhibition) against Mycobacterium tuberculosis and the highest lipophilicity (log P = 6.85) were shown by the 3,5-bistrifluoromethylphenyl amide of 5-tert-butyl-6-chloropyrazine-2-carbo...

  8. Syntheses of Macrocyclic Amides from L-Amino Acid Esters by RCM

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    A series of succinate-derived macrocyclic amides( 1 ) was synthesized via ring-closing metathesis (RCM) as the key step. The substrate included 12 to 15 members. The metathesis precursors were obtained from the amide coupling of tert-butyl 3-carboxyhex-5-enoate(2) with numerous side-chain alkenylated amino acid esters of general type(3)derived from L-lysine and L-ornithine.

  9. Antimicrobial and allelopathic potential of the amides isolated from the roots of Ottonia martiana miq., piperaceae

    International Nuclear Information System (INIS)

    Two amides, piperovatine and isopiperlonguminine, were isolated from the roots of Ottonia martiana Miq., a herbaceous shrub commonly used in folk medicine in the treatment of toothache. The crude extract (CE) and isolated compounds were submitted to bioautography and allelopathic assay. The bioautograms allowed the detection of compounds with antibacterial activity and the identification of the bioactive substance piperovatine. The CE and amides exhibited an allelopathic effect on Lactuca sativa (lettuce) seedling growth but did not affect the seeds' germinability. (author)

  10. A protocol for amide bond formation with electron deficient amines and sterically hindered substrates

    DEFF Research Database (Denmark)

    Due-Hansen, Maria E; Pandey, Sunil K; Christiansen, Elisabeth; Andersen, Rikke; Hansen, Steffen V F; Ulven, Trond

    2016-01-01

    A protocol for amide coupling by in situ formation of acyl fluorides and reaction with amines at elevated temperature has been developed and found to be efficient for coupling of sterically hindered substrates and electron deficient amines where standard methods failed.......A protocol for amide coupling by in situ formation of acyl fluorides and reaction with amines at elevated temperature has been developed and found to be efficient for coupling of sterically hindered substrates and electron deficient amines where standard methods failed....

  11. Synthesis and quantitation of six phenolic amides in Amaranthus spp.

    Science.gov (United States)

    Pedersen, Hans A; Steffensen, Stine K; Christophersen, Carsten; Mortensen, Anne G; Jørgensen, Lise N; Niveyro, Selene; de Troiani, Rosa M; Rodríguez-Enríquez, Ricardo José; Barba-de la Rosa, Ana Paulina; Fomsgaard, Inge S

    2010-05-26

    Cinnamoylphenethylamines are phenolic amides in which cinnamic acid provides the acid moiety and phenethylamine the amine moiety. Single ion monitoring (SIM) in LC-MS was performed on amaranth leaf extracts. Masses corresponding to sets of regioisomers, including previously reported compounds, were examined. Six peaks were detected and their corresponding standards synthesized for a quantitative LC-MS/MS investigation of cinnamoylphenethylamines in amaranth. Four cinnamoylphenethylamines (caffeoyltyramine, feruloyldopamine, sinapoyltyramine, and p-coumaroyltyramine) are reported in the Amaranthaceae for the first time; also, one rare compound, feruloyl-4-O-methyldopamine, appeared to be quite common in the genus Amaranthus. Feruloyldopamine showed moderate antifungal activity toward an isolate of Fusarium culmorum. Our LC-MS approach, in conjunction with the straightforward synthesis, provides a simple, reliable way of quantitatively investigating cinnamoylphenethylamines in plants. Concentrations of cinnamoylphenethylamines vary widely: feruloyltyramine was present in quantities of 5.26 to 114.31 microg/g and feruloyldopamine in quantities of 0.16 to 10.27 microg/g, depending on the plant sample. PMID:20438062

  12. Synthesis, spectroscopic and structural perspective of new ferrocenyl amides

    Science.gov (United States)

    Etter, Martin; Nigar, Asifa; Ali, Naveed Zafar; Akhter, Zareen; Dinnebier, Robert E.

    2016-05-01

    Two new ferrocene derivatives with amide linkages were synthesized by the condensation of 4-ferrocenylaniline with n-alkyl acid chloride derivatives as pristine orange solids in good yields. FTIR and 1H/13C NMR studies have confirmed the basic structure of the molecules with the involvement of intermolecular H-bonding, which together with the ferrocene-like packing ensures the stability of the crystal structure. Crystal structures for both compounds were solved by Rietveld refinements of high resolution X-ray powder diffraction data. The XRD results show that both compounds crystallize in the monoclinic space group P21/c. The primary feature of the crystal structure is a double layer of ferrocenyl groups stretched out in the b-c -plane perpendicular to the a-axis, with packing of the ferrocenyl groups occurring in a manner similar to that of pure ferrocene. Despite the close structural similarity, both compounds differ in the optimized geometry of respective Ferrocene conformers. The Cp rings are eclipsed for one Ferrocene conformer and close to staggered for the other, owing to the low energy barrier for the rotation of a cyclopentadienyl ring relative to the rest of the molecule.

  13. Synthesis, characterization and pharmacological evaluation of amide prodrugs of Flurbiprofen

    International Nuclear Information System (INIS)

    Flurbiprofen (FB) suffers from the general side effects of NSAIDs, owing to presence of free carboxylic acid group. The study was aimed to retard the adverse effects of gastrointestinal origin. Ten prodrugs of FB were synthesized by amidation with ethyl esters of amino acids, namely, glycine, L-phenylalanine, L-tryptophan, L-valine, L-isoleucine, L-alanine, L-leucine, L-glutamic acid, L-aspartic acid and β alanine. Purified synthesized prodrugs were characterized by m.p., TLC, solubility, partition coefficients, elemental analyses, UV, FTIR, NMR and MS. Synthesized prodrugs were subjected for bioavailability studies, analgesic, anti-inflammatory activities and ulcerogenic index. Marked reduction of ulcerogenic index and comparable analgesic, antiinflammatory activities were obtained in all cases as compared to FB. Among synthesized prodrugs AR-9, AR-10 and AR-2 showing excellent pharmacological response and encouraging hydrolysis rate both in (Simulated Intestinal Fluid) SIF and in 80% human plasma. Prodrugs with increased aliphatic side chain length or introduction of aromatic substituent resulted in enhanced partition coefficient but diminished dissolution and hydrolysis rate. Such prodrugs can be considered for sustained release purpose. (author)

  14. Theoretical study of corrosion inhibition of amides and thiosemicarbazones

    International Nuclear Information System (INIS)

    An examination of quantum chemical and corrosion inhibition studies were carried out to investigate whether any clear links exist between the results of quantum chemical calculations and the experimental efficiencies of urea (U), thiourea (TU), acetamide (A), thioacetamide (TA), semicarbazide (SC), thiosemicarbazide (TSC), methoxybenzaldehydethiosemicarbazone (MBTSC), 2-acetylpyridine-(4phenyl) thiosemicarbazone (2AP4PTSC), 2-acetylpyridine-(4-methyl) thiosemicarbazone (2AP4MTSC), benzointhiosemicarbazone (BZOTSC) and benzilthiosemicarbazone (BZITSC) being corrosion inhibitors. The quantum chemical calculations have been performed by using DFT, ab-initio molecular orbital and semi-empirical methods for some amides and thiosemicarbozone derivatives being corrosion inhibitors. The highest occupied molecular orbital energy (E HOMO), lowest unoccupied molecular orbital energy (E LUMO), the energy gap between E HOMO and E LUMO (ΔE HOMO-LUMO), dipole moments (μ), charges on the C, O, N, S atoms, the total energies of the molecules and the polarizabilities , the coefficients of the development of the MO over the atomic orbital (AO) corresponding to the between atoms which a new bond is established have been calculated. The results of quantum chemical calculations and experimental efficiencies of inhibitors were subjected to correlation analysis. We have reached the conclusion that the synthesis of better corrosion inhibitors can be achieved by controlling all electronic properties and parameters of a selected group of molecules

  15. Synthesis, characterization and pharmacological evaluation of amide prodrugs of Flurbiprofen

    Energy Technology Data Exchange (ETDEWEB)

    Mishra, Ashutosh; Veerasamy, Ravichandran; Jain, Prateek Kumar; Dixit, Vinod Kumar; Agrawal, Ram Kishor [Dr. H. S. Gour Vishwavidyalaya, Sagar (India). Dept. of Pharmaceutical Sciences. Pharmaceutical Chemistry Research Lab.]. E-mail: dragrawal2001@yahoo.co.in

    2008-07-01

    Flurbiprofen (FB) suffers from the general side effects of NSAIDs, owing to presence of free carboxylic acid group. The study was aimed to retard the adverse effects of gastrointestinal origin. Ten prodrugs of FB were synthesized by amidation with ethyl esters of amino acids, namely, glycine, L-phenylalanine, L-tryptophan, L-valine, L-isoleucine, L-alanine, L-leucine, L-glutamic acid, L-aspartic acid and {beta} alanine. Purified synthesized prodrugs were characterized by m.p., TLC, solubility, partition coefficients, elemental analyses, UV, FTIR, NMR and MS. Synthesized prodrugs were subjected for bioavailability studies, analgesic, anti-inflammatory activities and ulcerogenic index. Marked reduction of ulcerogenic index and comparable analgesic, antiinflammatory activities were obtained in all cases as compared to FB. Among synthesized prodrugs AR-9, AR-10 and AR-2 showing excellent pharmacological response and encouraging hydrolysis rate both in (Simulated Intestinal Fluid) SIF and in 80% human plasma. Prodrugs with increased aliphatic side chain length or introduction of aromatic substituent resulted in enhanced partition coefficient but diminished dissolution and hydrolysis rate. Such prodrugs can be considered for sustained release purpose. (author)

  16. Pb(II)-promoted amide cleavage: mechanistic comparison to a Zn(II) analogue.

    Science.gov (United States)

    Elton, Eric S; Zhang, Tingting; Prabhakar, Rajeev; Arif, Atta M; Berreau, Lisa M

    2013-10-01

    Two new Pb(II) complexes of the amide-appended nitrogen/sulfur epppa (N-((2-ethylthio)ethyl)-N-((6-pivaloylamido-2-pyridyl)methyl)-N-((2-pyridyl)methyl)amine) chelate ligand, [(epppa)Pb(NO3)2] (4-NO3) and [(epppa)Pb(ClO4)2] (4-ClO4), were prepared and characterized. In the solid state, 4-NO3 exhibits κ(5)-epppa chelate ligand coordination as well as the coordination of two bidentate nitrate ions. In acetonitrile, 4-NO3 is a 1:1 electrolyte with a coordinated NO3(-), whereas 4-ClO4 is a 1:2 electrolyte. Treatment of 4-ClO4 with 1 equiv Me4NOH·5H2O in CH3CN:CH3OH (3:5) results in amide methanolysis in a reaction that is akin to that previously reported for the Zn(II) analogue [(epppa)Zn](ClO4)2 (3-ClO4). (1)H NMR kinetic studies of the amide methanolysis reactions of 4-ClO4 and 3-ClO4 as a function of temperature revealed free energies of activation of 21.3 and 24.5 kcal/mol, respectively. The amide methanolysis reactions of 4-ClO4 and 3-ClO4 differ in terms of the effect of the concentration of methanol (saturation kinetics for 4-ClO4; second-order behavior for 3-ClO4), the observation of a small solvent kinetic isotope effect (SKIE) only for the reaction of the Zn(II)-containing 3-ClO4, and the properties of an initial intermediate isolated from each reaction upon treatment with Me4NOH·5H2O. These experimental results, combined with computational studies of the amide methanolysis reaction pathways of 4-ClO4 and 3-ClO4, indicate that the Zn(II)-containing 3-ClO4 initially undergoes amide deprotonation upon treatment with Me4NOH·5H2O. Subsequent amide protonation from coordinated methanol yields a structure containing a coordinated neutral amide and methoxide anion from which amide cleavage can then proceed. The rate-determining step in this pathway is either amide protonation or protonation of the leaving group. The Pb(II)-containing 4-ClO4 instead directly forms a neutral amide-containing, epppa-ligated Pb(II)-OH/Pb(II)-OCH3 equilibrium mixture upon treatment

  17. Synthesis of Biaryls through Nickel-Catalyzed Suzuki-Miyaura Coupling of Amides by Carbon-Nitrogen Bond Cleavage.

    Science.gov (United States)

    Shi, Shicheng; Meng, Guangrong; Szostak, Michal

    2016-06-01

    The first Ni-catalyzed Suzuki-Miyaura coupling of amides for the synthesis of widely occurring biaryl compounds through N-C amide bond activation is reported. The reaction tolerates a wide range of electron-withdrawing, electron-neutral, and electron-donating substituents on both coupling partners. The reaction constitutes the first example of the Ni-catalyzed generation of aryl electrophiles from bench-stable amides with potential applications for a broad range of organometallic reactions. PMID:27101428

  18. Expression of peptidyl-glycine alpha-amidating mono-oxygenase (PAM) enzymes in morphological abnormalities adjacent to pulmonary tumors.

    OpenAIRE

    Martinez, A.; Treston, A M; Saldise, L. (Laura); Montuenga, L.M. (Luis M.); Linnoila, R I

    1996-01-01

    Carboxyl-terminal amidated peptide hormones are known to be autocrine growth factors for lung tumors and tumor cell lines. Expression of the enzymes necessary for the biosynthesis of active amidated peptide hormones is therefore necessary for autocrine growth stimulation in lung tumors and possibly in the early proliferative stages of lung carcinogenesis. The peptidyl amidating enzymes have previously been identified in cell lines of all histological types of lung cancer and in lung tumors by...

  19. Generation of a novel monoclonal antibody that recognizes the alpha (α)-amidated isoform of a valine residue

    OpenAIRE

    Antón Palma, Benito; Leff Gelman, Philippe; Medecigo Ríos, Mayra; Calva Nieves, Juan Carlos; Acevedo Ortuño, Rodolfo; Matus Ortega, Maura Epifanía; Hernández Calderón, Jorge Alberto; Hernández Miramontes, Ricardo; Flores Zamora, Anabel; Salazar Juárez, Alberto

    2015-01-01

    Background Alpha (α)-amidation of peptides is a mechanism required for the conversion of prohormones into functional peptide sequences that display biological activities, receptor recognition and signal transduction on target cells. Alpha (α)-amidation occurs in almost all species and amino acids identified in nature. C-terminal valine amide neuropeptides constitute the smallest group of functional peptide compounds identified in neurosecretory structures in vertebrate and invertebrate specie...

  20. The design, synthesis of amide KARI inhibitors and their biological activities

    Institute of Scientific and Technical Information of China (English)

    Baolei WANG; Yi MA; Yonghong LI; Suhua WANG; Zhengming LI

    2009-01-01

    Ketol-acid reductoisomerase(KARI) is a promising target for the design of herbicides yet there are only few reports on the molecular design of KARI inhibitors. In this paper, based on the reported 0.165 nm high resolution crystal structure of the spinach KARI complex, 279 molecules with low binding energy toward KARI were obtained from an MDL/ACD 3D database search using the program DOCK 4.0. According to the structural information of 279 molecules provided, some amide compounds have been designed and synthesized. The bioassay results show that most of these amides had inhibitory activity to rice KARI at a test concentration of 200 μg/mL. Among which eight amides, compounds 1 and 6 show 57.4% and 48.1% inhibitory activity to KARI. The herbicidal activities of these amides were further investigated on di-cotyledonous rape (Brassica campestris) and mono-cotyledonous bar-nyardgrass (Echinochloa crusgalli). Compounds 1 and 6 were more favorable than others and showed 52.0% and 72.6% inhibitory activity on rape root at 100 μg/mL concentration, respectively. These amides could be further optimized for finding more potent candidates.

  1. Gas-Phase Amidation of Carboxylic Acids with Woodward's Reagent K Ions

    Science.gov (United States)

    Peng, Zhou; Pilo, Alice L.; Luongo, Carl A.; McLuckey, Scott A.

    2015-06-01

    Gas-phase amidation of carboxylic acids in multiply-charged peptides is demonstrated via ion/ion reactions with Woodward's reagent K (wrk) in both positive and negative mode. Woodward's reagent K, N-ethyl-3-phenylisoxazolium-3'-sulfonate, is a commonly used reagent that activates carboxylates to form amide bonds with amines in solution. Here, we demonstrate that the analogous gas-phase chemistry occurs upon reaction of the wrk ions and doubly protonated (or doubly deprotonated) peptide ions containing the carboxylic acid functionality. The reaction involves the formation of the enol ester intermediate in the electrostatic complex. Upon collisional activation, the ethyl amine on the reagent is transferred to the activated carbonyl carbon on the peptide, resulting in the formation of an ethyl amide (addition of 27 Da to the peptide) with loss of a neutral ketene derivative. Further collision-induced dissociation (CID) of the products and comparison with solution-phase amidation product confirms the structure of the ethyl amide.

  2. Arg-Phe-amide-related peptides influence gonadotropin-releasing hormone neurons

    Institute of Scientific and Technical Information of China (English)

    Haluk Kelestimur; Emine Kacar; Aysegul Uzun; Mete Ozcan; Selim Kutlu

    2013-01-01

    The hypothalamic Arg-Phe-amide-related peptides, gonadotropin-inhibitory hormone and orthologous mammalian peptides of Arg-Phe-amide, may be important regulators of the hypothalamus-pituitary-gonadal reproductive axis. These peptides may modulate the effects of kisspeptins because they are presently recognized as the most potent activators of the hypothalamus-pituitary-gonadal axis. However, their effects on gonadotropin-releasing hormone neurons have not been investigated. In the current study, the GT1–7 cell line-expressing gonadotropin-releasing hormone was used as a model to explore the effects of Arg-Phe- amide-related peptides on kisspeptin activation. Intracellular calcium concentration was quantified using the calcium-sensitive dye, fura-2 acetoxymethyl ester. Gonadotropin-releasing hormone released into the medium was detected via enzyme-linked immunosorbent assay. Results showed that 100 nmol/L kisspeptin-10 significantly increased gonadotropin-releasing hormone levels (at 120 minutes of exposure) and intracellular calcium concentrations. Co-treatment of kisspeptin with 1 μmol/L gonadotropin-inhibitory hormone or 1 μmol/L Arg-Phe-amide-related peptide-1 significantly attenuated levels of kisspeptin-induced gonadotropin-releasing hormone but did not affect kisspeptin-induced elevations of intracellular calcium concentration. Overall, the results suggest that gonadotropin-inhibitory hormone and Arg-Phe-amide-related peptide-1 may have inhibitory effects on kisspeptin-activated gonadotropin-releasing hormone neurons independent of the calcium signaling pathway.

  3. Effect of Secondary Species on Inhibition Efficiency of Fatty Amide Mixtures in Dynamic Environment

    Directory of Open Access Journals (Sweden)

    Izni Mariah Ibrahim

    2015-06-01

    Full Text Available The corrosion inhibition of carbon steel in 3.5wt% NaCl solution by fatty amides with addition of hydrazine, N2H4 in moving condition has been studied using linear polarization resistance measurements and scanning electron microscope technology with energy disperse X-ray spectroscopy (SEM-EDX. The effect of different moving condition was studied using rotating cylinder electrode, RCE at different rotational speeds (0, 1, 5 and 50 rpm. Results have shown that for uninhibited conditions, the corrosion resistance, Rp values decreased drastically as rotation speed increased up to 50 rpm. For inhibited solution, Rp values are highest under static condition and it decreased gradually with increase in rotational speed. It was found that, the inhibition efficiency enhanced by adding hydrazine into the solution containing fatty amide inhibitor due to multiple protections provided by both, fatty amides and hydrazine.

  4. Synthesis, Anticancer and Antibacterial Activity of Salinomycin N-Benzyl Amides

    Directory of Open Access Journals (Sweden)

    Michał Antoszczak

    2014-11-01

    Full Text Available A series of 12 novel monosubstituted N-benzyl amides of salinomycin (SAL was synthesized for the first time and characterized by NMR and FT-IR spectroscopic methods. Molecular structures of three salinomycin derivatives in the solid state were determined using single crystal X-ray method. All compounds obtained were screened for their antiproliferative activity against various human cancer cell lines as well as against the most problematic bacteria strains such as methicillin-resistant Staphylococcus aureus (MRSA and Staphylococcus epidermidis (MRSE, and Mycobacterium tuberculosis. Novel salinomycin derivatives exhibited potent anticancer activity against drug-resistant cell lines. Additionally, two N-benzyl amides of salinomycin revealed interesting antibacterial activity. The most active were N-benzyl amides of SAL substituted at -ortho position and the least anticancer active derivatives were those substituted at the -para position.

  5. Alpha-amidated peptides derived from pro-opiomelanocortin in human pituitary tumours

    DEFF Research Database (Denmark)

    Fenger, M; Johnsen, A H

    1988-01-01

    Human pituitary tumours, obtained at surgery for Cushing's disease and Nelson's syndrome, were extracted and the content and molecular forms of pro-opiomelanocortin (POMC)-derived peptides determined by radioimmunoassay, gel chromatography, reversed-phase high-performance liquid chromatography...... conclusion, all the molecular forms of the amidated peptides detected in tumours from patients with Cushing's disease and Nelson's syndrome were similar to the molecular forms found in the normal human pituitary. The main difference between the tumours and the normal pituitary was the greater amount of...... (HPLC) and sequence analysis. In the tumours from patients with Cushing's disease the mean concentrations of amidated peptides relative to the total amount of POMC were as follows: alpha-MSH, 1.7%; amidated gamma-MSH (gamma 1-MSH), 8.5% and the peptide linking gamma-MSH and ACTH in the precursor (hinge...

  6. Mechanistic insight into benzenethiol catalyzed amide bond formations from thioesters and primary amines

    DEFF Research Database (Denmark)

    Stuhr-Hansen, Nicolai; Bork, Nicolai; Strømgaard, Kristian

    2014-01-01

    The influence of arylthiols on cysteine-free ligation, i.e. the reaction between an alkyl thioester and a primary amine forming an amide bond, was studied in a polar aprotic solvent. We reacted the ethylthioester of hippuric acid with cyclohexylamine in the absence or presence of various quantities...... state in the aromatic thioester amidation reaction. Under similar conditions, cysteine-free ligation was achieved by coupling a fully side-chain protected 15 amino acid phosphopeptide thioester to the free N-terminal of a side-chain protected 9 amino acid peptide producing the corresponding 24 amino...... of thiophenol (PhSH) in a slurry of disodium hydrogen phosphate in dry DMF. Quantitative conversions into the resulting amide were observed within a few hours in the presence of equimolar amounts of thiophenol. Ab initio calculations showed that the reaction mechanism in DMF is similar to the well...

  7. Presumptive FMRF-amide-like immunoreactive retinopetal fibres in Crocodylus niloticus.

    Science.gov (United States)

    Médina, Monique; Repérant, Jacques; Ward, Roger; Miceli, Dom

    2004-10-29

    A small contingent of 30-50 of centrifugal visual fibres, showing FMRF-amide-like immunoreactivity, has been identified in C. niloticus; these fibres extend from the chiasmatic region into the retina. They do not take the marginal optic tract, but pass medially to the chiasmatic fascicles, from the preoptic region. The cells of origin of these fibres have not been identified. However, none of the retinopetal neurons of the brainstem [M. Medina, J. Reperant, R. Ward, D. Miceli, Centrifugal visual system of Crocodylus niloticus : a hodological, histochemical and immunocytochemical study, J. Comp. Neurol. 468 (2004) 65-85], labelled by retrograde transport of rhodamine beta-isothiocyanate after intraocular injection of this tracer, show FMRF-amide-like immunoreactivity; neither are any of the FMRF-amide-like immunopositive neurons in the crocodile brain, particularly those of the complex involving the terminal nerve and the septo-preoptic region, labelled by rhodamine after its intraocular injection. PMID:15464765

  8. Supported Gold Nanoparticles for Efficient α-Oxygenation of Secondary and Tertiary Amines into Amides.

    Science.gov (United States)

    Jin, Xiongjie; Kataoka, Kengo; Yatabe, Takafumi; Yamaguchi, Kazuya; Mizuno, Noritaka

    2016-06-13

    Although the α-oxygenation of amines is a highly attractive method for the synthesis of amides, efficient catalysts suited to a wide range of secondary and tertiary alkyl amines using O2 as the terminal oxidant have no precedent. This report describes a novel, green α-oxygenation of a wide range of linear and cyclic secondary and tertiary amines mediated by gold nanoparticles supported on alumina (Au/Al2 O3 ). The observed catalysis was truly heterogeneous, and the catalyst could be reused. The present α-oxygenation utilizes O2 as the terminal oxidant and water as the oxygen atom source of amides. The method generates water as the only theoretical by-product, which highlights the environmentally benign nature of the present reaction. Additionally, the present α-oxygenation provides a convenient method for the synthesis of (18) O-labeled amides using H2 (18) O as the oxygen source. PMID:27151621

  9. Synthesis and effect of fatty acid amides as friction modifiers in petroleum base stock.

    Science.gov (United States)

    Khalkar, Sharmishtha; Bhowmick, DiptiNarayan; Pratap, Amit

    2013-01-01

    Fatty acid amides were prepared by using Lewis acid as a catalyst. The products from reaction was subjected to solvent extraction with chloroform and then followed by purification with n-hexane, ethanol and acetonitrile. Fatty acid amide, characterized by various physicochemical and tribological properties like wear scar, weld load and coefficient of friction. These compounds found good antiwear (AW) and extreme pressure (EP) additive. The addition of various EP and AW additives in lubricating oil is an important and effective way to reduce friction and wear. Fatty acid amides were used as antiwear and friction modifier additive and a comparative study was carried out for 1%, 3%, 5% additive blend with commercial petroleum base stocks 150N and 500N. PMID:24200937

  10. Lipase-catalyzed synthesis of fatty acid amide (erucamide) using fatty acid and urea.

    Science.gov (United States)

    Awasthi, Neeraj Praphulla; Singh, R P

    2007-01-01

    Ammonolysis of fatty acids to the corresponding fatty acid amides is efficiently catalysed by Candida antartica lipase (Novozym 435). In the present paper lipase-catalysed synthesis of erucamide by ammonolysis of erucic acid and urea in organic solvent medium was studied and optimal conditions for fatty amides synthesis were established. In this process erucic acid gave 88.74 % pure erucamide after 48 hour and 250 rpm at 60 degrees C with 1:4 molar ratio of erucic acid and urea, the organic solvent media is 50 ml tert-butyl alcohol (2-methyl-2-propanol). This process for synthesis is economical as we used urea in place of ammonia or other amidation reactant at atmospheric pressure. The amount of catalyst used is 3 %. PMID:17898456

  11. Synthesis and Characterization of Novel Polyurethanes Based on Vegetable Oils Amide and Ester Polyols

    Directory of Open Access Journals (Sweden)

    Vladimir YAKUSHIN

    2014-09-01

    Full Text Available Amide and ester type polyols were synthesized from rapeseed, sunflower and castor oils, and two types of ethanolamine (diethanolamine and triethanolamine at different molar ratio. Poly(urethane amides and polyester urethanes based on the synthesized polyols were prepared. The effect of the chemical structure of the obtained polyurethanes on density, glass transition temperature, thermal stability and mechanical properties was investigated. The influence of the content of OH groups in the synthesized polyols on the specified characteristics was estimated. It has been found that poly(urethane amides have better mechanical characteristics, but their thermal stability is lower than that of polyester urethanes. The chemical structure of the synthesized polyols and polyurethanes is qualitatively confirmed by IR-spectroscopy data. DOI: http://dx.doi.org/10.5755/j01.ms.20.3.4532

  12. Amide Rotation Hindrance Predicts Proteolytic Resistance of Cystine-Knot Peptides.

    Science.gov (United States)

    Zhou, Yanzi; Xie, Daiqian; Zhang, Yingkai

    2016-04-01

    Cystine-knot peptides have remarkable stability against protease degradation and are attractive scaffolds for peptide-based therapeutic and diagnostic agents. In this work, by studying the hydrolysis reaction of a cystine-knot inhibitor MCTI-A and its variants with ab initio QM/MM molecular dynamics simulations, we have elucidated an amide rotation hindrance mechanism for proteolysis resistance: The proteolysis of MCTI-A is retarded due to the higher free energy cost during the rotation of NH group around scissile peptide bond at the tetrahedral intermediate of acylation, and covalent constraint provided by disulfide bonds is the key factor to hinder this rotation. A nearly linear correlation has been revealed between free energy barriers of the peptide hydrolysis reaction and the amide rotation free energy changes at the protease-peptide Michaelis complex state. This suggests that amide rotation hindrance could be one useful feature to estimate peptide proteolysis stability. PMID:26958702

  13. Synthesis and characterization of alternating poly(amide urea)s and poly(amide urethane urethane)s from ε-caprolactam, diamines, and diphenyl carbonate or ethylene carbonate

    NARCIS (Netherlands)

    Ubaghs, Luc; Sharma, Bhaskar; Keul, Helmut; Höcker, Hartwig; Loontjens, Ton; Benthem, Rolf van

    2003-01-01

    Alternating poly(amide urea)s from ε-caprolactam, diamines H2N-(CH2)x-NH2 (x = 2 - 4), and diphenyl carbonate were prepared in two steps. The microstructure of the poly(amide urea)s, as determined by means of 1H NMR spectroscopy, reveals a strictly alternating sequence of the building blocks. The mo

  14. Computation of the amide I band of polypeptides and proteins using a partial Hessian approach.

    Science.gov (United States)

    Besley, Nicholas A; Metcalf, Katie A

    2007-01-21

    A partial Hessian approximation for the computation of the amide I band of polypeptides and proteins is introduced. This approximation exploits the nature of the amide I band, which is largely localized on the carbonyl groups of the backbone amide residues. For a set of model peptides, harmonic frequencies computed from the Hessian comprising only derivatives of the energy with respect to the displacement of the carbon, oxygen, and nitrogen atoms of the backbone amide groups introduce mean absolute errors of 15 and 10 cm(-1) from the full Hessian values at the Hartree-Fock/STO-3G and density functional theory EDF16-31G(*) levels of theory, respectively. Limiting the partial Hessian to include only derivatives with respect to the displacement of the backbone carbon and oxygen atoms yields corresponding errors of 24 and 22 cm(-1). Both approximations reproduce the full Hessian band profiles well with only a small shift to lower wave number. Computationally, the partial Hessian approximation is used in the solution of the coupled perturbed Hartree-Fock/Kohn-Sham equations and the evaluation of the second derivatives of the electron repulsion integrals. The resulting computational savings are substantial and grow with the size of the polypeptide. At the HF/STO-3G level, the partial Hessian calculation for a polypeptide comprising five tryptophan residues takes approximately 10%-15% of the time for the full Hessian calculation. Using the partial Hessian method, the amide I bands of the constituent secondary structure elements of the protein agitoxin 2 (PDB code 1AGT) are calculated, and the amide I band of the full protein estimated. PMID:17249900

  15. Simultaneous NMR assignment of backbone and side chain amides in large proteins with IS-TROSY

    International Nuclear Information System (INIS)

    A new strategy for the simultaneous NMR assignment of both backbone and side chain amides in large proteins with isotopomer-selective transverse-relaxation-optimized spectroscopy (IS-TROSY) is reported. The method considers aspects of both the NMR sample preparation and the experimental design. First, the protein is dissolved in a buffer with 50%H2O/50%D2O in order to promote the population of semideuterated NHD isotopomers in side chain amides of Asn/Gln residues. Second, a 13C'-coupled 2D 15N-1H IS-TROSY spectrum provides a stereospecific distinction between the geminal protons in the E and Z configurations of the carboxyamide group. Third, a suite of IS-TROSY-based triple-resonance NMR experiments, e.g. 3D IS-TROSY-HNCA and 3D IS-TROSY-HNCACB, are designed to correlate aliphatic carbon atoms with backbone amides and, for Asn/Gln residues, at the same time with side chain amides. The NMR assignment procedure is similar to that for small proteins using conventional 3D HNCA/3D HNCACB spectra, in which, however, signals from NH2 groups are often very weak or even missing due to the use of broad-band proton decoupling schemes and NOE data have to be used as a remedy. For large proteins, the use of conventional TROSY experiments makes resonances of side chain amides not observable at all. The application of IS-TROSY experiments to the 35-kDa yeast cytosine deaminase has established a complete resonance assignment for the backbone and stereospecific assignment for side chain amides, which otherwise could not be achieved with existing NMR experiments. Thus, the development of IS-TROSY-based method provides new opportunities for the NMR study of important structural and biological roles of carboxyamides and side chain moieties of arginine and lysine residues in large proteins as well as amino moieties in nucleic acids

  16. Durability of amide N-chloramine biocides to ethylene oxide sterilization.

    Science.gov (United States)

    Zhao, Nan; Logsetty, Sarvesh; Liu, Song

    2012-01-01

    The objective of this work is to study the stability of three novel topical antimicrobial dressings consisting of amide N-chloramine structures against ethylene oxide sterilization. Cotton gauze samples bonded with one of three amide N-chloramine structures were subjected to standard ethylene oxide (EtO) sterilization. The amounts of amide N-chloramine structures before and after the sterilization were quantified to indicate the stabilities of these amide N-chloramine structures to the sterilization. The samples after sterilization were challenged with a clinical isolate of healthcare-associated multidrug-resistant Escherichia coli. N-Chloramine structure converted from polymethacrylamide (dressing 2) had the highest durability (89.7% retained active chlorine) toward EtO sterilization; that from hydantoin (dressing 3; 86.3% retained active chlorine) followed; and poly(N-chloroacrylamide) (dressing 1) had the lowest (64.0% retained active chlorine). After EtO sterilization, all the samples still reduced E. coli presence at 5 minutes of contact, with dressing 2 retaining a log 6 reduction. The three tested amide N-chloramine structures could all survive EtO sterilization while retaining percentages of active chlorine ranging from 64.0 to 89.7%. Dressing 2 showed the best durability, whereas dressing 1 had the poorest durability. With the remaining amounts of amide N-chloramine structures after EtO sterilization, all the dressings could still reduce E. coli numbers within 5 minutes of contact, and dressing 2 resulted in a log 6 reduction in colony count. PMID:22157019

  17. Novel L-DOPA-derived poly(ester amide)s: monomers, polymers, and the first L-DOPA-functionalized biobased adhesive tape.

    Science.gov (United States)

    Manolakis, Ioannis; Noordover, Bart A J; Vendamme, Richard; Eevers, Walter

    2014-01-01

    The synthesis, characterization, and testing of a range of novel bio-inspired L-DOPA-derived poly(ester amide)s is presented, using a widely applicable, straightforward chemistry. A model system is used to study and establish the monomer and polymer synthetic protocols, and to provide a set of optimum reaction conditions. It is further shown that fully biobased L-DOPA-containing adhesive tapes can be fabricated, which are positively evaluated in terms of their adhesive properties. The newly developed synthetic protocol constitutes a versatile platform for accessing and tailoring a plethora of relevant structures, including a variety of potentially biocompatible poly(ethylene glycol)-based materials. PMID:24265232

  18. Copper Complexes of Anionic Nitrogen Ligands in the Amidation and Imidation of Aryl Halides

    OpenAIRE

    Tye, Jesse W.; Weng, Zhiqiang; Johns, Adam M.; Incarvito, Christopher D.; Hartwig, John F.

    2008-01-01

    Copper(I) imidate and amidate complexes of chelating N,N-donor ligands, which are proposed intermediates in copper-catalyzed amidations of aryl halides, have been synthesized and characterized by X-ray diffraction and detailed solution-phase methods. In some cases, the complexes adopt neutral, three-coordinate trigonal planar structures in the solid state, but in other cases they adopt an ionic form consisting of an L2Cu+ cation and a CuX2− anion. A tetraalkylammonium salt of the CuX2− anion ...

  19. Occurrence, biological activities and 13C NMR data of amides from Piper (Piperaceae

    Directory of Open Access Journals (Sweden)

    Jeferson C. do Nascimento

    2012-01-01

    Full Text Available This manuscript describes an update review with up to 285 references concerning the occurrence of amides from a variety of species of the genus Piper (Piperaceae. Besides addressing occurrence, this review also describes the biological activities attributed to extracts and pure compounds, a compiled 13C NMR data set, the main correlations between structural and NMR spectroscopic data of these compounds, and employment of hyphened techniques such as LC-MS, GC-MS and NMR for analysis of amides from biological samples and crude Piper extracts.

  20. Amide functionalized MWNT/SPEEK composite membrane for better electrochemical performance

    Science.gov (United States)

    Gahlot, Swati; Sharma, Prem P.; Kulshrestha, Vaibhav

    2016-05-01

    Nanocomposite membranes based on multiwalled carbon nanotube /SPEEK (sulfonated poly ether ether ketone) have been synthesized via simple solution casting. Prior to use CNT have been purified and grafted with carboxylic acid groups onto its walls by means of sulfuric and nitric acid. Afterwards, amidation of carboxylated CNTs (c-CNT) has been done. Amidated CNT (a-CNT) is then incorporated in SPEEK polymer matrix to synthesize nanocomposite membranes. Physicochemical, structural, thermal and mechanical characterizations are done through the respective techniques. Electric and ionic conductivities have also been evaluated. Composites membranes show the enhanced electrochemical performance with higher electric conductivity.

  1. 3D QSAR Study on Alpha Keto Amide Derivatives as gp120-CD4 Inhibitors

    Directory of Open Access Journals (Sweden)

    Vinayak D. More

    2012-01-01

    Full Text Available The present communication deals with 3D QDAR analysis on series of Alpha keto amide derivatives some for the designing of new GP120-CD4 inhibitors with anti HIV activity. The four different QSAR models are generated using data set of 32 molecules as gp120-CD4 inhibitors from literature studies. The 3D QSAR result gives insights for understanding of the relationship between structural features of substituted alpha keto amide derivatives and their activities which should be useful to design newer potential anti-HIV agents.

  2. Protein structure validation and refinement using amide proton chemical shifts derived from quantum mechanics

    DEFF Research Database (Denmark)

    Christensen, Anders Steen; Linnet, Troels Emtekær; Borg, Mikael;

    2013-01-01

    We present the ProCS method for the rapid and accurate prediction of protein backbone amide proton chemical shifts - sensitive probes of the geometry of key hydrogen bonds that determine protein structure. ProCS is parameterized against quantum mechanical (QM) calculations and reproduces high level...... QM results obtained for a small protein with an RMSD of 0.25 ppm (r = 0.94). ProCS is interfaced with the PHAISTOS protein simulation program and is used to infer statistical protein ensembles that reflect experimentally measured amide proton chemical shift values. Such chemical shift...

  3. Production of R-(-)-Ketoprofen from an Amide Compound by Comamonas acidovorans KPO-2771-4

    OpenAIRE

    Yamamoto, K; Otsubo, K; Matsuo, A.; T Hayashi; Fujimatsu, I; Komatsu, K.

    1996-01-01

    R-(-)-2-(3(prm1)-Benzoylphenyl)propionic acid [R-(-)-ketoprofen] was produced from racemic 2-(3(prm1)-benzoylphenyl)propionamide (keto-amide) by the isolated bacterial strain Comamonas acidovorans KPO-2771-4. Sodium fumarate as the carbon source and 2-azacyclononanone or isobutyronitrile as the enhancer in the culture medium were effective for bacterial growth and the enhancement of R-(-)-ketoprofen-producing activity. R-(-)-Ketoprofen produced from the keto-amide by resting cells was present...

  4. Diastereoselective and enantioselective conjugate addition reactions utilizing α,β-unsaturated amides and lactams

    Directory of Open Access Journals (Sweden)

    Katherine M. Byrd

    2015-04-01

    Full Text Available The conjugate addition reaction has been a useful tool in the formation of carbon–carbon bonds. The utility of this reaction has been demonstrated in the synthesis of many natural products, materials, and pharmacological agents. In the last three decades, there has been a significant increase in the development of asymmetric variants of this reaction. Unfortunately, conjugate addition reactions using α,β-unsaturated amides and lactams remain underdeveloped due to their inherently low reactivity. This review highlights the work that has been done on both diastereoselective and enantioselective conjugate addition reactions utilizing α,β-unsaturated amides and lactams.

  5. Alpha-amidated peptides derived from pro-opiomelanocortin in normal human pituitary

    DEFF Research Database (Denmark)

    Fenger, M; Johnsen, A H

    1988-01-01

    Normal human pituitaries were extracted in boiling water and acetic acid, and the alpha-amidated peptide products of pro-opiomelanocortin (POMC), alpha-melanocyte-stimulating hormone (alpha MSH), gamma-melanocyte-stimulating hormone (gamma 1MSH), and amidated hinge peptide (HP-N), as well as their...... glycine-extended precursors, were characterized by sequence-specific radioimmunoassays, gel-chromatography, h.p.l.c. and amino acid sequencing. alpha MSH and gamma 1MSH constituted 0.27-1.32% and 0.10-5.10%, respectively, of the POMC-derived products [calculated as the sum of adrenocorticotropic hormone...

  6. Occurrence, biological activities and {sup 13}C NMR data of amides from Piper (Piperaceae)

    Energy Technology Data Exchange (ETDEWEB)

    Nascimento, Jeferson C. do; Paula, Vanderlucia F. de [Universidade Estadual do Sudoeste da Bahia, Jequie, BA (Brazil). Dept. de Quimica e Exatas; David, Jorge M. [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil). Inst. de Quimica; David, Juceni P., E-mail: jmdavid@ufba.br [Universidade Federal da Bahia (UFBA), Salvador, BA (Brazil). Fac. de Farmacia

    2012-07-01

    This manuscript describes an update review with up to 285 references concerning the occurrence of amides from a variety of species of the genus Piper (Piperaceae). Besides addressing occurrence, this review also describes the biological activities attributed to extracts and pure compounds, a compiled {sup 13}C NMR data set, the main correlations between structural and NMR spectroscopic data of these compounds, and employment of hyphened techniques such as LC-MS, GC-MS and NMR for analysis of amides from biological samples and crude Piper extracts. (author)

  7. Pharmaceuticals and Surfactants from Alga-Derived Feedstock: Amidation of Fatty Acids and Their Derivatives with Amino Alcohols.

    Science.gov (United States)

    Tkacheva, Anastasia; Dosmagambetova, Inkar; Chapellier, Yann; Mäki-Arvela, Päivi; Hachemi, Imane; Savela, Risto; Leino, Reko; Viegas, Carolina; Kumar, Narendra; Eränen, Kari; Hemming, Jarl; Smeds, Annika; Murzin, Dmitry Yu

    2015-08-24

    Amidation of renewable feedstocks, such as fatty acids, esters, and Chlorella alga based biodiesel, was demonstrated with zeolites and mesoporous materials as catalysts and ethanolamine, alaninol, and leucinol. The last two can be derived from amino acids present in alga. The main products were fatty alkanol amides and the corresponding ester amines, as confirmed by NMR and IR spectroscopy. Thermal amidation of technical-grade oleic acid and stearic acid at 180 °C with ethanolamine were non-negligible; both gave 61% conversion. In the amidation of stearic acid with ethanolamine, the conversion over H-Beta-150 was 80% after 3 h, whereas only 63% conversion was achieved for oleic acid; this shows that a microporous catalyst is not suitable for this acid and exhibits a wrinkled conformation. The highest selectivity to stearoyl ethanolamide of 92% was achieved with mildly acidic H-MCM-41 at 70% conversion in 3 h at 180 °C. Highly acidic catalysts favored the formation of the ester amine, whereas the amide was obtained with a catalyst that exhibited an optimum acidity. The conversion levels achieved with different fatty acids in the range C12-C18 were similar; this shows that the fatty acid length does not affect the amidation rate. The amidation of methyl palmitate and biodiesel gave low conversions over an acidic catalyst, which suggested that the reaction mechanism in the amidation of esters was different. PMID:26197759

  8. Amides complexing with BSA in presence of GuHCl; Kompleksowanie amidow z BSA w obecnosci GuHCl

    Energy Technology Data Exchange (ETDEWEB)

    Michnik, A.; Sulkowska, A. [Wydzial Farmaceutyczny, Slaska Akademia Medyczna, Sosnowiec (Poland)

    1994-12-31

    Mechanism of amides complexing with albumin has been studied by means of {sup 1}H NMR. The assessment of hydrogen bonds contribution in interaction of amides with albumin has been done through analysis of denaturation agent (GuHCl) influence results. 1 ref., 1 fig., 4 tabs.

  9. 40 CFR 721.6183 - Amides, from ammonium hydroxide - maleic anhydride polymer and hydrogenated tallow alkyl amines...

    Science.gov (United States)

    2010-07-01

    ... - maleic anhydride polymer and hydrogenated tallow alkyl amines, sodium salts, compds. with ethanolamine... Substances § 721.6183 Amides, from ammonium hydroxide - maleic anhydride polymer and hydrogenated tallow... subject to reporting. (1) The chemical substance identified as amides, from ammonium hydroxide -...

  10. Studies of linear correlation factor of dielectric polarization and excess dipolar free energies of amides in apolar solvents

    Indian Academy of Sciences (India)

    M Malathi; R Sabesan; S Krishnan

    2005-09-01

    The Kirkwood–Frohlich correlation factor (), Eyring's parameters and * and the dipolar excess free energies of dilute solutions of formamide, acetamide, -methyl acetamide, , -dimethyl formamide and , -dimethyl acetamide in 1,4-dioxan/benzene were obtained from a measurement of their static dielectric permittivities at 308 K. The fluid structure of these amides is discussed. Both in formamide and acetamide a dimeric linear chain with the individual dipoles more or less parallely oriented is preferred. In -methyl acetamide, the antiparallel orientation of dipoles at lower concentrations turns into a parallel orientation with increase of concentration. In tertiary amides, with increase of concentration, parallel orientation of dipoles with global value of tending to unity is observed. The dipolar excess free energy of mixing in a given solvent is of the order primary amide > secondary amide > tertiary amide.

  11. Direct Lactamization of Azido Amides via Staudinger-Type Reductive Cyclization

    Energy Technology Data Exchange (ETDEWEB)

    Heo, In Jung; Lee, Su Jeong; Cho, Chang Woo [Kyungpook National University, Daegu (Korea, Republic of)

    2012-01-15

    The direct lactamization of 1,3- and 1,4-azido amides has been achieved using triphenylphosphine and water, affording various γ- and δ-lactams in good to excellent yields. The direct lactamization of the azido amides was performed via the Staudinger-type reductive cyclization in which the amide group acts as the electrophile for lactam synthesis. This lactamization provides a mild, functional group tolerant and efficient route for the synthesis of various γ- and δ-lactams found in natural products and pharmaceuticals. Further studies will be conducted to develop new synthetic routes for the synthesis of various lactams. The lactam ring system is one of the most ubiquitous structural motifs found in natural products and pharmaceuticals. Owing to the prevalence of lactams, their synthesis has attracted considerable attention. Lactams are usually prepared by the coupling of activated carboxylic acid derivatives with amines. Alternative routes include the Beckmann rearrangement of oximes, the Schmidt reaction of cyclic ketones and hydrazoic acid, the Kinugasa reaction of nitrones and terminal acetylenes, the Diels-Alder reaction of cyclopentadiene and chlorosulfonyl isocyanate, transition metal catalyzed lactamization of amino alcohols, and iodolactamization of amides and alkenes. In particular, the intramolecular Staudinger ligation of azides and activated carboxy acids, including esters, is well known as an environmentally friendly and mild protocol for lactam synthesis.

  12. Ruthenium on chitosan: A recyclable heterogeneous catalyst for aqueous hydration of nitriles to amides

    Science.gov (United States)

    Ruthenium has been immobilized over chitosan by simply stirring an aqueous suspension of chitosan in water with ruthenium chloride and has been utilized for the oxidation of nitriles to amides; the hydration of nitriles occurs in high yield and excellent selectivity, which procee...

  13. Amide and amine nucleophiles in polar radical crossover cycloadditions: synthesis of γ-lactams and pyrrolidines.

    Science.gov (United States)

    Gesmundo, Nathan J; Grandjean, Jean-Marc M; Nicewicz, David A

    2015-03-01

    In this work we present a direct catalytic synthesis of γ-lactams and pyrrolidines from alkenes and activated unsaturated amides or protected unsaturated amines, respectively. Using a mesityl acridinium single electron photooxidant and a thiophenol cocatalyst under irradiation, we are able to directly forge these important classes of heterocycles with complete regiocontrol. PMID:25695366

  14. Characterization and dispersibility of improved thermally stable amide functionalized graphene oxide

    Energy Technology Data Exchange (ETDEWEB)

    Rani, Sumita [Electronic Science Department, Kurukshetra University, Kurukshetra, Haryana 136119 (India); Kumar, Mukesh, E-mail: kumarmukesh@gmail.com [Electronic Science Department, Kurukshetra University, Kurukshetra, Haryana 136119 (India); Kumar, Rajiv [Department of Chemistry, Kurukshetra University, Kurukshetra, Haryana 136119 (India); Kumar, Dinesh; Sharma, Sumit [Electronic Science Department, Kurukshetra University, Kurukshetra, Haryana 136119 (India); Singh, Gulshan [Department of Chemistry, Kurukshetra University, Kurukshetra, Haryana 136119 (India)

    2014-12-15

    Graphical abstract: Improved thermal stability and surface study of amide functionalized graphene oxide. - Highlights: • Amide functionalized graphene oxides (AGOs) were synthesized from aniline, 2-aminothiazole and 2-aminopyrimidine. • Achieved enhancement in thermal stability of AGOs as compare to GO. • AGOs are found to be highly dispersible in water, DMSO and DMF. • Dispersibility is stable for more than two and half months. - Abstract: Amidation of graphene oxide (GO) with aniline, 2-aminothiazole and 2-aminopyrimidine results in the synthesis of amide functionalized graphene oxides (AGOs). Scanning electron microscopy, X-ray diffraction, thermogravimetric analysis (TGA), UV–vis and Raman spectroscopy were used to investigate the properties of AGOs. It was found that, contrary to GO, AGOs are soluble in water, dimethyl sulfoxide, dimethylformamide and can be stabilized for months. TGA of AGOs shows the major weight loss above 670 °C as compared to GO in which significant weight loss occurs near 200 °C. Thus AGOs show strong improvement in thermal properties.

  15. Synthesis and intrinsic blue fluorescence study of hyperbranched poly(ester-amide-ether)

    Institute of Scientific and Technical Information of China (English)

    2010-01-01

    A series of hyperbranched poly(ester-amide-ether)s (H-PEAEs) were synthesized via the A2+CB3 approach by the self-transesterification of ethyl ester-amide-ethers end-capped with three hydroxyl groups and ethyl ester group at two terminals.The molecular structures were characterized with 1H NMR and FT-IR spectroscopy.The number average molecular weights were estimated by GPC analysis to possess bimodal wide distribution from 1.57 to 2.09.The strong inherent blue fluorescence was observed at 330 nm for excitation and 390 nm for emission.Moreover,the emission intensity and fluorescence quantum yield increased along with the incorporated ether chain length,as well as almost linearly with the H-PEAE concentration in an aqueous solution.For comparing the fluorescence performance,the linear poly(ester-amide-ether) (L-PEAE) and hyperbranched poly(ester-amide) (H-PEA) were synthesized.The results showed that the coexistence of ether bond and carboxyl group in the molecular chain was essential for generating the strong fluorescence.However,the compact backbone of H-PEAE would be propitious to the enhancement of fluorescence properties.

  16. Direct Lactamization of Azido Amides via Staudinger-Type Reductive Cyclization

    International Nuclear Information System (INIS)

    The direct lactamization of 1,3- and 1,4-azido amides has been achieved using triphenylphosphine and water, affording various γ- and δ-lactams in good to excellent yields. The direct lactamization of the azido amides was performed via the Staudinger-type reductive cyclization in which the amide group acts as the electrophile for lactam synthesis. This lactamization provides a mild, functional group tolerant and efficient route for the synthesis of various γ- and δ-lactams found in natural products and pharmaceuticals. Further studies will be conducted to develop new synthetic routes for the synthesis of various lactams. The lactam ring system is one of the most ubiquitous structural motifs found in natural products and pharmaceuticals. Owing to the prevalence of lactams, their synthesis has attracted considerable attention. Lactams are usually prepared by the coupling of activated carboxylic acid derivatives with amines. Alternative routes include the Beckmann rearrangement of oximes, the Schmidt reaction of cyclic ketones and hydrazoic acid, the Kinugasa reaction of nitrones and terminal acetylenes, the Diels-Alder reaction of cyclopentadiene and chlorosulfonyl isocyanate, transition metal catalyzed lactamization of amino alcohols, and iodolactamization of amides and alkenes. In particular, the intramolecular Staudinger ligation of azides and activated carboxy acids, including esters, is well known as an environmentally friendly and mild protocol for lactam synthesis

  17. High Performance Liquid Chromatographic Analysis of Phytoplankton Pigments Using a C16-Amide Column

    Science.gov (United States)

    A reverse-phase high performance liquid chromatographic (RP-HPLC) method was developed to analyze in a single run, most polar and non-polar chlorophylls and carotenoids from marine phytoplankton. The method is based on a RP-C16-Amide column and a ternary gradient system consistin...

  18. Communication: Quantitative multi-site frequency maps for amide I vibrational spectroscopy

    International Nuclear Information System (INIS)

    An accurate method for predicting the amide I vibrational spectrum of a given protein structure has been sought for many years. Significant progress has been made recently by sampling structures from molecular dynamics simulations and mapping local electrostatic variables onto the frequencies of individual amide bonds. Agreement with experiment, however, has remained largely qualitative. Previously, we used dipeptide fragments and isotope-labeled constructs of the protein G mimic NuG2b as experimental standards for developing and testing amide I frequency maps. Here, we combine these datasets to test different frequency-map models and develop a novel method to produce an optimized four-site potential (4P) map based on the CHARMM27 force field. Together with a charge correction for glycine residues, the optimized map accurately describes both experimental datasets, with average frequency errors of 2–3 cm−1. This 4P map is shown to be convertible to a three-site field map which provides equivalent performance, highlighting the viability of both field- and potential-based maps for amide I spectral modeling. The use of multiple sampling points for local electrostatics is found to be essential for accurate map performance

  19. Synthesis of Peptide Amides using Sol-Gel Immobilized Alcalase in Batch and Continuous Reaction System

    NARCIS (Netherlands)

    Corici, L.N.; Frissen, A.E.; Zoelen, van D.J.; Eggen, I.F.; Peter, F.; Davidescu, C.; Boeriu, C.G.

    2011-01-01

    Two commercial proteases from Bacillus licheniformis (Alcalase 2.4 L FG and Alcalase 2.5 L, Type DX) were screened for the production of Z-Ala-Phe-NH2 in batch reaction. Alcalase 2.4 L FG was the most efficient enzyme for the C-terminal amidation of Z-Ala-Phe-OMe using ammonium carbamate as ammonium

  20. Communication: Quantitative multi-site frequency maps for amide I vibrational spectroscopy

    Science.gov (United States)

    Reppert, Mike; Tokmakoff, Andrei

    2015-08-01

    An accurate method for predicting the amide I vibrational spectrum of a given protein structure has been sought for many years. Significant progress has been made recently by sampling structures from molecular dynamics simulations and mapping local electrostatic variables onto the frequencies of individual amide bonds. Agreement with experiment, however, has remained largely qualitative. Previously, we used dipeptide fragments and isotope-labeled constructs of the protein G mimic NuG2b as experimental standards for developing and testing amide I frequency maps. Here, we combine these datasets to test different frequency-map models and develop a novel method to produce an optimized four-site potential (4P) map based on the CHARMM27 force field. Together with a charge correction for glycine residues, the optimized map accurately describes both experimental datasets, with average frequency errors of 2-3 cm-1. This 4P map is shown to be convertible to a three-site field map which provides equivalent performance, highlighting the viability of both field- and potential-based maps for amide I spectral modeling. The use of multiple sampling points for local electrostatics is found to be essential for accurate map performance.

  1. 2,4-dimethoxybenzyl: An amide protecting group for 2-acetamido glycosyl donors

    DEFF Research Database (Denmark)

    Kelly, N.M.; Jensen, Knud Jørgen

    2001-01-01

    2,4-Dimethoxybenzyl (Dmob) was used as an amide protecting group for 2-acetamido glycosyl donors. The N-Dmob group was introduced by imine formation between 2,4-dimethoxybenzaldehyde and d-glucosamine, followed by per-O-acylation, reduction to form the amine, and finally N-acetylation to give 1,3...

  2. S(N)2' reaction of allylic difluorides with lithium amides and thiolates.

    Science.gov (United States)

    Bergeron, Maxime; Guyader, David; Paquin, Jean-François

    2012-12-01

    The synthesis of monofluoroalkenes using an S(N)2' reaction of lithium amides derived from aromatic amines or lithium thiolates with 3,3-difluoropropenes is reported. This transformation features the use of fluoride as a leaving group. PMID:23145465

  3. Plasma-enabled sensing of urea and related amides on polyaniline

    Czech Academy of Sciences Publication Activity Database

    Puliyalil, H.; Slobodian, P.; Sedlacik, M.; Benlikaya, R.; Říha, Pavel; Ostrikov, K.; Cvelbar, U.

    2016-01-01

    Roč. 10, č. 2 (2016), s. 265-272. ISSN 2095-0179 Grant ostatní: Ministerstvo školství, mládeže a tělovýchovy (MŠMT)(CZ) LO1504 Institutional support: RVO:67985874 Keywords : gas sensing * urea * PANI * amides * plasma Subject RIV: BK - Fluid Dynamics

  4. Amide, urea and thiourea-containing triphenylene derivatives: influence of H-bonding on mesomorphic properties

    NARCIS (Netherlands)

    Paraschiv, I.; Tomkinson, A.; Giesbers, M.; Sudhölter, E.J.R.; Zuilhof, H.; Marcelis, A.T.M.

    2007-01-01

    The synthesis and thermotropic properties are reported for a series of hexaalkoxytriphenylenes that contain an amide, urea or thiourea group in one of their alkoxy tails. The intermolecular hydrogen bonding abilities of these molecules have a disturbing influence on the formation and stability of th

  5. 2,4-dimethoxybenzyl: An amide protecting group for 2-acetamido glycosyl donors

    DEFF Research Database (Denmark)

    Kelly, N.M.; Jensen, Knud Jørgen

    2,4-Dimethoxybenzyl (Dmob) was used as an amide protecting group for 2-acetamido glycosyl donors. The N-Dmob group was introduced by imine formation between 2,4-dimethoxybenzaldehyde and d-glucosamine, followed by per-O-acylation, reduction to form the amine, and finally N-acetylation to give 1...

  6. Segmented copolymers of uniform tetra-amide units and poly(phenylene oxide) by direct coupling

    NARCIS (Netherlands)

    Krijgsman, J.; Biemond, G.J.E.; Gaymans, R.J.

    2007-01-01

    Segmented copolymers with telechelic poly(2,6-dimethyl-1,4-phenylene ether) (PPE) segments and crystallizable bisester tetra-amide units (two-and-a-half repeating unit of nylon-6,T) were studied. The copolymers were synthesized by reacting bifunctional PPE with hydroxylic end groups with an average

  7. Synthesis and properties of segmented copolymers of polyphenylene ether and tetra-amide units

    NARCIS (Netherlands)

    Krijgsman, Josien; Feijen, Jan; Gaymans, Reinoud J.

    2003-01-01

    Copolymers of telechelic poly(2,6-dimethyl-1,4-phenylene ether) segments with terephthalic methyl ester endgroups (PPE-2T, 3100 g/mol), uniform crystallizable tetra-amide units based on nylon-6,T (T6T6T, 13 wt%) and dodecanediol (C12) as an extender were made via a polycondensation reaction. The PPE

  8. One pot direct synthesis of amides or oxazolines from carboxylic acids using Deoxo-Fluor reagent

    OpenAIRE

    Kangani, Cyrous O.; Kelley, David E.

    2005-01-01

    A mild and highly efficient one pot–one step condensation and/or condensation–cyclization of various acids to amides and/or oxazolines using Deoxo-Fluor reagents is described. Parallel syntheses of various free fatty acids with 2-amino-2, 2-dimethyl-1-propanol resulted with excellent yields.

  9. Synthesis of polypiperazine-amide thin-film membrane on PPESK hollow fiber UF membrane

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    A new interfacial polymerization (IP) procedure is developed in order to synthesize polypiperazine-amide thin-film membrane on the inner surface of poly(phthalazinone ether sulfone ketone) (PPESK) hollow fiber ultrafiltration (UF) membrane. A hollow fiber composite membrane with good performance was prepared and studied by FT-IR and scanning electron microscopy.

  10. Vitamin E amides, a new class of vitamin E analogues with enhanced proapoptotic activity

    Czech Academy of Sciences Publication Activity Database

    Tomic-Vatic, A.; EyTina, J.; Chapmann, J.; Mahdavian, E.; Neužil, Jiří; Salvatore, B.A.

    2005-01-01

    Roč. 117, č. 2 (2005), s. 118-193. ISSN 0020-7136 Institutional research plan: CEZ:AV0Z5052915; CEZ:AV0Z50520514 Keywords : vitamin E amides * apoptosis * anticancer agents Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.700, year: 2005

  11. Computational Amide I 2D IR Spectroscopy as a Probe of Protein Structure and Dynamics

    Science.gov (United States)

    Reppert, Mike; Tokmakoff, Andrei

    2016-05-01

    Two-dimensional infrared spectroscopy of amide I vibrations is increasingly being used to study the structure and dynamics of proteins and peptides. Amide I, a primarily carbonyl stretching vibration of the protein backbone, provides information on secondary structures as a result of vibrational couplings and on hydrogen-bonding contacts when isotope labeling is used to isolate specific sites. In parallel with experiments, computational models of amide I spectra that use atomistic structures from molecular dynamics simulations have evolved to calculate experimental spectra. Mixed quantum-classical models use spectroscopic maps to translate the structural information into a quantum-mechanical Hamiltonian for the spectroscopically observed vibrations. This allows one to model the spectroscopy of large proteins, disordered states, and protein conformational dynamics. With improvements in amide I models, quantitative modeling of time-dependent structural ensembles and of direct feedback between experiments and simulations is possible. We review the advances in developing these models, their theoretical basis, and current and future applications.

  12. Nonplanar Tertiary Amides in Rigid Chiral Tricyclic Dilactams. Peptide Group Distortions and Vibrational Optical Activity

    Czech Academy of Sciences Publication Activity Database

    Pazderková, Markéta; Profant, V.; Hodačová, J.; Šebestík, Jaroslav; Pazderka, T.; Novotná, P.; Urbanová, M.; Šafařík, Martin; Buděšínský, Miloš; Tichý, Miloš; Bednárová, Lucie; Baumruk, V.; Maloň, Petr

    2013-01-01

    Roč. 117, č. 33 (2013), s. 9626-9642. ISSN 1520-6106 R&D Projects: GA ČR GAP205/10/1276 Institutional support: RVO:61388963 Keywords : spirodilactams * amide bond * vibrational circular dichroism * non-planarity * Raman optical activity Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.377, year: 2013

  13. Communication: Quantitative multi-site frequency maps for amide I vibrational spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Reppert, Mike [Department of Chemistry, Massachusetts Institute of Technology, Cambridge, Massachusetts 02139 (United States); Department of Chemistry, University of Chicago, Chicago, Illinois 60637 (United States); Tokmakoff, Andrei, E-mail: tokmakoff@uchicago.edu [Department of Chemistry, University of Chicago, Chicago, Illinois 60637 (United States)

    2015-08-14

    An accurate method for predicting the amide I vibrational spectrum of a given protein structure has been sought for many years. Significant progress has been made recently by sampling structures from molecular dynamics simulations and mapping local electrostatic variables onto the frequencies of individual amide bonds. Agreement with experiment, however, has remained largely qualitative. Previously, we used dipeptide fragments and isotope-labeled constructs of the protein G mimic NuG2b as experimental standards for developing and testing amide I frequency maps. Here, we combine these datasets to test different frequency-map models and develop a novel method to produce an optimized four-site potential (4P) map based on the CHARMM27 force field. Together with a charge correction for glycine residues, the optimized map accurately describes both experimental datasets, with average frequency errors of 2–3 cm{sup −1}. This 4P map is shown to be convertible to a three-site field map which provides equivalent performance, highlighting the viability of both field- and potential-based maps for amide I spectral modeling. The use of multiple sampling points for local electrostatics is found to be essential for accurate map performance.

  14. Growth hormone responses to hp GRF 1-44 amide, bromocriptine and stress in acromegaly are correlated.

    OpenAIRE

    Belchetz, P E

    1987-01-01

    The results of testing growth hormone (GH) reserve using human pancreatic growth hormone-releasing factor 1-44 amide (hp GRF 1-44 amide) have been compared with the GH responses in a variety of other dynamic tests in seven acromegalic patients. The GH release following hp GRF 1-44 amide correlated with the GH suppression following bromocriptine, but showed an inverse correlation with the GH release following stress tests (insulin-induced hypoglycaemia/glucagon). There was no correlation betwe...

  15. Insight into the SEA amide thioester equilibrium. Application to the synthesis of thioesters at neutral pH.

    Science.gov (United States)

    Pira, S L; El Mahdi, O; Raibaut, L; Drobecq, H; Dheur, J; Boll, E; Melnyk, O

    2016-07-26

    The bis(2-sulfanylethyl)amide (SEA) N,S-acyl shift thioester surrogate has found a variety of useful applications in the field of protein total synthesis. Here we present novel insights into the SEA amide/thioester equilibrium in water which is an essential step in any reaction involving the thioester surrogate properties of the SEA group. We also show that the SEA amide thioester equilibrium can be efficiently displaced at neutral pH for accessing peptide alkylthioesters, i.e. the key components of the native chemical ligation (NCL) reaction. PMID:27282651

  16. The glucagon-like peptide-1 metabolite GLP-1-(9-36) amide reduces postprandial glycemia independently of gastric emptying and insulin secretion in humans

    DEFF Research Database (Denmark)

    Meier, Juris J; Gethmann, Arnica; Nauck, Michael A;

    2006-01-01

    Glucagon-like peptide 1 (GLP-1) lowers glycemia by modulating gastric emptying and endocrine pancreatic secretion. Rapidly after its secretion, GLP-1-(7-36) amide is degraded to the metabolite GLP-1-(9-36) amide. The effects of GLP-1-(9-36) amide in humans are less well characterized. Fourteen...... healthy volunteers were studied with intravenous infusion of GLP-1-(7-36) amide, GLP-1-(9-36) amide, or placebo over 390 min. After 30 min, a solid test meal was served, and gastric emptying was assessed. Blood was drawn for GLP-1 (total and intact), glucose, insulin, C-peptide, and glucagon measurements......-(7-36) amide administration]. GLP-1-(7-36) amide reduced fasting and postprandial glucose concentrations (P gastric emptying (P

  17. Novel endogenous N-acyl amides activate TRPV1-4 receptors, BV-2 microglia, and are regulated in brain in an acute model of inflammation

    Directory of Open Access Journals (Sweden)

    Siham eRaboune

    2014-08-01

    Full Text Available A family of endogenous lipids, structurally analogous to the endogenous cannabinoid, N-arachidonoyl ethanolamine (Anandamide, and called N-acyl amides have emerged as a family of biologically active compounds at TRP receptors. N-acyl amides are constructed from an acyl group and an amine via an amide bond. This same structure can be modified by changing either the fatty acid or the amide to form potentially hundreds of lipids. More than 70 N-acyl amides have been identified in nature. We have ongoing studies aimed at isolating and characterizing additional members of the family of N-acyl amides in both central and peripheral tissues in mammalian systems. Here, using a unique in-house library of over 70 N-acyl amides we tested the following three hypotheses: 1 Additional N-acyl amides will have activity at TRPV1-4, 2 Acute peripheral injury will drive changes in CNS levels of N-acyl amides, and 3 N-acyl amides will regulate calcium in CNS-derived microglia. Through these studies, we have identified 20 novel N-acyl amides that collectively activate (stimulating or inhibiting TRPV1-4. Using lipid extraction and HPLC coupled to tandem mass spectrometry we showed that levels of at least 10 of these N-acyl amides that activate TRPVs are regulated in brain after intraplantar carrageenan injection. We then screened the BV2 microglial cell line for activity with this N-acyl amide library and found overlap with TRPV receptor activity as well as additional activators of calcium mobilization from these lipids. Together these data provide new insight into the family of N-acyl amides and their roles as signaling molecules at ion channels, in microglia, and in the brain in the context of inflammation.

  18. Temperature-Dependence of the Amide-I Frequency Map for Peptides and Proteins

    Institute of Scientific and Technical Information of China (English)

    Chen Han; Jian-ping Wang

    2011-01-01

    In our recent work [Phys.Chem.Chem.Phys.11,9149 (2009)],a molecular-mechanics force field-based amide-I vibration frequency map (MM-map) for peptides and proteins was constructed.In this work,the temperature dependence of the MM-map is examined based on high-temperature molecular dynamics simulations and infrared (IR) experiments.It is shown that the 298-K map works for up to 500-K molecular dynamics trajectories,which reasonably reproduces the 88 ℃ experimental IR results.Linear IR spectra are also simulated for two tripeptides containing natural and unnatural amino acid residues,and the results are in reasonable agreement with experiment.The results suggest the MM-map can be used to obtain the temperature-dependent amide-I local mode frequencies and their distributions for peptide oligomers,which is useful in particular for understanding the IR signatures of the thermally unfolded species.

  19. Synthesis, Characterization and Properties of Amide Anions Based Ionic Liquids Containing Nitrile Group

    Institute of Scientific and Technical Information of China (English)

    ZOU Ting; LU Liang; LIU Xiuli; ZHANG Zhan; XUE Yunrong; YANG Yu; Li Caimeng; FU Xianlei; GAO Guohua

    2009-01-01

    A series of novel amide anion based ionic liquids containing nitrile groups have been synthesized using the method of ion-exchange between potassium amide and various quaternary halide salts such as trimethylamine,triethylamine,tributylamine,N-methylpyrrolidine,and N-methylimidazole.All of the functionalised ionic liquids were characterized by IR,1H and 13C NMR,and MS.The synthesized ionic liquids exhibited advantageously high thermal stability.The decomposition temperature of ionic liquids measured via TGA ranged from 224 to 289 ℃.The functionalised ionic liquid,l-ethyl-3-methylimidazolium propionyl cyanamide ([EMIm][N(CN)COC2H5]),was used as a ligand in the palladium catalyzed Suzuki coupling reaction.The yields of the coupling reaction increased by 10%-20% by the addition of [EMIm]IN(CN)COC2H5].

  20. Chemical constituents from red algae Bostrychia radicans (Rhodomelaceae: new amides and phenolic compounds

    Directory of Open Access Journals (Sweden)

    Ana Lígia Leandrini de Oliveira

    2012-01-01

    Full Text Available This study describes the isolation and structural determination of two amides, isolated for the first time: N,4-dihydroxy-N-(2'-hydroxyethyl-benzamide (0.019% and N,4-dihydroxy-N-(2'-hydroxyethyl-benzeneacetamide (0.023%. These amides, produced by the red macroalgae Bostrychia radicans, had their structures assigned by NMR spectral data and MS analyses. In addition, this chemical study led to the isolation of cholesterol, heptadecane, squalene, trans-phytol, neophytadiene, tetradecanoic and hexadecanoic acids, methyl hexadecanoate and methyl 9-octadecenoate, 4-(methoxymethyl-phenol, 4-hydroxybenzaldehyde, methyl 4-hydroxybenzeneacetate, methyl 2-hydroxy-3-(4-hydroxyphenyl-propanoate, hydroquinone, methyl 4-hydroxymandelate, methyl 4-hydroxybenzoate, 4-hydroxybenzeneacetic acid and (4-hydroxyphenyl-oxo-acetaldehyde. This is the first report concerning these compounds in B. radicans, contributing by illustrating the chemical diversity within the Rhodomelaceae family.

  1. Chemical constituents from red algae Bostrychia radicans (Rhodomelaceae): new amides and phenolic compounds

    International Nuclear Information System (INIS)

    This study describes the isolation and structural determination of two amides, isolated for the first time: N,4-dihydroxy-N-(2'-hydroxyethyl)-benzamide (0.019%) and N,4-dihydroxy-N-(2'-hydroxyethyl)-benzeneacetamide (0.023%). These amides, produced by the red macroalgae Bostrychia radicans, had their structures assigned by NMR spectral data and MS analyses. In addition, this chemical study led to the isolation of cholesterol, heptadecane, squalene, trans-phytol, neophytadiene, tetradecanoic and hexadecanoic acids, methyl hexadecanoate and methyl 9-octadecenoate, 4-(methoxymethyl)-phenol, 4-hydroxybenzaldehyde, methyl 4-hydroxybenzeneacetate, methyl 2-hydroxy-3-(4-hydroxyphenyl)-propanoate, hydroquinone, methyl 4-hydroxymandelate, methyl 4-hydroxybenzoate, 4-hydroxybenzeneacetic acid and (4-hydroxyphenyl)-oxo-acetaldehyde. This is the first report concerning these compounds in B. radicans, contributing by illustrating the chemical diversity within the Rhodomelaceae family. (author)

  2. Synthesis and characterization of poly(ester amide from remewable resources through melt polycondensation

    Directory of Open Access Journals (Sweden)

    B. B. Wang

    2014-01-01

    Full Text Available Biodegradable poly(ester amides (PEAs were synthesized from lactic acid and 11-aminoundecanoic acid via melt polycondensation. Molecular weights, chemical structures and thermal properties of the poly(ester amides were characterized in terms of gel permeation chromatography (GPC, Fourier transform infrared spectroscopy (FTIR, 1H nuclear magnetic resonance (1H NMR, differential scanning calorimetry (DSC and thermogravimetric analysis (TGA, respectively. The PEAs have low molecular weights and display a lower cold crystallization temperature as well as smaller crystallinity by comparison with the pure poly(lactic acid (PLA. The incorporation of the 11-aminoundecanoic acid into the PLA chain not only improved the thermal stability but changed the decomposition process.

  3. Chemical constituents from red algae Bostrychia radicans (Rhodomelaceae): new amides and phenolic compounds

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Ana Ligia Leandrini de; Silva, Denise B. da; Lopes, Norberto P.; Debonsi, Hosana M. [Universidade de Sao Paulo (FCFRP/USP), Ribeirao Preto, SP (Brazil). Fac. de Ciencias Farmaceuticas de Ribeirao Preto. Dept. de Quimica e Fisica; Yokoya, Nair S., E-mail: hosana@fcfrp.usp.br [Instituto de Botanica, Sao Paulo, SP (Brazil). Secao de Ficologia

    2012-07-01

    This study describes the isolation and structural determination of two amides, isolated for the first time: N,4-dihydroxy-N-(2'-hydroxyethyl)-benzamide (0.019%) and N,4-dihydroxy-N-(2'-hydroxyethyl)-benzeneacetamide (0.023%). These amides, produced by the red macroalgae Bostrychia radicans, had their structures assigned by NMR spectral data and MS analyses. In addition, this chemical study led to the isolation of cholesterol, heptadecane, squalene, trans-phytol, neophytadiene, tetradecanoic and hexadecanoic acids, methyl hexadecanoate and methyl 9-octadecenoate, 4-(methoxymethyl)-phenol, 4-hydroxybenzaldehyde, methyl 4-hydroxybenzeneacetate, methyl 2-hydroxy-3-(4-hydroxyphenyl)-propanoate, hydroquinone, methyl 4-hydroxymandelate, methyl 4-hydroxybenzoate, 4-hydroxybenzeneacetic acid and (4-hydroxyphenyl)-oxo-acetaldehyde. This is the first report concerning these compounds in B. radicans, contributing by illustrating the chemical diversity within the Rhodomelaceae family. (author)

  4. Passive Membrane Permeability of Macrocycles Can Be Controlled by Exocyclic Amide Bonds.

    Science.gov (United States)

    Hickey, Jennifer L; Zaretsky, Serge; St Denis, Megan A; Kumar Chakka, Sai; Morshed, M Monzur; Scully, Conor C G; Roughton, Andrew L; Yudin, Andrei K

    2016-06-01

    We have developed a strategy for synthesizing passively permeable peptidomimetic macrocycles. The cyclization chemistry centers on using aziridine aldehydes in a multicomponent reaction with peptides and isocyanides. The linker region in the resulting product contains an exocyclic amide positioned α to the peptide backbone, an arrangement that is not found among natural amino acids. This amide provides structural rigidity within the cyclic peptidomimetic and promotes the creation of a stabilizing intramolecular hydrogen bonding network. This exocyclic control element also contributes to the increased membrane permeability exhibited by multicomponent-derived macrocycles with respect to their homodetic counterparts. The exocyclic control element is employed along with a strategic placement of N-methyl and d-amino acids to produce passively permeable peptides, which contain multiple polar residues. This strategy should be applicable in the pursuit of synthesizing therapeutically relevant macrocycles. PMID:27120576

  5. Interacting Blends of Novel Unsaturated Polyester Amide Resin with Vinyl Acetate

    OpenAIRE

    Patel, H. S.; Panchal, K. K.; Patel, S. R.; Desai, S N

    2004-01-01

    Novel unsaturated poly (ester- amide) resins (UPEAs) were prepared by the reaction between an epoxy resin, namely diglycidyl ether of bisphenol–A (DGEBA) and unsaturated aliphatic bisamic acids using a base catalyst. These UPEAs were then blended with a vinyl monomer namely, Vinyl acetate (VA) to produce a homogeneous resin syrup. The curing of these UPEAs-VA resin blends was carried out by using benzoyl peroxide (BPO) as an initiator for the radical polymerization and was monitored by using ...

  6. IR-spectra of amides of steroidal alkaloids with lactic acid

    OpenAIRE

    Kastelic-Suhadolc, Tatjana

    2015-01-01

    IR spectra of lactamides of 1,4-tomatidien-3-one, 4-solasoden-3-one, dihydrotomatidine and tomatine were taken and the frequency of the ▫$C=0$▫ amide band compared with that of the lactamides of piperidine and its derivatives, and with that of N-acetyltomatidine. It was found that the ▫$C=0$▫ bands of lactamides of steroidal alkaloids show an unusual but characteristic frequency at 1730-1733 cm▫$^{-1}$▫.

  7. A new feruloyl amide derivative from the fruits of Tribulus terrestris.

    Science.gov (United States)

    Zhang, Xiaopo; Wei, Na; Huang, Jian; Tan, Yinfeng; Jin, Dejun

    2012-01-01

    A new feruloyl amide derivative, named tribulusamide C, was isolated from the fruits of Tribulus terrestris. Its structure was determined on the basis of spectroscopic analysis including IR, 1-D-, 2-D-NMR and HR-ESI-MS. The structure of tribulusamide C was characterised by a unit of pyrrolidine-2,5-dione, which distinguished it from other lignanamides previously isolated from the fruits of T. terrestris. PMID:22149942

  8. Amide Synthesis from Alcohols and Amines Catalyzed by Ruthenium N-Heterocyclic Carbene Complexes

    DEFF Research Database (Denmark)

    Dam, Johan Hygum; Osztrovszky, Gyorgyi; Nordstrøm, Lars Ulrik Rubæk;

    2010-01-01

    not show any significant differences in reactivity, which indicates that the same catalytically active species is operating. The reaction is believed to proceed by initial dehydrogenation of the primary alcohol to the aldehyde that stays coordinated to ruthenium and is not released into the reaction...... mixture. Addition of the amine forms the hemiaminal that undergoes dehydrogenation to the amide. A catalytic cycle is proposed with the {(IiPr)Ru-II} species as the catalytically active components....

  9. The Factors Which Motivate Zimbabwean Teachers Amid the Economic Challenges the Country Is Confronted With

    OpenAIRE

    Victor Chaboneka Ngwenya

    2015-01-01

    This research investigated the factors which motivate teachers in Zimbabwean public schools amid the economic challenges ravaging the country. A survey design was used to gather data on biography, motivators, demotivators, need fulfilment, need deprivation and possible motivators by means of a questionnaire consisting of seven open-ended questions. The qualitative data amassed was screened and categorised in themes. The responses of thirty-seven teachers indicated that participants were motiv...

  10. Phenotypic assessment of THC discriminative stimulus properties in fatty acid amide hydrolase knockout and wildtype mice

    OpenAIRE

    Walentiny, D. Matthew; Vann, Robert E.; Wiley, Jenny L.

    2015-01-01

    A number of studies have examined the ability of the endogenous cannabinoid anandamide to elicit Δ9 -tetrahydrocannabinol (THC)-like subjective effects, as modeled through the THC discrimination paradigm. In the present study, we compared transgenic mice lacking fatty acid amide hydrolase (FAAH), the enzyme primarily responsible for anandamide catabolism, to wildtype counterparts in a THC discrimination procedure. THC (5.6 mg/kg) served as a discriminative stimulus in both genotypes, with sim...

  11. Direct amidation of amino acid derivatives catalyzed by arylboronic acids : applications in dipeptide synthesis.

    OpenAIRE

    Liu, S.; Yang, Y.; Liu, X.; Ferdousi, F. K.; Batsanov, A.S.; Whiting, A

    2013-01-01

    The direct amidation of amino acid derivatives catalyzed by arylboronic acids has been examined. The reaction was generally slow relative to simple amine-carboxylic acid combinations though proceeded at 65–68 °C generally avoiding racemization. 3,4,5-Trifluorophenylboronic and o-nitrophenylboronic acids were found to be the best catalysts, though for slower dipeptide formations, high catalyst loadings were required and an interesting synergistic catalytic effect between two arylboronic acids ...

  12. Settlement of Internal Cutthroat Competition Amid IT Group Companies: Away from "Prisoners' Dilemma" of Price Wars

    Institute of Scientific and Technical Information of China (English)

    CHEN Chao-long

    2006-01-01

    Cutthroat competition amid subsidiary companies of IT Group Company due to immanent characteristics of IT industry and grouping management mechanism infringes upon the collective profits. Two ways to avoid cutthroat competition of group company with game theory are studied: the assessment objective made by IT group company for subsidiary companies focuses on profits not revenue;the supervisory department of group company shall intensify law enforcement strength and give severe punishment against illegal depreciation of the subsidiary company.

  13. Inferential protein structure determination and refinement using fast, electronic structure based backbone amide chemical shift predictions

    CERN Document Server

    Christensen, Anders S

    2015-01-01

    This report covers the development of a new, fast method for calculating the backbone amide proton chemical shifts in proteins. Through quantum chemical calculations, structure-based forudsiglese the chemical shift for amidprotonen in protein has been parameterized. The parameters are then implemented in a computer program called Padawan. The program has since been implemented in protein folding program Phaistos, wherein the method andvendes to de novo folding of the protein structures and to refine the existing protein structures.

  14. Hemodynamic profile, responsiveness to anandamide, and baroreflex sensitivity of mice lacking fatty acid amide hydrolase

    OpenAIRE

    Pacher, Pál; Bátkai, Sándor; Osei-Hyiaman, Douglas; Offertáler, László; Liu, Jie; Harvey-White, Judy; Brassai, Attila; Járai, Zoltán; Cravatt, Benjamin F.; Kunos, George

    2005-01-01

    The endocannabinoid anandamide exerts neurobehavioral, cardiovascular, and immune-regulatory effects through cannabinoid receptors (CB). Fatty acid amide hydrolase (FAAH) is an enzyme responsible for the in vivo degradation of anandamide. Recent experimental studies have suggested that targeting the endocannabinergic system by FAAH inhibitors is a promising novel approach for the treatment of anxiety, inflammation, and hypertension. In this study, we compared the cardiac performance of FAAH k...

  15. Symmetrical and unsymmetrical α,ω-nucleobase amide-conjugated systems

    OpenAIRE

    Boncel, Sławomir; Mączka, Maciej; Koziol, Krzysztof K K; Motyka, Radosław; Walczak, Krzysztof Z.

    2010-01-01

    We present the synthesis and selected physicochemical properties of several novel symmetrical and unsymmetrical α,ω-nucleobase mono- and bis-amide conjugated systems containing aliphatic, aromatic or saccharidic linkages. The final stage of the synthesis involves condensation of a subunit bearing carboxylic group with an amine subunit. 4-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium chloride (DMT-MM) was found to be a particularly effective condensing agent. The subunits containing ...

  16. Symmetrical and unsymmetrical α,ω-nucleobase amide-conjugated systems

    OpenAIRE

    Sławomir Boncel; Maciej Mączka; Koziol, Krzysztof K K; Radosław Motyka; Walczak, Krzysztof Z.

    2010-01-01

    We present the synthesis and selected physicochemical properties of several novel symmetrical and unsymmetrical α,ω-nucleobase mono- and bis-amide conjugated systems containing aliphatic, aromatic or saccharidic linkages. The final stage of the synthesis involves condensation of a subunit bearing carboxylic group with an amine subunit. 4-(4,6-Dimethoxy-1,3,5-triazin-2-yl)-4-methylmorpholinium chloride (DMT-MM) was found to be a particularly effective condensing agent. The subunits c...

  17. Synthesis, in vitro antimalarial activity and cytotoxicity of novel 4-aminoquinolinyl-chalcone amides

    OpenAIRE

    Smit, Frans J; N'Da, David D.

    2014-01-01

    A series of 4-aminoquinolinyl-chalcone amides 11–19 were synthesized through condensation of carboxylic acid-functionalized chalcone with aminoquinolines, using 1,10-carbonyldiimidazole as coupling agent. These compounds were screened against the chloroquine sensitive (3D7) and chloroquine resistant (W2) strains of Plasmodium falciparum. Their cytotoxicity towards the WI-38 cell line of normal human fetal lung fibroblast was determined. All compounds were found active, with IC50 v...

  18. Defects in fatty acid amide hydrolase 2 in a male with neurologic and psychiatric symptoms

    OpenAIRE

    Sirrs, Sandra; van Karnebeek, Clara DM; Peng, Xiaoxue; Shyr, Casper; Tarailo-Graovac, Maja; Mandal, Rupasri; Testa, Daniel; Dubin, Devin; Carbonetti, Gregory; Glynn, Steven E.; Sayson, Bryan; Robinson, Wendy P.; Han, Beomsoo; Wishart, David; Ross, Colin J

    2015-01-01

    Background Fatty acid amide hydrolase 2 (FAAH2) is a hydrolase that mediates the degradation of endocannabinoids in man. Alterations in the endocannabinoid system are associated with a wide variety of neurologic and psychiatric conditions, but the phenotype and biochemical characterization of patients with genetic defects of FAAH2 activity have not previously been described. We report a male with autistic features with an onset before the age of 2 years who subsequently developed additional f...

  19. New Polymeric Admixture for Cement Based on Hyperbranched Poly Amide-Ester with Pentaerythritol Core

    OpenAIRE

    Amal Amin Ibrahim; Ahmed El-Sayed Abdel-Megied; Mohamed Sayed Selim; Hassan Hassenen Darweesh; Magdy Mohamed Ayoub

    2013-01-01

    Hyperbranched poly amide-ester (HBPAE) was synthesized by a solution condensation polymerization through one-step process using pentaerythritol as a central core and AB2 prepolymerized monomer which was rapidly prepared at room temperature (25°C) using commercially available maleic anhydride (MA) and diethanolamine (DEA) monomers in the presence of p-toluene sulfonic acid as a catalyst. The prepared polymer was characterized by GPC, IR, 1H-NMR, and thermal analysis (TGA and DSC). The influenc...

  20. Synthesis and Biological Investigation of some Novel Sulfonamide and Amide Derivatives Containing Coumarin Moieties

    OpenAIRE

    Saeedi, Mina; Goli, Fereshteh; Mahdavi, Mohammad; Dehghan, Gholamreza; Faramarzi, Mohammad Ali; Foroumadi, Alireza; Shafiee, Abbas

    2014-01-01

    New sulfonamide and amide derivatives containing coumarin moieties; oxo-2H-chromen-sulfamoylphenylacetamides and oxo-2H-chromen-arylacetamides were synthesized starting from diverse 2-chloroacetamide derivatives and a wide range of coumarins. The structures of compounds were elucidated by IR and NMR spectra and also analytical elemental analysis. In the next step, the above mentioned compounds were screened for their antimicrobial and antioxidant activities. Their antimicrobial activity was a...

  1. Synthesis and Tumor Cytotoxicity of Novel Amide Derivatives of β-Hederin

    OpenAIRE

    Mao-Sheng Cheng; Yang Yu; Takashi Ikejima; Wen-Xiang Lu; Mao-Cai Yan; Yang Liu

    2010-01-01

    Thirteen novel triterpenoid saponins, designed as amide derivatives of the natural cytotoxic saponin β-hederin, were synthesized by a stepwise glycosylation strategy. The in vitro cytotoxic activity of these compounds was evaluated against five different tumor cell lines. Most of the evaluated compounds showed effective inhibitory activity against at least one tumor cell line at micromolar concentrations. The preliminary structure-activity relationships (SAR) indicate that mide derivatization...

  2. The role of fatty acid amide hydrolase inhibition in nicotine reward and dependence

    OpenAIRE

    Muldoon, Pretal P.; Lichtman, Aron H.; Parsons, Loren H.; Damaj, M Imad

    2012-01-01

    The endogenous cannabinoid anandamide (AEA) exerts the majority of its effects at CB1 and CB2 receptors and is degraded by fatty acid amide hydrolase (FAAH). FAAH KO mice and animals treated with FAAH inhibitors are impaired in their ability to hydrolyze AEA and other non-cannabinoid lipid signaling molecules, such as oleoylethanolamide (OEA) and palmitoylethanolamide (PEA). AEA and these other substrates activate non- cannabinoid receptor systems, including TRPV1 and PPAR-α receptors. In thi...

  3. Cellular viability effects of fatty acid amide hydrolase inhibition on cerebellar neurons

    OpenAIRE

    Lueneberg Kathia; Domínguez Guadalupe; Arias-Carrión Oscar; Palomero-Rivero Marcela; Millán-Aldaco Diana; Morán. Julio; Drucker-Colín René; Murillo-Rodríguez Eric

    2011-01-01

    Abstract The endocannabinoid anandamide (ANA) participates in the control of cell death inducing the formation of apoptotic bodies and DNA fragmentation. The aim of this study was to evaluate whether the ANA degrading enzyme, the fatty acid amide hydrolase (FAAH), would induce cellular death. Experiments were performed in cerebellar granule neurons cultured with the FAAH inhibitor, URB597 (25, 50 or 100 nM) as well as endogenous lipids such as oleoylethanolamide (OEA) or palmitoylethanolamide...

  4. Chiral amide from (1, 2)-(+)-norephedrine and furoic acid: An efficient catalyst for asymmetric Reformatsky reaction

    Indian Academy of Sciences (India)

    Nallamuthu Ananthi; Sivan Velmathi

    2014-01-01

    Chiral amide derived from (1, 2)-(+)-norephedrine and 2-furoic acid was found to catalyse the asymmetric Reformatsky reaction between prochiral aldehydes and α-bromo ethylacetate with diethylzinc as zinc source. The corresponding chiral -hydroxy esters were formed in 99% yield with over 80% enantiomeric excess. The presence of air was found to be essential for the effective C-C bond formation. The mechanism for the catalytic reaction was proposed.

  5. Synthesis and Properties of Lactic Acid-based Cross-linked Poly(ester-amide)

    Institute of Scientific and Technical Information of China (English)

    Yue Ying HE; Cong Ming XIAO

    2006-01-01

    A novel lactic acid-based cross-linked poly(ester-amide) (LCPEA) was synthesized. The gel fraction of the LCPEA could be modulated by the reaction conditions and it affected the mechanical and thermal properties of the LCPEA. The tensile strength, elastic modulus and bend strength of the LCPEA of 65% gel fraction were 4.65, 136.55 and 39.63 MPa, respectively. The thermal decomposition temperature (50 wt%) of the LCPEA was around 410 ℃.

  6. Boophiline, an Antimicrobial Sterol Amide from the Cattle Tick Boophilus microplus

    OpenAIRE

    Potterat, Olivier; Hostettmann, Kurt; Höltzel, Alexandra; Jung, Günther; Diehl, Peter A.; Petrini, Orlando

    2008-01-01

    Boophiline (1), a new sterol amide was isolated from the cattle tick Boophilus microplus (Ixodidae). The structure was assigned as N-[3-(sulfooxy)-25ξ-cholest-5-en-26-oyl]-L-isoleucine by detailed 2D NMR investigations in conjunction with FAB mass spectrometry and acidic hydrolyses. Complete assignment of the diastereotopic methylene protons of the ring system could be deduced from the NMR data. In agar dilution assays, 1 exhibited antifungal properties against Cladosporium cucumerinum and an...

  7. Visible-Light-Mediated Synthesis of Amides from Aldehydes and Amines via in Situ Acid Chloride Formation.

    Science.gov (United States)

    Iqbal, Naeem; Cho, Eun Jin

    2016-03-01

    An efficient visible-light photocatalysis-based one-pot amide synthesis method was developed; visible-light irradiation of a mixture of an aldehyde, tert-butyl hydrogen peroxide, and N-chlorosuccinimide using a Ru(bpy)3Cl2 photocatalyst afforded an acid chloride, which subsequently reacted with amine to yield the corresponding amide. The reaction was used to synthesize moclobemide and a D3 receptor intermediate. PMID:26836367

  8. Combination of Novozym 435-catalyzed enantioselective hydrolysis and amidation for the preparation of optically active δ-hexadecalactone

    OpenAIRE

    Shimotori, Yasutaka; Hoshi, Masayuki; Miyakoshi, Tetsuo; 霜鳥, 慈岳; 星,雅之

    2015-01-01

    A new enzymatic method for synthesis of enantiomerically enriched δ-hexadecalactone (3) based on the enzymatic kinetic resolution of N-methyl-5-acetoxyhexadecanamide (1) is described. A combination of lipase-catalyzed hydrolysis and amidation improved enantioselectivity. Lipase-catalyzed amidation was also investigated. Detailed screening of solvents and additive amines was performed. The addition of cyclohexylamine to lipase-catalyzed hydrolysis afforded the best results to give both enantio...

  9. Reverse Anomeric Effect in Large-Amplitude Pyridinium Amide-Containing Mannosyl [2]Rotaxane Molecular Shuttles.

    Science.gov (United States)

    Riss-Yaw, Benjamin; Waelès, Philip; Coutrot, Frédéric

    2016-06-17

    The reverse anomeric effect (RAE) was investigated in different mannosyl [2]rotaxane molecular shuttle isomers that contain dibenzo-24-crown-8 (DB24C8) as the macrocycle, and anilinium and pyridinium amide as molecular stations. The switching on or off of the RAE was possible depending on both the pyridinium amide motif and the localization of the DB24C8 along the thread. The (1) C4 mannopyranosyl chair-like conformation was observed in all the non-interlocked molecules because the anomeric carbon of the mannose is linked to the positively charged nitrogen of the pyridinium unit. In the protonated rotaxanes, the (1) C4 chair conformation of the mannose end remains because the DB24C8 resides around the best anilinium station, which is located at the other end of the axle. Upon deprotonation of the anilinium, the DB24C8 shuttles with a large-amplitude motion toward the pyridinium amide stations, where it interacts in a different fashion depending on the pyridinium motif. In one molecular shuttle, the RAE could be switched on or off with control at one end of the encircled thread upon protonation/deprotonation of the other end, through shuttling of the DB24C8. PMID:27062432

  10. MATE Transporter-Dependent Export of Hydroxycinnamic Acid Amides[OPEN

    Science.gov (United States)

    Eschen-Lippold, Lennart; Gorzolka, Karin; Matern, Andreas; Marillonnet, Sylvestre; Böttcher, Christoph; Rosahl, Sabine

    2016-01-01

    The ability of Arabidopsis thaliana to successfully prevent colonization by Phytophthora infestans, the causal agent of late blight disease of potato (Solanum tuberosum), depends on multilayered defense responses. To address the role of surface-localized secondary metabolites for entry control, droplets of a P. infestans zoospore suspension, incubated on Arabidopsis leaves, were subjected to untargeted metabolite profiling. The hydroxycinnamic acid amide coumaroylagmatine was among the metabolites secreted into the inoculum. In vitro assays revealed an inhibitory activity of coumaroylagmatine on P. infestans spore germination. Mutant analyses suggested a requirement of the p-coumaroyl-CoA:agmatine N4-p-coumaroyl transferase ACT for the biosynthesis and of the MATE transporter DTX18 for the extracellular accumulation of coumaroylagmatine. The host plant potato is not able to efficiently secrete coumaroylagmatine. This inability is overcome in transgenic potato plants expressing the two Arabidopsis genes ACT and DTX18. These plants secrete agmatine and putrescine conjugates to high levels, indicating that DTX18 is a hydroxycinnamic acid amide transporter with a distinct specificity. The export of hydroxycinnamic acid amides correlates with a decreased ability of P. infestans spores to germinate, suggesting a contribution of secreted antimicrobial compounds to pathogen defense at the leaf surface. PMID:26744218

  11. Measurement of {sup 15}N relaxation in deuterated amide groups in proteins using direct nitrogen detection

    Energy Technology Data Exchange (ETDEWEB)

    Vasos, Paul R.; Hall, Jennifer B. [University of Maryland, Department of Chemistry and Biochemistry, Center for Biomolecular Structure and Organization (United States); Kuemmerle, Rainer [Bruker Biospin AG, NMR Division (Switzerland); Fushman, David [University of Maryland, Department of Chemistry and Biochemistry, Center for Biomolecular Structure and Organization (United States)], E-mail: fushman@umd.edu

    2006-09-15

    {sup 15}N chemical shielding tensors contain useful structural information, and their knowledge is essential for accurate analysis of protein backbone dynamics. The anisotropic component (CSA) of {sup 15}N chemical shielding can be obtained from {sup 15}N relaxation measurements in solution. However, the predominant contribution to nitrogen relaxation from {sup 15}N-{sup 1}H dipolar coupling in amide groups limits the sensitivity of these measurements to the actual CSA values. Here we present nitrogen-detected NMR experiments for measuring {sup 15}N relaxation in deuterated amide groups in proteins, where the dipolar contribution to {sup 15}N relaxation is significantly reduced by the deuteration. Under these conditions nitrogen spin relaxation becomes a sensitive probe for variations in {sup 15}N chemical shielding tensors. Using the nitrogen direct-detection experiments we measured the rates of longitudinal and transverse {sup 15}N relaxation for backbone amides in protein G in D{sub 2}O at 11.7 T. The measured relaxation rates are validated by comparing the overall rotational diffusion tensor obtained from these data with that from the conventional {sup 15}N relaxation measurements in H{sub 2}O. This analysis revealed a 17-24{sup o} angle between the NH-bond and the unique axis of the {sup 15}N chemical shielding tensor.

  12. Measurement of 15N relaxation in deuterated amide groups in proteins using direct nitrogen detection

    International Nuclear Information System (INIS)

    15N chemical shielding tensors contain useful structural information, and their knowledge is essential for accurate analysis of protein backbone dynamics. The anisotropic component (CSA) of 15N chemical shielding can be obtained from 15N relaxation measurements in solution. However, the predominant contribution to nitrogen relaxation from 15N-1H dipolar coupling in amide groups limits the sensitivity of these measurements to the actual CSA values. Here we present nitrogen-detected NMR experiments for measuring 15N relaxation in deuterated amide groups in proteins, where the dipolar contribution to 15N relaxation is significantly reduced by the deuteration. Under these conditions nitrogen spin relaxation becomes a sensitive probe for variations in 15N chemical shielding tensors. Using the nitrogen direct-detection experiments we measured the rates of longitudinal and transverse 15N relaxation for backbone amides in protein G in D2O at 11.7 T. The measured relaxation rates are validated by comparing the overall rotational diffusion tensor obtained from these data with that from the conventional 15N relaxation measurements in H2O. This analysis revealed a 17-24o angle between the NH-bond and the unique axis of the 15N chemical shielding tensor

  13. Substituted Amides of Pyrazine-2-carboxylic acids: Synthesis and Biological Activity

    Directory of Open Access Journals (Sweden)

    Katarina Kralova

    2002-03-01

    Full Text Available Condensation of 6-chloro-, 5-tert-butyl- or 6-chloro-5-tert-butylpyrazine-2-carboxylic acid chloride with ring substituted anilines yielded a series of amides, which were tested for their in vitro antimycobacterial, antifungal and photosynthesis-inhibiting activities. The highest antituberculotic activity (72% inhibition against Mycobacterium tuberculosis and the highest lipophilicity (log P = 6.85 were shown by the 3,5-bistrifluoromethylphenyl amide of 5-tert-butyl-6-chloropyrazine-2-carboxylic acid (2o. The 3-methylphenyl amides of 6-chloro- and 5-tert-butyl-6-chloro-pyrazine-2-carboxylic acid (2d and 2f exhibited only a poor in vitro antifungal effect (MIC = 31.25-500 μmol·dm-3 against all strains tested, although the latter was the most active antialgal compound (IC50 = 0.063 mmol·dm-3. The most active inhibitor of oxygen evolution rate in spinach chloroplasts was the (3,5-bis-trifluoromethylphenylamide of 6-chloropyrazine-2-carboxylic acid (2m, IC50 = 0.026 mmol·dm-3.

  14. Protein structure validation and refinement using amide proton chemical shifts derived from quantum mechanics.

    Directory of Open Access Journals (Sweden)

    Anders S Christensen

    Full Text Available We present the ProCS method for the rapid and accurate prediction of protein backbone amide proton chemical shifts--sensitive probes of the geometry of key hydrogen bonds that determine protein structure. ProCS is parameterized against quantum mechanical (QM calculations and reproduces high level QM results obtained for a small protein with an RMSD of 0.25 ppm (r = 0.94. ProCS is interfaced with the PHAISTOS protein simulation program and is used to infer statistical protein ensembles that reflect experimentally measured amide proton chemical shift values. Such chemical shift-based structural refinements, starting from high-resolution X-ray structures of Protein G, ubiquitin, and SMN Tudor Domain, result in average chemical shifts, hydrogen bond geometries, and trans-hydrogen bond ((h3J(NC' spin-spin coupling constants that are in excellent agreement with experiment. We show that the structural sensitivity of the QM-based amide proton chemical shift predictions is needed to obtain this agreement. The ProCS method thus offers a powerful new tool for refining the structures of hydrogen bonding networks to high accuracy with many potential applications such as protein flexibility in ligand binding.

  15. Electrode reactions of ruthenium–bipyridine complex in amide-type ionic liquids

    International Nuclear Information System (INIS)

    The electrode kinetics of [Ru(bpy)3]3+/[Ru(bpy)3]2+ (bpy = 2,2′-bipyridine) on a platinum electrode was investigated in room-temperature ionic liquids, 1-butyl-1-methylpyrrolidinium bis(trifluoromethylsulfonyl)amide (BMPTFSA), 1-ethyl-3-methylimidazolium bis(trifluoromethylsulfonyl)amide (EMITFSA), and 1-butyl-1-methylpyrrolidinium bis(perfluoroethylsulfonyl)amide (BMPBETA) over the temperature range from 25 to 45 °C. The diffusion coefficients of [Ru(bpy)3]2+ and [Ru(bpy)3]3+ were found to be affected not only by the viscosity of ionic liquids but also by the charge density of the complex. The activation energy for the diffusion coefficients of these complexes in the ionic liquids were close to that for the viscosity of the ionic liquids. The standard rate constants of [Ru(bpy)3]3+/[Ru(bpy)3]2+ in BMPTFSA, EMITFSA and BMPBETA were estimated by electrochemical impedance spectroscopy. The standard rate constants in the ionic liquids were estimated to be smaller than those in aqueous and organic electrolytes, probably due to the slow dynamics of the ionic liquids.

  16. Protein structure validation and refinement using amide proton chemical shifts derived from quantum mechanics

    CERN Document Server

    Christensen, Anders S; Borg, Mikael; Boomsma, Wouter; Lindorff-Larsen, Kresten; Hamelryck, Thomas; Jensen, Jan H

    2013-01-01

    We present the ProCS method for the rapid and accurate prediction of protein backbone amide proton chemical shifts - sensitive probes of the geometry of key hydrogen bonds that determine protein structure. ProCS is parameterized against quantum mechanical (QM) calculations and reproduces high level QM results obtained for a small protein with an RMSD of 0.25 ppm (r = 0.94). ProCS is interfaced with the PHAISTOS protein simulation program and is used to infer statistical protein ensembles that reflect experimentally measured amide proton chemical shift values. Such chemical shift-based structural refinements, starting from high-resolution X-ray structures of Protein G, ubiquitin, and SMN Tudor Domain, result in average chemical shifts, hydrogen bond geometries, and trans-hydrogen bond (h3JNC') spin-spin coupling constants that are in excellent agreement with experiment. We show that the structural sensitivity of the QM-based amide proton chemical shift predictions is needed to refine protein structures to this...

  17. Structure elucidation and in vitro cytotoxicity of ochratoxin α amide, a new degradation product of ochratoxin A.

    Science.gov (United States)

    Bittner, Andrea; Cramer, Benedikt; Harrer, Henning; Humpf, Hans-Ulrich

    2015-05-01

    The mycotoxin ochratoxin A is a secondary metabolite occurring in a wide range of commodities. During the exposure of ochratoxin A to white and blue light, a cleavage between the carbon atom C-14 and the nitrogen atom was described. As a reaction product, the new compound ochratoxin α amide has been proposed based on mass spectrometry (MS) experiments. In the following study, we observed that this compound is also formed at high temperatures such as used for example during coffee roasting and therefore represents a further thermal ochratoxin A degradation product. To confirm the structure of ochratoxin α amide, the compound was prepared in large scale and complete structure elucidation via nuclear magnetic resonance (NMR) and MS was performed. Additionally, first studies on the toxicity of ochratoxin α amide were performed using immortalized human kidney epithelial (IHKE) cells, a cell line known to be sensitive against ochratoxin A with an IC50 value of 0.5 μM. Using this system, ochratoxin α amide revealed no cytotoxicity up to concentrations of 50 μM. Thus, these results propose that the thermal degradation of ochratoxin A to ochratoxin α amide might be a detoxification process. Finally, we present a sample preparation and a HPLC-tandem mass spectrometry (HPLC-MS/MS) method for the analysis of ochratoxin α amide in extrudates and checked its formation during the extrusion of artificially contaminated wheat grits at 150 and 180 °C, whereas no ochratoxin α amide was detectable under these conditions. PMID:25566949

  18. A polarizable QM/MM approach to the molecular dynamics of amide groups solvated in water

    Science.gov (United States)

    Schwörer, Magnus; Wichmann, Christoph; Tavan, Paul

    2016-03-01

    The infrared (IR) spectra of polypeptides are dominated by the so-called amide bands. Because they originate from the strongly polar and polarizable amide groups (AGs) making up the backbone, their spectral positions sensitively depend on the local electric fields. Aiming at accurate computations of these IR spectra by molecular dynamics (MD) simulations, which derive atomic forces from a hybrid quantum and molecular mechanics (QM/MM) Hamiltonian, here we consider the effects of solvation in bulk liquid water on the amide bands of the AG model compound N-methyl-acetamide (NMA). As QM approach to NMA we choose grid-based density functional theory (DFT). For the surrounding MM water, we develop, largely based on computations, a polarizable molecular mechanics (PMM) model potential called GP6P, which features six Gaussian electrostatic sources (one induced dipole, five static partial charge distributions) and, therefore, avoids spurious distortions of the DFT electron density in hybrid DFT/PMM simulations. Bulk liquid GP6P is shown to have favorable properties at the thermodynamic conditions of the parameterization and beyond. Lennard-Jones (LJ) parameters of the DFT fragment NMA are optimized by comparing radial distribution functions in the surrounding GP6P liquid with reference data obtained from a "first-principles" DFT-MD simulation. Finally, IR spectra of NMA in GP6P water are calculated from extended DFT/PMM-MD trajectories, in which the NMA is treated by three different DFT functionals (BP, BLYP, B3LYP). Method-specific frequency scaling factors are derived from DFT-MD simulations of isolated NMA. The DFT/PMM-MD simulations with GP6P and with the optimized LJ parameters then excellently predict the effects of aqueous solvation and deuteration observed in the IR spectra of NMA. As a result, the methods required to accurately compute such spectra by DFT/PMM-MD also for larger peptides in aqueous solution are now at hand.

  19. Kinetic isotope effects support the twisted amide mechanism of Pin1 peptidyl-prolyl isomerase.

    Science.gov (United States)

    Mercedes-Camacho, Ana Y; Mullins, Ashley B; Mason, Matthew D; Xu, Guoyan G; Mahoney, Brendan J; Wang, Xingsheng; Peng, Jeffrey W; Etzkorn, Felicia A

    2013-11-01

    The Pin1 peptidyl-prolyl isomerase catalyzes isomerization of pSer/pThr-Pro motifs in regulating the cell cycle. Peptide substrates, Ac-Phe-Phe-phosphoSer-Pro-Arg-p-nitroaniline, were synthesized in unlabeled form, and with deuterium-labeled Ser-d3 and Pro-d7 amino acids. Kinetic data were collected as a function of Pin1 concentration to measure kinetic isotope effects (KIEs) on catalytic efficiency (kcat/Km). The normal secondary (2°) KIE value measured for the Ser-d3 substrate (kH/kD = 1.6 ± 0.2) indicates that the serine carbonyl does not rehybridize from sp(2) to sp(3) in the rate-determining step, ruling out a nucleophilic addition mechanism. The normal 2° KIE can be explained by hyperconjugation between Ser α-C-H/D and C═O and release of steric strain upon rotation of the amide bond from cis to syn-exo. The inverse 2° KIE value (kH/kD = 0.86 ± 0.08) measured for the Pro-d7 substrate indicates rehybridization of the prolyl nitrogen from sp(2) to sp(3) during the rate-limiting step of isomerization. No solvent kinetic isotope was measured by NMR exchange spectroscopy (kH2O/kD2O = 0.92 ± 0.12), indicating little or no involvement of exchangeable protons in the mechanism. These results support the formation of a simple twisted amide transition state as the mechanism for peptidyl prolyl isomerization catalyzed by Pin1. A model of the reaction mechanism is presented using crystal structures of Pin1 with ground state analogues and an inhibitor that resembles a twisted amide transition state. PMID:24116866

  20. A polarizable QM/MM approach to the molecular dynamics of amide groups solvated in water.

    Science.gov (United States)

    Schwörer, Magnus; Wichmann, Christoph; Tavan, Paul

    2016-03-21

    The infrared (IR) spectra of polypeptides are dominated by the so-called amide bands. Because they originate from the strongly polar and polarizable amide groups (AGs) making up the backbone, their spectral positions sensitively depend on the local electric fields. Aiming at accurate computations of these IR spectra by molecular dynamics (MD) simulations, which derive atomic forces from a hybrid quantum and molecular mechanics (QM/MM) Hamiltonian, here we consider the effects of solvation in bulk liquid water on the amide bands of the AG model compound N-methyl-acetamide (NMA). As QM approach to NMA we choose grid-based density functional theory (DFT). For the surrounding MM water, we develop, largely based on computations, a polarizable molecular mechanics (PMM) model potential called GP6P, which features six Gaussian electrostatic sources (one induced dipole, five static partial charge distributions) and, therefore, avoids spurious distortions of the DFT electron density in hybrid DFT/PMM simulations. Bulk liquid GP6P is shown to have favorable properties at the thermodynamic conditions of the parameterization and beyond. Lennard-Jones (LJ) parameters of the DFT fragment NMA are optimized by comparing radial distribution functions in the surrounding GP6P liquid with reference data obtained from a "first-principles" DFT-MD simulation. Finally, IR spectra of NMA in GP6P water are calculated from extended DFT/PMM-MD trajectories, in which the NMA is treated by three different DFT functionals (BP, BLYP, B3LYP). Method-specific frequency scaling factors are derived from DFT-MD simulations of isolated NMA. The DFT/PMM-MD simulations with GP6P and with the optimized LJ parameters then excellently predict the effects of aqueous solvation and deuteration observed in the IR spectra of NMA. As a result, the methods required to accurately compute such spectra by DFT/PMM-MD also for larger peptides in aqueous solution are now at hand. PMID:27004884

  1. Mechanistic Investigation of the Ruthenium–N-Heterocyclic-Carbene-Catalyzed Amidation of Alcohols and Amines

    DEFF Research Database (Denmark)

    Makarov, Ilya; Fristrup, Peter; Madsen, Robert

    2012-01-01

    The mechanism of the ruthenium–N-heterocyclic-carbene-catalyzed formation of amides from alcohols and amines was investigated by experimental techniques (Hammett studies, kinetic isotope effects) and by a computational study by using dispersion-corrected density functional theory (DFT/ M06). The...... it is one of several slow steps in the catalytic cycle. Rapid scrambling of hydrogen and deuterium at the a position of the alcohol was observed with deuterium-labeled substrates, which implies that the catalytically active species is a ruthenium dihydride. The experimental results were supported by...

  2. The use of chiral lithium amides in the desymmetrisation of N-trialkylsilyl dimethyl sulfoximines

    Directory of Open Access Journals (Sweden)

    McGrath Matthew J

    2007-10-01

    Full Text Available Abstract Background Chiral base desymmetrisation of dimethyl sulfoximines could provide a general route to chiral, enantioenriched dialkyl sulfoximines with potential for use in asymmetric catalysis. Results Asymmetric deprotonation of N-trialkylsilyl dimethyl sulfoximines with either enantiomer of lithium N,N-bis(1-phenylethylamide in the presence of lithium chloride affords enantioenriched sulfoximines on electrophilic trapping. Ketones, ketimines, trialkylsilyl chlorides and activated alkyl halides may be used as electrophiles in the reaction. Furthermore, a modified Horner-Emmons methodology was investigated. Conclusion Simple chiral lithium amides afford products with enantiomeric excesses of up to 70%, illustrating that chiral base desymmetrisation of dimethyl sulfoximines is possible.

  3. Enhancement of productivity of recombinant α-amidating enzyme by low temperature culture

    OpenAIRE

    Furukawa, Kazuaki; Ohsuye, Kazuhiro

    1999-01-01

    We have produced a recombinant C-terminal α-amidating enzyme (799BglIIα-AE) derived from Xenopus laevis by culturing a CHO cell line named 3μ-1S. Recently, we demonstrated that culturing 3μ-1S cells at a temperature below 37 °C led to the following phenomena: inhibited cell growth with high viability, enhanced cellular productivity (maximally at 32 °C), and suppressed medium consumption and release of impurities from the cells. Therefore, it is suggested that the 799BglIIα-AE production will ...

  4. Rapid and accurate processing method for amide proton exchange rate measurement in proteins

    Energy Technology Data Exchange (ETDEWEB)

    Koskela, Harri [University of Helsinki, Finnish Institute for Verification of the Chemical Weapons Convention (VERIFIN) (Finland)], E-mail: Harri.T.Koskela@helsinki.fi; Heikkinen, Outi; Kilpelaeinen, Ilkka; Heikkinen, Sami [University of Helsinki, Laboratory of Organic Chemistry (Finland)

    2007-04-15

    Exchange between protein backbone amide hydrogen and water gives relevant information about solvent accessibility and protein secondary structure stability. NMR spectroscopy provides a convenient tool to study these dynamic processes with saturation transfer experiments. Processing of this type of NMR spectra has traditionally required peak integration followed by exponential fitting, which can be tedious with large data sets. We propose here a computer-aided method that applies inverse Laplace transform in the exchange rate measurement. With this approach, the determination of exchange rates can be automated, and reliable results can be acquired rapidly without a need for manual processing.

  5. Rapid and accurate processing method for amide proton exchange rate measurement in proteins

    International Nuclear Information System (INIS)

    Exchange between protein backbone amide hydrogen and water gives relevant information about solvent accessibility and protein secondary structure stability. NMR spectroscopy provides a convenient tool to study these dynamic processes with saturation transfer experiments. Processing of this type of NMR spectra has traditionally required peak integration followed by exponential fitting, which can be tedious with large data sets. We propose here a computer-aided method that applies inverse Laplace transform in the exchange rate measurement. With this approach, the determination of exchange rates can be automated, and reliable results can be acquired rapidly without a need for manual processing

  6. The in vitro metabolism of phospho-sulindac amide, a novel potential anticancer agent

    OpenAIRE

    Xie, Gang; Cheng, Ka-Wing; Huang, Liqun; Rigas, Basil

    2014-01-01

    Phospho-sulindac amide (PSA) is a novel potential anti-cancer and anti-inflammatory agent. Here we report the metabolism of PSA in vitro. PSA was rapidly hydroxylated at its butane-phosphate moiety to form two di-hydroxyl-PSA and four mono-hydroxyl-PSA metabolites in mouse and human liver microsomes. PSA also can be oxidized or reduced at its sulindac moiety to form PSA sulfone and PSA sulfide, respectively. PSA was mono-hydroxylated and cleared more rapidly in mouse liver microsomes than in ...

  7. Amides from Piper capense with CNS activity

    DEFF Research Database (Denmark)

    Pedersen, Mikael Egebjerg; Metzler, Bjørn; Stafford, Gary Ivan;

    2009-01-01

    Piper capense L.f. (Piperaceae) is used traditionally in South Africa as a sleep inducing remedy. Bioassay-guided fractionation of the roots of P. capense led to the isolation of piperine (1) and 4,5-dihydropiperine (2), which showed moderate affinity for the benzodiazepine site on the GABA......(A) receptor (IC(50) values of 1.2 mM and 1.0 mM, respectively). The present study suggests that strict structural properties of the amides are essential for affinity. Taken together, these observations suggest that the carbon chain must contain not less than four carbons, and that a conjugated double bond...

  8. Discovery of MK-3168: A PET Tracer for Imaging Brain Fatty Acid Amide Hydrolase.

    Science.gov (United States)

    Liu, Ping; Hamill, Terence G; Chioda, Marc; Chobanian, Harry; Fung, Selena; Guo, Yan; Chang, Linda; Bakshi, Raman; Hong, Qingmei; Dellureficio, James; Lin, Linus S; Abbadie, Catherine; Alexander, Jessica; Jin, Hong; Mandala, Suzanne; Shiao, Lin-Lin; Li, Wenping; Sanabria, Sandra; Williams, David; Zeng, Zhizhen; Hajdu, Richard; Jochnowitz, Nina; Rosenbach, Mark; Karanam, Bindhu; Madeira, Maria; Salituro, Gino; Powell, Joyce; Xu, Ling; Terebetski, Jenna L; Leone, Joseph F; Miller, Patricia; Cook, Jacquelynn; Holahan, Marie; Joshi, Aniket; O'Malley, Stacey; Purcell, Mona; Posavec, Diane; Chen, Tsing-Bau; Riffel, Kerry; Williams, Mangay; Hargreaves, Richard; Sullivan, Kathleen A; Nargund, Ravi P; DeVita, Robert J

    2013-06-13

    We report herein the discovery of a fatty acid amide hydrolase (FAAH) positron emission tomography (PET) tracer. Starting from a pyrazole lead, medicinal chemistry efforts directed toward reducing lipophilicity led to the synthesis of a series of imidazole analogues. Compound 6 was chosen for further profiling due to its appropriate physical chemical properties and excellent FAAH inhibition potency across species. [(11)C]-6 (MK-3168) exhibited good brain uptake and FAAH-specific signal in rhesus monkeys and is a suitable PET tracer for imaging FAAH in the brain. PMID:24900701

  9. Clean SEA-TROSY Experiments to Map Solvent Exposed Amides in Large Proteins

    Institute of Scientific and Technical Information of China (English)

    林东海

    2004-01-01

    It is well known that the SEA-TROSY experiment could alleviate some of the problems of resonance overlap in 15N/2H labeled proteins as it was designed to selectively map solvent exposed amide protons. However, SEATROSY spectra may be contaminated with exchange-relayed NOE contributions from fast exchanged hydroxyl or amine protons and contributions from longitudinal relaxation. Also, perdeuteration of the protein sample is a prerequisite for this experiment. In this communication, a modified version, clean SEA-TROSY, was proposed to eliminate these artifacts and to allow the experiment to be applied to protonated or partially deuterated proteins and protein complexes.

  10. Vibration characteristics of single- and double-walled carbon nanotubes functionalized with amide and amine groups

    Energy Technology Data Exchange (ETDEWEB)

    Ajori, S.; Ansari, R., E-mail: r_ansari@guilan.ac.ir; Darvizeh, M.

    2015-04-01

    Carbon nanotube functionalization for designing devices with atomic precision has been of great importance in recent years. This article studies the vibration behavior of single-walled carbon nanotubes (SWCNTs) and double-walled carbon nanotubes (DWCNTs) functionalized with amine and amide groups employing molecular dynamics (MD) simulations. The results demonstrate that the natural frequency of CNTs reduces considerably through attaching functional groups to them. Also, it is demonstrated that the natural frequency of DWCNTs is less sensitive to functional groups in comparison with their constituent inner and outer functionalized tubes. Further, it is indicated that the functionalization performed has its most pronounced effect on SWCNTs with small aspect ratios.

  11. Vibration characteristics of single- and double-walled carbon nanotubes functionalized with amide and amine groups

    International Nuclear Information System (INIS)

    Carbon nanotube functionalization for designing devices with atomic precision has been of great importance in recent years. This article studies the vibration behavior of single-walled carbon nanotubes (SWCNTs) and double-walled carbon nanotubes (DWCNTs) functionalized with amine and amide groups employing molecular dynamics (MD) simulations. The results demonstrate that the natural frequency of CNTs reduces considerably through attaching functional groups to them. Also, it is demonstrated that the natural frequency of DWCNTs is less sensitive to functional groups in comparison with their constituent inner and outer functionalized tubes. Further, it is indicated that the functionalization performed has its most pronounced effect on SWCNTs with small aspect ratios

  12. Studies and Applications of Metals for the Synthesis of Carbinols, Amides and Carbohydrates

    DEFF Research Database (Denmark)

    Osztrovszky, Gyorgyi

    amidation. These two systems do not show any significant differences in reactivity indicating that the same catalytically active species is operating. Project 3: Synthesis of a trisaccharide probe as a putative dengue virus receptor At the Institute for Glycomics major research has been devoted to identify...... putative receptors for dengue virus (DENV). Based on previous studies the GlcNAcß1-3Galß1-4GlcNAc trisaccharide was considered as a putative virus receptor. The synthesis of the trisaccharide probe has been achieved by the coupling of the corresponding D-glucosamine donor and the lactosamine acceptor...

  13. Synthesis and Tumor Cytotoxicity of Novel Amide Derivatives of β-Hederin

    Directory of Open Access Journals (Sweden)

    Mao-Sheng Cheng

    2010-11-01

    Full Text Available Thirteen novel triterpenoid saponins, designed as amide derivatives of the natural cytotoxic saponin β-hederin, were synthesized by a stepwise glycosylation strategy. The in vitro cytotoxic activity of these compounds was evaluated against five different tumor cell lines. Most of the evaluated compounds showed effective inhibitory activity against at least one tumor cell line at micromolar concentrations. The preliminary structure-activity relationships (SAR indicate that mide derivatization at C-28 resulted in highly cytotoxic derivatives on specific tumor cell lines, and also resulted in an increase in the antitumor selectivity of β-hederin. 

  14. Methods for attaching polymerizable ceragenins to water treatment membranes using amine and amide linkages

    Energy Technology Data Exchange (ETDEWEB)

    Hibbs, Michael; Altman, Susan J.; Jones, Howland D.T.; Savage, Paul B.

    2013-10-15

    This invention relates to methods for chemically grafting and attaching ceragenin molecules to polymer substrates; methods for synthesizing ceragenin-containing copolymers; methods for making ceragenin-modified water treatment membranes and spacers; and methods of treating contaminated water using ceragenin-modified treatment membranes and spacers. Ceragenins are synthetically produced antimicrobial peptide mimics that display broad-spectrum bactericidal activity. Alkene-functionalized ceragenins (e.g., acrylamide-functionalized ceragenins) can be attached to polyamide reverse osmosis membranes using amine-linking, amide-linking, UV-grafting, or silane-coating methods. In addition, silane-functionalized ceragenins can be directly attached to polymer surfaces that have free hydroxyls.

  15. Studies on novel interpenetrating networks of urethane modified poly(ester-amide and vinyl ester of bisphenol-C

    Directory of Open Access Journals (Sweden)

    Pragnesh N. Dave

    2016-05-01

    Full Text Available Bisphthalamic acids were prepared by reaction of maleic anhydride and aromatic diamines. Novel poly(ester-amides (PEAs were prepared by reaction of DGEBF with bisphthalamic acids. Acrylation of PEAs was carried out using acryloyl chloride; products are called acrylated poly(ester-amides (APEAs. Epoxy resin based unsaturated poly(ester-amide resins (UPEAs can be prepared by many methods but here these were prepared by reported method. These UPEAs were then treated with acryloyl chloride to afford acrylated UPEAs resin (i.e. AUPEAs. Interpenetrating networks of equal proportional urethane modified poly(ester-amide and acrylated poly(ester-amide and vinyl ester of biaphenol c (VE resin were prepared. Urethane modified APEAs and AUPEAs were characterized by elemental analysis, molecular weight was determined by vapor pressure osmometer and by IR spectral study and by thermogravimetry. Based on DSC data in situ glass reinforced composites of the resultant blends have been prepared and characterized for mechanical, electrical and chemical properties. Unreinforced blends were characterized by thermogravimetry (TGA.

  16. The Influence of the Amide Linkage in the Fe(III) -Binding Properties of Catechol-Modified Rosamine Derivatives.

    Science.gov (United States)

    Queirós, Carla; Leite, Andreia; G M Couto, Maria; Cunha-Silva, Luís; Barone, Giampaolo; de Castro, Baltazar; Rangel, Maria; M N Silva, André; M G Silva, Ana

    2015-10-26

    The two new fluorescent ligands RosCat1 and RosCat2 contain catechol receptors connected to rosamine platforms through an amide linkage and were synthesized by using microwave-assisted coupling reactions of carboxyl- or amine-substituted rosamines with the corresponding catechol units and subsequent deprotection. RosCat1 possesses a reverse amide, whereas RosCat2 has the usual oriented amide bond (HNCO vs. CONH, respectively). The ligands were characterized by means of NMR spectroscopy, mass-spectrometry, and DFT calculations and X-ray crystallography studies for RosCat1. The influence of the amide linkage on the photophysical properties of the fluorescent ligands was assessed in different solvents and showed a higher fluorescence quantum yield for RosCat1. The coordination chemistry of these ligands with a Fe(III) center has been rationalized by mass-spectrometric analysis and semiempirical calculations. Octahedral Fe(III) complexes were obtained by the chelation of three RosCat1 or RosCat2 ligands. Interestingly, the unconventional amide connectivity in RosCat1 imposes the formation of an eight-membered ring on the chelate complex through a "salicylate-type" mode of coordination. PMID:26493881

  17. Distribution of serotonin and FMRF-amide in the brain of Lymnaea stagnalis with respect to the visual system

    Institute of Scientific and Technical Information of China (English)

    Oksana P.TUCHINA; Valery V.ZHUKOV; Victor B.MEYER-ROCHOW

    2012-01-01

    Despite serotonin's and FMRF-amide's wide distribution in the nervous system of invertebrates and their importance as neurotransmitters,the exact roles they play in neuronal networks leaves many questions.We mapped the presence of serotonin and FMRF-amide-immunoreactivity in the central nervous system and eyes of the pond snail Lymnaea stagnalis and interpreted the results in connection with our earlier findings on the central projections of different peripheral nerves.Since the chemical nature of the intercellular connections in the retina of L.stagnalis is still largely unknown,we paid special attention to clarifying the role of serotonin and FMRF-amide in the visual system of this snail and compared our findings with those reported from other species.At least one serotonin- and one FMRF-amidergic fibre were labeled in each optic nerve,and since no cell bodies in the eye showed immunoreactivity to these neurotransmitters,we believe that efferent fibres with somata located in the central ganglia branch at the base of the eye and probably release 5HT and FMRF-amide as neuro-hormones.Double labelling revealed retrograde transport of neurobiotin through the optic nerve,allowing us to conclude that the central pathways and serotonin- and FMRF-amide-immunoreactive cells and fibres have different locations in the CNS in L.stagnalis.The chemical nature of the fibres,which connect the two eyes in L.stagnalis,is neither serotoninergic nor FMRF-amidergic.

  18. Synthesis and copper-dependent antimycoplasmal activity of amides and amidines derived from 2-amino-1,10-phenanthroline.

    Science.gov (United States)

    de Zwart, M A; Bastiaans, H M; van der Goot, H; Timmerman, H

    1991-03-01

    A series of both aliphatic and aromatic amides and aromatic amidines derived from 2-amino-1,10-phenanthroline (3) according to the Topliss scheme were synthesized and subsequently tested for antimycoplasmal potency. Although the compounds themselves showed no activity, in the presence of a nontoxic copper concentration of 40 microM all compounds appeared to be very active against Mycoplasma gallisepticum K154. The most active compounds were found in the amide series and show growth inhibition in the nanomolar range. These compounds are 4 times more active than tylosin, a macrolide antibiotic, which is used therapeutically in veterinary practice. In the presence of copper, amides derived from 3 are more active than corresponding amidines. Increased activity following derivatization of 3 may be due to the presence of a third coordination site for copper in the title compounds. Evaluation of biological data revealed that antimycoplasmal activity of amides derived from 3 is dependent on lipophilicity. For these amides a good linear correlation was found between antimycoplasmal activity and hydrophobic fragmental values for substituents considered. This quantitative structure-activity relationship study indicated that antimycoplasmal activity was increased upon a decrease of these hydrophobic fragmental values. PMID:2002460

  19. Proximate and qualitative analysis of different parts of Piper sarmentosum, and quantification of total amides in various extracts

    Directory of Open Access Journals (Sweden)

    K Hussain

    2009-01-01

    Full Text Available Present study aimed to analyze crude powders and extracts of different parts of Piper sarmentosum for proximate, qualitative and quantitative studies to prepare standardized botanical drugs from the plant. Unlike synthetic drugs, standardization of botanical drugs is always challenging for natural product researchers due to inadequacy and unavailability of standards and methods. Standardization of botanical drugs is not just an analytical process which ends with the detection of few constituents rather it embodies a set of analytical, biochemical and biological protocols. Keeping analytical protocols in view, crude powders were analyzed for the content of moisture, total ash, acid insoluble ash, sulphated ash and soluble extractives in water and methanol. These physicochemical properties were found within specified limits. Comparison of Fourier Transform Infrared (FTIR fingerprints of crude powders of different parts indicated the difference of constituents. Similarly, comparison of ultra violet (UV profiles of extracts of all the parts exhibited discrimination. Qualitative analysis of aqueous and ethanol extracts by high performance thin layer chromatography (HPTLC indicated the presence of amides in ethanol extracts of all parts of the plant. Quantitative analysis of extracts indicated that total amide content was significantly higher by colorimetry as compared to UV spectrophotometry. The distribution of amides in different parts was in the order fruit > root > leaf > stem (P=0.000. It is concluded from the study that amide content varies in different parts of the plant and ethanol is a better solvent for their extraction. Additionally, colorimetric method exhibits high content of amides.

  20. Crystal structures of (E)-3-(furan-2-yl)-2-phenyl-N-tosyl­acryl­amide and (E)-3-phenyl-2-(m-tol­yl)-N-tosyl­acryl­amide

    OpenAIRE

    Cheng, Dong; Meng, Xiangzhen; Sheng, Zeyuan; Wang, Shuangming; Duan, Yuanyuan; Li, Ziqian

    2016-01-01

    In the title N-tosyl­acryl­amide compounds, C20H17NO4S, (I), and C23H21NO3S, (II), the conformation about the C=C bond is E. The acryl­amide groups, [–NH—C(=O)—C=C–], are almost planar, with the N—C—C=C torsion angle being −170.18 (14)° in (I) and −168.01 (17)° in (II). In (I), the furan, phenyl and 4-methyl­benzene rings are inclined to the acryl­amide mean plane by 26.47 (11), 69.01 (8) and 82.49 (9)°, respectively. In (II), the phenyl, 3-methyl­benzene and 4-methyl­benzene rings are inclin...

  1. Mapping temperature-induced conformational changes in the Escherichia coli heat shock transcription factor sigma 32 by amide hydrogen exchange

    DEFF Research Database (Denmark)

    Rist, Wolfgang; Jørgensen, Thomas J D; Roepstorff, Peter;

    2003-01-01

    degrees C, indicating that sigma 32 adopts a highly flexible structure. At 42 degrees C we observed a slow correlated exchange of 30 additional amide hydrogens and localized it to a helix-loop-helix motif within domain sigma 2 that is responsible for the recognition of the -10 region in heat shock......Stress conditions such as heat shock alter the transcriptional profile in all organisms. In Escherichia coli the heat shock transcription factor, sigma 32, out-competes upon temperature up-shift the housekeeping sigma-factor, sigma 70, for binding to core RNA polymerase and initiates heat shock...... gene transcription. To investigate possible heat-induced conformational changes in sigma 32 we performed amide hydrogen (H/D) exchange experiments under optimal growth and heat shock conditions combined with mass spectrometry. We found a rapid exchange of around 220 of the 294 amide hydrogens at 37...

  2. Amide functionalized Calix-Benzocrown-6 ionophore for extraction of cesium from highly concentrated nitric acid medium

    International Nuclear Information System (INIS)

    A series of novel calix(4)arene-benzocrown-6 amide (CBCA) ligands in 1,3-alternate conformations with amidic group attached to aromatic ring of the polyether ring network have been synthesised and evaluated for extraction of caesium from nitric acid medium (1-10M). Isodecyl alcohol (IDA) and o-nitrophenyl hexyl ether (o-NPHE) modified calix/dodecane have been used for extraction studies. The extraction of Cs increases with nitric acid concentration, the maxima is obtained at ∼ 4.5M for calix-benzo-crown-6 (CBC) used as standard, whereas, in case of CBCA this maxima reaches to ∼ 8M nitric acid concentration. This difference is attributed to neutralization of nitric acid by intramolecular buffering effect of amidic group of CBCA. (author)

  3. Detailed insights into the retention mechanism of caffeine metabolites on the amide stationary phase in hydrophilic interaction chromatography.

    Science.gov (United States)

    Guo, Yong; Shah, Rajan

    2016-09-01

    The amide phase was investigated using a wide range of acetonitrile content in the mobile phase in both the HILIC and RPLC modes. Using caffeine metabolites as the model compounds, the retention, thermodynamic and kinetic data was obtained under various mobile phase conditions and supported the previous postulation that there might be a transition of the predominant retention mechanism in relation to the acetonitrile content in HILIC. On the amide phase, hydrophilic partitioning seemed to be the predominant retention mechanism below 85% acetonitrile; and a different retention mechanism (presumably surface adsorption) made more and more significant contributions to the overall retention when the acetonitrile content reached above 85%. This study also provided more direct evidences to explain the effect of salt concentration on the retention of non-charged solutes in HILIC. In addition, the retention, thermodynamic and kinetic data suggest that the amide phase behaved very differently from the conventional C18 phase in the RPLC mode. PMID:27522153

  4. Design, Synthesis, and Fungicidal Activities of Novel 5-Methyl-1H-1,2,3- trizole-4-carboxyl Amide Analogues.

    Science.gov (United States)

    Wang, Zhen-Jun; Yang, Hui-Hui; Tian, Lei; Zhao, Wei-Guang

    2016-01-01

    Succinate dehydrogenase inhibitors (SDHIs) are fungicides with an amide bond widely used to control plant diseases caused by phytopathogenic fungi. Because of broad spectrum activity of new SDHIs, they have attracted wide attention from the research community. A series of structurally novel SDHIs with a bioactive 1,2,3-triazole moiety were designed and synthesized. Bioactivity screening showed that some of designed N-phenethyl-1,2,3-trizole-4-carboxyl amide analogues exhibited good fungicidal activities toward Sclerotinia sclerotiorum and Botrytis cinerea, while some of Nbenzyl- 1,2,3-trizole-4-carboxyl amide analogues exhibited good fungicidal activities toward Phytophthora capsici and Cercospora arachidicola. EC50 value of compound 5d against Cercospora arachidicola (6.6 µg/mL) was lower than that of chlorothalonil (12.3 µg/mL). PMID:26558376

  5. Microwave assisted synthesis, spectral, magnetic and bioevolution of few Mn (II)-amide complexes

    Science.gov (United States)

    Joshi, Gaurav; Verma, K. K.; Gudesaria, D. D.; Bhojak, N.

    2016-05-01

    The importance and versatility of amide group containing ligands have promoted the selection of this class of ligands and their complexes for the study. The present work describes the synthesis, spectral and biological investigations on the complexes of amides derived from heterocyclic amines with Mn (II) ions. Four ligands derived 2-aminopyridine and their complexes with Mn (II) have been synthesized. A method for the synthesis of complexes has been developed by the use of microwave irradiation which is in agreement to Green chemistry approach. The complexes have been characterized on the basis of elemental analysis, infrared, electronic, ESR spectra and magnetic susceptibility studies. The diffuse reflectance spectrum of the complexes show bands in the region 20,000 cm-1 to 26,000 cm-1 assignable to 6A1g → 4T2g and 6A1g → 4E1g transitions. These are also typical of tetrahedral environment around the manganese. The magnetic moment (5.80 BM) of the complex indicates high spin tetrahedral environment. The microwave method of synthesis of complexes have been found easier, convenient and ecofriendly. Antimicrobial activities of compounds were also carried out against bacteria and fungi. Further minimal inhibitory concentration (MIC) was also determined for each compound.

  6. N,N-Dialkyl amides as extractants for spent fuel reprocessing. An overview

    International Nuclear Information System (INIS)

    Reprocessing of spent nuclear fuel is vital for the long-term global nuclear power growth and is the major motivation for developing novel separation schemes. Conventionally, PUREX and THOREX processes have been proposed for the reprocessing of U and Th based spent fuels employing tri-n-butyl phosphate (TBP) as extractant. However, based on the experiences gained over last five-six decades on the reprocessing of spent fuels, some major drawbacks of TBP have been identified. Evaluation of alternative extractants is, therefore, desirable which can overcome at least some of these problems. Extensive studies have been carried out on the evaluation of N,N-dialkyl amides as extractants in the back-end of the nuclear fuel cycle for addressing the issues related to the reprocessing of U and Th based spent fuels. Under advanced fuel cycle scenario, efforts are also being made by countries with a developed nuclear technological base to provide safe nuclear power to other countries and to minimize proliferation concerns worldwide. This paper presents an overview of studies carried out in our laboratory on different aspects of reprocessing of U and Th based spent fuels employing N,N-dialkyl amides as extractants. (author)

  7. Papain-like protease (PLpro) inhibitory effects of cinnamic amides from Tribulus terrestris fruits.

    Science.gov (United States)

    Song, Yeong Hun; Kim, Dae Wook; Curtis-Long, Marcus John; Yuk, Heung Joo; Wang, Yan; Zhuang, Ningning; Lee, Kon Ho; Jeon, Kwon Seok; Park, Ki Hun

    2014-01-01

    Tribulus terrestris fruits are well known for their usage in pharmaceutical preparations and food supplements. The methanol extract of T. terrestris fruits showed potent inhibition against the papain-like protease (PLpro), an essential proteolylic enzyme for protection to pathogenic virus and bacteria. Subsequent bioactivity-guided fractionation of this extract led to six cinnamic amides (1-6) and ferulic acid (7). Compound 6 emerged as new compound possessing the very rare carbinolamide motif. These compounds (1-7) were evaluated for severe acute respiratory syndrome coronavirus (SARS-CoV) PLpro inhibitory activity to identify their potencies and kinetic behavior. Compounds (1-6) displayed significant inhibitory activity with IC50 values in the range 15.8-70.1 µM. The new cinnamic amide 6 was found to be most potent inhibitor with an IC50 of 15.8 µM. In kinetic studies, all inhibitors exhibited mixed type inhibition. Furthermore, the most active PLpro inhibitors (1-6) were proven to be present in the native fruits in high quantities by HPLC chromatogram and liquid chromatography with diode array detection and electrospray ionization mass spectrometry (LC-DAD-ESI/MS). PMID:24882413

  8. Cinnamic acid amides from Tribulus terrestris displaying uncompetitive α-glucosidase inhibition.

    Science.gov (United States)

    Song, Yeong Hun; Kim, Dae Wook; Curtis-Long, Marcus J; Park, Chanin; Son, Minky; Kim, Jeong Yoon; Yuk, Heung Joo; Lee, Keun Woo; Park, Ki Hun

    2016-05-23

    The α-glucosidase inhibitory potential of Tribulus terrestris extracts has been reported but as yet the active ingredients are unknown. This study attempted to isolate the responsible metabolites and elucidate their inhibition mechanism of α-glucosidase. By fractionating T. terristris extracts, three cinnamic acid amide derivatives (1-3) were ascertained to be active components against α-glucosidase. The lead structure, N-trans-coumaroyltyramine 1, showed significant inhibition of α-glucosidase (IC50 = 0.42 μM). Moreover, all active compounds displayed uncompetitive inhibition mechanisms that have rarely been reported for α-glucosidase inhibitors. This kinetic behavior was fully demonstrated by showing a decrease of both Km and Vmax, and Kik/Kiv ratio ranging between 1.029 and 1.053. We progressed to study how chemical modifications to the lead structure 1 may impact inhibition. An α, β-unsaturation carbonyl group and hydroxyl group in A-ring of cinnamic acid amide emerged to be critical functionalities for α-glucosidase inhibition. The molecular modeling study revealed that the inhibitory activities are tightly related to π-π interaction as well as hydrogen bond interaction between enzyme and inhibitors. PMID:26974386

  9. Amidation reaction of eugenyl oxyacetate ethyl ester with 1,3 diaminopropane

    Science.gov (United States)

    Suryanti, V.; Wibowo, F. R.; Kusumaningsih, T.; Wibowo, A. H.; Khumaidah, S. A.; Wijayanti, L. A.

    2016-04-01

    Eugenol having various substituents on the aromatic ring (hydroxy, methoxy and allyl) are useful for starting material in synthesizing of its derivatives. Eugenol derivatives have shown wide future potential applications in many areas, especially as future drugs against many diseases. The aim of this work was to synthesize an amide of eugenol derivative. The starting material used was eugenol from clove oil and the reaction was conducted in 3 step reactions to give the final product. Firstly, eugenol was converted into eugenyl oxyacetate [2-(4-allyl-2-methoxyphenoxy) acetic acid] as a white crystal with 70.5% yield, which was then esterified with ethanol to have eugenyl oxyacetate ethyl ester [ethyl 2-(4-allyl-2-methoxyphenoxy) acetate] as brown liquid in 75.7%. The last step was the reaction between eugenyl oxyacetate ethyl ester and 1,3 diaminopropane to give 2-(4-allyl-2-methoxyphenoxy)-N-(3-aminopropyl) acetamide as a brown powder with 71.6% yield, where the amidation reaction was occurred.

  10. Shedding light on minipig drug metabolism - elevated amide hydrolysis in vitro.

    Science.gov (United States)

    Jones, Russell; Marschmann, Michaela; Keller, Michael; Qiu, Na Hong; Fowler, Stephen; Singer, Thomas; Schuler, Franz; Funk, Christoph; Schadt, Simone

    2016-06-01

    1. In recent years, the minipig is increasingly used as a test species in non-clinical assessment of drug candidates. While there is good scientific evidence available concerning cytochrome P450-mediated metabolism in minipig, the knowledge of other metabolic pathways is more limited. 2. The aim of this study was to provide an understanding of when, why, and how drug metabolism in minipig differs from other species commonly used in non-clinical studies. In-house cross-species metabolite profile comparisons in hepatocytes and microsomes of 38 Roche development compounds were retrospectively analyzed to compare the metabolism among minipig, human, rat, dog, monkey, rabbit and mouse. 3. A significant contributor to the elevated metabolism observed for certain compounds in minipig was identified as amide hydrolysis. The hepatic amide hydrolysis activity in minipig was further investigated in subcellular liver fractions and a structure-activity relationship was established. When structural motifs according to the established SAR are excluded, coverage of major human metabolic pathways was shown to be higher in minipig than in dog, and only slightly lower than in cynomolgus monkey. 4. A strategy is presented for early identification of drug compounds which might not be suited to further investigation in minipig due to excessive hydrolytic metabolism. PMID:26405846

  11. Synthesis, characterization and biological evaluation of novel α, β unsaturated amides

    Science.gov (United States)

    Esmailzadeh, K.; Housaindokht, M. R.; Moradi, A.; esmaeili, A. A.; Sharifi, Z.

    2016-05-01

    Three derivatives of α,β unsaturated amides have been successfully synthesized via Ugi-four component (U-4CR) reaction. The interactions of the amides with calf thymus deoxyribonucleic acid (ct-DNA) have been investigated in the Tris-HCl buffer (pH = 7.4) using viscometric, spectroscopic, thermal denaturation studies, and also molecular docking. By UV-Vis absorption spectroscopy studies, adding CT-DNA to the compound solution caused the hypochromism indicates that there are interactions between the compounds and DNA base pairs. In competitive fluorescence with methylene blue as an intercalator probe, adding compounds to DNA-MB solution caused an increase in emission spectra of the complex. This could be because of compound replacing, with similar binding mode of MB, between the DNA base pairs due to release of bonded MB molecules from DNA-MB complex. Thermal denaturation studies and viscometric experiments also indicated that all three investigated compounds bind to CT-DNA by non-classical intercalation mode. Additionally, molecular docking technique predicted partial intercalation binding mode for the compounds. Also, the highest binding energy was obtained for compound 5a. These results are in agreement with results obtained by empirical methods.

  12. Actinide separation with a novel tridentate ligand, di-glycolic amide for application to partitioning process

    Energy Technology Data Exchange (ETDEWEB)

    Yuji Sasaki; Yumi Sugo; Shoichi Tachimori [Japan Atomic Energy Research Institute, Tokai-Mura, Ibaraki-Ken (Japan)

    2000-07-01

    The tridentate neutral ligands, having two amidic carbonyl donors and an etheric oxygen, were synthesized in our laboratory and examined the extraction of actinides and fission products. Among the synthesized diglycol-amides (DGA) with varying length of alkyl chains attached to two N atoms, N,N,N',N'-tetra-octyl-3-oxa-pentane-diamide (TODGA) and N,N,N',N'-tetra-decyl-3-oxa-pentane-diamide (TDDGA), showed a sufficient solubility in n-dodecane. The extractability of both TODGA and TDDGA for actinides(Ans), i.e., U(VI), Pu(IV), Am(III), and Cm(III), in nitric acid solution was satisfactorily high and its order was in a succession of An(III), An(IV) > An(VI) > An(V). The extraction of fission products (FPs), except Zr(IV) and lanthanides(Lns), are relatively small, indicating the sufficient separation of actinides, Zr(IV) and Lns(III) from other FPs. The extraction kinetics, maximum loading in the organic phase, back-extraction behavior, and radiolytic stability of TODGA showed that TODGA is applicable to the treatment of the high level waste. (authors)

  13. Actinide separation with a novel tridentate ligand, di-glycolic amide for application to partitioning process

    International Nuclear Information System (INIS)

    The tridentate neutral ligands, having two amidic carbonyl donors and an etheric oxygen, were synthesized in our laboratory and examined the extraction of actinides and fission products. Among the synthesized diglycol-amides (DGA) with varying length of alkyl chains attached to two N atoms, N,N,N',N'-tetra-octyl-3-oxa-pentane-diamide (TODGA) and N,N,N',N'-tetra-decyl-3-oxa-pentane-diamide (TDDGA), showed a sufficient solubility in n-dodecane. The extractability of both TODGA and TDDGA for actinides(Ans), i.e., U(VI), Pu(IV), Am(III), and Cm(III), in nitric acid solution was satisfactorily high and its order was in a succession of An(III), An(IV) > An(VI) > An(V). The extraction of fission products (FPs), except Zr(IV) and lanthanides(Lns), are relatively small, indicating the sufficient separation of actinides, Zr(IV) and Lns(III) from other FPs. The extraction kinetics, maximum loading in the organic phase, back-extraction behavior, and radiolytic stability of TODGA showed that TODGA is applicable to the treatment of the high level waste. (authors)

  14. Benzothiazole derivatives bearing amide moiety: potential cytotoxic and apoptosis-inducing agents against cervical cancer.

    Science.gov (United States)

    Singh, Meenakshi; Modi, Arusha; Narayan, Gopeshwar; Singh, Sushil K

    2016-07-01

    Cervical cancer is a major cause of morbidity and mortality in women worldwide. In recent years, benzothiazole analogues have attracted considerable attention in anticancer research. Therefore, in this study, the earlier reported amide series of benzothiazole derivatives were investigated for their antiproliferative activity. The activity of amide derivatives was evaluated using the 3-(4, 5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide assay, flow cytometric analysis, apoptosis assay, and DNA fragmentation on two human cervical cancer cell lines: SiHa and C33-A. The data reported from this investigation indicated that benzothiazole derivatives show pronounced cytotoxicity in the HPV16-positive SiHa cells compared with HPV-negative C-33A cells. The in-vitro cytotoxicity of the compounds on the HEK-293 noncancer cell line was evaluated to establish selectivity. Cells treated with benzothiazole derivatives showed prominent morphological features as evidenced by cell shrinkage, membrane blebbing, apoptotic nuclei, and DNA fragmentation. The benzothiazole derivatives show accumulation of cells in the sub-G1 and S-phase of the cell cycle in SiHa and C33-A, respectively. In addition, these derivatives exert their beneficial effect by inducing apoptosis, in the chemoprevention of cervical cancer cells, and were further ascertained using a DNA fragmentation assay. The compounds studied showed potent cytotoxic and apoptotic properties against SiHa and C33-A cancer cell lines and thus represent an excellent starting point for further optimization of therapeutically effective anticancer drugs. PMID:26945135

  15. Radiolabeled biotin amides from triazenyl precursors: synthesis, binding, and in-vivo properties

    International Nuclear Information System (INIS)

    The synthesis of N-(4-[127/125/123I]iodobenzyl)biotin amides 4a - 4c performed by the direct decomposition of N-[4-(3',3'-dimethyltriazenyl)benzyl]biotin amide with sodium iodide in the presence of CF3COOH is described. Iodinated in this way biotin formed a stable complex with avidin (Kd = 2.84 ± 0.45 x 10-15 M, n = 3.9 ± 0.6) which dissociated in the presence of excess native biotin with a rate constant of 0.034 ± 0.006 hr-1. Blood clearance studies and the lack of thyroid uptake indicated that this compound was not deiodinated in vivo and behaved in circulation much like native biotin. This aryltriazene precursor method is suitable for labeling with short-lived radiohalides. It can be used to produce no-carrier-added derivatives of biotin for use in biologic studies and assays involving avidin or streptavidin. (author)

  16. Synthesis and Evaluation of Coumaroyl Dipeptide Amide as Potential Whitening Agents

    Energy Technology Data Exchange (ETDEWEB)

    Kim, Jaeil; Lee, Jaeho [Gwangju Institute of Science and Technology, Gwangju (Korea, Republic of); Lee, Hyesuk; Shin, Kyonghoon; Ryu, Geunseog; Cho, Inshik; Kim, Hanyoung [Central Research Laboratories, Daejeon (Korea, Republic of)

    2013-10-15

    Coumaroyl dipeptide amide, Coumaric acid-LG-NH{sub 2}, was prepared successfully using the solid-phase method, and its efficacy as a skin whitening agent was studied. Coumaric acid-LG-NH{sub 2} was prepared with Rink-amide resin, and 96.354% of purity was obtained. Using MTT assay and LDH release assay, we found that it exhibited very low cytotoxicity. And, we found that Coumaric acid-LG-NH{sub 2} inhibited tyrosinase activity dose-dependently and showed superior tyrosinase inhibitory activity to well-known whitening agent, arbutin. IC{sub 50} value of Coumaric acid-LG-NH{sub 2} was 182.4 μM, and IC{sub 50} value of arbutin was 384.6 μM. Also, in measurement of melanin contents using B16F1 melanoma cell lines, Coumaric acid-LG-NH{sub 2} reduced melanin production induced by α-MSH statistically significant, and showed superior melanin inhibitory activity to p-coumaric acid or arbutin. In addition, Coumaric acid-LG-NH{sub 2} reduced MC1R mRNA expression level. Thus, we concluded that MC1R pathway is the significant pathway of Coumaric acid-LG-NH{sub 2}, and Coumaric acid-LG-NH{sub 2} has great potential to be used as novel whitening agents.

  17. Synthesis and Evaluation of Coumaroyl Dipeptide Amide as Potential Whitening Agents

    International Nuclear Information System (INIS)

    Coumaroyl dipeptide amide, Coumaric acid-LG-NH2, was prepared successfully using the solid-phase method, and its efficacy as a skin whitening agent was studied. Coumaric acid-LG-NH2 was prepared with Rink-amide resin, and 96.354% of purity was obtained. Using MTT assay and LDH release assay, we found that it exhibited very low cytotoxicity. And, we found that Coumaric acid-LG-NH2 inhibited tyrosinase activity dose-dependently and showed superior tyrosinase inhibitory activity to well-known whitening agent, arbutin. IC50 value of Coumaric acid-LG-NH2 was 182.4 μM, and IC50 value of arbutin was 384.6 μM. Also, in measurement of melanin contents using B16F1 melanoma cell lines, Coumaric acid-LG-NH2 reduced melanin production induced by α-MSH statistically significant, and showed superior melanin inhibitory activity to p-coumaric acid or arbutin. In addition, Coumaric acid-LG-NH2 reduced MC1R mRNA expression level. Thus, we concluded that MC1R pathway is the significant pathway of Coumaric acid-LG-NH2, and Coumaric acid-LG-NH2 has great potential to be used as novel whitening agents

  18. Electrical behavior of amide functionalized graphene oxide and graphene oxide films annealed at different temperatures

    International Nuclear Information System (INIS)

    Films of graphene oxide (GO) and amide functionalized graphene oxides (AGOs) were deposited on SiO2/Si(100) by spin coating and were thermally annealed at different temperatures. Sheet resistance of GO and AGOs films was measured using four probe resistivity method. GO an insulator at room temperature, exhibits decrease in sheet resistance with increase in annealing temperature. However, AGOs' low sheet resistance (250.43 Ω) at room temperature further decreases to 39.26 Ω after annealing at 800 °C. It was observed that the sheet resistance of GO was more than AGOs up to 700 °C, but effect was reversed after annealing at higher temperature. At higher annealing temperatures the oxygen functionality reduces in GO and sheet resistance decreases. Sheet resistance was found to be annealing time dependent. Longer duration of annealing at a particular temperature results in decrease of sheet resistance. - Highlights: • Amide functionalized graphene oxides (AGOs) were synthesized at room temperature (RT). • AGO films have low sheet resistance at RT as compared to graphene oxide (GO). • Fast decrease in the sheet resistance of GO with annealing as compared to AGOs • AGOs were found to be highly dispersible in polar solvents

  19. Fatty acid amide supplementation decreases impulsivity in young adult heavy drinkers.

    Science.gov (United States)

    van Kooten, Maria J; Veldhuizen, Maria G; de Araujo, Ivan E; O'Malley, Stephanie S; Small, Dana M

    2016-03-01

    Compromised dopamine signaling in the striatum has been associated with the expression of impulsive behaviors in addiction, obesity and alcoholism. In rodents, intragastric infusion of the fatty acid amide oleoylethanolamide increases striatal extracellular dopamine levels via vagal afferent signaling. Here we tested whether supplementation with PhosphoLean™, a dietary supplement that contains the precursor of the fatty acid amide oleoylethanolamide (N-oleyl-phosphatidylethanolamine), would reduce impulsive responding and alcohol use in heavy drinking young adults. Twenty-two individuals were assigned to a three-week supplementation regimen with PhosphoLean™ or placebo. Impulsivity was assessed with self-report questionnaires and behavioral tasks pre- and post-supplementation. Although self-report measures of impulsivity did not change, supplementation with PhosphoLean™, but not placebo, significantly reduced false alarm rate on a Go/No-Go task. In addition, an association was found between improved sensitivity on the Go/No-Go task and reduced alcohol intake. These findings provide preliminary evidence that promoting fatty acid derived gut-brain dopamine communication may have therapeutic potential for reducing impulsivity in heavy drinkers. PMID:26656766

  20. Mapping the amide I absorption in single bacteria and mammalian cells with resonant infrared nanospectroscopy

    Science.gov (United States)

    Baldassarre, L.; Giliberti, V.; Rosa, A.; Ortolani, M.; Bonamore, A.; Baiocco, P.; Kjoller, K.; Calvani, P.; Nucara, A.

    2016-02-01

    Infrared (IR) nanospectroscopy performed in conjunction with atomic force microscopy (AFM) is a novel, label-free spectroscopic technique that meets the increasing request for nano-imaging tools with chemical specificity in the field of life sciences. In the novel resonant version of AFM-IR, a mid-IR wavelength-tunable quantum cascade laser illuminates the sample below an AFM tip working in contact mode, and the repetition rate of the mid-IR pulses matches the cantilever mechanical resonance frequency. The AFM-IR signal is the amplitude of the cantilever oscillations driven by the thermal expansion of the sample after absorption of mid-IR radiation. Using purposely nanofabricated polymer samples, here we demonstrate that the AFM-IR signal increases linearly with the sample thickness t for t \\gt 50 nm, as expected from the thermal expansion model of the sample volume below the AFM tip. We then show the capability of the apparatus to derive information on the protein distribution in single cells through mapping of the AFM-IR signal related to the amide-I mid-IR absorption band at 1660 cm-1. In Escherichia Coli bacteria we see how the topography changes, observed when the cell hosts a protein over-expression plasmid, are correlated with the amide I signal intensity. In human HeLa cells we obtain evidence that the protein distribution in the cytoplasm and in the nucleus is uneven, with a lateral resolution better than 100 nm.

  1. N-Acetylcysteine amide: a derivative to fulfill the promises of N-Acetylcysteine.

    Science.gov (United States)

    Sunitha, K; Hemshekhar, M; Thushara, R M; Santhosh, M Sebastin; Yariswamy, M; Kemparaju, K; Girish, K S

    2013-05-01

    In the present human health scenario, implication of oxidative stress in numerous pathologies including neurodegenerative, cardiovascular, liver, renal, pulmonary disorders, and cancer has gained attention. N-Acetylcysteine (NAC), a popular thiol antioxidant, has been clinically used to treat various pathophysiological disorders. However, NAC therapy is routine only in paracetamol intoxication and as a mucolytic agent. Over six decades, numerous studies involving NAC therapy have yielded inconsistent results, and this could be due to low bioavailability. In order to overcome the limitations of NAC, an amide derivative N-Acetylcysteine amide (NACA) has been synthesized to improve the lipophilicity, membrane permeability, and antioxidant property. Recent studies have demonstrated the blood-brain barrier permeability and therapeutic potentials of NACA in neurological disorders including Parkinson's disease, Alzheimer's disease, Multiple sclerosis, Tardive dyskinesia, and HIV-associated neurological disorders. In addition, NACA displays protective effect against pulmonary inflammation and antibiotic-induced apoptosis. Forthcoming research on the possible therapeutic properties of NACA and its generics in the management of pathologies associated with extracellular matrix degradation and oxidative stress-related inflammation is highly exiting. Superior bioavailability of NACA is likely to fulfill the promises of NAC as well as a molecule to improve the endurance and resident time of bioscaffolds and biomaterials. Till date, more than 800 reviews on NAC have been published. However, no comprehensive review is available on the therapeutic applications of NACA. Therefore, the current review would be the first to emphasize the therapeutic potentials of NACA and its derivatives. PMID:23472882

  2. Biodegradable gadolinium-chelated cationic poly(urethane amide) copolymers for gene transfection and magnetic resonance imaging.

    Science.gov (United States)

    Gao, Xiaolong; Wang, Gangmin; Shi, Ting; Shao, Zhihong; Zhao, Peng; Shi, Donglu; Ren, Jie; Lin, Chao; Wang, Peijun

    2016-08-01

    Theranostic nano-polyplexes containing gene and imaging agents hold a great promise for tumor diagnosis and therapy. In this work, we develop a group of new gadolinium (Gd)-chelated cationic poly(urethane amide)s for gene delivery and T1-weighted magnetic resonance (MR) imaging. Cationic poly(urethane amide)s (denoted as CPUAs) having multiple disulfide bonds, urethane and amide linkages were synthesized by stepwise polycondensation reaction between 1,4-bis(3-aminopropyl)piperazine and a mixture of di(4-nitrophenyl)-2, 2'-dithiodiethanocarbonate (DTDE-PNC) and diethylenetriaminepentaacetic acid (DTPA) dianhydride at varied molar ratios. Then, Gd-chelated CPUAs (denoted as GdCPUAs) were produced by chelating Gd(III) ions with DTPA residues of CPUAs. These GdCPUAs could condense gene into nanosized and positively-charged polyplexes in a physiological condition and, however, liberated gene in an intracellular reductive environment. In vitro transfection experiments revealed that the GdCPUA at a DTDE-PNC/DTPA residue molar ratio of 85/15 induced the highest transfection efficiency in different cancer cells. This efficiency was higher than that yielded with 25kDa branched polyethylenimine as a positive control. GdCPUAs and their polyplexes exhibited low cytotoxicity when an optimal transfection activity was detected. Moreover, GdCPUAs may serve as contrast agents for T1-weighted magnetic resonance imaging. The results of this work indicate that biodegradable Gd-chelated cationic poly(urethane amide) copolymers have high potential for tumor theranostics. PMID:27157741

  3. Amide as an efficient ligand in the palladium-catalyzed Suzuki coupling reaction in water/ethanol under aerobic conditions

    Institute of Scientific and Technical Information of China (English)

    Hai Yang Liu; Kun Wang; Hai Yan Fu; Mao Lin Yuan; Hua Chen; Rui Xiang Li

    2011-01-01

    Amide, which is derived from proline and is inexpensive and air-stable, has been synthesized and characterized by 1H NMR,13C NMR, and MS. It was found to be an efficient ligand in the palladium-catalyzed Suzuki cross-coupling reaction. In the Pd/amide catalytic system, aryl bromides can be coupled with phenylboronic acid in ethanol/water (1:2;v/v) in excellent yields even with a low Pd loading of 0.01 mol%. Moreover, the scope of the reaction is broad, and a wide variety of functional groups are tolerant.

  4. Cis–Trans Amide Bond Rotamers in β-Peptoids and Peptoids: Evaluation of Stereoelectronic

    DEFF Research Database (Denmark)

    Laursen, Jonas Striegler; Engel-Andreasen, Jens; Fristrup, Peter; Harris, Pernille; Olsen, Christian Adam

    2013-01-01

    folding propensity. Thus, we here report an investigation of the effect of structural variations on the cis–trans amide bond rotamer equilibria in a selection of monomer model systems. In addition to various side chain effects, which correlated well with previous studies of α-peptoids, we present the...... synthesis and investigation of cis–trans isomerism in the first examples of peptoids and β-peptoids containing thioamide bonds as well as trifluoroacetylated peptoids and β-peptoids. These systems revealed an increase in the preference for cis-amides as compared to their parent compounds, and thus provide...

  5. Green and selective synthesis of N-substituted amides using water soluble porphyrazinato copper(II) catalyst

    Energy Technology Data Exchange (ETDEWEB)

    Ghodsinia, Sara S.E.; Akhlaghinia, Batool; Eshghi, Hossein, E-mail: akhlaghinia@um.ac.ir [Ferdowsi University of Mashhad (Iran, Islamic Republic of). Faculty of Sciences. Department of Chemistry; Safaei, Elham [Institute for Advanced Studies in Basic Sciences (IASBS), Zanjan (Iran, Islamic Republic of). Department of Chemistry

    2013-06-15

    N, N',N{sup ,} N{sup '}-Tetramethyl tetra-2,3-pyridinoporphyrazinato copper(II) methyl sulfate ([Cu(2,3-tmtppa)](MeSO{sub 4}){sub 4}) efficiently catalyzed the direct conversion of nitriles to N-substituted amides. The one pot selective synthesis of the N-substituted amides from nitriles and primary amines was performed in refluxing H{sub 2}O. The catalyst was recovered and reused at least four times, maintaining its efficiency. (author)

  6. Regiospecific tritium labeling of aromatic acids, amides, amines and heterocyclics using homogeneous rhodium trichloride and ruthenium acetylacetonate catalysts

    International Nuclear Information System (INIS)

    Homogeneous rhodium trichloride has been found to promote ortho-tritiation with high regioselectivity in a wide range of aromatic carboxylic acids, amides and aralkylamines. Less successful results were obtained using o-chlorobenzoic and o-anisic acids where some decomposition was seen, and in acids and amides of the phenolic type, where a degree of electrophilic exchange accompanies the ortho-exchange. The same catalyst has also been used to regiospecifically label a number of heterocyclics. In the course of investigations with other metal complexes ruthenium acetylacetonate has been identified as an excellent promoter of ortho-exchange in benzoic acids. (author)

  7. Tissue and plasma concentrations of amidated and glycine-extended glucagon-like peptide I in humans

    DEFF Research Database (Denmark)

    Orskov, C; Rabenhøj, L; Wettergren, A; Kofod, Hans; Holst, J J

    1994-01-01

    Using specific radioimmunoassays, we studied the occurrence of amidated and glycine-extended glucagon-like peptide I (GLP-I) molecules in the human small intestine and pancreas and in the circulation system in response to a breakfast meal. Through gel permeation chromatography of extracts of the...... plasma were 7 +/- 1 and 6 +/- 1 pM, respectively (n = 6). In response to a breakfast meal, the concentration of amidated GLP-I rose significantly amounting to 41 +/- 5 pM 90 min after the meal ingestion, whereas the concentration of glycine-extended GLP-I only rose slightly to a maximum of 10 +/- 1 p...

  8. Calculations of Molecular Structures and Processes Important for Hydrogen Behaviour in the Li-Amide/Imide System

    OpenAIRE

    Ivanovic, N.; Radisavljevic, I.; Novakovic, N.; Manasijevic, M.; Colognesi, D.

    2011-01-01

    Lithium amide (LiNH2) and imide (Li2NH) have recently attracted much attention as part of the Li-H-N system suitable for hydrogen (H) storage applications. However, the ground-state imide structure is still unknown with at least six candidate structures, with ground state energies all very close to one another. In order to discover possible pathways for the imide-amide-imide transformations during the hydrogen absorption/desorption cycles, we have examined the molecular structures involved (a...

  9. Designing of molecular architecture, synthesis and properties of the next generation of state-of-the-art high-performance thermoplastic fluoro-poly(ether amide)s, (6F-PEA), fluoro-poly(ether amide-imide)s (6F-PEAI), and their co-polymers

    International Nuclear Information System (INIS)

    Graphical abstract: Molecular architectures of next generation of high-performance advanced heat stable thermoplastic polymer compositions of fluoro-poly(ether amide) (6F-PA) and fluoro-poly(ether amide-imide) (6F-PEAI) having di-ether diamines moieties were designed based on fluoro-polyimide (6F-PI) chemistry, and polymers were synthesized using two novel state-of-the-art 2-(3,4'-carboxy anhydrophenyl-2(4-carboxyphenyl) hexafluoropropane (6FTMA) and 2,2'-bis(4-carboxyphenyl) hexafluropropane (6F-DAc) monomers. Their copolymers: fluoro-copoly(ether amide-(ether imide))s (6F-co(PEA-PEI)), fluoro-copoly(ether amide-(ether amide-imide))s (6F-co(PEA-PEAI)) and fluoro-copoly(ether amide-imide-(ether imide))s (6F-co(PEAI-PEI)) were also designed and synthesized using 2,2'-bis(3,4-dicarboxyphenyl) hexafluoropropane dianhydrides (6FDA) for the advanced aerospace, defense and industrial engineering applications. -- Abstract: A new generation of high-performance polymers for the advanced industrial, aerospace and defense engineering applications are being investigated in the academic and industrial research institutions throughout the world. Fluoro-polyimides (6F-PI) are one such sub-class of high-performance polyimide polymers. In the last 25 years a number of fluoro-polyimides have been reported but only a handful of them have been commercialized. This paper describes the 6F-polyimide chemistry-based designed molecular architectures and synthesis of two series of next generation of heat stable thermoplastic polymer compositions having di-ether diamines moieties, such as fluoro-poly(ether amide) (6F-PA) and fluoro-poly(ether amide-imide) (6F-PEAI) using the novel state-of-the-art 2-(3,4'-carboxy anhydrophenyl-2(4-carboxyphenyl) hexafluoropropane (6F-TMA) and 2,2'-bis(4-carboxyphenyl) hexafluoropropane (6F-DAc) monomers. Their co-polymers: fluoro-copoly(ether amide-(ether imide))s (6F-co(PEA-PEI)), fluoro-copoly(ether amide-(ether amide-imide))s (6F-co(PEA-PEAI)) and fluoro

  10. Formation of carboxy- and amide-terminated alkyl monolayers on silicon(111) investigated by ATR-FTIR, XPS, and X-ray scattering: Construction of photoswitchable surfaces

    DEFF Research Database (Denmark)

    Rück-Braun, Karola; Petersen, Michael Åxman; Michalik, Fabian;

    2013-01-01

    -FTIR and XPS studies of the fulgimide samples revealed closely covered amide-terminated SAMs. Reversible photoswitching of the headgroup was read out by applying XPS, ATR-FTIR, and difference absorption spectra in the mid-IR. In XPS, we observed a reversible breathing of the amide/imide C1s and N1s signals...

  11. Influence of alkali and alkaline earth ions on the -alkylation of the lower rim phenolic-OH groups of -tert-butyl-calix[4]arene to result in amide-pendants: Template action of K+ and the structure of K+ bound tetra-amide derivative crystallized with a -tert-butylcalix[4]arene anion

    Indian Academy of Sciences (India)

    Amjad Ali; Chebrolu P Rao; Philippe Guionneau

    2008-03-01

    Role of alkali and alkaline earth ions on the formation of calix[4]arene-amide derivatives through -alkylation of the lower rim phenolic-OH groups in general and template action of K+ in particular have been explored. Na+ and K+ ions among alkali, and Ca2+ and Sr2+ ions among alkaline earth have shown tetra-amide derivatives bound to metal ion species. Among all these, potassium salts act as template and yields a K+ bound tetra-amide derivative where the charge is counter balanced by a calix[4] arene-monoanion and the product is crystallographically characterized. Change in the amide precursor used in these -alkylation reactions has no effect on the type of the amide derivative formed. Also demonstrated is a direct one-step reaction for the preparation of 1,3-di-amide derivative in high yield and low reaction period using CsHCO3.

  12. Synthetic polyspermine imidazole-4, 5-amide as an efficient and cytotoxicity-free gene delivery system

    Directory of Open Access Journals (Sweden)

    Duan S

    2012-07-01

    Full Text Available Shi-Yue Duan, Xue-Mei Ge, Nan Lu, Fei Wu, Weien Yuan, Tuo JinSchool of Pharmacy, Shanghai Jiao Tong University, Shanghai, 200240, People's Republic of ChinaAbstract: A chemically dynamic spermine-based polymer: polyspermine imidazole-4, 5-amide (PSIA, Mw > 7 kDa was designed, synthesized, and evaluated in terms of its ability to deliver nucleic acids. This polymer was made from an endogenous monomer professionally condensing genes in sperms, spermine, and a known safety drug metabolite, imidazole-4, 5-dicarboxylic acid, through a bis-amide bond conjugated with the imidazole ring. This polymer can condense pDNA at a W/W ratio above 10 to form polyplexes (100–200 nm in diameter, which is consistent with the observation by transmission electron microscopy (TEM, and the zeta potential was in the range of 10–20 mV. The pDNA packaged polymer was stable in phosphate buffer solution (PBS at pH 7.4 (simulated body fluid while the polyplexes were releasing pDNA into the solution at pH 5.8 (simulated endo-lysosomes due to the degradation of the bis-amide linkages in response to changes in pH values. PSIA-polyplexes were able to achieve efficient cellular uptake and luciferase gene silencing by co-transfection of pDNA and siRNA in COS-7 cells and HepG2 cells with negligible cytotoxicity. Biodistribution of Rhodamine B-labeled PSIA-polyplexes after being systemically injected in BALB/c nude-mice showed that the polyplexes circulated throughout the body, accumulated mainly in the kidney at 4 hours of sample administration, and moved to the liver and spleen after 24 hours. All the results suggested that PSIA offered a promising example to balance the transfection efficiency and toxicity of a synthetic carrier system for the delivery of therapeutic nucleic acids.Keywords: gene delivery, polyspermine, cytotoxicity, transfection efficiency, biodistribution

  13. Using non-invasive molecular spectroscopic techniques to detect unique aspects of protein Amide functional groups and chemical properties of modeled forage from different sourced-origins

    Science.gov (United States)

    Ji, Cuiying; Zhang, Xuewei; Yu, Peiqiang

    2016-03-01

    The non-invasive molecular spectroscopic technique-FT/IR is capable to detect the molecular structure spectral features that are associated with biological, nutritional and biodegradation functions. However, to date, few researches have been conducted to use these non-invasive molecular spectroscopic techniques to study forage internal protein structures associated with biodegradation and biological functions. The objectives of this study were to detect unique aspects and association of protein Amide functional groups in terms of protein Amide I and II spectral profiles and chemical properties in the alfalfa forage (Medicago sativa L.) from different sourced-origins. In this study, alfalfa hay with two different origins was used as modeled forage for molecular structure and chemical property study. In each forage origin, five to seven sources were analyzed. The molecular spectral profiles were determined using FT/IR non-invasive molecular spectroscopy. The parameters of protein spectral profiles included functional groups of Amide I, Amide II and Amide I to II ratio. The results show that the modeled forage Amide I and Amide II were centered at 1653 cm- 1 and 1545 cm- 1, respectively. The Amide I spectral height and area intensities were from 0.02 to 0.03 and 2.67 to 3.36 AI, respectively. The Amide II spectral height and area intensities were from 0.01 to 0.02 and 0.71 to 0.93 AI, respectively. The Amide I to II spectral peak height and area ratios were from 1.86 to 1.88 and 3.68 to 3.79, respectively. Our results show that the non-invasive molecular spectroscopic techniques are capable to detect forage internal protein structure features which are associated with forage chemical properties.

  14. Investigation of Uranyl Nitrate Ion Pairs Complexed with Amide Ligands using Electrospray Ionization Ion Trap Mass Spectrometry and Density Functional Theory

    International Nuclear Information System (INIS)

    Ion populations formed from electrospray of uranyl nitrate solutions containing different amides vary depending on ligand nucleophilicity and steric crowding at the metal center. The most abundant species were ion pair complexes having the general formula (UO2(NO3)(amide)n=2,3)+, and complexes containing the amide conjugate base, reduced uranyl UO2+, and a 2+ charge were also formed. The formamide experiment produced the greatest diversity of species that stems from weaker amide binding leading to dissociation and subsequent solvent coordination or metal reduction. Experiments using methyl formamide, dimethyl formamide, acetamide, and methyl acetamide produced ion pair and doubly charged complexes that were more abundant, and less abundant complexes containing solvent or reduced uranyl. This pattern is reversed in the dimethylacetamide experiment, which displayed reduced doubly charged complexes and augmented reduced uranyl complexes. DFT investigations of the tris-amide ion pair complexes showed that inter-ligand repulsion distorts the amide ligands out of the uranyl equatorial plane, and that complex stabilities do not increase with increasing amide nucleophilicity. Elimination of an amide ligand largely relieves the interligand repulsion, and the remaining amide ligands become closely aligned with the equatorial plane in the structures of the bis-amide ligands. The studies show that the phenomenological distribution of coordination complexes in a metal-ligand electrospray experiment is a function of both ligand nucleophilicity and interligand repulsion, and that the latter factor begins exerting influence even in the case of relatively small ligands like the substituted methyl-formamide and methyl-acetamide ligands.

  15. Investigation of Uranyl Nitrate Ion Pairs Complexed with Amide Ligands using Electrospray Ionization Ion Trap Mass Spectrometry and Density Functional Theory

    Energy Technology Data Exchange (ETDEWEB)

    Gary S. Groenewold; Adriana Dinescu; Michael T. Benson; Garold L. Gresham; Michael J. van Stipdonk

    2011-04-01

    Ion populations formed from electrospray of uranyl nitrate solutions containing different amides vary depending on ligand nucleophilicity and steric crowding at the metal center. The most abundant species were ion pair complexes having the general formula [UO2(NO3)(amide)n=2,3]+, and complexes containing the amide conjugate base, reduced uranyl UO2+, and a 2+ charge were also formed. The formamide experiment produced the greatest diversity of species that stems from weaker amide binding leading to dissociation and subsequent solvent coordination or metal reduction. Experiments using methyl formamide, dimethyl formamide, acetamide, and methyl acetamide produced ion pair and doubly charged complexes that were more abundant, and less abundant complexes containing solvent or reduced uranyl. This pattern is reversed in the dimethylacetamide experiment, which displayed reduced doubly charged complexes and augmented reduced uranyl complexes. DFT investigations of the tris-amide ion pair complexes showed that inter-ligand repulsion distorts the amide ligands out of the uranyl equatorial plane, and that complex stabilities do not increase with increasing amide nucleophilicity. Elimination of an amide ligand largely relieves the interligand repulsion, and the remaining amide ligands become closely aligned with the equatorial plane in the structures of the bis-amide ligands. The studies show that the phenomenological distribution of coordination complexes in a metal-ligand electrospray experiment is a function of both ligand nucleophilicity and interligand repulsion, and that the latter factor begins exerting influence even in the case of relatively small ligands like the substituted methyl-formamide and –acetamide ligands.

  16. Large-Scale Solvent-Free Chlorination of Hydroxy-Pyrimidines, -Pyridines, -Pyrazines and -Amides Using Equimolar POCl3

    Directory of Open Access Journals (Sweden)

    Zhihua Sun

    2012-04-01

    Full Text Available Chlorination with equimolar POCl3 can be efficiently achieved not only for hydroxypyrimidines, but also for many other substrates such as 2-hydroxy-pyridines, -quinoxalines, or even -amides. The procedure is solvent-free and involves heating in a sealed reactor at high temperatures using one equivalent of pyridine as base. It is suitable for large scale (multigram batch preparations.

  17. Potentiation of glucose-induced insulin release in islets by desHis1[Glu9]glucagon amide

    DEFF Research Database (Denmark)

    Kofod, Hans; Unson, C G; Merrifield, R B

    1988-01-01

    Glucagon and secretin and some of their hybrid analogs potentiate glucose-induced release of insulin from isolated mouse pancreatic islets. It was recently shown that the synthetic glucagon analog, desHis1[Glu9]glucagon amide, does not stimulate the formation of cyclic adenosine monophosphate in ...

  18. Copper-Catalyzed N-Arylation of Amides Using (S-N-Methylpyrrolidine-2-carboxylate as the Ligand

    Directory of Open Access Journals (Sweden)

    Dong-Sheng Ma

    2010-03-01

    Full Text Available (S-N-methylpyrrolidine-2-carboxylate, a derivative of natural L-proline, was found to be an efficient ligand for the copper-catalyzed Goldberg-type N-arylation of amides with aryl halides under mild conditions. A variety of N-arylamides were synthesized in good to high yields.

  19. Nafion®-catalyzed microwave-assisted Ritter reaction: An atom-economic solvent-free synthesis of amides

    Science.gov (United States)

    An atom-economic solvent-free synthesis of amides by the Ritter reaction of alcohols and nitriles under microwave irradiation is reported. This green protocol is catalyzed by solid supported Nafion®NR50 with improved efficiency and reduced waste production.

  20. Effects of thionation and fluorination on cis-trans isomerization in tertiary amides: An investigation of N -alkylglycine (Peptoid) rotamers

    DEFF Research Database (Denmark)

    Engel-Andreasen, Jens; Wich, Kathrine; Laursen, Jonas S.;

    2015-01-01

    we present an investigation of the effects of thioamides and/or fluorides in peptoid monomer model systems using chemical synthesis, NMR spectroscopy, and X-ray crystallography. We find that the steric environment surrounding the tertiary amide bonds is the key promoter of conformational preference...

  1. Sol–gel immobilization of Alcalase from Bacillus licheniformis for application in the synthesis of C-terminal peptide amides

    NARCIS (Netherlands)

    Corici, L.N.; Frissen, A.E.; Zoelen, van D.J.; Eggen, I.F.; Peter, F.; Davidescu, C.M.; Boeriu, C.G.

    2011-01-01

    Alcalase 2.4L FG, a commercial preparation of Subtilisin A, was physically entrapped in glass sol–gel matrices using alkoxysilanes of different types mixed with tetramethoxysilane (TMOS). The materials were used for catalyzing C-terminal amidation of Z-Ala-Phe-OMe in a mixture of tert-butanol/DMF. F

  2. CUTICULAR LIPIDS OF THE STORED FOOD PEST, LIPOSCELIS BOSTRYCHOPHILA BADONNEL (PSOCOPTERA: LIPOSCELIDIDAE): HYDROCARBONS, ALDEHYDES, FATTY ACIDS AND FATTY ACID AMIDES

    Science.gov (United States)

    The booklouse, Liposcelis bostrychophila, has increasingly become a common pest of stored food products worldwide. We report here the cuticular hydrocarbon composition of this pest (the first report of the hydrocarbons of any member of the Order Psocoptera) and the first report of fatty acid amides...

  3. N-Arylation of amines, amides, imides and sulfonamides with arylboroxines catalyzed by simple copper salt/EtOH system

    OpenAIRE

    Zheng, Zhang-Guo; Wen, Jun; Wang, Na; Wu, Bo; Yu, Xiao-Qi

    2008-01-01

    The coupling of arylboroxines with a variety of amines, amides, imides and sulfonamides catalyzed by a copper salt/EtOH system has been developed. In the absence of a base or additive the corresponding N-arylation products were obtained in moderate to excellent yields.

  4. Coordination between yttrium ions and amide groups of polyamide 6 and the crystalline behavior of polyamide 6/yttrium composites

    Science.gov (United States)

    Liu, Shaoxuan; Zhang, Chengfeng; Liu, Yuhai; Zhao, Ying; Xu, Yizhuang; Ozaki, Yukihiro; Wu, Jinguang

    2012-08-01

    Different amounts of yttrium ions were introduced into polyamide 6 (PA6) matrix by solution casting process. Structure, morphology and properties of the obtained PA6/Y3+ composite films were investigated by using FT-IR spectroscopy, Raman spectroscopy, scanning electron microscope (SEM), polarized optical microscope (POM) and differential scanning calorimeter (DSC) methods. Yttrium ions show strong coordination ability and their complexation with amide groups of PA6 can be reflected by the appearance of new bands in the amide A and amide I regions in FT-IR and Raman spectra. Furthermore, the FT-IR and Raman spectra of the PA6/Y3+ composite show that the resultant chain conformations of the amide groups in the composite films are twisted from the ideal trans conformation. The DSC results reveal that Y3+ ions cause a significant reduction of the melting point of PA6. In addition, the existence of Y3+ prevents the crystallization of molten PA6/Y3+ composite films during the cooling process. Moreover, the PA6/Y3+ composite can convert into γ phase PA6 or α phase PA6 when different solvents are used to remove Y3+ ions and induce crystallization of PA6.

  5. Base-mediated decomposition of amide-substituted furfuryl tosylhydrazones: synthesis and cytotoxic activities of enynyl-ketoamides.

    Science.gov (United States)

    Ji, Fanghua; Peng, Hui; Zhang, Xiaoting; Lu, Wenhua; Liu, Shubin; Jiang, Huanfeng; Liu, Bo; Yin, Biaolin

    2015-02-20

    Base-mediated decomposition of amide-substituted furfuryl tosylhydrazones afforded practical access to novel multifunctionalized enynyl-ketoamides. In addition, furfuryl tosylhydrazones with stable furan rings underwent an interesting tosyl-group migration to form sulfones, which have potential synthetic applications. Some of the obtained enynyl-ketoamides demonstrated good cytotoxicities against human tumor cell lines. PMID:25635471

  6. Synthesis and catalytic evaluation in the Heck reaction of deposited palladium catalysts immobilized via amide linkers and their molecular analogues

    Czech Academy of Sciences Publication Activity Database

    Semler, M.; Čejka, Jiří; Štěpnička, P.

    2014-01-01

    Roč. 227, MAY 2014 (2014), s. 207-214. ISSN 0920-5861 R&D Projects: GA ČR GA104/09/0561; GA ČR(CZ) GA13-08944S Institutional support: RVO:61388955 Keywords : deposited catalysts * palladium * amide linkers Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 3.893, year: 2014

  7. Endogenous Auxin Profile in the Christmas Rose (Helleborus niger L.) Flower and Fruit: Free and Amide Conjugated IAA

    Czech Academy of Sciences Publication Activity Database

    Brcko, A.; Pěnčík, Aleš; Magnus, V.; Prebeg, T.; Mlinaric, S.; Antunovic, J.; Lepeduš, H.; Cesar, V.; Strnad, Miroslav; Rolčík, Jakub; Salopek-Sondi, B.

    2012-01-01

    Roč. 31, č. 1 (2012), s. 63-78. ISSN 0721-7595 R&D Projects: GA AV ČR KAN200380801 Keywords : Auxin * Indole-3-acetic acid * Amide conjugates * Christmas rose * Helleborus niger L. * Flower and fruit development * Perianth greening * Peduncle elongation * Vascular system Subject RIV: EF - Botanics Impact factor: 1.990, year: 2012

  8. Effect of alkyl substituent on the aggregation behavior of N,N dialkyl amides: small angle neutron scattering studies

    International Nuclear Information System (INIS)

    N,N-dialkylamides have been identified as a promising class of alternative extractants of tri-n-butyl phosphate(TBP) for the spent nuclear fuel reprocessing. Earlier studies have shown that successive alkylation of the Cα atom adjacent to the carbonyl group of dialkyl amides greatly suppresses the extraction of quadrivalent actinides such as Th(IV) and Pu(IV) and fission products as compared to the hexavalent metal ions like U(VI). In this paper, Small-Angle Neutron Scattering (SANS) experiments have been carried out to understand the effect of successive methylation on the Cα atom adjacent to the carbonyl group on the aggregation behavior of four amides, viz. di(2-ethylhexyl) derivative of acetamide (D2EHAA), propionamide (D2EHPRA), isobutyramide (D2EHIBA), pivalamide (D2EHPVA). 1.1 M solutions of these amides were prepared in deuterated dodecane and the following four sets of samples were used: (a) amide solutions as such, (b) equilibrated with 3 M HNO3, (c) equilibrated with 8.4 mM U(VI) at 3 M HNO3, and (d) equilibrated with 8.6 mM U(VI) at 3 M HNO3. These measurements were carried out at SANS facility, Dhruva reactor, BARC, Trombay. The details of SANS data treatment are mentioned elsewhere. Baxter sticky model was employed to analyze the changes in scattering intensities of samples considering the interaction between the micelles

  9. Fatty Acid Amide Hydrolase (FAAH) Inhibition Enhances Memory Acquisition through Activation of PPAR-alpha Nuclear Receptors

    Science.gov (United States)

    Mazzola, Carmen; Medalie, Julie; Scherma, Maria; Panlilio, Leigh V.; Solinas, Marcello; Tanda, Gianluigi; Drago, Filippo; Cadet, Jean Lud; Goldberg, Steven R.; Yasar, Sevil

    2009-01-01

    Inhibitors of fatty acid amide hydrolase (FAAH) increase endogenous levels of anandamide (a cannabinoid CB[subscript 1]-receptor ligand) and oleoylethanolamide and palmitoylethanolamide (OEA and PEA, ligands for alpha-type peroxisome proliferator-activated nuclear receptors, PPAR-alpha) when and where they are naturally released in the brain.…

  10. A Solvent-free Approach to Glycosyl Amides: Towards the Synthesis of α-N-Galactosyl Ceramides

    Science.gov (United States)

    Chennamadhavuni, Divya; Howell, Amy R.

    2015-01-01

    A new, simple and efficient method for the synthesis of both α- and β-glycosyl amides using solvent-free conditions is described. This method involves the coupling of glycosyl amines with the p-nitrophenol esters of lipids as a key step. PMID:26028787

  11. Hydrogen bonding to carbonyl oxygen of nitrogen-pyramidalized amide - detection of pyramidalization direction preference by vibrational circular dichroism spectroscopy.

    Science.gov (United States)

    Wang, Siyuan; Taniguchi, Tohru; Monde, Kenji; Kawahata, Masatoshi; Yamaguchi, Kentaro; Otani, Yuko; Ohwada, Tomohiko

    2016-03-01

    Nitrogen-pyramidalization of amide increases electron density on nitrogen and decreases that on carbonyl oxygen. We identified hydrogen-bonding to carbonyl of nitrogen-pyramidalized bicyclic β-proline derivatives by crystallography, and by NMR and vibrational circular dichroism (VCD) spectroscopy in solution. Such hydrogen-bonding can switch the preferred nitrogen-pyramidalization direction, as detected by VCD spectroscopy. PMID:26889607

  12. Effect of pectin and amidated pectin on cholesterol homeostasis and cecal metabolism in rats fed a high-cholesterol diet

    Czech Academy of Sciences Publication Activity Database

    Marounek, Milan; Volek, Z.; Synytsya, A.; Čopíková, J.

    2007-01-01

    Roč. 56, - (2007), s. 433-442. ISSN 0862-8408 R&D Projects: GA ČR GA525/03/0358 Institutional research plan: CEZ:AV0Z50450515 Keywords : pectin * amidated pectin s * rat Subject RIV: GH - Livestock Nutrition Impact factor: 1.505, year: 2007

  13. Indirect labeling of monoclonal antibodies employing N2-diethylentriamine-pentaacetil lysine amide as 99mTc chelating agent

    International Nuclear Information System (INIS)

    Labeled monoclonal antibodies and their fragments are been widely employed for the diagnosis and follow up of different kinds of neoplasm. The aim of the present work was to develop a method for indirect labeling of antibodies with 99mTc, using N2-diethylentriamine-pentaacetil lysine amide as chelating agent. By reactions with a 200-fold molar excess of 2-iminothiolane, and the reduction using a 2000-fold molar excess of 2-mercaptoethanol, 3.5 ± 0.6 and 5.8 ± 0.5 sulfhydryl groups, respectively, were generated in the antibody. Thus, work was continued using the second procedure. Reduced h-R3 was incubated for 12 h with N6-cyclohexylmaleimide-N2-diethylentriamine-pentaacetil lysine amide, previously obtained by the reaction of N2-diethylentriamine-pentaacetil lysine amide with sodium sulfosuccinimidyl-4(N-maleimidomethyl)cyclohexane-1-carboxylate. Labeling efficiency of h-R3 monoclonal antibody, modified by this method with 99mTc, was (98.6 ± 1.4) %. A satisfactory stability of the label was observed up to 24 h in presence of a 300-fold molar excess of L-cysteine. Conclusions: Developed procedure allowed satisfactory indirect labeling of the humanized monoclonal antibody h-R3 with 99mTc, using N2-diethylentriamine-pentaacetil lysine amide as bifunctional chelating agent

  14. Use of amides as cryoprotectants in extenders for frozen sperm of tambaqui, Colossoma macropomum.

    Science.gov (United States)

    Varela Junior, A S; Corcini, C D; Gheller, S M M; Jardim, R D; Lucia, T; Streit, D P; Figueiredo, M R C

    2012-07-15

    Amides were tested as cryoprotectants in comparison with glycerol and DMSO (more traditional cryoprotectants) for recovery of Colossoma macropomum (tambaqui fish) sperm. Milt was extended in Beltsville Thawing Solution, then frozen with the addition of 2%, 5%, 8%, or 11% of: (1) dimethylacetamide (DMA), (2) dimethylformamide (DMF), (3) methylformamide (MF), or with 5% glycerol or 10% dimethylsulfoxide. Fertilization rates were greatest (P0.05). For such treatments, both fertilization and hatching rates were similar (P>0.05) to those with fresh sperm (91.7±1.4 and 87.4±1.4, respectively). The best sperm motility across extenders (at least 55.7%) was with 5%, 8%, and 11% DMF (Pmacropomum sperm. PMID:22578629

  15. CO2 permeation through poly(amide-6-b-ethylene oxide)-nanosilica membranes

    Science.gov (United States)

    Lovineh, Shirin Gh.; Asghari, Morteza; Khanbabaei, Ghader

    2014-11-01

    The organic-inorganic hybrids of poly(amide-6-b-ethylene oxide) (PEBA) and silica utilizing aminopropyltriethoxysilane (APTES) as precursor was prepared via sol-gel process and was compared with neat PEBA. The nanodispersed inorganic network produced in the organic matrix was structurally characterized using Fourier transform infrared (FT-IR) that revealed the existence of different chemical groups corresponding to the silica precursors. The single gas permeability was carried out for neat PEBA and PEBA-nano silica (10 wt.% precursor) membranes. CO2 permeability for the neat polymer membrane was higher than the nano-composite membrane and increased with pressure. Adding 10 wt.% of nanosilica filler into the polymeric matrix caused CO2 permeability to decrease.

  16. CO2 Solubilities in Amide-based Brφnsted Acidic Ionic Liquids

    International Nuclear Information System (INIS)

    A distinguished class of hydrophobic ionic liquids bearing a Brφnsted acidic character derived from amide-like compounds were prepared by a neutralization reaction of N,N-diethylformamide, N,N-dibutylformamide, 1-formylpiperidine, and ε-caprolactam with trifluoroacetic acid and physical absorptions of CO2 in these ionic liquids were demonstrated and evaluated. CO2 solubilities in these ionic liquids were influenced by the molecular structure of the cation and were apparently increased with the molar volume. Comparison based on a volume unit reveals that CO2 solubilities in these liquids are relatively higher than those in imidazolium-based ionic liquids. Henry's coefficients calculated from low-pressure solubility tests at 313 to 333 K were used to derive the thermodynamics quantities. Enthalpy and entropy of solvation may share equal contributions in solubility

  17. Synthesis and antifungal activity evaluation of new heterocycle containing amide derivatives.

    Science.gov (United States)

    Wang, Xuesong; Gao, Sumei; Yang, Jian; Gao, Yang; Wang, Ling; Tang, Xiaorong

    2016-01-01

    A series of heterocycle containing amide derivatives (1-28) were synthesised by the combination of acyl chlorides (1a, 2a) and heterocyclic/homocyclic ring containing amines, and their in vitro antifungal activity was evaluated against five plant pathogenic fungi, namely Gibberella zeae, Helminthosporium maydis, Rhizoctonia solani, Botrytis cinerea and Sclerotinia sclerotiorum. Results of antifungal activity analysis indicated that some of the products showed good to excellent antifungal activity, as compound 2 showed excellent activity against G. zeae and R. solani and potent activity against H. maydi, B. cinerea and S. sclerotiorum, and compounds 1, 8 and 10 also displayed excellent antifungal potential against H. maydi, B. cinerea and S. sclerotiorum and good activity against R. solani when compared with the standard carbendazim. PMID:26140452

  18. Novel 3-nitrotriazole-based amides and carbinols as bifunctional antichagasic agents.

    Science.gov (United States)

    Papadopoulou, Maria V; Bloomer, William D; Lepesheva, Galina I; Rosenzweig, Howard S; Kaiser, Marcel; Aguilera-Venegas, Benjamín; Wilkinson, Shane R; Chatelain, Eric; Ioset, Jean-Robert

    2015-02-12

    3-Nitro-1H-1,2,4-triazole-based amides with a linear, rigid core and 3-nitrotriazole-based fluconazole analogues were synthesized as dual functioning antitrypanosomal agents. Such compounds are excellent substrates for type I nitroreductase (NTR) located in the mitochondrion of trypanosomatids and, at the same time, act as inhibitors of the sterol 14α-demethylase (T. cruzi CYP51) enzyme. Because combination treatments against parasites are often superior to monotherapy, we believe that this emerging class of bifunctional compounds may introduce a new generation of antitrypanosomal drugs. In the present work, the synthesis and in vitro and in vivo evaluation of such compounds is discussed. PMID:25580906

  19. Electrostatic interaction of pi-acidic amides with hydrogen-bond acceptors.

    Science.gov (United States)

    Li, Yi; Snyder, Lawrence B; Langley, David R

    2003-10-01

    Interactions between N-methylacetamide (NMA) and N-methylated derivatives of uracil, isocyanurate and barbituric acid have been studied using ab initio methods at the local MP2/6-31G** level of theory. The results were compared to similar interactions between the oxygen atom of NMA and the pi-clouds of perfluorobenzene, quinone and trimethyltriazine. The pi-acidic amides of isocyanurate and barbituric acid were found to interact with a hydrogen bond acceptor primarily through electrostatic attractions. These groups may be used as alternatives of a hydrogen bond donor to complement a hydrogen bond acceptor or an anion in molecular recognition and drug design. Examples of such interactions were identified through a search of the CSD database. PMID:12951105

  20. 2D-QSAR Studies on Triazolone Compounds Containing Benzenesulfonic Amide

    Institute of Scientific and Technical Information of China (English)

    WEI Qing-Li; GAO Jun; SUN Dao-Xing; ZHANG Shu-Sheng

    2007-01-01

    The geometry structures of 6 triazolone compounds containing benzenesulfonic amide were fully optimized with DFT (Density Functional Theory) method at the B3LYP/6-31G level, and the structural and electronic parameters of the compounds were calculated. The hydrophobic and topological parameters of the title compounds were calculated by HyperChem software. The mono- and bi-parametric models between the parameters and biological activity of the compounds were analyzed by Multiple Linear Regression method based on Hansch-Fujita model. The results show that the activities of the title compounds were increased with higher hydrophobic property logP and molecular volume V, lower molecular energy ETOTAL and electronegative of benzene ring Qph.

  1. Electron capture dissociation proceeds with a low degree of intramolecular migration of peptide amide hydrogens

    DEFF Research Database (Denmark)

    Rand, Kasper D; Adams, Christopher M; Zubarev, Roman A;

    2008-01-01

    scrambling) that occurs during vibrational excitation of gas-phase ions. Unlike traditional collisional ion activation, electron capture dissociation (ECD) is not associated with substantial vibrational excitation. We investigated the extent of intramolecular backbone amide hydrogen (1H/2H) migration upon...... electrospray ion source by, e.g., high declustering potentials or during precursor ion selection (via sideband excitation) in the external linear quadrupole ion trap undergo nearly complete hydrogen (1H/2H) scrambling. Similarly, collision-induced dissociation (CID) in the external linear quadrupole ion trap...... closely mimic the known solution deuteration pattern of the selectively labeled peptides. This excellent correlation between the results obtained from gas phase and solution suggests that ECD holds great promise as a general method to obtain single residue resolution in proteins from solution 1H/2H...

  2. MEDV-13 for QSAR Studies on the COX-2 Inhibition by In domethacin Amides and Esters

    Institute of Scientific and Technical Information of China (English)

    LIU,Shu-Shen (刘树深); YIN,Chun-Sheng(印春生); SHI,Yun-Yu(施蕴渝); CAI,Shao-Xi(蔡绍皙); LI,Zhi-Liang(李志良)

    2001-01-01

    A molecular electronegativity distance vector based on 13 atomic types (MEDV-13), is a descriptor for predicting the biological activities of molecules based on the quantitative structure-activity relationship (QSAR). The MEDV-13 with 91 descriptors is employed to describe the structures of a series of selective cydooxygenase-2 (COX-2) inhibitors inchuding 16 indomethacin and its amide and ester derivatives (ImAE). A principal component regression (PCR) is used to derive a QSAR model relating the biological activities expressed by pIC50 values to the MEDV-13. With the number of principal components of 6, the correlation coeffcient (R) and the root mean square error (RMS) are 0.9245 and 0.1682 in modeling stage, and 0.8417 and 0.2389 in leave-one-out prediction step, respectively.

  3. Poly(ester amide-Poly(ethylene oxide Graft Copolymers: Towards Micellar Drug Delivery Vehicles

    Directory of Open Access Journals (Sweden)

    Gregory J. Zilinskas

    2012-01-01

    Full Text Available Micelles formed from amphiphilic copolymers are promising materials for the delivery of drug molecules, potentially leading to enhanced biological properties and efficacy. In this work, new poly(ester amide-poly(ethylene oxide (PEA-PEO graft copolymers were synthesized and their assembly into micelles in aqueous solution was investigated. It was possible to tune the sizes of the micelles by varying the PEO content of the polymers and the method of micelle preparation. Under optimized conditions, it was possible to obtain micelles with diameters less than 100 nm as measured by dynamic light scattering and transmission electron microscopy. These micelles were demonstrated to encapsulate and release a model drug, Nile Red, and were nontoxic to HeLa cells as measured by an MTT assay. Overall, the properties of these micelles suggest that they are promising new materials for drug delivery systems.

  4. Synthesis and Biological Investigation of some Novel Sulfonamide and Amide Derivatives Containing Coumarin Moieties.

    Science.gov (United States)

    Saeedi, Mina; Goli, Fereshteh; Mahdavi, Mohammad; Dehghan, Gholamreza; Faramarzi, Mohammad Ali; Foroumadi, Alireza; Shafiee, Abbas

    2014-01-01

    New sulfonamide and amide derivatives containing coumarin moieties; oxo-2H-chromen-sulfamoylphenylacetamides and oxo-2H-chromen-arylacetamides were synthesized starting from diverse 2-chloroacetamide derivatives and a wide range of coumarins. The structures of compounds were elucidated by IR and NMR spectra and also analytical elemental analysis. In the next step, the above mentioned compounds were screened for their antimicrobial and antioxidant activities. Their antimicrobial activity was assigned using the conventional agar dilution method and the antioxidant activity was assessed using two methods, 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging method and ferric reducing antioxidant power (FRAP) assay. Although the compounds showed no remarkable antimicrobial activities, most of them exhibited good antioxidant activities. Compounds 5b showed the most potent DPPH activity, whereas 8c was the most efficient compound in FRAP assay. PMID:25276188

  5. Isolation, identification and quantification of unsaturated fatty acids, amides, phenolic compounds and glycoalkaloids from potato peel.

    Science.gov (United States)

    Wu, Zhi-Gang; Xu, Hai-Yan; Ma, Qiong; Cao, Ye; Ma, Jian-Nan; Ma, Chao-Mei

    2012-12-15

    Eleven compounds were isolated from potato peels and identified. Their structures were determined by interpretation of UV, MS, 1D, and 2D NMR spectral data and by comparison with reported data. The main components of the potato peels were found to be chlorogenic acid and other phenolic compounds, accompanied by 2 glycoalkaloids, 3 low-molecular-weight amide compounds, and 2 unsaturated fatty acids, including an omega-3 fatty acid. The potato peels showed more potent radical scavenging activity than the flesh. The quantification of the 11 components indicated that the potato peels contained a higher amount of phenolic compounds than the flesh. These results suggest that peel waste from the industry of potato chips and fries may be a source of useful compounds for human health. PMID:22980823

  6. Mechanism of Oxidative Amidation of Nitroalkanes with Oxygen and Amine Nucleophiles by Using Electrophilic Iodine.

    Science.gov (United States)

    Li, Jing; Lear, Martin J; Kwon, Eunsang; Hayashi, Yujiro

    2016-04-11

    Recently, we developed a direct method to oxidatively convert primary nitroalkanes into amides that entailed mixing an iodonium source with an amine, base, and oxygen. Herein, we systematically investigated the mechanism and likely intermediates of such methods. We conclude that an amine-iodonium complex first forms through N-halogen bonding. This complex reacts with aci-nitronates to give both α-iodo- and α,α-diiodonitroalkanes, which can act as alternative sources of electrophilic iodine and also generate an extra equimolar amount of I(+) under O2. In particular, evidence supports α,α-diiodonitroalkane intermediates reacting with molecular oxygen to form a peroxy adduct; alternatively, these tetrahedral intermediates rearrange anaerobically to form a cleavable nitrite ester. In either case, activated esters are proposed to form that eventually reacts with nucleophilic amines in a traditional fashion. PMID:26938791

  7. Bipolamides A and B, triene amides isolated from the endophytic fungus Bipolaris sp. MU34.

    Science.gov (United States)

    Siriwach, Ratklao; Kinoshita, Hiroshi; Kitani, Shigeru; Igarashi, Yasuhiro; Pansuksan, Kanokthip; Panbangred, Watanalai; Nihira, Takuya

    2014-02-01

    As a result of the continued screening for new metabolites produced by endophytic fungi from Thai medicinal plants, two new triene fatty acid amides, bipolamides A (1) and B (2), were discovered from the endophytic fungus Bipolaris sp. MU34. The structures of all of the isolated compounds were elucidated on the basis of the spectroscopic data of NMR and MS. An antimicrobial assay revealed that bipolamide B (2) had moderate antifungal activity against Cladosporium cladosporioides FERMS-9, Cladosporium cucumerinum NBRC 6370, Saccharomyces cerevisiae ATCC 9804, Aspergillus niger ATCC 6275 and Rhisopus oryzae ATCC 10404, with Minimum inhibitory concentration (MIC) values of 16, 32, 32, 64 and 64 μg ml(-1), respectively. PMID:24192556

  8. Complexes of rare-earth perchlorates with ditbutyl amides of di, tri and tetraglycolic acids

    OpenAIRE

    Premlatha, C; Soundararajan, S

    1981-01-01

    New complexes of lanthanide perchlorates with di-t-butyl amides of di, tri and tetraglycolic acids have been synthesised. The complexes have the general formula Ln(DiGA)3(ClO4)3; Ln(TriGA)2 (ClO4)3 and Ln(TetGA)2 (C1O4)3, where Ln = La-Yb and Y and DiGA = N,N′, di-t-butyl diglycolamide, TriGA N,N′, di-t-butyl triglycolamide and TetGA = N,N′ di-t-butyl tetraglycolamide, respectively. The complexes have been characterized by analysis, electrolytic conductance, infrared,1H and13C nuclear magneti...

  9. In vivo regulation of NADP-specific glutamate dehydrogenase by L-amides in Stemphylium botryosum

    International Nuclear Information System (INIS)

    The activity of NADP-specific glutamate dehydrogenase (NADP-GDH; EC 1.4.1.4) increased at a linear rate of 2.1 x 103 units h-1(g fresh wt)-1 following the transfer of Stemphylium botryosum mycelium growth in L-asparagine medium to nitrate medium. The maximum enzyme activity was reached after 5 h. De nova synthesis was demonstrated by density labelling of the enzyme with deuterium and inhibition of NADP-GDH synthesis by cycloheximide, p-fluorophenylalanine or 6-methylpurine. L-Asparagine or L-glutamine could serve as a corepressor of NADP-GDH synthesis whereas the D-isomers were ineffective. Of the various amide derivatives tested, only L-asparagine tert-butyl ester could mimic the effect of L-asparagine. Enzyme repression was not correlated with the internal pool of L-amides. After NADP-GDH had been induced to the maximum level, the addition of L-asparagine and cycloheximide resulted in a decrease of activity with half-lives of 4.5 h and 8 h respectively. The mean half-life, as measured by following the decay in specific radioactivity of the enzyme in nitrate medium after administration of 35SO42-, was 7 h. Mycelium starved of carbon and nitrogen sources showed a slow decrease (half-life of 17 h) in NADP-GDH activity. Depletion of energy by carbon starvation or the presence of sodium azide did not prevent the decrease in enzyme activity caused by L-asparagine. The decrease in NADP-GDH activity mediated by L-asparagine was inhibited by cycloheximide or α-iodoacetamide. Sodium azide inhibited the decrease in enzyme activity caused by cylcoheximide. (author)

  10. New 2{alpha}-tropane amides as potential PET ligands for the dopamine transporter

    Energy Technology Data Exchange (ETDEWEB)

    Drewes, Birte [Institut fuer Nuklearchemie, Forschungszentrum Juelich GmbH, 52425 Juelich (Germany)]. E-mail: b.drewes@fz-juelich.de; Sihver, Wiebke [Institut fuer Nuklearchemie, Forschungszentrum Juelich GmbH, 52425 Juelich (Germany); Willbold, Sabine [Zentralabteilung fuer chemische Analysen, Forschungszentrum Juelich GmbH, 52425 Juelich (Germany); Olsson, Ray A. [Institut fuer Nuklearchemie, Forschungszentrum Juelich GmbH, 52425 Juelich (Germany); Coenen, Heinz H. [Institut fuer Nuklearchemie, Forschungszentrum Juelich GmbH, 52425 Juelich (Germany)

    2007-07-15

    Positron emission tomography (PET) imaging of dopamine transporter (DAT) density in the brain is a potentially valuable tool for studying the etiopathology of degenerative brain disorders. The present study evaluated five new potential competitive inhibitors of DAT as ligands for PET. The evaluation of the new compounds measured their ability to compete with the binding of the reference ligand 2{beta}-carbomethoxy-3{beta}-(4-[{sup 131}I]iodophenyl)tropane [{sup 131}I]{beta}-CIT to striatal and cortical membranes from rat and pig brain. Four of the new compounds structurally related to cocaine were synthesized in their 2{alpha},3{beta} configuration; the most potent one, 3{beta}-(4-iodo-phenyl)-8-methyl-8-aza-bicyclo[3.2.1]octane-2{alpha}-carboxylic acid (2-fluoro-ethyl)-amide, was synthesized also in the 2{beta},3{beta} configuration. For comparative studies in rat brain and new evaluation in pig brain homogenate, the established compounds {beta}-CIT, FP-CIT, PE2I and FETT were also synthesized and evaluated. Contrary to expectation, the 2{alpha},3{beta} and 2{beta},3{beta} isomers of 3-(4-iodo-phenyl)-8-methyl-8-aza-bicyclo[3.2.1]octane-2-carboxylic acid (2-fluoro-ethyl)-amide showed the same affinity constant for rat striatum (K {sub i}=200 nM{+-}34), but in pig striatum and rat and pig cortex the 2{alpha},3{beta} form even had a higher affinity than the 2{beta},3{beta} form.

  11. Spectroscopic and molecular modeling investigation on the binding of a synthesized steroidal amide to protein

    International Nuclear Information System (INIS)

    Owing to the various valuable biological activities, steroidal amides have become a hot topic in steroidal pharmaceutical chemistry. In this paper, an anti-tumor steroid derivate (DAAO) was synthesized and identified. The interaction between DAAO and human serum albumin (HSA) was studied by fluorescence spectra, circular dichroism (CD) spectra, molecular modeling and molecular probe techniques. The results suggested that DAAO had reacted with HSA through hydrogen bonds and van der Waals power. The formation of DAAO–HSA complex at ground state led to static quenching of HSA's fluorescence. The number of binding sites, binding constants, enthalpy change (ΔHθ), Gibbs free energy change (ΔGθ) and entropy change (ΔSθ) were calculated at different temperatures based on fluorescence quenching theory and classic equation. Molecular modeling investigation indicated that DAAO was more inclined to absorb on Sudlow's site I in subdomain IIA of HSA molecule on grounds of the lowest energy principle and steric hindrance effect. The binding location was further confirmed by fluorescence probe experiment using warfarin (site I probe) for displacement. Furthermore, the conformational changes of HSA in presence of DAAO were investigated by CD spectra. The results could provide new evidence explaining the relationship between the chemical structure and biological activity and may be useful for understanding the anti-cancer mechanism of steroidal drug. - Highlights: • A designed steroidal amide compound (DAAO) was synthesized by introducing amido bonds into a steroid nucleus. • DAAO binds to Sudlow's site I in HSA through hydrogen bonds and van der Waals power. • The interaction was a spontaneous and exothermic process with modest degree of reversibility. • The secondary structure of HSA and the microenvironment of TRP214 altered. • Amido bond in steroid nucleus (–NH–CO–) plays important role in stabling the structure of macromolecules

  12. Spectroscopic and molecular modeling investigation on the binding of a synthesized steroidal amide to protein

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Hua-xin, E-mail: h.x.zhang@yeah.net; Liu, E.

    2014-09-15

    Owing to the various valuable biological activities, steroidal amides have become a hot topic in steroidal pharmaceutical chemistry. In this paper, an anti-tumor steroid derivate (DAAO) was synthesized and identified. The interaction between DAAO and human serum albumin (HSA) was studied by fluorescence spectra, circular dichroism (CD) spectra, molecular modeling and molecular probe techniques. The results suggested that DAAO had reacted with HSA through hydrogen bonds and van der Waals power. The formation of DAAO–HSA complex at ground state led to static quenching of HSA's fluorescence. The number of binding sites, binding constants, enthalpy change (ΔH{sup θ}), Gibbs free energy change (ΔG{sup θ}) and entropy change (ΔS{sup θ}) were calculated at different temperatures based on fluorescence quenching theory and classic equation. Molecular modeling investigation indicated that DAAO was more inclined to absorb on Sudlow's site I in subdomain IIA of HSA molecule on grounds of the lowest energy principle and steric hindrance effect. The binding location was further confirmed by fluorescence probe experiment using warfarin (site I probe) for displacement. Furthermore, the conformational changes of HSA in presence of DAAO were investigated by CD spectra. The results could provide new evidence explaining the relationship between the chemical structure and biological activity and may be useful for understanding the anti-cancer mechanism of steroidal drug. - Highlights: • A designed steroidal amide compound (DAAO) was synthesized by introducing amido bonds into a steroid nucleus. • DAAO binds to Sudlow's site I in HSA through hydrogen bonds and van der Waals power. • The interaction was a spontaneous and exothermic process with modest degree of reversibility. • The secondary structure of HSA and the microenvironment of TRP214 altered. • Amido bond in steroid nucleus (–NH–CO–) plays important role in stabling the structure of

  13. Structures of Plutonium(IV) and Uranium(VI) with N,N-Dialkyl Amides from Crystallography, X-ray Absorption Spectra, and Theoretical Calculations.

    Science.gov (United States)

    Acher, Eléonor; Hacene Cherkaski, Yanis; Dumas, Thomas; Tamain, Christelle; Guillaumont, Dominique; Boubals, Nathalie; Javierre, Guilhem; Hennig, Christoph; Solari, Pier Lorenzo; Charbonnel, Marie-Christine

    2016-06-01

    The structures of plutonium(IV) and uranium(VI) ions with a series of N,N-dialkyl amides ligands with linear and branched alkyl chains were elucidated from single-crystal X-ray diffraction (XRD), extended X-ray absorption fine structure (EXAFS), and theoretical calculations. In the field of nuclear fuel reprocessing, N,N-dialkyl amides are alternative organic ligands to achieve the separation of uranium(VI) and plutonium(IV) from highly concentrated nitric acid solution. EXAFS analysis combined with XRD shows that the coordination structure of U(VI) is identical in the solution and in the solid state and is independent of the alkyl chain: two amide ligands and four bidentate nitrate ions coordinate the uranyl ion. With linear alkyl chain amides, Pu(IV) also adopt identical structures in the solid state and in solution with two amides and four bidentate nitrate ions. With branched alkyl chain amides, the coordination structure of Pu(IV) was more difficult to establish unambiguously from EXAFS. Density functional theory (DFT) calculations were consequently performed on a series of structures with different coordination modes. Structural parameters and Debye-Waller factors derived from the DFT calculations were used to compute EXAFS spectra without using fitting parameters. By using this methodology, it was possible to show that the branched alkyl chain amides form partly outer-sphere complexes with protonated ligands hydrogen bonded to nitrate ions. PMID:27171842

  14. Photophysical studies on the interaction of amides with Bovine Serum Albumin (BSA) in aqueous solution: Fluorescence quenching and protein unfolding

    Energy Technology Data Exchange (ETDEWEB)

    Kumaran, R., E-mail: kumaranwau@rediffmail.com [Department of Chemistry, Dwaraka Doss Goverdhan Doss Vaishnav College, Arumbakkam, Chennai 600106 (India); Ramamurthy, P. [National Centre for Ultrafast Processes, University of Madras, Sekhizar Campus, Taramani, Chennai 600113 (India)

    2014-04-15

    Addition. of amides containing a H-CO(NH{sub 2}) or CH{sub 3}-CO(NH{sub 2}) framework to BSA results in a fluorescence quenching. On the contrary, fluorescence enhancement with a shift in the emission maximum towards the blue region is observed on the addition of dimethylformamide (DMF) (H-CON(CH{sub 3}){sub 2}). Fluorescence quenching accompanied initially with a shift towards the blue region and a subsequent red shift in the emission maximum of BSA is observed on the addition of formamide (H-CO(NH{sub 2})), whereas a shift in the emission maximum only towards the red region results on the addition of acetamide (CH{sub 3}-CONH{sub 2}). Steady state emission spectral studies reveal that amides that possess a free NH{sub 2} and N(CH{sub 3}){sub 2} moiety result in fluorescence quenching and enhancement of BSA respectively. The 3D contour spectral studies of BSA with formamide exhibit a shift in the emission towards the red region accompanied with fluorescence quenching, which indicates that the tryptophan residues of the BSA are exposed to a more polar environment. Circular Dichroism (CD) studies of BSA with amides resulted in a gradual decrease in the α-helical content of BSA at 208 nm, which confirms that there is a conformational change in the native structure of BSA. Time-resolved fluorescence studies illustrate that the extent of buried trytophan moieties exposed to the aqueous phase on the addition of amides follows the order DMFamides. Amides act as a hydrogen-bonding donor and acceptor resulting in a hydrogen-bonding interaction with amino and carboxy moieties (amino acids) present in BSA. The fact that the –NH{sub 2} hydrogen and the carbonyl oxygen of amide form a concerted hydrogen-bonding network with the carbonyl oxygen and the amino moieties of amino acids respectively is established from fluorescence methods. -- Highlights:

  15. Synthesis, Anti-HCV, Antioxidant and Reduction of Intracellular Reactive Oxygen Species Generation of a Chlorogenic Acid Analogue with an Amide Bond Replacing the Ester Bond

    Directory of Open Access Journals (Sweden)

    Ling-Na Wang

    2016-06-01

    Full Text Available Chlorogenic acid is a well known natural product with important bioactivities. It contains an ester bond formed between the COOH of caffeic acid and the 3-OH of quinic acid. We synthesized a chlorogenic acid analogue, 3α-caffeoylquinic acid amide, using caffeic and quinic acids as starting materials. The caffeoylquinc acid amide was found to be much more stable than chlorogenic acid and showed anti-Hepatitis C virus (anti-HCV activity with a potency similar to chlorogenic acid. The caffeoylquinc acid amide potently protected HepG2 cells against oxidative stress induced by tert-butyl hydroperoxide.

  16. Synthesis and Antimicrobial Activities of Amides of Chiral Benzyl Ethers of N-Boc Protected Aminols of L-amino acids with Succinic Acid

    International Nuclear Information System (INIS)

    The research work presented in this article describes a synthesis of chiral amides. Chiral benzyl ethers of N-Boc protected aminols reacted with succinic acid using 2,4,6-trichloro-1,3,5-triazine (TCT) as a coupling agent producing chiral amides in high yields. The synthetic amides were investigated for their antifungal and antibacterial activities against different bacterial and fungal strains. All the compounds showed excellent zone of inhibition against the three tested bacterial strains and good to moderate activity against one fungal strain. (author)

  17. Synthesis of amides and sulfonamides of β-D- galactopyranosylamine and β-lactosylamine and evaluation of their interactions with the lectins from Erythrina cristagalli and Ricinus communis

    International Nuclear Information System (INIS)

    We report herein the synthesis of some β-D-galactopyranosylamine and β-lactosylamine amides and sulfonamides. The interactions of these compounds with lectins from the seeds of Erythrina cristagalli (LEC) and Ricinus communis (RCA120) were evaluated in a hemagglutination inhibitory activity assay. D-Galactose and lactose were used as reference compounds. The β-lactosylamine amides and sulfonamides were nearly as active as lactose in inhibiting LEC mediated hemagglutination and were less active against RCA120 agglutinin. The β-D-galactopyranosylamine amides and sulfonamides were, with one exception, considerably less active than D-galactose in the assay with both lectins. (author)

  18. A pro-nociceptive phenotype unmasked in mice lacking fatty-acid amide hydrolase.

    Science.gov (United States)

    Carey, Lawrence M; Slivicki, Richard A; Leishman, Emma; Cornett, Ben; Mackie, Ken; Bradshaw, Heather; Hohmann, Andrea G

    2016-02-01

    Fatty-acid amide hydrolase (FAAH) is the major enzyme responsible for degradation of anandamide, an endocannabinoid. Pharmacological inhibition or genetic deletion of FAAH (FAAH KO) produces antinociception in preclinical pain models that is largely attributed to anandamide-induced activation of cannabinoid receptors. However, FAAH metabolizes a wide range of structurally related, biologically active lipid signaling molecules whose functions remain largely unknown. Some of these endogenous lipids, including anandamide itself, may exert pro-nociceptive effects under certain conditions. In our study, FAAH KO mice exhibited a characteristic analgesic phenotype in the tail flick test and in both formalin and carrageenan models of inflammatory nociception. Nonetheless, intradermal injection of the transient receptor potential channel V1 (TRPV1) agonist capsaicin increased nocifensive behavior as well as mechanical and heat hypersensitivity in FAAH KO relative to wild-type mice. This pro-nociceptive phenotype was accompanied by increases in capsaicin-evoked Fos-like immunoreactive (FLI) cells in spinal dorsal horn regions implicated in nociceptive processing and was attenuated by CB1 (AM251) and TRPV1 (AMG9810) antagonists. When central sensitization was established, FAAH KO mice displayed elevated levels of anandamide, other fatty-acid amides, and endogenous TRPV1 agonists in both paw skin and lumbar spinal cord relative to wild-type mice. Capsaicin decreased spinal cord 2-AG levels and increased arachidonic acid and prostaglandin E2 levels in both spinal cord and paw skin irrespective of genotype. Our studies identify a previously unrecognized pro-nociceptive phenotype in FAAH KO mice that was unmasked by capsaicin challenge. The heightened nociceptive response was mediated by CB1 and TRPV1 receptors and accompanied by enhanced spinal neuronal activation. Moreover, genetic deletion of FAAH has a profound impact on the peripheral and central lipidome. Thus, genetic

  19. Paracellular permeation-enhancing effect of AT1002 C-terminal amidation in nasal delivery

    Directory of Open Access Journals (Sweden)

    Song KH

    2015-03-01

    Full Text Available Keon-Hyoung Song,1 Sang-Bum Kim,2 Chang-Koo Shim,2 Suk-Jae Chung,2 Dae-Duk Kim,2 Sang-Ki Rhee,1 Guang J Choi,1 Chul-Hyun Kim,3 Kiyoung Kim4 1Department of Pharmaceutical Engineering, Soonchunhyang University, Asan, Republic of Korea; 2College of Pharmacy and Research Institute of Pharmaceutical Sciences, Seoul National University, Seoul, Republic of Korea; 3Department of Sports Medicine, 4Department of Medical Biotechnology, Soonchunhyang University, Asan, Republic of Korea Background: The identification of permeation enhancers has gained interest in the development of drug delivery systems. A six-mer peptide, H-FCIGRL-OH (AT1002, is a tight junction modulator with promising permeation-enhancing activity. AT1002 enhances the transport of molecular weight markers or agents with low bioavailability with no cytotoxicity. However, AT1002 is not stable in neutral pH or after incubation under physiological conditions, which is necessary to fully uncover its permeation-enhancing effect. Thus, we increased the stability or mitigated the instability of AT1002 by modifying its terminal amino acids and evaluated its subsequent biological activity.Methods: C-terminal-amidated (FCIGRL-NH2, Pep1 and N-terminal-acetylated (Ac-FCIGRL, Pep2 peptides were analyzed by liquid chromatography–mass spectrometry. We further assessed cytotoxicity on cell monolayers, as well as the permeation-enhancing activity following nasal administration of the paracellular marker mannitol.Results: Pep1 was nontoxic to cell monolayers and showed a relatively low decrease in peak area compared to AT1002. In addition, administration of mannitol with Pep1 resulted in significant increases in the area under the plasma concentration–time curve and peak plasma concentration at 3.63-fold and 2.68-fold, respectively, compared to mannitol alone. In contrast, no increase in mannitol concentration was shown with mannitol/AT1002 or mannitol/Pep2 compared to the control. Thus, Pep1 increased

  20. cis–trans-Amide isomerism of the 3,4-dehydroproline residue, the ‘unpuckered’ proline

    Science.gov (United States)

    2016-01-01

    Summary Proline (Pro) is an outstanding amino acid in various biochemical and physicochemical perspectives, especially when considering the cis–trans isomerism of the peptidyl-Pro amide bond. Elucidation of the roles of Pro in chemical or biological systems and engineering of its features can be addressed with various Pro analogues. Here we report an experimental work investigating the basic physicochemical properties of two Pro analogues which possess a 3,4-double bond: 3,4-dehydroproline and 4-trifluoromethyl-3,4-dehydroproline. Both indicate a flat pyrroline ring in their crystal structures, in agreement with previous theoretical calculations. In solution, the peptide mimics exhibit an almost unchanged equilibrium of the trans/cis ratios compared to that of Pro and 4-trifluoromethylproline derivatives. Finally we demonstrate that the 3,4-double bond in the investigated structures leads to an increase of the amide rotational barriers, presumably due to an interplay with the transition state.

  1. Influence of chain length and polymer concentration on the gelation of (amidated) low-methoxyl pectin induced by calcium.

    Science.gov (United States)

    Capel, François; Nicolai, Taco; Durand, Dominique; Boulenguer, Patrick; Langendorff, Virginie

    2005-01-01

    The gelation of low-methoxyl pectin (LMP) induced by addition of Ca2+ was studied by measuring the storage modulus as a function of temperature during cooling. Samples with different molar masses were prepared by mechanical degradation. The effect of the molar mass and the pectin concentration on the gelation properties was investigated. The effect of partial amidation was studied by comparing LMP and partially amidated LMP with the same molar mass and degree of methylation. The results are compared to those from a model developed for Ca2+-induced pectin gelation, and good agreement is found except at low concentrations and low molar masses where the gels are weaker than predicted. At low concentrations intrachain bonding weakens the gel, while the presence of small pectin chains weakens the gel because it neutralizes binding sites on larger chains. PMID:16283714

  2. Synthesis and structure-activity relationship of α-keto amides as enterovirus 71 3C protease inhibitors.

    Science.gov (United States)

    Zeng, Debin; Ma, Yuying; Zhang, Rui; Nie, Quandeng; Cui, Zhengjie; Wang, Yaxin; Shang, Luqing; Yin, Zheng

    2016-04-01

    α-Keto amide derivatives as enterovirus 71 (EV71) 3C protease (3C(pro)) inhibitors have been synthesized and assayed for their biochemical and antiviral activities. structure-activity relationship (SAR) study indicated that small moieties were primarily tolerated at P1' and the introduction of para-fluoro benzyl at P2 notably improved the potency of inhibitor. Inhibitors 8v, 8w and 8x exhibited satisfactory activity (IC50=1.32±0.26μM, 1.88±0.35μM and 1.52±0.31μM, respectively) and favorable CC50 values (CC50>100μM). α-Keto amide may represent a good choice as a warhead for EV71 3C(pro) inhibitor. PMID:26916437

  3. Thermal and Optical Properties of New Poly(amide-imide)/Nanocomposite Reinforced by Layer Silicate Containing Diphenyl Ether Moieties

    Science.gov (United States)

    Faghihi, Khalil; Faramarzi, Ellahe; Shabanian, Meisam

    2011-04-01

    New poly(amide-imide)-montmorillonite reinforced nanocomposites containing Bis(4-N-trimellitylimido) diphenyl ether moiety in the main chain were synthesized by a convenient solution intercalation technique. Poly(amide-imide) (PAI) 4 was synthesized by the direct polycondensation reaction of Bis(4-N-trimellitylimido) diphenyl ether 3 with 4,4'-diamino diphenyl ether 2 in the presence of triphenyl phosphite (TPP), CaCl2, pyridine and N-methyl-2-pyrrolidone (NMP). Morphology and structure of the resulting PAI-nanocomposite films 4a and 4b with 10 and 20 mass% silicate particles respectively, were characterized by FT-IR spectroscopy, X-ray diffraction (XRD) and scanning electron microscopy (SEM). The properties of nanocomposites films were investigated by using Uv-vis spectroscopy, thermogravimetric analysis (TGA) and water uptake measurements.

  4. Preparation of new series of poly(amide-imide) reinforced layer silicate nano composite containing N-trimellitimide-L-alanine

    Energy Technology Data Exchange (ETDEWEB)

    Faghihi, K.; Soleimani, M. [Polymer Research Laboratory, Department of Chemistry, Faculty of Science, Islamic Azad University, Arak Branch, Arak (Iran, Islamic Republic of); Shabanian, M., E-mail: k-faghihi@araku.ac.ir [Young Researches Club, Islamic Azad University, Arak Branch, Arak (Iran, Islamic Republic of)

    2011-07-01

    A new poly(amide-imide)-montmorillonite series were generated through solution intercalation technique. Cloisite 20A was used as a modified montmorillonite for ample compatibility with the poly(amide-imide) (PAI) matrix. The PAI 5 chains were synthesized by the direct polycondensation reaction of N-trimellitylimido-L-alanine (3) with 4,4'-diamino diphenyl ether (4) in the presence of tryphenyl phosphites (TPP), CaCl{sub 2}, pyridine and N-methyl-2-pyrrolidone (NMP). Morphology and structure of the resulting PAI-nano composite films 5a-5d with (5-20 Wt%) silicate particles were characterized by Ftir spectroscopy, X-ray diffraction and scanning electron microscopy. The effect of clay dispersion and the interaction between clay and polymeric chains on the properties of nano composites films were investigated by using UV-Vis spectroscopy, thermogravimetric analysis and water uptake measurements. (Author)

  5. Influence of nanoclay particles modification by polyester-amide hyperbranched polymer on the corrosion protective performance of the epoxy nanocomposite

    International Nuclear Information System (INIS)

    Highlights: • Nanoclay particles were modified with polyester-amide hyperbranched polymer. • Epoxy/clay nanocomposites were prepared using modified clay particles. • Surface modification enhanced the clay particles exfoliation properties. • Surface modified clay particles enhanced corrosion resistance of the epoxy coating. - Abstract: Surface modification of nanoclay particles was carried out by various amounts of polyester-amide hyperbranched polymer (HBP). Thermal gravimetric analysis and X-ray diffraction analysis were performed to estimate the efficiency of the HPB grafting on the clay particles. Epoxy/clay nanocomposites were prepared by addition of 1 wt.% unmodified and modified clays. The corrosion protection properties of the nanocomposites were evaluated by electrochemical impedance spectroscopy (EIS). Results revealed that surface modification of the clay particles by HBP caused significant enhancement of the epoxy coating corrosion resistance especially when the ‘polymer/clay’ ratios were 10/1 and 5/1

  6. Assignment of amide proton signals by combined evaluation of HN, NN and HNCA MAS-NMR correlation spectra

    Energy Technology Data Exchange (ETDEWEB)

    Rossum, Barth-Jan van; Castellani, Federica [Forschungsinstitut fuer Molekulare Pharmakologie (FMP) (Germany); Pauli, Jutta [BAM (Germany); Rehbein, Kristina [Forschungsinstitut fuer Molekulare Pharmakologie (FMP) (Germany); Hollander, J.; Groot, Huub J.M. de [BAM (Germany); Oschkinat, Hartmut [Forschungsinstitut fuer Molekulare Pharmakologie (FMP) (Germany)], E-mail: Oschkinat@fmp-berlin.de

    2003-03-15

    In this paper, we present a strategy for the {sup 1}H{sup N} resonance assignment in solid-state magic-angle spinning (MAS) NMR, using the {alpha}-spectrin SH3 domain as an example. A novel 3D triple resonance experiment is presented that yields intraresidue H{sup N}-N-C{sup {alpha}} correlations, which was essential for the proton assignment. For the observable residues, 52 out of the 54 amide proton resonances were assigned from 2D ({sup 1}H-{sup 15}N) and 3D ({sup 1}H-{sup 15}N-{sup 13}C) heteronuclear correlation spectra. It is demonstrated that proton-driven spin diffusion (PDSD) experiments recorded with long mixing times (4 s) are helpful for confirming the assignment of the protein backbone {sup 15}N resonances and as an aid in the amide proton assignment.

  7. The pH sensitivity of −NH exchange in LnDOTA-tetraamide complexes varies with amide substituent

    OpenAIRE

    Opina, Ana Christina L.; Wu, Yunkou; Zhao, Piyu; Kiefer, Garry; Sherry, A. Dean

    2011-01-01

    The amide proton exchange rates in various lanthanide(III) DOTA-tetraamide complexes were investigated by CEST as a function of variable chemical structures and charges on the amide substituents. Comparisons were made between YbDOTA-(gly)4− (Yb-1), YbDOTA-(NHCH2PO3)45− (Yb-2), and YbDOTA-(NHCH2PO3Et2)43+ (Yb-3). The general shapes of the CEST versus pH profiles were similar for the three complexes but they showed maximum CEST intensities at different pH values, pH 8.3, 8.8 and 6.9 for Yb-1, Y...

  8. H-Bonding Self-assembled Template-directed Synthesis of a Reactive Amide-bridged Ladder Polyvinylsiloxane

    Institute of Scientific and Technical Information of China (English)

    You Zhi WAN; Ying Hua LIU; Ping XIE; Rong Ben ZHANG

    2006-01-01

    A novel, reactive amide-bridged ladder polyvinylsiloxane (abbr. LP) with Mn = 2.4×104was synthesized for the first time by means of aryl amide H-bonding self-assembled template.The regularity of LP was characterized by the XRD, 29Si NMR and DSC methods. XRD analysis demonstrated the ladder width w = 9.09 A and the ladder thickness t = 3.89 A, respectively, which are approximately consistent with the molecular simulation-calculated ones: w'= 10.60 A and t'=3.06 A. 29Si NMR displayed a resonance peak with small half peak width, △1/2 ~ 4 ppm, for the moiety [=Si(Vi)O2/2-]n of LP. Besides, as a collateral evidence, DSC measurement revealed a high glass transition temperature Tg = 225℃, suggesting high stiffness of the ladder main chain of LP.

  9. GLP-1 Amidation Efficiency Along the Length of the Intestine in Mice, Rats and Pigs and in GLP-1 Secreting Cell Lines

    DEFF Research Database (Denmark)

    Kuhre, Rune Ehrenreich; Albrechtsen, Nicolai Jacob Wewer; Windeløv, Johanne Agerlin;

    2014-01-01

    XXX: Measurements of plasma concentrations of the incretin hormone GLP-1 are complex because of extensive molecular heterogeneity. This is partly due to a varying and incompletely known degree of C-terminal amidation. Given that virtually all GLP-1 assays rely on a C-terminal antibody, it is...... essential to know whether or not the molecule one wants to measure is amidated. We performed a detailed analysis of extractable GLP-1 from duodenum, proximal jejunum, distal ileum, caecum, proximal colon and distal colon of mice (n=9), rats (n=9) and pigs (n=8) and determined the degree of amidation and...... whether this varied with the six different locations. We also analyzed the amidation in 3 GLP-1 secreting cell lines (GLUTag, NCI-H716 and STC-1). To our surprise there were marked differences between the 3 species with respect to the concentration of GLP-1 in gut. In the mouse, concentrations increased...

  10. Amid- und esterfunktionalisierte Amine sowie deren Verwendung als Ionophore bzw. als Trägermaterialien in der Suzuki-Reaktion

    OpenAIRE

    Nicolai, Anja

    2009-01-01

    Die vorliegende Arbeit befasst sich mit der Synthese und Charakterisierung von amid- und esterfunktionalisierten Aminen. Dabei steht vor allem die Verwendung dieser Verbindungsklasse als Ionophore in der chemischen Sensorik im Vordergrund. Durch geeignete Voruntersuchungen, wie die Bestimmung der Lipophilie und UV/Vis-Spektroskopie, war es möglich, eine Selektion der Vielzahl von synthetisierten Ionophoren durchzuführen. Dennoch war es nur durch systematische Untersuchungen err...

  11. Quantifying the Sigma and Pi interactions between U(V) f orbitals and halide, alkyl, alkoxide, amide and ketimide ligands

    OpenAIRE

    Lukens, Wayne W.

    2014-01-01

    f Orbital bonding in actinide and lanthanide complexes is critical to their behavior in a variety of areas from separations to magnetic properties. Octahedral f1 hexahalide complexes have been extensively used to study f orbital bonding due to their simple electronic structure and extensive spectroscopic characterization. The recent expansion of this family to include alkyl, alkoxide, amide, and ketimide ligands presents the opportunity to extend this study to a wider variety of ligands. To b...

  12. Isolation and Total Synthesis of Stolonines A–C, Unique Taurine Amides from the Australian Marine Tunicate Cnemidocarpa stolonifera

    OpenAIRE

    Tran, Trong D.; Pham, Ngoc B.; Merrick Ekins; Hooper, John N. A.; Quinn, Ronald J.

    2015-01-01

    Cnemidocarpa stolonifera is an underexplored marine tunicate that only occurs on the tropical to subtropical East Coast of Australia, with only two pyridoacridine compounds reported previously. Qualitative analysis of the lead-like enhanced fractions of C. stolonifera by LC-MS dual electrospray ionization coupled with PDA and ELSD detectors led to the identification of three new natural products, stolonines A–C (1–3), belonging to the taurine amide structure class. Structures of the new compo...

  13. Identification of N-acylethanolamines in Dictyostelium discoideum and confirmation of their hydrolysis by fatty acid amide hydrolase[S

    OpenAIRE

    Hayes, Alexander C.; Stupak, Jacek; Li, Jianjun; Cox, Andrew D.

    2013-01-01

    N-acylethanolamines (NAEs) are endogenous lipid-based signaling molecules best known for their role in the endocannabinoid system in mammals, but they are also known to play roles in signaling pathways in plants. The regulation of NAEs in vivo is partly accomplished by the enzyme fatty acid amide hydrolase (FAAH), which hydrolyses NAEs to ethanolamine and their corresponding fatty acid. Inhibition of FAAH has been shown to increase the levels of NAEs in vivo and to produce desirable phenotype...

  14. Amidate Prodrugs of 9-[2-(Phosphonomethoxy)Ethyl]Adenine as Inhibitors of Adenylate Cyclase Toxin from Bordetella pertussis

    Czech Academy of Sciences Publication Activity Database

    Šmídková, Markéta; Dvořáková, Alexandra; Tloušťová, Eva; Česnek, Michal; Janeba, Zlatko; Mertlíková-Kaiserová, Helena

    2014-01-01

    Roč. 58, č. 2 (2014), s. 664-671. ISSN 0066-4804 R&D Projects: GA MV VG20102015046 Grant ostatní: OPPC(XE) CZ.2.16/3.1.00/24016 Institutional support: RVO:61388963 Keywords : Bordetella pertussis * adenylate cyclase toxin * ACT * inhibitors * PMEA * amidate prodrugs Subject RIV: CC - Organic Chemistry Impact factor: 4.476, year: 2014

  15. Pharmacological Classification and Activity Evaluation of Furan and Thiophene Amide Derivatives Applying Semi-Empirical ab initio Molecular Modeling Methods

    OpenAIRE

    Leszek Bober; Tomasz Baczek; Piotr Kawczak

    2012-01-01

    Pharmacological and physicochemical classification of the furan and thiophene amide derivatives by multiple regression analysis and partial least square (PLS) based on semi-empirical ab initio molecular modeling studies and high-performance liquid chromatography (HPLC) retention data is proposed. Structural parameters obtained from the PCM (Polarizable Continuum Model) method and the literature values of biological activity (antiproliferative for the A431 cells) expressed...

  16. 2D IR Spectroscopy of Histidine: Probing Side-Chain Structure and Dynamics via Backbone Amide Vibrations

    OpenAIRE

    Ghosh, Ayanjeet; Tucker, Matthew J.; Gai, Feng

    2014-01-01

    It is well known that histidine is involved in many biological functions due to the structural versatility of its side chain. However, probing the conformational transitions of histidine in proteins, especially those occurring on an ultrafast time scale, is difficult. Herein we show, using a histidine dipeptide as a model, that it is possible to probe the tautomer and protonation status of a histidine residue by measuring the two-dimensional infrared (2D IR) spectrum of its amide I vibrationa...

  17. Review of "Emerging Markets Resilience and Growth Amid Global Turmoil by M. Ayhan Kose and Eswar S. Prasad"

    OpenAIRE

    C. Bora Durdu

    2011-01-01

    Emerging Markets Resilience and Growth amid Global Turmoil provides an excellent contribution to the literature. The book covers a variety of important topics on emerging market economies and offers invaluable information for a wide range of audience; from academics to policy makers as well as anyone interested in learning about these countries. The vast amount of information provided in the book is, then, used to shed light on an important question: What explains the resilience of emerging m...

  18. Alternative synthetic methodology for amide formation in the post-synthetic modification of Ti-MIL125-NH2

    OpenAIRE

    Smalley, AP; Reid, DG; Tan, JC; Lloyd, GO

    2013-01-01

    There are relatively few metal-organic framework materials that are robust enough to survive post-synthetic modification of their structures. We present test modifications of Ti-MIL125-NH2 leading towards tuning of the porous and catalytic properties of the material. We also present the first use of a mild amide synthesis method for post-synthetic modification. © 2013 The Royal Society of Chemistry.

  19. Fatty acid amide hydrolase (FAAH) inhibition enhances memory acquisition through activation of PPAR-α nuclear receptors

    OpenAIRE

    Mazzola, Carmen; Medalie, Julie; Scherma, Maria; Panlilio, Leigh V; Solinas, Marcello; Tanda, Gianluigi; Drago, Filippo; Cadet, Jean Lud; Goldberg, Steven R.; Yasar, Sevil

    2009-01-01

    Inhibitors of fatty acid amide hydrolase (FAAH) increase endogenous levels of anandamide (a cannabinoid CB1-receptor ligand) and oleoylethanolamide and palmitoylethanolamide (OEA and PEA, ligands for α-type peroxisome proliferator-activated nuclear receptors, PPAR-α) when and where they are naturally released in the brain. Using a passive-avoidance task in rats, we found that memory acquisition was enhanced by the FAAH inhibitor URB597 or by the PPAR-α agonist WY14643, and these enhancements ...

  20. A Direct Access to 7-Aminoindoles via Iridium-Catalyzed Mild C-H Amidation of N-Pivaloylindoles with Organic Azides.

    Science.gov (United States)

    Kim, Youyoung; Park, Juhyeon; Chang, Sukbok

    2016-04-15

    Ir(III)-catalyzed regioselective direct C-7 amidation of indoles in reaction with organic azides has been developed. While its efficiency was varied by the choice of N-directing groups, N-pivaloylindoles were most effective in undergoing the desired amidation at room temperature over a broad range of substrates. The reaction was scalable, and deprotection of the chelation group was also facile. PMID:27023669

  1. Pd-Catalyzed Coupling of γ-C(sp(3))-H Bonds of Oxalyl Amide-Protected Amino Acids with Heteroaryl and Aryl Iodides.

    Science.gov (United States)

    Han, Jian; Zheng, Yongxiang; Wang, Chao; Zhu, Yan; Huang, Zhi-Bin; Shi, Da-Qing; Zeng, Runsheng; Zhao, Yingsheng

    2016-07-01

    Pd-catalyzed regioselective coupling of γ-C(sp(3))-H bonds of oxalyl amide-protected amino acids with heteroaryl and aryl iodides is reported. A wide variety of iodides are tolerated, giving the corresponding products in moderate to good yields. Various oxalyl amide-protected amino acids were compatible in this C-H transformation, thus representing a practical method for constructing non-natural amino acid derivatives. PMID:27286881

  2. Metabolically-inactive glucagon-like peptide-1(9-36)amide confers selective protective actions against post-myocardial infarction remodelling

    OpenAIRE

    Robinson, Emma; Tate, Mitchel; Lockhart, Samuel; McPeake, Claire; O'Neill, Karla M; Edgar, Kevin S; Calderwood, Danielle; Green, Brian D; McDermott, Barbara J.; Grieve, David J

    2016-01-01

    BACKGROUND: Glucagon-like peptide-1 (GLP-1) therapies are routinely used for glycaemic control in diabetes and their emerging cardiovascular actions have been a major recent research focus. In addition to GLP-1 receptor activation, the metabolically-inactive breakdown product, GLP-1(9-36)amide, also appears to exert notable cardiovascular effects, including protection against acute cardiac ischaemia. Here, we specifically studied the influence of GLP-1(9-36)amide on chronic post-myocardial in...

  3. One-pot synthesis of amides by aerobic oxidative coupling of alcohols or aldehydes with amines using supported gold and base as catalysts

    DEFF Research Database (Denmark)

    Kegnæs, Søren; Mielby, Jerrik Jørgen; Mentzel, Uffe Vie;

    2012-01-01

    Synthesis of amides by aerobic oxidative coupling of alcohols or aldehydes with amines via intermediate formation of methyl esters is highly efficient and selective when using a catalytic system comprised of supported gold nanoparticles and added base in methanol.......Synthesis of amides by aerobic oxidative coupling of alcohols or aldehydes with amines via intermediate formation of methyl esters is highly efficient and selective when using a catalytic system comprised of supported gold nanoparticles and added base in methanol....

  4. Discovery of a Potent, Selective, and Efficacious Class of Reversible α-Ketoheterocycle Inhibitors of Fatty Acid Amide Hydrolase Effective as Analgesicsa

    OpenAIRE

    Boger, Dale L.; Miyauchi, Hiroshi; Du, Wu; Hardouin, Christophe; Fecik, Robert A.; Cheng, Heng; Hwang, Inkyu; Hedrick, Michael P.; Leung, Donmienne; Acevedo, Orlando; Guimarães, Cristiano R. W.; Jorgensen, William L.; Cravatt, Benjamin F.

    2005-01-01

    Fatty acid amide hydrolase (FAAH) degrades neuromodulating fatty acid amides including anandamide (endogenous cannabinoid agonist) and oleamide (sleep-inducing lipid) at their sites of action and is intimately involved in their regulation. Herein we report the discovery of a potent, selective, and efficacious class of reversible FAAH inhibitors that produce analgesia in animal models validating a new therapeutic target for pain intervention. Key to the useful inhibitor discovery was the routi...

  5. Preparation of composite poly(ether block amide) membrane for CO2 capture

    Institute of Scientific and Technical Information of China (English)

    Lianjun Wang; Yang Li; Shuguang Li; Pengfei Ji; Chengzhang Jiang

    2014-01-01

    In this study, a poly(ether block amide) (Pebax 1657) composite membrane applied for CO2 capture was prepared by coating Pebax 1657 solution on polyacrylonitrile (PAN) ultrafiltration membrane. Ethanol/water mixture was used as the solvent of Pebax and the effects of ethanol/water mass ratios and Pebax concentration on the permeation properties of composite membrane were studied. To enhance the com-posite membrane permeance, the gutter layer, made from reactive amino silicone crosslinking with polydimethylsiloxane (PDMS), was de-signed. The influence of crosslinking degree of the gutter layer on membrane performance was investigated. As a result, a Pebax/amino-PDMS/PAN multilayer membrane with hexane resistance was developed, showing CO2 permeance of 350 GPU and CO2/N2 selectivity over 50. The blend of polyethylene glycol dimethyl ether (PEG-DME) with Pebax as coating material was studied to further improve the membrane performance. After being combined with PEG-DME additive, CO2 permeance of the final Pebax-PEG-DME/amino-PDMS/PAN composite membrane reached 400 GPU above with CO2/N2 selectivity over 65.

  6. Fluorogenic ratiometric dipodal optode containing imine-amide linkages: Exploiting subtle thorium (IV) ion sensing

    Energy Technology Data Exchange (ETDEWEB)

    Tayade, Kundan [School of Chemical Sciences, North Maharashtra University, Jalgaon (India); Kaur, Amanpreet [Centre for Nanoscience and Nanotechnology, Panjab University, Chandigarh (India); Tetgure, Sandesh [School of Chemical Sciences, North Maharashtra University, Jalgaon (India); Chaitanya, G. Krishana [School of Chemical Sciences, Swami Ramanand Tirth Marathawada University, Nanded (India); Singh, Narinder [Department of Chemistry, Indian Institute of Technology, Ropar, Punjab (India); Kuwar, Anil, E-mail: kuwaras@gmail.com [School of Chemical Sciences, North Maharashtra University, Jalgaon (India)

    2014-12-10

    Highlights: • A highly selective, simple, noncyclic, imine-amide based dipodal off–on fluorescence chemosensor for Th{sup 4+} ion is reported. • Sensing mechanism is based upon twisted plane intramolecular charge–transfer upon interaction with cations. • Th{sup 4+} ion on detection limit (as low as 0.1 μM) is reported. • This system can also be applied in real samples. - Abstract: The (13E,19E)-N1′,N3′-bis[4-(diethylamino)-2-hydroxybenzylidene]malonohydrazide (L) has been developed for the detection of Th{sup 4+} ions using dual channel signalling system. The UV–vis absorbance and fluorescence spectroscopic data revealed the formation of L–Th{sup 4+} complex in 1:1 equilibrium. The density functional theory (DFT) also confirms the optimum binding cavity for the recognition of metal ion. The binding constant computed from different mathematical models for an assembly of L–Th{sup 4+}. The detection limit of L for Th{sup 4+} recognition is to a concentration down to 0.1 μM (0.023 μg g{sup −1}). The present sensing system is also successfully applied for the detection of Th{sup 4+} ion present in soil near nuclear atomic plants.

  7. Determination of Mercury (II Ion on Aryl Amide-Type Podand-Modified Glassy Carbon Electrode

    Directory of Open Access Journals (Sweden)

    Sevgi Güney

    2011-01-01

    Full Text Available A new voltammetric sensor based on an aryl amide type podand, 1,8-bis(o-amidophenoxy-3,6-dioxaoctane, (AAP modified glassy carbon electrode, was described for the determination of trace level of mercury (II ion by cyclic voltammetry (CV and differential pulse voltammetry (DPV. A well-defined anodic peak corresponding to the oxidation of mercury on proposed electrode was obtained at 0.2 V versus Ag/AgCl reference electrode. The effect of experimental parameters on differential voltammetric peak currents was investigated in acetate buffer solution of pH 7.0 containing 1 × 10−1 mol L−1 NaCl. Mercury (II ion was preconcentrated at the modified electrode by forming complex with AAP under proper conditions and then reduced on the surface of the electrode. Interferences of Cu2+, Pb2+, Fe3+, Cd2+, and Zn2+ ions were also studied at two different concentration ratios with respect to mercury (II ions. The modified electrode was applied to the determination of mercury (II ions in seawater sample.

  8. Picosecond pulsed infrared laser tuned to amide I band dissociates polyglutamine fibrils in cells.

    Science.gov (United States)

    Kawasaki, Takayasu; Ohori, Gaku; Chiba, Tomoyuki; Tsukiyama, Koichi; Nakamura, Kazuhiro

    2016-09-01

    Amyloid fibrils are causal substances for serious neurodegenerative disorders and amyloidosis. Among them, polyglutamine fibrils seen in multiple polyglutamine diseases are toxic to neurons. Although much efforts have been made to explore the treatments of polyglutamine diseases, there are no effective drugs to block progression of the diseases. We recently found that a free electron laser (FEL), which has an oscillation wavelength at the amide I band (C = O stretch vibration mode) and picosecond pulse width, was effective for conversion of the fibril forms of insulin, lysozyme, and calcitonin peptide into their monomer forms. However, it is not known if that is also the case in polyglutamine fibrils in cells. We found in this study that the fibril-specific β-sheet conformation of polyglutamine peptide was converted into nonfibril form, as evidenced by the infrared microscopy and scanning-electron microscopy after the irradiation tuned to 6.08 μm. Furthermore, irradiation at this wavelength also changed polyglutamine fibrils to their nonfibril state in cultured cells, as shown by infrared mapping image of protein secondary structure. Notably, infrared thermography analysis showed that temperature increase of the cells during the irradiation was within 1 K, excluding thermal damage of cells. These results indicate that the picosecond pulsed infrared laser can safely reduce amyloid fibril structure to the nonfibril form even in cells. PMID:27342599

  9. Synthesis, Characterization, and Retinol Stabilization of Fatty Amide-β-cyclodextrin Conjugates

    Directory of Open Access Journals (Sweden)

    Hwanhee Kim

    2016-07-01

    Full Text Available Amphiphilic cyclodextrin (CD has been the object of growing scientific attention because of its two recognition sites, the cavity and the apolar heart, formed by self-assembly. In the present study, mono[6-deoxy-6-(octadecanamido]-β-CD and mono[6-deoxy-6-(octadecenamido]-β-CD were successfully synthesized by reacting mono-6-amino-6-deoxy-β-CD with N-hydroxysuccinimide esters of corresponding fatty acids in DMF. The structures were analyzed using nuclear magnetic resonance spectroscopy and mass spectrometry. The amphiphilic β-CDs were able to form self-assembled nano-vesicles in water, and the supramolecular architectures were characterized using fluorescence spectroscopy, dynamic light scattering, and transmission electron microscopy. Using the cavity-type nano-vesicles, all-trans-retinol was efficiently encapsulated; it was then stabilized against the photo-degradation. Therefore, the present fatty amide-β-CD conjugate will be a potential molecule for carrier systems in cosmetic and pharmaceutical applications.

  10. Synthesis, Characterization, and Retinol Stabilization of Fatty Amide-β-cyclodextrin Conjugates.

    Science.gov (United States)

    Kim, Hwanhee; Hu, Yiluo; Jeong, Daham; Jun, Bong-Hyun; Cho, Eunae; Jung, Seunho

    2016-01-01

    Amphiphilic cyclodextrin (CD) has been the object of growing scientific attention because of its two recognition sites, the cavity and the apolar heart, formed by self-assembly. In the present study, mono[6-deoxy-6-(octadecanamido)]-β-CD and mono[6-deoxy-6-(octadecenamido)]-β-CD were successfully synthesized by reacting mono-6-amino-6-deoxy-β-CD with N-hydroxysuccinimide esters of corresponding fatty acids in DMF. The structures were analyzed using nuclear magnetic resonance spectroscopy and mass spectrometry. The amphiphilic β-CDs were able to form self-assembled nano-vesicles in water, and the supramolecular architectures were characterized using fluorescence spectroscopy, dynamic light scattering, and transmission electron microscopy. Using the cavity-type nano-vesicles, all-trans-retinol was efficiently encapsulated; it was then stabilized against the photo-degradation. Therefore, the present fatty amide-β-CD conjugate will be a potential molecule for carrier systems in cosmetic and pharmaceutical applications. PMID:27455224

  11. [Synthesis and anti-proliferative activity of fluoroquinolone (rhodanine unsaturated ketone) amide derivatives].

    Science.gov (United States)

    Gao, Liu-zhou; Xie, Yu-suo; Yan, Qiang; Wu, Shu-min; Ni, Li-li; Zhao, Hui; Huang, Wen-long; Hu, Guo-qiang

    2015-08-01

    To discover novel antitumor rhodanine unsaturated ketones, a series of fluoroquinolone (rhodanine α, β-unsaturated ketone) amine derivatives (5a-5r) were designed and synthesized with fluoroquinolone amide scaffold as a carrier. The structures of eighteen title compounds were characterized by elemental analysis, 1H NMR and MS. The in vitro anti-proliferative activity against Hep-3B, Capan-1 and HL60 cells was evaluated by MTT assay. The results showed that the title compounds not only had more significant anti-proliferative activity against three tested cancer cell lines than that of the parent ciprofloxacin 1, but also exhibited the highest activity against Capan-1 cells. The SAR revealed that some compounds carrying aromatic heterocyclic rings or phenyl attached to an electron-withdrawing carboxyl or sulfonamide substituent were comparable to or better than comparison doxorubicin against Capan-1 cells. As such, it suggests that fluoroquinolone (rhodanine α, β-unsaturated ketone) amines are promising leads for the development of novel antitumor fluoroquinolones or rhodanine analogues. PMID:26669001

  12. Biocompatibility of Poly(ester amide (PEA Microfibrils in Ocular Tissues

    Directory of Open Access Journals (Sweden)

    Martina Kropp

    2014-01-01

    Full Text Available Drug delivery systems (DDS are able to deliver, over long periods of time, therapeutic concentrations of drugs requiring frequent administration. Two classes of DDS are available, biodegradable and non-biodegradable. The larger non-biodegradable implants ensure long-term delivery, but require surgical interventions. Biodegradable biomaterials are smaller, injectable implants, but degrade hydrolytically and release drugs in non-zero order kinetics, which is inefficient for long-term sustained drug release. Biodegradable poly(ester amides (PEAs may overcome these difficulties. To assess their ocular biocompatibility and long-term behavior, PEA fibrils were analyzed in vitro and in vivo. In vitro, incubation in vitreous humor changes to PEA structure, suggests degradation by surface erosion, enabling drug release with zero order kinetics. Clinical and histological analysis of PEA fibrils implanted subconjunctivally and intravitreally showed the absence of an inflammatory response or other pathological tissue alteration. This study shows that PEA fibrils are biocompatible with ocular environment and degrade by surface erosion.

  13. Crystal structure determination and reaction pathway of amide-hydride mixtures

    International Nuclear Information System (INIS)

    Combined synchrotron in situ X-ray diffraction and neutron diffraction studies were performed on 2:1 mixtures of lithium amide and magnesium hydride, which have shown promise as solid-state hydrogen storage materials. The dehydrogenated product is a mixed lithium and magnesium imide, Li2Mg(NH)2, whose crystal structure has not heretofore been determined. Furthermore, at elevated temperatures, Li2Mg(NH)2 undergoes two structural transitions from an orthorhombic structure to a primitive cubic structure at intermediate temperature (350 deg. C) followed by a face-centered cubic crystal structure at high temperature (500 deg. C). Disordering of the Li, Mg and cation vacancies as a function of temperature drives the structural transitions. We report the reaction pathway from in situ X-ray diffraction studies and the crystal structures of the three structural variants of Li2Mg(NH)2 as determined by high-resolution X-ray and neutron powder diffraction. We also report the hydrogen storage reaction pathways for mixtures with other cation ratios

  14. Particle-size dependence of the activation energy for decomposition of lithium amide

    Science.gov (United States)

    van de Walle, Chris; Hoang, Khang; Janotti, Anderson

    2012-02-01

    Lithium amide (LiNH2) is a promising material for reversible hydrogen storage, yet atomistic mechanisms behind the dehydrogenation process are unknown. The activation energy for LiNH2 decomposition has been observed to strongly vary with ball milling, suggesting a dependence of the thermodynamics and kinetics of the decomposition on the particle size. We have examined these mechanisms based on first-principles calculations for native point defects and defect complexes in LiNH2. We propose that the decomposition of LiNH2 into lithium imide (Li2NH) and ammonia (NH3) occurs through two competing mechanisms, one involving the formation of native defects in the interior of the material and the other at the surface. As a result, the prevailing mechanism and hence the activation energy depend on the surface-to-volume ratio, or the specific surface area, which changes with the particle size. We explain the observed variations of activation energy, and address the role played by LiH in the dehydrogenation of (LiNH2+LiH) mixtures. The relationship between the structure of hydrogen-related defects and the end products in the decomposition reaction can be extended to other complex hydrides.

  15. Synthesis and Gene Silencing Properties of siRNAs Containing Terminal Amide Linkages

    Directory of Open Access Journals (Sweden)

    Maria Gaglione

    2014-01-01

    Full Text Available The active components of the RNAi are 21 nucleotides long dsRNAs containing a 2 nucleotide overhang at the 3′ end, carrying 5′-phosphate and 3′-hydroxyl groups (siRNAs. Structural analysis revealed that the siRNA is functionally bound at both ends to RISC. Terminal modifications are considered with interest as the introduction of chemical moieties interferes with the 3′ overhang recognition by the PAZ domain and the 5′-phosphate recognition by the MID and PIWI domains of RISC. Herein, we report the synthesis of modified siRNAs containing terminal amide linkages by introducing hydroxyethylglycine PNA (hegPNA moieties at 5′, and at 3′ positions and on both terminals. Results of gene silencing studies highlight that some of these modifications are compatible with the RNAi machinery and markedly increase the resistance to serum-derived nucleases even after 24 h of incubation. Molecular docking simulations were attained to give at atomistic level a clearer picture of the effect of the most performing modifications on the interactions with the human Argonaute 2 PAZ, MID, and PIWI domains. This study adds another piece to the puzzle of the heterogeneous chemical modifications that can be attained to enhance the silencing efficiency of siRNAs.

  16. Synthesis, structure and catalytic behavior of ytterbium complexes bearing a phenoxy(quinolinyl)amide ligand

    Institute of Scientific and Technical Information of China (English)

    ZHU Xi; WANG Yaorong; YAO Yingming; WU Bing; SHEN Qi

    2012-01-01

    Two ytterbium complexes stabilized by phenoxy(quinolinyl)amide ligand 3,5-But2-2-OC6H2CH2N-8-C9H6N (L) were synthesized and characterized.Reaction of anhydrous YbCl3 with l equiv.of LLi2 in THF gave the ytterbium chloride [LYbCl(THF)]2 (1) in 73% yield.A further reaction of complex 1 with equimolar of NaN(SiMe3)2 in THF afforded the unexpected heterobimetallic "ate"-complex L2YbNa(THF)2 (2) via a ligand redistribution reaction.Complex 2 could also be prepared in high isolated yield by the reaction of anhydrous YbCl3 with 2 equiv.of LNa2 generated in situ.Both complexes 1 and 2 were characterized by IR spectroscopy,elemental analysis,and single-crystal X-ray diffraction analysis.It was found that complex 2 was an effective catalyst for the addition reaction of aromatic amines to carbodiimides.

  17. Residual Cooling and Persistent Star Formation amid AGN Feedback in Abell 2597

    CERN Document Server

    Tremblay, G R; Baum, S A; Clarke, T E; Sarazin, C L; Bregman, J N; Combes, F; Donahue, M; Edge, A C; Fabian, A C; Ferland, G J; McNamara, B R; Mittal, R; Oonk, J B R; Quillen, A C; Russell, H R; Sanders, J S; Salomé, P; Voit, G M; Wilman, R J; Wise, M W

    2012-01-01

    New Chandra X-ray and Herschel FIR observations enable a multiwavelength study of active galactic nucleus (AGN) heating and intracluster medium (ICM) cooling in the brightest cluster galaxy of Abell 2597. The new Chandra observations reveal the central < 30 kiloparsec X-ray cavity network to be more extensive than previously thought, and associated with enough enthalpy to theoretically inhibit the inferred classical cooling flow. Nevertheless, we present new evidence, consistent with previous results, that a moderately strong residual cooling flow is persisting at 4%-8% of the classically predicted rates in a spatially structured manner amid the feedback-driven excavation of the X-ray cavity network. New Herschel observations are used to estimate warm and cold dust masses, a lower-limit gas-to-dust ratio, and a star formation rate consistent with previous measurements. The cooling time profile of the ambient X-ray atmosphere is used to map the locations of the observational star formation entropy threshold...

  18. Synthesis and Antibacterial Testing of Silver/Poly (Ether Amide Composite Nanofibers with Ultralow Silver Content

    Directory of Open Access Journals (Sweden)

    Shuai Liang

    2014-01-01

    Full Text Available Antimicrobial materials have attracted much attention all over the world. Herein, a new kind of antimicrobial material, poly (ether amide (PebaxⓇ nanofibers containing Ag nanoparticles, was prepared by electrospinning method. The Ag/PebaxⓇ composites were characterized by scanning electron microscopy (SEM, transmission electron microscopy (TEM, X-ray diffraction (XRD, X-ray photoelectron spectroscopy (XPS, differential scanning calorimetry (DSC, and thermogravimetric analyzer (TGA measurements. The antimicrobial properties of Ag/PebaxⓇ composites against Escherichia coli (E. coli; ATCC25922 and avirulent and Staphylococcus aureus (S. aureus; ATCC6538 and avirulent were evaluated by membrane adhering method. It was found that the Ag content played an important part in the antimicrobial ability of Ag/PebaxⓇ composites. When the mass ratio of AgNO3 to PebaxⓇ in the precursor was 0.15‰, the inhibition rate can reach >99.9% and antimicrobial activity against E. coli and S. aureus was 5.8 and 5.6, respectively, exceeding the antimicrobial testing standards JIS Z 2801. The above results indicated that the Ag/PebaxⓇ composite was a promising antimicrobial material that can be used in many applications.

  19. Direct Catalytic Asymmetric Mannich-Type Reaction of α- and β-Fluorinated Amides.

    Science.gov (United States)

    Brewitz, Lennart; Arteaga, Fernando Arteaga; Yin, Liang; Alagiri, Kaliyamoorthy; Kumagai, Naoya; Shibasaki, Masakatsu

    2015-12-23

    The last two decades have witnessed the emergence of direct enolization protocols providing atom-economical and operationally simple methods to use enolates for stereoselective C-C bond-forming reactions, eliminating the inherent drawback of the preformation of enolates using stoichiometric amounts of reagents. In its infancy, direct enolization relied heavily on the intrinsic acidity of the latent enolates, and the reaction scope was limited to readily enolizable ketones and aldehydes. Recent advances in this field enabled the exploitation of carboxylic acid derivatives for direct enolization, offering expeditious access to synthetically versatile chiral building blocks. Despite the growing demand for enantioenriched fluorine-containing small molecules, α- and β-fluorinated carbonyl compounds have been neglected in direct enolization chemistry because of the competing and dominating defluorination pathway. Herein we present a comprehensive study on direct and highly stereoselective Mannich-type reactions of α- and β-fluorine-functionalized 7-azaindoline amides that rely on a soft Lewis acid/hard Brønsted base cooperative catalytic system to guarantee an efficient enolization while suppressing undesired defluorination. This protocol contributes to provide a series of fluorinated analogs of enantioenriched β-amino acids for medicinal chemistry. PMID:26652911

  20. Synthesis of novel nanostructured chiral poly(amide-imide)s containing dopamine and natural amino acids

    Indian Academy of Sciences (India)

    Shadpour Mallakpour; Amin Zadehnazari

    2013-01-01

    Four new thermally stable and optically active poly(amide-imide)s (PAI)s with good inherent viscosities were synthesized from the direct polycondensation reaction of N,N'-(pyromellitoyl)-bis-L--amino acids with 3,5-diamino-N-(3,4-dihydroxy-phen-ethyl)benzamide in a medium consisting of a molten salt, tetrabutylammonium bromide, and triphenyl phosphite as the activator. The polymerization reactions produced a series of novel PAIs containing dopamine segment in the side chain in high yield with inherent viscosities between 0.33 and 0.49 dL/g. The obtained polymers were typically characterized by means of FT-IR, 1HNMR spectroscopy, elemental analyses, powder X-ray diffraction, field emission scanning electronmicroscopy, inherent viscosity, and solubility tests. Thermal properties and flame retardant behaviour of the PAIs were also investigated using thermal gravimetric analysis (TGA and DTG) and limiting oxygen index (LOI). Data obtained by thermal analysis revealed that these polymers showed good thermal stability. Furthermore, high char yield in TGA and good LOI values indicated that the obtained polymers were capable of exhibiting good flame retardant properties.

  1. Inhibitors of Fatty Acid Amide Hydrolase and Monoacylglycerol Lipase: New Targets for Future Antidepressants.

    Science.gov (United States)

    Ogawa, Shintaro; Kunugi, Hiroshi

    2015-01-01

    Cannabis and analogs of Δ9-tetrahydrocannabinol have been used for therapeutic purposes, but their therapeutic use remains limited because of various adverse effects. Endogenous cannabinoids have been discovered, and dysregulation of endocannabinoid signaling is implicated in the pathophysiology of major depressive disorder (MDD). Recently, endocannabinoid hydrolytic enzymes such as fatty acid amide hydrolase (FAAH) and monoacylglycerol lipase (MAGL) have become new therapeutic targets in the treatment of MDD. Several FAAH or MAGL inhibitors are reported to have no cannabimimetic side effects and, therefore, are new potential therapeutic options for patients with MDD who are resistant to first-line antidepressants (selective serotonin and serotonin-norepinephrine reuptake inhibitors). In this review, we focus on the possible relationships between MDD and the endocannabinoid system as well as the inhibitors' therapeutic potential. MAGL inhibitors may reduce inflammatory responses through activation of cannabinoid receptor type 2. In the hypothalamic-pituitary-adrenal axis, repeated FAAH inhibitor administration may be beneficial for reducing circulating glucocorticoid levels. Both FAAH and MAGL inhibitors may contribute to dopaminergic system regulation. Recently, several new inhibitors have been developed with strong potency and selectivity. FAAH inhibitor, MAGL inhibitor, or dual blocker use would be promising new treatments for MDD. Further pre-clinical studies and clinical trials using these inhibitors are warranted. PMID:26630956

  2. The Structure-Property Relationship of Poly(amide-imide)/Organoclay Nanocomposites

    Science.gov (United States)

    Faghihi, Khalil; Soleimani, Masoumeh; Shabanian, Meisam; Abootalebi, Ashraf Sadateh

    2011-06-01

    Surface treated montmorillonite (MMT) was used to prepare nanocomposites with poly(amide-imide) (PAI) 5 by solution intercalation technique with various percent of organoclay (5-15 mass %). Surface modification of the MMT was performed with Cloisite 20A for ample compatibilization with the PAI matrix. The PAI 5 chains were produced through polycondensation of 4,4-diamino diphenyl sulfone 4 with N-trimellitylimido-L-alanine 3 in a medium consisting of triphenyl phosphite, N-methyl-2-pyrolidone (NMP), pyridine and calcium chloride. The PAI-Nanocomposites morphology and clay dispersion were investigated by X-ray diffraction (XRD) and Scanning electron microscopy (SEM). The effect of clay dispersion and the interaction between clay and PAI chains on the properties of PAI-Nanocomposites films were investigated by using UV-Vis spectroscopy, thermogravimetric analysis (TGA) and water uptake measurements. Thermal stability of nanocomposites increased relative to the neat polyamide with increasing organoclay content but water uptake of these materials decreased as compared to the neat polyamide indicating reduced permeability.

  3. Surface modification of polypiperazine-amide membrane by self-assembled method for dye wastewater treatment☆

    Institute of Scientific and Technical Information of China (English)

    Yong Zhou; Zhenan Dai; Ding Zhai; Congjie Gao

    2015-01-01

    Polypiperazine-amide membranes were modified with poly(ethyleneimine) (PEI) by self-assembled method, through which PEI molecules were fixed on the membrane surface by ionic interaction. In the experiments, the PEI concentration ranged from 50 to 2000 mg·L−1 while the depositing time was fixed at 20 min. The results showed that low PEI concentration resulted in a slight increase of pure water flux, which was attributed to the enhanced membrane surface hydrophilicity. The PEI adsorption on membrane surface had less effect on the re-jections to neutral PEG and sucrose, but improved the rejections to divalent cationic ions and methylene blue as the result of reversion of the membrane surface charge from negative to positive according to the XPS analysis and zeta potential measurements. The membrane modified at PEI=1500 mg·L−1 exhibited high rejection to methylene blue (MB) and is potential to be applied in the treatment of effluents containing positively charged dyes.

  4. Low antiplasmodial activity of alkaloids and amides from the stem bark of Zanthoxylum rubescens (Rutaceae

    Directory of Open Access Journals (Sweden)

    Penali L.

    2007-06-01

    Full Text Available The stem bark of Zanthoxylum rubescens (syn. Fagara rubescens is used for treating fevers associated with malaria in the Ivory Coast. Three alkaloids: N-nornitidine, 7,9-dimethoxy-2,3- methylenedioxybenzophenanthridine, and bis[6-(5,6- dihydrochelerythrinyl] ether; and two amides: zanthomamide and lemairamide, were isolated from the stem bark of this plant. These compounds were screened in vitro against the chloroquine-sensitive 3D7 strain and the chloroquine-resistant FCM29 strain of P. falciparum. N-nornitidine was found to be inactive. 7,9- dimethoxy-2,3-methylenedioxybenzophenanthridine, lemairamide and zanthomamide showed weak activity with average IC50 values ranging from 45.6 μM to 149.9 μM. Bis[6-(5,6- dihydrochelerythrinyl] ether was the most active of the tested compounds with mean IC50s of 14.9 ± 1.4 μM in FCM29 strain and 15.3 ± 3.4 μM in 3D7 strain (~ 58 to ~ 1130 times less active than chloroquine respectively. The anti-Plasmodium activities of the tested alkaloids of Z. rubescens were low; and do not encourage the use of this plant as antimalarial.

  5. Low antiplasmodial activity of alkaloids and amides from the stem bark of Zanthoxylum rubescens (Rutaceae).

    Science.gov (United States)

    Penali, L; Mulholland, D A; Tano, K D; Cheplogoi, P K; Randrianarivelojosia, M

    2007-06-01

    The stem bark of Zanthoxylum rubescens (syn. Fagara rubescens) is used for treating fevers associated with malaria in the Ivory Coast. Three alkaloids: N-nornitidine, 7,9-dimethoxy-2,3-methylenedioxybenzophenanthridine, and bis[6-5,6-dihydrochelerythrinyl)] ether; and two amides: zanthomamide and lemairamide, were isolated from the stem bark of this plant. These compounds were screened in vitro against the chloroquine-sensitive 3D7 strain and the chloroquine-resistant FCM29 strain of P. falciparum. N-nornitidine was found to be inactive. 7,9-dimethoxy-2,3-methylenedioxybenzophenanthridine, lemairamide and zanthomamide showed weak activity with average IC50 values ranging from 45.6 microM to 149.9 microM. Bis[6-15,6-dihydrochelerythrinyl)] ether was the most active of the tested compounds with mean IC50s of 14.9 +/- 1.4 microM in FCM29 strain and 15.3 +/- 3.4 microM in 3D7 strain (approximately 58 to approximately 1130 times less active than chloroquine respectively). The anti-Plasmodium activities of the tested alkaloids of Z. rubescens were low; and do not encourage the use of this plant as antimalarial. PMID:17645189

  6. Piperidinyl amides with insecticidal activity from the maritime plant Otanthus maritimus.

    Science.gov (United States)

    Christodoulopoulou, Lito; Tsoukatou, Maria; Tziveleka, Leto A; Vagias, Constantinos; Petrakis, Panos V; Roussis, Vassilios

    2005-03-01

    Two new piperidine amides, N-[(2E,4E,8Z)-tetradecatrienoyl]piperidine (1) and N-[(2E,4E,8Z,11Z)-tetradecatetrenoyl]piperidine (2), along with the known metabolites N-[(2E,4E)-tetradecadienoyl]piperidine (3), N-isobutyl-(2E,4E,)-tetradecadienamide (4), N-isobutyl-(2E,4E,8Z)-tetradecatrienamide (5), N-isobutyl-(2E,4E,8Z,11Z)-tetradecatetraenamide (6), sesamine (7), pinoresinol (8), and espeletone (9), were isolated from the dichloromethane/methanol extracts of the plant Otanthus maritimus Hoffman & Link collected from coastal areas in Greece. Pinoresinol (8) and espeletone (9) are reported for the first time as metabolites of O. maritimus. The structures of the new natural products were elucidated by interpretation of their NMR and high-resolution mass spectral measurements. The insecticidal properties of the crude extracts, essential oil, and isolated metabolites 1-9 were evaluated on Crematogaster scutellaris (Olivier) ants and Reticulitermes balkanensis (Clement) termites, showing significant levels of activity. PMID:15740019

  7. Mutual Amide Prodrug of Etodolac-glucosamine: Synthesis, Characterization and Pharmacological Screening

    Directory of Open Access Journals (Sweden)

    Preeti Pandey

    2013-01-01

    Full Text Available Etodolac, a nonsteroidal antiinflammatory drug, widely used in arthritis is associated with gastric ulceration and irritation due to presence of free carboxylic group. The current investigation reports synthesis of mutual amide prodrug of etodolac by masking free carboxylic group with glucosamine, a nutritional supplement for treatment of arthritis. Confirmation and characterization of the structure of the synthesized prodrug done by elemental and spectroscopy analysis, melting point, determination of migration parameters (R f , R M , and R t by using thin layer chromatography and high performance liquid chromatography, respectively. Partition coefficient and solubility study confirms its lipophilic character so can be suitable candidate for controlled release delivery. In vitro hydrolytic studies of prodrug confirms good rate of hydrolysis in blood plasma, fecal matter, and simulated intestinal fluid while stable in gastric simulated fluid. In vivo pharmacological screening performed on animals. Prodrug with respect to etodolac shows good analgesic, antiinflammatory, and antiarthritic activity. The prodrug was assessed for their probable damaging effects by ulcerogeniticity and histopathological analysis. The histopathological studies showed less ulceration in the gastric region when treated with prodrug, thereby proving the prodrug to be better in action as compared to etodolac and are advantageous in having less gastrointestinal side effects.

  8. Temperature-dependent structure of methyltributylammonium bis(trifluoromethylsulfonyl)amide: X ray scattering and simulations

    Science.gov (United States)

    Santos, Cherry S.; Annapureddy, Harsha V. R.; Murthy, N. Sanjeeva; Kashyap, Hemant K.; Castner, Edward W.; Margulis, Claudio J.

    2011-02-01

    We report the combined results of computational and x ray scattering studies of amorphous methyltributylammonium bis(trifluoromethylsulfonyl)amide as a function of temperature. These studies included the temperature range for the normal isotropic liquid, a deeply supercooled liquid and the glass. The low q peaks in the range from 0.3 to 1.5 Å-1 in the structure function of this liquid can be properly accounted for by correlations between first and second nearest neighbors. The lowest q peak can be assigned to real space correlations between ions of the same charge, while the second peak arises mostly from nearest neighbors of opposite charge. Peaks at larger q values are mostly intramolecular in nature. While our simulated structure functions provide an excellent match to our experimental results and our experimental findings agree with previous studies reported for this liquid, the prior interpretation of the experimental data in terms of an interdigitated smectic A phase is not supported by our simulations. In this work, we introduce a set of general theoretical partitions of real and reciprocal space correlations that allow for unambiguous analysis of all intra- and interionic contributions to the structure function and coherent scattering intensity. We find that the intermolecular contributions to the x ray scattering intensity are dominated by the anions and cross terms between cations and anions for this ionic liquid.

  9. The limits of oral history: ethics and methodology amid highly politicized research settings.

    Science.gov (United States)

    Jessee, Erin

    2011-01-01

    In recent years, oral history has been celebrated by its practitioners for its humanizing potential, and its ability to democratize history by bringing the narratives of people and communities typically absent in the archives into conversation with that of the political and intellectual elites who generally write history. And when dealing with the narratives of ordinary people living in conditions of social and political stability, the value of oral history is unquestionable. However, in recent years, oral historians have increasingly expanded their gaze to consider intimate accounts of extreme human experiences, such as narratives of survival and flight in response to mass atrocities. This shift in academic and practical interests begs the questions: Are there limits to oral historical methods and theory? And if so, what are these limits? This paper begins to address these questions by drawing upon fourteen months of fieldwork in Rwanda and Bosnia-Hercegovina, during which I conducted multiple life history interviews with approximately one hundred survivors, ex-combatants, and perpetrators of genocide and related mass atrocities. I argue that there are limits to the application of oral history, particularly when working amid highly politicized research settings. PMID:22175095

  10. Solubility of CO2 in amide-based Brønsted acidic ionic liquids

    International Nuclear Information System (INIS)

    Highlights: ► The CO2 solubility in Brønsted acidic ionic liquids (BAIL) has been reported. ► The experimental data were reduced to Henry’s law constants as a function of temperature. ► The Gibbs free energy, enthalpy and entropy changes were calculated. ► Relationship between solubility and molar volumes of BAILs was developed. - Abstract: Several hydrophilic amide-based Brønsted acidic ionic liquids (BAILs) were prepared by simple acid-base neutralization reaction of N,N-dimethylformamide (DMF), N,N-dimethylacetamide (DMAc), and N-methylpyrrolidone (NMP) with trifluoroacetic acid (TFA) or tetrafluoroboric acid (FBA). The solubility data of CO2 in these BAILs were determined at T = (303.15, 313.15, and 323.15) K and subatmospheric pressure using isochoric saturation method. With the same cation, CO2 solubility in TFA-based BAILs was higher than that in FBA-based ones. From the variation of solubility, expressed as Henry’s law constants, with temperature, the standard Gibbs free energy, enthalpy, and entropy changes of CO2 solvation were calculated. The solubilities of CO2 in these BAILs were apparently increased with increasing the molar volume of BAIL except for [DMFH][TFA].

  11. In Preparation or Response: Examining Health Care Coalitions Amid a Changing Economic and Political Landscape.

    Science.gov (United States)

    Dornauer, Mark E

    2015-12-01

    The Office of the Assistant Secretary for Preparedness and Response within the US Department of Health and Human Services leads the nation in preparing for, responding to, and recovering from the adverse health effects of public health emergencies, in part through formal collaborations between hospitals, health systems, community health centers, public health departments, and community organizations via health care coalitions (HCCs). HCCs endeavor to meet the medical surge demands inherent to disasters and to improve health outcomes before, during, and after public health emergencies. Nevertheless, significant changes in health economics and policy can impact the operations, capabilities, and scope of HCCs. Specifically, hospital consolidation and the Affordable Care Act (ACA) are altering the national health care landscape, as well as the emergency preparedness sector, and are challenging HCCs to adapt to large-scale, industry-wide transformations. This article examines HCCs in the context of the developments of hospital consolidation and the ACA in order to facilitate future discourse regarding the strategy and policy of HCCs amid a changing economic and political landscape. PMID:26545191

  12. Synthesis, Antifungal Activity and QSAR of Some Novel Carboxylic Acid Amides

    Directory of Open Access Journals (Sweden)

    Shijie Du

    2015-03-01

    Full Text Available A series of novel aromatic carboxylic acid amides were synthesized and tested for their activities against six phytopathogenic fungi by an in vitro mycelia growth inhibition assay. Most of them displayed moderate to good activity. Among them N-(2-(1H-indazol-1-ylphenyl-2-(trifluoromethylbenzamide (3c exhibited the highest antifungal activity against Pythium aphanidermatum (EC50 = 16.75 µg/mL and Rhizoctonia solani (EC50 = 19.19 µg/mL, compared to the reference compound boscalid with EC50 values of 10.68 and 14.47 µg/mL, respectively. Comparative molecular field analysis (CoMFA and comparative molecular similarity indices analysis (CoMSIA were employed to develop a three-dimensional quantitative structure-activity relationship model for the activity of the compounds. In the molecular docking, a fluorine atom and the carbonyl oxygen atom of 3c formed hydrogen bonds toward the hydroxyl hydrogens of TYR58 and TRP173.

  13. Synthesis and structural studies of amino amide salts derived from 2-(aminomethyl)benzimidazole and α-amino acids

    Science.gov (United States)

    Avila-Montiel, Concepción; Tapia-Benavides, Antonio R.; Falcón-León, Martha; Ariza-Castolo, Armando; Tlahuext, Hugo; Tlahuextl, Margarita

    2015-11-01

    2-{[(Ammoniumacetyl)amino]methyl}-1H-benzimidazol-3-ium dichloride 4, 2-{[(2-ammoniumpropanoyl)amino]methyl}-1H-benzimidazol-3-ium dichloride 5, and 2-{[(2-ammonium-3-phenylpropanoyl)amino]methyl}-1H-benzimidazol-3-ium dichloride 6 amino amides were synthesized via condensation of 2AMBZ dihydrochloride with the corresponding amino acid. Compounds 7-12 were obtained by replacing chloride ions (in salts 4-6) with nitrate or tetrachlorozincate ions. The results of X-ray diffraction crystallographic studies indicated that the geometries, charges and sizes of the anions are essential for the formation of the strong hydrogen bond interactions of compounds 4, 5, 9-12. Moreover, in most cases, the presence of water and solvent molecules stabilizes the supramolecular structures of these compounds. Nuclear magnetic resonance (NMR) and infrared (IR) spectroscopy indicated that the presence of chloride or tetrachlorozincate anions increases the acidity of the benzimidazolic and amide groups more significantly than the presence of nitrate anions. However, Quantum Theory of Atoms in Molecules (QTAIM) computations of the crystal structures demonstrate that amino amides interact more strongly with NO3- than with Cl- and ZnCl42- anions; this difference explains the spectroscopic results.

  14. The extraction of uranium (VI) and plutonium (IV) from nitric acid solutions with N,N-dialkyl substituting amides

    International Nuclear Information System (INIS)

    The use of N,N-di-2-methylheptyl acetamide (DMHAA),N,N-di-butylbutylamide(DBBA) and N,N-di-butylheptylamide(DBHA) as extractants for the extraction of nitric acid, U(VI) and Pu(IV) from the nitric acid solution has been investigated. The molar ratios of DBHA-HNO3 and DBHA-UO2(NO3)2 complexes are found to be 1:1 and 2:1 respectively. The complexes of both nitric acid and uranyl nitrate with these amides are highly soluble in aromatic diluent such as toluene without any formation of the third phase. The results show that, by modifying the length of the substitute chain and the degree of branch chain, some substituted amides might be found with which U(VI) and Pu(IV) could be co-extracted at moderate nitric acid solution and Pu(IV) could be preferably stripped at low acidity, and the separation of U(VI) and Pu(IV) could be accomplished without reductant of U(VI) and Pu(IV) in amide extraction

  15. Urea and amide-based inhibitors of the juvenile hormone epoxide hydrolase of the tobacco hornworm (Manduca sexta: Sphingidae).

    Science.gov (United States)

    Severson, Tonya F; Goodrow, Marvin H; Morisseau, Christophe; Dowdy, Deanna L; Hammock, Bruce D

    2002-12-01

    A new class of inhibitors of juvenile hormone epoxide hydrolase (JHEH) of Manduca sexta and further in vitro characterization of the enzyme are reported. The compounds are based on urea and amide pharmacophores that were previously demonstrated as effective inhibitors of mammalian soluble and microsomal epoxide hydrolases. The best inhibitors against JHEH activity so far within this class are N-[(Z)-9-octadecenyl]-N'-propylurea and N-hexadecyl-N'-propylurea, which inhibited hydrolysis of a surrogate substrate (t-DPPO) with an IC(50) around 90 nM. The importance of substitution number and type was investigated and results indicated that N, N'-disubstitution with asymmetric alkyl groups was favored. Potencies of pharmacophores decreased as follows: amide>urea>carbamate>carbodiimide>thiourea and thiocarbamate for N, N'-disubstituted compounds with symmetric substituents, and urea>amide>carbamate for compounds with asymmetric N, N'-substituents. JHEH hydrolyzes t-DPPO with a K(m) of 65.6 microM and a V(max) of 59 nmol min(-1) mg(-1) and has a substantially lower K(m) of 3.6 microM and higher V(max) of 322 nmol min(-1) mg(-1) for JH III. Although none of these compounds were potent inhibitors of hydrolysis of JH III by JHEH, they are the first leads toward inhibitors of JHEH that are not potentially subject to metabolism through epoxide degradation. PMID:12429126

  16. Novel and facile methods for the synthesis of DTPA-mono-amide. A new completely revised strategy in radiopharmaceutical chemistry

    International Nuclear Information System (INIS)

    DTPA is a very strong metal chelator widely utilized in radiopharmaceutical chemistry for conjugation of chemicals which do not have enough potency for direct metalo-labeling and also to manage toxic radioactive materials such as plutonium, americium, and curium. It is difficult to conjugate DTPA to an amine group in a singular direction and such reactions usually also coincidently produce a mixture of DTPA-bis-amides and DTPA-mono-amide resulting in considerable insufficiencies/difficulties in synthesis and especially yield/separation procedures. In this paper, novel methods for the exclusive synthesis of DTPA-mono-amide have been established which extensively reduce the difficulties otherwise encountered and increase the reaction's yield considering the green chemistry approaches. This is expected to be of interest to radiopharmaceutical researchers interested in the DTPA (Radio)-metallic-conjugate. Overall, this paper provides a framework to achieve a higher degree of propriety from DTPA as a chelator to conjugate to the chemical compounds. (author)

  17. Alternative methods of making [11C]amides: Application to the preparation of 5-HT1A receptor radioligands

    International Nuclear Information System (INIS)

    Many ligands for brain 5-HT1A receptors contain an amide group that is subject to hydrolysis in vivo. In the development of radioligands for use with positron emission tomography (PET), labelling in the carbonyl function of an amide group may be advantageous for avoiding radioactive metabolites that would readily enter the brain to confound PET receptor measurements. Several methods of labelling secondary and tertiary amides in their carbonyl functions with 11C (T1/2 = 20.4 min) have been developed over the past two decades or so. These methods include reaction of a [carbonyl-11C]acid chloride, [carboxyl-11C]magnesium halide carboxylate or [carboxyl-11C]acid with an amine or reaction of [11C]carbon monoxide with an amine plus an aryl halide, alkyl halide or aryl triflate. Some of these processes are successfully promoted with microwaves, palladium complexes, light or thermally initiated radicals. These methods are surveyed here and especially exemplified from research on the development of 5-HT1A receptor radioligands for brain imaging applications with PET. (author)

  18. Part 1: Notch-sparing γ-secretase inhibitors: The identification of novel naphthyl and benzofuranyl amide analogs.

    Science.gov (United States)

    Lu, Dai; Wei, Han-Xun; Zhang, Jing; Gu, Yongli; Osenkowski, Pamela; Ye, Wenjuan; Selkoe, Dennis J; Wolfe, Michael S; Augelli-Szafran, Corinne E

    2016-05-01

    γ-Secretase is one of two proteases directly involved in the production of the amyloid β-peptide (Aβ), which is pathogenic in Alzheimer's disease. Inhibition of γ-secretase to suppress the production of Aβ should not block processing of one of its alternative substrates, Notch1 receptors, as interference with Notch1 signaling leads to severe toxic effects. In the course of our studies to identify γ-secretase inhibitors with selectivity for APP over Notch, 1 [3-(benzyl(isopropyl)amino)-1-(naphthalen-2-yl)propan-1-one] was found to inhibit γ-secretase-mediated Aβ production without interfering with γ-secretase-mediated Notch processing in purified enzyme assays. As 1 is chemically unstable, efforts to increase the stability of this compound led to the identification of 2 [naphthalene-2-carboxylic acid benzyl-isopropyl-amide] which showed similar biological activity to compound 1. Synthesis and evaluation of a series of amide analogs resulted in benzofuranyl amide analogs that showed promising Notch-sparing γ-secretase inhibitory effects. This class of compounds may serve as a novel lead series for further study in the development of γ-secretase inhibitors. PMID:27013392

  19. Determining in situ protein conformation and orientation from the amide-I sum-frequency generation spectrum: theory and experiment.

    Science.gov (United States)

    Roeters, S J; van Dijk, C N; Torres-Knoop, A; Backus, E H G; Campen, R K; Bonn, M; Woutersen, S

    2013-07-25

    Vibrational sum-frequency generation (VSFG) spectra of the amide-I band of proteins can give detailed insight into biomolecular processes near membranes. However, interpreting these spectra in terms of the conformation and orientation of a protein can be difficult, especially in the case of complex proteins. Here we present a formalism to calculate the amide-I infrared (IR), Raman, and VSFG spectra based on the protein conformation and orientation distribution. Based on the protein conformation, we set up the amide-I exciton Hamiltonian for the backbone amide modes that generate the linear and nonlinear spectroscopic responses. In this Hamiltonian, we distinguish between nearest-neighbor and non-nearest-neighbor vibrational couplings. To determine nearest-neighbor couplings we use an ab initio 6-31G+(d) B3LYP-calculated map of the coupling as a function of the dihedral angles. The other couplings are estimated using the transition-dipole coupling model. The local-mode frequencies of hydrogen-bonded peptide bonds and of peptide bonds to proline residues are red-shifted. To obtain realistic hydrogen-bond shifts we perform a molecular dynamics simulation in which the protein is solvated by water. As a first application, we measure and calculate the amide-I IR, Raman, and VSFG spectra of cholera toxin B subunit docked to a model cell membrane. To deduce the orientation of the protein with respect to the membrane from the VSFG spectra, we compare the experimental and calculated spectral shapes of single-polarization results, rather than comparing the relative amplitudes of VSFG spectra recorded for different polarization conditions for infrared, visible, and sum-frequency light. We find that the intrinsic uncertainty in the interfacial refractive index--essential to determine the overall amplitude of the VSFG spectra--prohibits a meaningful comparison of the intensities of the different polarization combinations. In contrast, the spectral shape of most of the VSFG

  20. Antimicrobial hyperbranched poly(ester amide)/polyaniline nanofiber modified montmorillonite nanocomposites

    International Nuclear Information System (INIS)

    There has been growing interest in the use of nanomaterials featuring potent of antimicrobial activity in the biomedical domain. It still remains a challenge for the researchers to develop an efficient nanocomposite possessing antimicrobial efficacy against broad spectrum microbes including bacteria, fungi as well as algal consortium, posing serious challenges for the human survival. In addressing the above problem, we report the fabrication of bio-based hyperbranched poly(ester amide) (HBPEA)/polyaniline nanofiber modified montmorillonite (MMT) nanocomposites by an ex-situ polymerization technique at varied weight percentages (1, 2.5, 5 wt.%) of the modified MMT (nanohybrid). The Fourier transform infrared spectroscopy confirmed the structural changes upon interaction of the nanohybrid with HBPEA. A probable mechanism is proposed for the formation of nanocomposites with partially exfoliated nanoplatelet structure, which was further confirmed from the high resolution transmission electron microscopic analyses. The prepared nanocomposites exhibited potent efficacy against gram positive bacteria like Bacillus subtilis and Staphylococcus aureus as compared to the gram negative ones like Pseudomonas aeruginosa and Escherichia coli. The nanocomposites showed significant antifungal activity against Aspergillus niger, Fusarium oxysporum and Coleotricum capcii and antialgal activity against algal consortium comprising of Chlorella, Hormidium and Cladophorella species. The formation of thermosetting nanocomposites resulted in the acceptable improvement of desired physico-chemical and mechanical properties including thermostability. Thus pronounced antimicrobial activity of the nanocomposites against a spectrum of bacterial and fungal strains as well as a consortium of algal species along with other desired performance vouched them as potent antimicrobial materials in the realm of health and biomedical industry. - Highlights: • A possible approach for fabrication of the

  1. Effects of valproate derivatives I. Antiepileptic efficacy of amides, structural analogs and esters.

    Science.gov (United States)

    Redecker, C; Altrup, U; Hoppe, D; Düsing, R; Speckmann, E J

    2000-01-01

    Derivatives of the antiepileptic drug valproate (VPA, 2-propylpentanoic acid) have been synthesized and tested in order to improve the intracellular availability of VPA. The buccal ganglia of Helix pomatia were used as a test nervous system and antiepileptic efficacies were reconfirmed using rat cortex in vivo. Epileptiform activities consisted of typical paroxysmal depolarization shifts (PDS) which appeared in the identified neuron B3 with application of pentylenetetrazol. Epileptiform activities were found to be accelerated, unaffected or blocked. (i) The Amide-derivatives 2-propylpentanamide and N,N-dipropyl-2-propylpentanamide, and short chain ester derivatives 1-O-(2-propylpentanoyl)-2,3-propandiol, 2,2-di(hydroxymethyl)-1-O-(2-propylpentanoyl)-1,3-propanediol and 2,2-di(hydroxymethyl)-1,3-di-O-(2-propylpentanoyl)-1,3-propanediol accelerated epileptiform activities. Membrane potential often shifted to a permanent depolarization which corresponded to the PDS-inactivation level. (ii) The structural analogs 1-cycloheptene-1-carboxylic acid and cyclooctanecarboxylic acid accelerated epileptiform activities only slightly or were without effects. (iii) The small VPA-ester, 2-propylpentanoic acid ethyl ester, decreased the epileptiform activities in a way that is comparable to the effects of VPA well known from previous studies. It thus could be thought as a VPA-pro-drug. (iv) The mannitol-esters 1-O-(2-propylpentanoyl)-D-mannitol and 3,4;5,6-Di-O-isopropylidene-1-O-(2-propylpentanoyl)-D-mannitol blocked the PDS in a way which is different from the known effects of VPA. These substances are interpreted not to exert their effects after being metabolized to VPA and thus they are thought to be new antiepileptic substances. PMID:10670421

  2. Interaction of amidated single-walled carbon nanotubes with protein by multiple spectroscopic methods

    Energy Technology Data Exchange (ETDEWEB)

    Li, Lili [China Pharmaceutical University, Nanjing 210009 (China); The Nursing College of Pingdingshan University, Pingdingshan 467000 (China); Lin, Rui [Yancheng Health Vocational and Technical College, Yancheng 224005 (China); He, Hua, E-mail: dochehua@163.com [China Pharmaceutical University, Nanjing 210009 (China); Key Laboratory of Drug Quality Control and Pharmacovigilance, Ministry of Education, China Pharmaceutical University, Nanjing 210009 (China); Sun, Meiling, E-mail: sml-nir@sohu.com [China Pharmaceutical University, Nanjing 210009 (China); Jiang, Li; Gao, Mengmeng [China Pharmaceutical University, Nanjing 210009 (China)

    2014-01-15

    The aim of this work was to investigate the detailed interaction between BSA and amidated single walled carbon nanotubes (e-SWNTs) in vitro. Ethylenediamine (EDA) was successfully linked on the surface of single-walled carbon nanotubes (SWNTs) via acylation to improve their dispersion and to introduce active groups. Bovine serum albumin (BSA) was selected as the template protein to inspect the interaction of e-SWNTs with protein. Decreases in fluorescence intensity of BSA induced by e-SWNTs demonstrated the occurrence of interaction between BSA and e-SWNTs. Quenching parameters and different absorption spectra for e-SWNTs–BSA show that the quenching effect of e-SWNTs was static quenching. Hydrophobic force had a leading contribution to the binding roles of BSA on e-SWNTs, which was confirmed by positive enthalpy change and entropy change. The interference of Na{sup +} with the quenching effect of e-SWNTs authenticated that electrostatic force existed in the interactive process simultaneously. The hydrophobicity of amino acid residues markedly increased with the addition of e-SWNTs viewed from UV spectra of BSA. The content of α-helix structure in BSA decreased by 6.8% due to the addition of e-SWNTs, indicating that e-SWNTs have an effect on the secondary conformation of BSA. -- Highlights: • The interaction between e-SWNTs and BSA was investigated by multiple spectroscopic methods. • Quenching mechanism was static quenching. • Changes in structure of BSA were inspected by synchronous fluorescence, UV–vis and CD spectrum.

  3. The Utilization of Amide Groups To Expand and Functionalize Metal-Organic Frameworks Simultaneously.

    Science.gov (United States)

    Lu, Zhiyong; Bai, Junfeng; Hang, Cheng; Meng, Fei; Liu, Wenlong; Pan, Yi; You, Xiaozeng

    2016-04-25

    A new stepwise ligand-elongation strategy by amide spacers is utilized to prepare isoreticularly high-porous metal-organic frameworks (MOFs), namely, quasi-mesoporous [Cu2 (PDBAD)(H2 O)]n (H4 PDBAD=5,5'-((4,4'-((pyridine-3,5-dicarbonyl)bis(azanediyl))bis(benzoyl))bis(azanediyl))diisophthalic acid; NJU-Bai22: NJU-Bai for Nanjing University Bai's group), and mesoporous [Cu2 (PABAD)(H2 O)]n (H4 PABAD=5,5'-((4,4'-((4,4'-((pyridine-3,5-dicarbonyl)bis(azanediyl))bis(benzoyl))bis (azanediyl))bis(benzoyl))bis(azanediyl))diisophthalic acid; NJU-Bai23). Compared with the prototypical MOF of [Cu2 (PDAD)(H2 O)]n (H4 PDAD=5,5'-(pyridine-3,5-dicarbonyl)bis(azanediyl)diisophthalic acid; NJU-Bai21, also termed as PCN-124), both MOFs exhibit almost the same CO2 adsorption enthalpy and CO2 selectivity values, and better capacity for CO2 storage under high pressure; these results make them promising candidate materials for CO2 capture and sequestration. Interestingly, this new method, in comparison with traditional strategies of using phenyl or triple-bond spacers, is easier and cheaper, resulting in a better ability to retain high CO2 affinity and selectivity in MOFs with large pores and high CO2 storage capacity. Additionally, it may lead to the high thermal stability of the MOFs and also their tolerance to water, which is related to the balance between the density of functional groups and pore sizes. Therefore, this strategy could provide new opportunities to explore more functionalized mesoporous MOFs with high performance. PMID:27031809

  4. Overexpression of fatty acid amide hydrolase induces early flowering in Arabidopsis thaliana

    Directory of Open Access Journals (Sweden)

    Neal D. Teaster

    2012-02-01

    Full Text Available N-Acylethanolamines (NAEs are bioactive lipids derived from the hydrolysis of the membrane phospholipid N-acylphosphatidylethanolamine (NAPE. In animal systems this reaction is part of the endocannabinoid signaling pathway, which regulates a variety of physiological processes. The signaling function of NAE is terminated by fatty acid amide hydrolase (FAAH, which hydrolyzes NAE to ethanolamine and free fatty acid. Our previous work in Arabidopsis thaliana showed that overexpression of AtFAAH (At5g64440 lowered endogenous levels of NAEs in seeds, consistent with its role in NAE signal termination. Reduced NAE levels were accompanied by an accelerated growth phenotype, increased sensitivity to abscisic acid (ABA, enhanced susceptibility to bacterial pathogens, and early flowering. Here we investigated the nature of the early flowering phenotype of AtFAAH overexpression. AtFAAH overexpressors flowered several days earlier than wild type and AtFAAH knockouts under both non-inductive short day (SD and inductive long day (LD conditions. Microarray analysis revealed that the FLOWERING LOCUS T (FT gene, which plays a major role in regulating flowering time, and one target MADS box transcription factor, SEPATALLA3 (SEP3, were elevated in AtFAAH overexpressors. Furthermore, AtFAAH overexpressors, with the early flowering phenotype had lower endogenous NAE levels in leaves compared to wild type prior to flowering. Exogenous application of NAE 12:0, which was reduced by up to 30% in AtFAAH overexpressors, delayed the onset of flowering in wild type plants. We conclude that the early flowering phenotype of AtFAAH overexpressors is, in part, explained by elevated FT gene expression resulting from the enhanced NAE hydrolase activity of AtFAAH, suggesting that NAE metabolism may participate in floral signaling pathways.

  5. Interaction of amidated single-walled carbon nanotubes with protein by multiple spectroscopic methods

    International Nuclear Information System (INIS)

    The aim of this work was to investigate the detailed interaction between BSA and amidated single walled carbon nanotubes (e-SWNTs) in vitro. Ethylenediamine (EDA) was successfully linked on the surface of single-walled carbon nanotubes (SWNTs) via acylation to improve their dispersion and to introduce active groups. Bovine serum albumin (BSA) was selected as the template protein to inspect the interaction of e-SWNTs with protein. Decreases in fluorescence intensity of BSA induced by e-SWNTs demonstrated the occurrence of interaction between BSA and e-SWNTs. Quenching parameters and different absorption spectra for e-SWNTs–BSA show that the quenching effect of e-SWNTs was static quenching. Hydrophobic force had a leading contribution to the binding roles of BSA on e-SWNTs, which was confirmed by positive enthalpy change and entropy change. The interference of Na+ with the quenching effect of e-SWNTs authenticated that electrostatic force existed in the interactive process simultaneously. The hydrophobicity of amino acid residues markedly increased with the addition of e-SWNTs viewed from UV spectra of BSA. The content of α-helix structure in BSA decreased by 6.8% due to the addition of e-SWNTs, indicating that e-SWNTs have an effect on the secondary conformation of BSA. -- Highlights: • The interaction between e-SWNTs and BSA was investigated by multiple spectroscopic methods. • Quenching mechanism was static quenching. • Changes in structure of BSA were inspected by synchronous fluorescence, UV–vis and CD spectrum

  6. Removal of Cr(VI) onto functionalized pyridine copolymer with amide groups

    Energy Technology Data Exchange (ETDEWEB)

    Neagu, Violeta, E-mail: vneagu@icmpp.ro [' Petru Poni' Institute of Macromolecular Chemistry, Gr. Ghica Voda 41A, 700487 Iasi (Romania)

    2009-11-15

    New pyridine strong base anion exchange resin has been prepared by the nucleophilic substitution reaction of 4-vinylpyridine:divinylbenzene copolymer of gel structure with 2-chloroacetamide as halogenated compound. The resulting resin was used to remove Cr(VI) from the aqueous solution. Batch adsorption studies have been carried out to determine the effect of the initial concentration of Cr(VI), adsorbent dose, pH, temperature and the presence of sulfate anions as counter ions. The process was found to be pH, solid/liquid ratio and concentration dependent. The adsorption capacities increase with the increase of the initial concentration of Cr(VI) and therefore, the resin exhibited the degree of usage of the strong base exchange capacities higher than 90% and the good efficiency in the chromium removal. At acidic pH and low concentration of the hexavalent chromium the synthesized pyridine resin offer much greater chromate removal capacities compared to alkaline pH. Equilibrium modeling of the process of Cr(VI) removal was carried out by using the Langmuir and Freundlich isotherms. The experimental data obeyed these isotherm models. Thermodynamic studies were performed and the parameters namely, {Delta}G{sup o}, {Delta}H{sup o} and {Delta}S{sup o} showed the spontaneous and endothermic process of the adsorption of Cr(VI) on the pyridine resin. In the competitive adsorption studies, chromate/sulfate revealed the selectivity of the pyridine adsorbents towards chromium ions. This selectivity is explained by the adsorption of the transition metal anion on the {pi} bonds of the pyridine ring and the formation a sandwich arrangement with chromium anion and amide functional groups attached to the quaternary nitrogen atoms.

  7. Removal of Cr(VI) onto functionalized pyridine copolymer with amide groups

    International Nuclear Information System (INIS)

    New pyridine strong base anion exchange resin has been prepared by the nucleophilic substitution reaction of 4-vinylpyridine:divinylbenzene copolymer of gel structure with 2-chloroacetamide as halogenated compound. The resulting resin was used to remove Cr(VI) from the aqueous solution. Batch adsorption studies have been carried out to determine the effect of the initial concentration of Cr(VI), adsorbent dose, pH, temperature and the presence of sulfate anions as counter ions. The process was found to be pH, solid/liquid ratio and concentration dependent. The adsorption capacities increase with the increase of the initial concentration of Cr(VI) and therefore, the resin exhibited the degree of usage of the strong base exchange capacities higher than 90% and the good efficiency in the chromium removal. At acidic pH and low concentration of the hexavalent chromium the synthesized pyridine resin offer much greater chromate removal capacities compared to alkaline pH. Equilibrium modeling of the process of Cr(VI) removal was carried out by using the Langmuir and Freundlich isotherms. The experimental data obeyed these isotherm models. Thermodynamic studies were performed and the parameters namely, ΔGo, ΔHo and ΔSo showed the spontaneous and endothermic process of the adsorption of Cr(VI) on the pyridine resin. In the competitive adsorption studies, chromate/sulfate revealed the selectivity of the pyridine adsorbents towards chromium ions. This selectivity is explained by the adsorption of the transition metal anion on the π bonds of the pyridine ring and the formation a sandwich arrangement with chromium anion and amide functional groups attached to the quaternary nitrogen atoms.

  8. Removal of Cr(VI) onto functionalized pyridine copolymer with amide groups.

    Science.gov (United States)

    Neagu, Violeta

    2009-11-15

    New pyridine strong base anion exchange resin has been prepared by the nucleophilic substitution reaction of 4-vinylpyridine:divinylbenzene copolymer of gel structure with 2-chloroacetamide as halogenated compound. The resulting resin was used to remove Cr(VI) from the aqueous solution. Batch adsorption studies have been carried out to determine the effect of the initial concentration of Cr(VI), adsorbent dose, pH, temperature and the presence of sulfate anions as counter ions. The process was found to be pH, solid/liquid ratio and concentration dependent. The adsorption capacities increase with the increase of the initial concentration of Cr(VI) and therefore, the resin exhibited the degree of usage of the strong base exchange capacities higher than 90% and the good efficiency in the chromium removal. At acidic pH and low concentration of the hexavalent chromium the synthesized pyridine resin offer much greater chromate removal capacities compared to alkaline pH. Equilibrium modeling of the process of Cr(VI) removal was carried out by using the Langmuir and Freundlich isotherms. The experimental data obeyed these isotherm models. Thermodynamic studies were performed and the parameters namely, DeltaG degrees , DeltaH degrees and DeltaS degrees showed the spontaneous and endothermic process of the adsorption of Cr(VI) on the pyridine resin. In the competitive adsorption studies, chromate/sulfate revealed the selectivity of the pyridine adsorbents towards chromium ions. This selectivity is explained by the adsorption of the transition metal anion on the pi bonds of the pyridine ring and the formation a sandwich arrangement with chromium anion and amide functional groups attached to the quaternary nitrogen atoms. PMID:19647364

  9. Evaluation of unsaturated alkanoic acid amides as maskers of epigallocatechin gallate astringency.

    Science.gov (United States)

    Obst, Katja; Paetz, Susanne; Backes, Michael; Reichelt, Katharina V; Ley, Jakob P; Engel, Karl-Heinz

    2013-05-01

    Some foods, beverages, and food ingredients show characteristic long-lasting aftertastes. The sweet, lingering taste of high intensity sweeteners or the astringency of tea catechins are typical examples. Epigallocatechin-3-gallate (EGCG), the most abundant catechin in green tea, causes a long-lasting astringency and bitterness. These sensations are mostly perceived as aversive and are only accepted in a few foods (e.g., tea and red wine). For the evaluation of the aftertaste of such constituents over a certain period of time, Intensity Variation Descriptive Methodology (IVDM) was used. The approach allows the measurement of different descriptors in parallel in one panel session. IVDM was evaluated concerning the inter- and intraindividual differences of panelists for bitterness and astringency of EGCG. Subsequently, the test method was used as a screening tool for the identification of potential modality-selective masking compounds. In particular, the intensity of the astringency of EGCG (750 mg kg(-1)) could be significantly lowered by 18-33% during the time course by adding the trigeminal-active compound trans-pellitorine (2E,4E-decadienoic acid N-isobutyl amide 1, 5 mg kg(-1)) without significantly affecting bitterness perception. Further, structurally related compounds were evaluated on EGCG to gain evidence for possible structure-activity relationships. A more polar derivative of 1, (2S)-2-[[(2E,4E)-deca-2,4-dienoyl]amino]propanoic acid 9, was also able to reduce the astringency of EGCG similar to trans-pellitorine but without showing the strong tingling effect. PMID:23582039

  10. Physicochemical properties of pentaglyme-sodium bis(trifluoromethanesulfonyl)amide solvate ionic liquid.

    Science.gov (United States)

    Terada, Shoshi; Mandai, Toshihiko; Nozawa, Risa; Yoshida, Kazuki; Ueno, Kazuhide; Tsuzuki, Seiji; Dokko, Kaoru; Watanabe, Masayoshi

    2014-06-21

    The physicochemical properties of pentaglyme (G5) and sodium bis(trifluoromethanesulfonyl)amide (Na[TFSA]) binary mixtures were investigated with respect to salt concentration and temperature. The density, viscosity, ionic conductivity, self-diffusion coefficient, and oxidative stability of a series of binary mixtures were measured, and the mixtures were examined as electrolytes for Na secondary batteries. An equimolar mixture of G5 and Na[TFSA] formed a low melting solvate, [Na(G5)1][TFSA], which exhibited an ionic conductivity of 0.61 mS cm(-1) at 30 °C. The ionicity (Λimp/Λideal) of the glyme-Na[TFSA] mixture was estimated from the molar conductivity of electrochemical impedance measurements (Λimp) and the Walden plot (Λideal). [Na(G5)1][TFSA] possessed a high ionicity of 0.63 at 30 °C, suggesting that [Na(G5)1][TFSA] is highly dissociated into a [Na(G5)1](+) cation and a [TFSA](-) anion, regardless of the extreme salt concentration in the liquid. The oxidative stabilities of G5-Na[TFSA] mixtures were investigated by linear sweep voltammetry, and the higher concentration resulted in higher oxidative stability due to the lowering of the HOMO energy level of G5 by complexation with the Na(+) ion. In addition, battery tests were performed using the mixtures as electrolytes. The [Na|[Na(G5)1][TFSA]|Na0.44MnO2] cell showed good charge-discharge cycle stability, with a discharge capacity of ca. 100 mA h g(-1), while the [Na(G5)1.25][TFSA] system, containing excess G5, showed poor stability. PMID:24810659

  11. Characterization of titanium oxynitride films deposited by low pressure chemical vapor deposition using amide Ti precursor

    Energy Technology Data Exchange (ETDEWEB)

    Song Xuemei; Gopireddy, Deepthi [Department of Chemical Engineering, University of Illinois at Chicago, Chicago, Illinois 60607 (United States); Takoudis, Christos G. [Department of Chemical Engineering, University of Illinois at Chicago, Chicago, Illinois 60607 (United States); Department of Bioengineering, University of Illinois at Chicago, Chicago, Illinois 60607 (United States)], E-mail: takoudis@uic.edu

    2008-07-31

    In this study, we investigate the use of an amide-based Ti-containing precursor, namely tetrakis(diethylamido)titanium (TDEAT), for TiN{sub x}O{sub y} film deposition at low temperature. Traditionally, alkoxide-based Ti-containing precursor, such as titanium tetra-isopropoxide (TTIP), along with NH{sub 3} is used for titanium oxynitride (TiN{sub x}O{sub y}) film deposition. When TTIP is used, at low temperatures it is difficult to form TiN{sub x}O{sub y} films with high N/O ratios. In this study, by using TDEAT, TiN{sub x}O{sub y} films are deposited on H-passivated Si (100) substrates in a cold wall reactor at 300 {sup o}C and 106 Pa. Rutherford backscattering spectroscopy analysis shows nitrogen incorporation in the TiN{sub x}O{sub y} films to be as high as 28 at.%. X-ray photoelectron spectroscopy analysis of as-deposited films confirms the formation of{sub .} TiN{sub x}O{sub y}, while Fourier transform infrared and Raman spectra indicate that the films have amorphous structure. Moreover, there is no detectable bulk carbon impurity and no SiO{sub 2} formation at the TiN{sub x}O{sub y}/Si interface. Upon annealing the as-deposited films in air at 750 deg. C for 30 min, they oxidize to TiO{sub 2} and crystallize to form a rutile structure with a small amount of anatase phase. Based on these results, TDEAT appears to be a promising precursor for both TiN{sub x}O{sub y} and TiO{sub 2} film deposition.

  12. Business return in New Orleans: decision making amid post-Katrina uncertainty.

    Directory of Open Access Journals (Sweden)

    Nina S N Lam

    Full Text Available BACKGROUND: Empirical observations on how businesses respond after a major catastrophe are rare, especially for a catastrophe as great as Hurricane Katrina, which hit New Orleans, Louisiana on August 29, 2005. We analyzed repeated telephone surveys of New Orleans businesses conducted in December 2005, June 2006, and October 2007 to understand factors that influenced decisions to re-open amid post-disaster uncertainty. METHODOLOGY/PRINCIPAL FINDINGS: Businesses in the group of professional, scientific, and technical services reopened the fastest in the near term, but differences in the rate of reopening for businesses stratified by type became indistinguishable in the longer term (around two years later. A reopening rate of 65% was found for all businesses by October 2007. Discriminant analysis showed significant differences in responses reflecting their attitudes about important factors between businesses that reopened and those that did not. Businesses that remained closed at the time of our third survey (two years after Katrina ranked levee protection as the top concern immediately after Katrina, but damage to their premises and financing became major concerns in subsequent months reflected in the later surveys. For businesses that had opened (at the time of our third survey, infrastructure protection including levee, utility, and communications were the main concerns mentioned in surveys up to the third survey, when the issue of crime became their top concern. CONCLUSIONS/SIGNIFICANCE: These findings underscore the need to have public policy and emergency plans in place prior to the actual disaster, such as infrastructure protection, so that the policy can be applied in a timely manner before business decisions to return or close are made. Our survey results, which include responses from both open and closed businesses, overcome the "survivorship bias" problem and provide empirical observations that should be useful to improve micro

  13. An amide based dipodal Zn2+ complex for multications recognition: Nanomolar detection

    International Nuclear Information System (INIS)

    An imine-linked dipodal Zn2+ complex has been synthesized and elevated its binding affinity towards library of metal ions (Cr3+, Mn2+, Fe3+, Co2+, Ni2+, Cu2+, Zn2+, Cd2+, Hg2+, Pb2+ and Bi3+). The recognition properties of receptor 4 were performed in DMSO/H2O (50:50; v/v) and showed quenching upon interaction with Fe3+, Co2+ and Cu2+ ions. A photoinduced electron transfer (PET) is potential mechanism behind quenching. The coordination of such cations with the receptor 4 at amide part of carbonyl oxygen hindered the PET process and accordingly Turn-OFF the fluorescence of the receptor 4. The photophysical properties (fluorescence and absorption spectra) and density functional theory (DFT) clearly explains the binding mode between the receptor 4 and the detected cations. The selectivity and sensitivity of the receptor 4 for Fe3+, Co2+ and Cu2+ ions were acceptable and achieving a detection limit at the nano-molar level. - Highlights: • Zinc chemosensor Schiff base complex bearing carbonyl moieties was constructed through the selective assembly of a chemosensor. • Fluorescence spectra and density functional theory (DFT) clearly explains the binding mode between the receptor 4 and cations. • The 1:1 stoichiometry of the host guest relationship was realized from the Job's plot. • The selectivity and sensitivity of the receptor 4 for Fe3+, Co2+ and Cu2+ ions were acceptable and achieving a detection limit at the nanomolar level

  14. Antimicrobial hyperbranched poly(ester amide)/polyaniline nanofiber modified montmorillonite nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Pramanik, Sujata [Advanced Polymer and Nanomaterial Laboratory, Department of Chemical Sciences, Tezpur University, Tezpur 784028 (India); Bharali, Pranjal; Konwar, B.K. [Department of Molecular Biology and Biotechnology, Tezpur University, Tezpur 784028 (India); Karak, Niranjan, E-mail: karakniranjan@yahoo.com [Advanced Polymer and Nanomaterial Laboratory, Department of Chemical Sciences, Tezpur University, Tezpur 784028 (India)

    2014-02-01

    There has been growing interest in the use of nanomaterials featuring potent of antimicrobial activity in the biomedical domain. It still remains a challenge for the researchers to develop an efficient nanocomposite possessing antimicrobial efficacy against broad spectrum microbes including bacteria, fungi as well as algal consortium, posing serious challenges for the human survival. In addressing the above problem, we report the fabrication of bio-based hyperbranched poly(ester amide) (HBPEA)/polyaniline nanofiber modified montmorillonite (MMT) nanocomposites by an ex-situ polymerization technique at varied weight percentages (1, 2.5, 5 wt.%) of the modified MMT (nanohybrid). The Fourier transform infrared spectroscopy confirmed the structural changes upon interaction of the nanohybrid with HBPEA. A probable mechanism is proposed for the formation of nanocomposites with partially exfoliated nanoplatelet structure, which was further confirmed from the high resolution transmission electron microscopic analyses. The prepared nanocomposites exhibited potent efficacy against gram positive bacteria like Bacillus subtilis and Staphylococcus aureus as compared to the gram negative ones like Pseudomonas aeruginosa and Escherichia coli. The nanocomposites showed significant antifungal activity against Aspergillus niger, Fusarium oxysporum and Coleotricum capcii and antialgal activity against algal consortium comprising of Chlorella, Hormidium and Cladophorella species. The formation of thermosetting nanocomposites resulted in the acceptable improvement of desired physico-chemical and mechanical properties including thermostability. Thus pronounced antimicrobial activity of the nanocomposites against a spectrum of bacterial and fungal strains as well as a consortium of algal species along with other desired performance vouched them as potent antimicrobial materials in the realm of health and biomedical industry. - Highlights: • A possible approach for fabrication of the

  15. Studies on the translational and rotational motions of ionic liquids composed of N-methyl-N-propyl-pyrrolidinium (P13) cation and bis(trifluoromethanesulfonyl)amide and bis(fluorosulfonyl)amide anions and their binary systems including lithium salts

    Science.gov (United States)

    Hayamizu, Kikuko; Tsuzuki, Seiji; Seki, Shiro; Fujii, Kenta; Suenaga, Masahiko; Umebayashi, Yasuhiro

    2010-11-01

    Room-temperature ionic liquids (RTIL, IL) are stable liquids composed of anions and cations. N-methyl-N-propyl-pyrrolidinium (P13, Py13, PYR13, or mppy) is an important cation and produces stable ILs with various anions. In this study two amide-type anions, bis(trifluoromethanesulfonyl)amide [N(SO2CF3)2, TFSA, TFSI, NTf2, or Tf2N] and bis(fluorosulfonyl)amide [N(SO2F)2, FSA, or FSI], were investigated. In addition to P13-TFSA and P13-FSA, lithium salt doped samples were prepared (P13-TFSA-Li and P13-FSA-Li). The individual ion diffusion coefficients (D) and spin-lattice relaxation times (T1) were measured by H1, F19, and L7i NMR. At the same time, the ionic conductivity (σ), viscosity (η), and density (ρ) were measured over a wide temperature range. The van der Waals volumes of P13, TFSA, FSA, Li(TFSA)2, and Li(FSA)3 were estimated by molecular orbital calculations. The experimental values obtained in this study were analyzed by the classical Stokes-Einstein, Nernst-Einstein (NE), and Stokes-Einstein-Debye equations and Walden plots were also made for the neat and binary ILs to clarify physical and mobile properties of individual ions. From the temperature-dependent velocity correlation coefficients for neat P13-TFSA and P13-FSA, the NE parameter 1-ξ was evaluated. The ionicity (electrochemical molar conductivity divided by the NE conductivity from NMR) and the 1-ξ had exactly the same values. The rotational and translational motions of P13 and jump of a lithium ion are also discussed.

  16. CURING KINETICS AND THERMAL STABILITY OF EPOXY BLENDS CONTAINING PHOSPHOROUS-OXIRANE WITH AROMATIC AMIDE-AMINE AS CURING AGENTS

    Institute of Scientific and Technical Information of China (English)

    Geeta Durga; A.K.Narula

    2012-01-01

    This article describes the synthesis of a series of aromatic amide-amines and their potential use as epoxy hardeners.These amines were synthesized by the reaction of L-phenylalanine (PA) with diamines of different structures i.e.1,4-phenylene diamine (PD),1,5-diamino naphthalene (N),4,4′-(9-fluorenyllidene)-dianiline (F),4,4′-diaminodiphenyl sulphide (DS) and 3,4′-oxydianiline (O) in a stoichiometric ratio (1∶1).Structural characterization of synthesized amide-amines was done with the help of elemental analysis and spectroscopic techniques viz.FT-IR,1H-NMR and 13C-NMR.An epoxy blend was prepared by mixing tris(glycidyloxy) phosphine oxide (TGPO) with conventional epoxy i.e.diglycidyl ether of bisphenol-A (DGEBA) in an equivalent ratio of 2∶3 to incorporate phosphorous into the main chain.The curing kinetics of the epoxy blend with synthesized aromatic amide-amines was investigated by non-isothermal DSC technique using multiple heating rate method (5,10,15 and 20 K/min.).The activation energies were determined by fitting the experimental data into Kissinger and Ozawa kinetic models.The activation energies obtained through Ozawa method were slightly higher than those of Kissinger method but were comparable.However,both the energies were found to be dependent on the structure of amines.The thermal stability and weight loss behavior of isothermally cured thermosets were also investigated using thermogravimetric analysis (TGA) in nitrogen atmosphere.All the samples showed improved thermal stability in terms of char yield than using only amines as hardeners.

  17. Synthesis of monomeric and polymeric alkali and alkaline earth metal complexes using a phosphinoselenoic amide ligand in metal coordination sphere

    Indian Academy of Sciences (India)

    Jayeeta Bhattacharjee; Ravi K Kottalanka; Harinath Adimulam; Tarun K Panda

    2014-09-01

    We report the monomeric complexes of magnesium and calcium of composition [M(THF){2-Ph2P(Se)N(CMe3)}2] [M= Mg (3), n = 1 andM = Ca (4), n = 2)] and polymeric complexes of potassium and barium of composition [K(THF)2{Ph2P(Se)N(CMe3)}] (2) and [K(THF)Ba{Ph2P(Se)N(CMe3)}3](5) respectively. The potassium complex 2 was readily prepared by the reaction of potassium bis(trimethylsilyl)amide with phosphinoselenoic amide ligand (1) at ambient temperature. The calcium complex 4 was prepared by two synthetic routes: in the first method, commonly known as salt metathesis reaction, the potassium complex 2 was made to react with alkaline earth metal diiodide at room temperature to afford the corresponding calcium complex. The metal bis(trimethylsilyl)amides were made to react with protic ligand 1 in the second method to eliminate the volatile bis(trimethyl)silyl amine. The magnesium complex 3 and barium complex 5 were prepared only through the first method. Solid-state structures of all the new complexes were established by single crystal X-ray diffraction analysis. The smaller ionic radii of Mg2+ (0.72Å) and Ca2+ (0.99Å) ions form the monomeric complex, whereas the larger ions K+ (1.38Å) and Ba2+ (1.35Å) were found to form onedimensional polymeric complexes with monoanionic ligand 1. Compound 2 serves an example of magnesium complex with a Mg-Se direct bond.

  18. One-pot synthesis and antifungal activity against plant pathogens of quinazolinone derivatives containing an amide moiety.

    Science.gov (United States)

    Zhang, Jin; Liu, Jia; Ma, Yangmin; Ren, Decheng; Cheng, Pei; Zhao, Jiawen; Zhang, Fan; Yao, Yuan

    2016-05-01

    An efficient one-pot, three-component synthesis of quinazolinone derivatives containing 3-acrylamino motif was carried out using CeO2 nanoparticles as catalyst. Thirty-nine synthesized compounds were obtained with satisfied yield and elucidated by spectroscopic analysis. Four phytopathogenic fungi were chosen to test the antifungal activities by minimum inhibitory concentration (MIC) method. Compounds 4ag, 4bb, 4bc showed broad antifungal activities against at least three fungi, and dramatic effects of substituents on the activities were observed. Docking studies were established to explore the potential antifungal mechanism of quinazolinone derivatives as the chitinase inhibitors, and also verified the importance of the amide moiety. PMID:27040656

  19. Ab initio study of chemical bond interactions between covalently functionalized carbon nanotubes via amide, ester and anhydride linkages

    Science.gov (United States)

    Ben Doudou, Bessem; Chen, Jun; Vivet, Alexandre; Poilâne, Christophe

    2016-03-01

    In this paper, we have investigated the chemical bond interactions between covalently functionalized zigzag (5,0) and (8,0) SWCNT-SWCNT via various covalent linkages. Side-to-side junctions connected via amide, ester and anhydride linkages were particularly studied. The geometries and energy of the forming reaction were investigated using first-principles density functional theory. Furthermore, the band structures and the total density of states (DOS) of the junctions have also been analyzed. Our results show that several promising structures could be obtained by using chemical connection strategy and particularly the junctions formed by coupling amino functionalized SWCNT and carboxylic acid functionalized SWCNT was more favorable.

  20. Electrophilic Activation of α,β-Unsaturated Amides: Catalytic Asymmetric Vinylogous Conjugate Addition of Unsaturated γ-Butyrolactones.

    Science.gov (United States)

    Zhang, Ming; Kumagai, Naoya; Shibasaki, Masakatsu

    2016-04-11

    Although catalytic asymmetric conjugate addition reactions have remarkably advanced over the last two decades, the application of less electrophilic α,β-unsaturated carboxylic acid derivatives in this useful reaction manifold remains challenging. Herein, we report that α,β-unsaturated 7-azaindoline amides act as reactive electrophiles to participate in catalytic diastereo- and enantioselective vinylogous conjugate addition of γ-butyrolactones in the presence of a cooperative catalyst comprising of a soft Lewis acid and a Brønsted base. Reactions mostly reached completion with as little as 1 mol % of catalyst loading to give the desired conjugate adducts in a highly stereoselective manner. PMID:26970428

  1. Thermodynamics of extraction of uranium(VI) and plutonium(IV) with some long-chain aliphatic amides

    International Nuclear Information System (INIS)

    Distribution data for U(VI) and Pu(IV) from 3.5 M nitric acid medium with 0.5 M N,N-dihexyl derivatives of hexanamide (DHHA), octanamide (DHOA) and decanamide (DHDA) in n-dodecane have been obtained in the temperature range 20-50 C. From these data, the enthalpy, entropy and free energy changes associated with their extraction reactions were evaluated by the temperature coefficient method. Results indicate that the extraction reactions of U(VI) and Pu(IV) with all the three amides are predominantly enthalpy stabilised. (orig.)

  2. Gd-Complexes of New Arylpiperazinyl Conjugates of DTPA-Bis(amides): Synthesis, Characterization and Magnetic Relaxation Properties

    OpenAIRE

    Abdullah O. Ba-Salem; Nisar Ullah; M. Nasiruzzaman Shaikh; Mohamed Faiz; Zaheer Ul-Haq

    2015-01-01

    Two new DTPA-bis(amide) based ligands conjugated with the arylpiperazinyl moiety were synthesized and subsequently transformed into their corresponding Gd(III) complexes 1 and 2 of the type [Gd(L)H2O]·nH2O. The relaxivity (R1) of these complexes was measured, which turned out to be comparable with that of Omniscan®, a commercially available MRI contrast agent. The cytotoxicity studies of these complexes indicated that they are non-toxic, which reveals their potential and physiological suitabi...

  3. English amid(st) and among(st) : a contrastive approach based on Norwegian and Swedish translation data

    OpenAIRE

    Egan, Thomas; Rawoens, Gudrun

    2014-01-01

    This chapter examines the hypothesis that translation equivalents may be em-ployed to cast light on the semantic network of a lexeme in its original language. The lexemes investigated are amid(st) and among(st), which are commonly taken to overlap in meaning. The data consist of all tokens of both prepositions in the English language original texts that are common to both the English-Norwegian Parallel Corpus and the English-Swedish Parallel Corpus. A particular question addressed is how the ...

  4. The effect of pH on the toxicity of fatty acids and fatty acid amides to rainbow trout gill cells.

    Science.gov (United States)

    Bertin, Matthew J; Voronca, Delia C; Chapman, Robert W; Moeller, Peter D R

    2014-01-01

    Harmful algal blooms (HABs) expose aquatic organisms to multiple physical and chemical stressors during an acute time period. Algal toxins themselves may be altered by water chemistry parameters affecting their bioavailability and resultant toxicity. The purpose of this study was to determine the effects of two abiotic parameters (pH, inorganic metal salts) on the toxicity of fatty acid amides and fatty acids, two classes of lipids produced by harmful algae, including the golden alga, Prymnesium parvum, that are toxic to aquatic organisms. Rainbow trout gill cells were used as a model of the fish gill and exposed to single compounds and mixtures of compounds along with variations in pH level and concentration of inorganic metal salts. We employed artificial neural networks (ANNs) and standard ANOVA statistical analysis to examine and predict the effects of these abiotic parameters on the toxicity of fatty acid amides and fatty acids. Our results demonstrate that increasing pH levels increases the toxicity of fatty acid amides and inhibits the toxicity of fatty acids. This phenomenon is reversed at lower pH levels. Exposing gill cells to complex mixtures of chemical factors resulted in dramatic increases in toxicity compared to tests of single compounds for both the fatty acid amides and fatty acids. These findings highlight the potential of physicochemical factors to affect the toxicity of chemicals released during algal blooms and demonstrate drastic differences in the effect of pH on fatty acid amides and fatty acids. PMID:24240104

  5. Carbonyl 13C NMR spectrum of basin pancreatic trypsin inhibitor: resonance assignments by selective amide hydrogen isotope labeling and detection of isotope effects on 13C nuclear shielding

    International Nuclear Information System (INIS)

    The carbonyl region of the natural abundance 13C nuclear magnetic resonance (NMR) spectrum of basic pancreatic trypsin inhibitor is examined, and 65 of the 66 expected signals are characterized at varying pH and temperature. Assignments are reported for over two-thirds of the signals, including those of all buried backbone amide groups with slow proton exchange and all side-chain carbonyl groups. This is the first extensively assigned carbonyl spectrum for any protein. A method for carbonyl resonance assignments utilizing amide proton exchange and isotope effects on nuclear shielding is described in detail. The assignments are made by establishing kinetic correlation between effects of amide proton exchange observed in the carbonyl 13C region with development of isotope effects and in the amide proton region with disappearance of preassigned resonances. Several aspects of protein structure and dynamics in solution may be investigated by carbonyl 13C NMR spectroscopy. Some effects of side-chain primary amide group hydrolysis are described. The main interest is on information about intramolecular hydrogen-bond energies and changes in the protein due to amino acid replacements by chemical modification or genetic engineering

  6. Dihydro-CDDO-trifluoroethyl amide suppresses inflammatory responses in macrophages via activation of Nrf2

    Energy Technology Data Exchange (ETDEWEB)

    Li, Bin [Shandong University Qilu Hospital Research Center for Cell Therapy, Key Laboratory of Cardiovascular Remodeling and Function Research, Qilu Hospital of Shandong University, Jinan 250012 (China); Department of Cell Biology and Anatomy, University of South Carolina School of Medicine, Columbia, SC 29208 (United States); Abdalrahman, Akram; Lai, Yimu; Janicki, Joseph S. [Department of Cell Biology and Anatomy, University of South Carolina School of Medicine, Columbia, SC 29208 (United States); Ward, Keith W.; Meyer, Colin J. [Department of Pharmacology, Reata Pharmaceuticals, Inc., Irving, TX 75063 (United States); Wang, Xing Li [Shandong University Qilu Hospital Research Center for Cell Therapy, Key Laboratory of Cardiovascular Remodeling and Function Research, Qilu Hospital of Shandong University, Jinan 250012 (China); Tang, Dongqi, E-mail: Dongqi.Tang@uscmed.sc.edu [Shandong University Qilu Hospital Research Center for Cell Therapy, Key Laboratory of Cardiovascular Remodeling and Function Research, Qilu Hospital of Shandong University, Jinan 250012 (China); Department of Cell Biology and Anatomy, University of South Carolina School of Medicine, Columbia, SC 29208 (United States); Cui, Taixing, E-mail: taixing.cui@uscmed.sc.edu [Shandong University Qilu Hospital Research Center for Cell Therapy, Key Laboratory of Cardiovascular Remodeling and Function Research, Qilu Hospital of Shandong University, Jinan 250012 (China); Department of Cell Biology and Anatomy, University of South Carolina School of Medicine, Columbia, SC 29208 (United States)

    2014-02-21

    Highlights: • Dh404 suppresses the expression of a selected set of pro-inflammatory cytokines in inflamed macrophages via activating Nrf2. • Dh404 activates Nrf2 while keeping Keap1 function intact in macrophages. • Dh404 minimally regulates NF-κB pathway in macrophages. - Abstract: Nuclear factor erythroid 2-related factor (Nrf2) is the major regulator of cellular defenses against various pathological stresses in a variety of organ systems, thus Nrf2 has evolved to be an attractive drug target for the treatment and/or prevention of human disease. Several synthetic oleanolic triterpenoids including dihydro-CDDO-trifluoroethyl amide (dh404) appear to be potent activators of Nrf2 and exhibit chemopreventive promises in multiple disease models. While the pharmacological efficacy of Nrf2 activators may be dependent on the nature of Nrf2 activation in specific cell types of target organs, the precise role of Nrf2 in mediating biological effects of Nrf2 activating compounds in various cell types remains to be further explored. Herein we report a unique and Nrf2-dependent anti-inflammatory profile of dh404 in inflamed macrophages. In lipopolysaccharide (LPS)-inflamed RAW264.7 macrophages, dh404 dramatically suppressed the expression of pro-inflammatory cytokines including inducible nitric oxide synthase (iNOS), monocyte chemotactic protein-1 (MCP-1), and macrophage inflammatory protein-1 beta (MIP-1β), while minimally regulating the expression of interleulin-6 (IL-6), IL-1β, and tumor necrosis factor alpha (TNFα). Dh404 potently activated Nrf2 signaling; however, it did not affect LPS-induced NF-κB activity. Dh404 did not interrupt the interaction of Nrf2 with its endogenous inhibitor Kelch-like ECH associating protein 1 (Keap1) in macrophages. Moreover, knockout of Nrf2 blocked the dh404-induced anti-inflammatory responses in LPS-inflamed macrophages. These results demonstrated that dh404 suppresses pro-inflammatory responses in macrophages via an activation

  7. The influence of amine/amide versus bisamide coordination in nickel superoxide dismutase.

    Science.gov (United States)

    Neupane, Kosh P; Shearer, Jason

    2006-12-25

    Nickel superoxide dismutase (NiSOD) is a mononuclear nickel-containing metalloenzyme that catalyzes the disproportionation of superoxide by cycling between NiII and NiIII oxidation states. In the reduced NiII oxidation state, the metal center is ligated by two cysteinate sulfurs, one amide nitrogen, and one amine nitrogen (from the N-terminus), while in the oxidized NiIII state, an imidazole nitrogen coordinates to the metal center. Herein, we expand on a previous report in which we described a functional metallopeptide-based NiSOD model compound [NiII(SODM1)] (SODM1 = H2N-HCDLPCGVYDPA-COOH) by exploring how acylation of the N-terminus (producing [NiII(SODM1-Ac)]) influences the properties of the metallopeptide. Titration results, GPC data, and mass-spectrometry data demonstrate that NiII coordinates to SODM1-Ac in a 1:1 ratio, while variable pH studies show that NiII coordination is strong at a pH of 7.5 and above but not observed below a pH of 6.2. This is higher than [NiII(SODM1)] by approximately 1.0 pH unit consistent with bisamide ligation. Ni K-edge XAS demonstrates that the NiII center is coordinated in a square-planar NiN2S2 coordination environment with Ni-N distances of 1.846(4) A and Ni-S distances of 2.174(3) A. Comparison of the electronic absorption and CD spectrum of [NiII(SODM1)] versus [NiII(SODM1-Ac)] in conjunction with time-dependent DFT calculations suggests a decrease in Ni covalency in the acylated versus unacylated metallopeptide. This decrease in covalency was also supported by DFT calculations and Ni L-edge XAS. [NiII(SODM1-Ac)] has a quasireversible NiII/NiIII redox couple of 0.49(1) V vs Ag/AgCl, which represents a -0.2 V shift compared with [NiII(SODM1)], while the peak separation suggests a change in the coordination environment upon oxidation (i.e., axial imidazole ligation). Using the xanthine/xanthine oxidase assay, we determine that [NiII(SODM1-Ac)] is less active than [NiII(SODM1)] by over 2 orders of magnitude (IC50 = 3(1) x 10

  8. Palladium-catalyzed C–N and C–O bond formation of N-substituted 4-bromo-7-azaindoles with amides, amines, amino acid esters and phenols

    Directory of Open Access Journals (Sweden)

    Rajendra Surasani

    2012-11-01

    Full Text Available Simple and efficient procedures for palladium-catalyzed cross-coupling reactions of N-substituted 4-bromo-7-azaindole (1H-pyrrole[2,3-b]pyridine, with amides, amines, amino acid esters and phenols through C–N and C–O bond formation have been developed. The C–N cross-coupling reaction of amides, amines and amino acid esters takes place rapidly by using the combination of Xantphos, Cs2CO3, dioxane and palladium catalyst precursors Pd(OAc2/Pd2(dba3. The combination of Pd(OAc2, Xantphos, K2CO3 and dioxane was found to be crucial for the C–O cross-coupling reaction. This is the first report on coupling of amides, amino acid esters and phenols with N-protected 4-bromo-7-azaindole derivatives.

  9. Influence of physico-chemical parameters of some barbituric acid derivatives on their retention on an amide embedded RP silica column.

    Science.gov (United States)

    Jakab, Annamaria; Prodan, Miklos; Forgács, Esther

    2002-03-01

    Retention parameters of 45 different barbituric acid derivatives were determined on an amide embedded RP silica column (Discovery RP-AmideC16) using non-buffered water-acetonitrile eluent systems. Linear correlation were calculated between the logarithm of the capacity factor and the acetonitrile concentration in the eluent. To determine the retention behavior of barbituric acid derivatives, stepwise regression analysis (SRA) and principal component analysis (PCA) followed by two-dimensional nonlinear and modified nonlinear mapping was used. It can be concluded, the retention of barbituric acid derivatives are governed mainly by the steric parameters of the substituents. Principal component analysis indicated that the barbituric acid derivatives have mixed retention on this amide embedded RP silica column in water-acetonitrile eluent. PMID:11836055

  10. Identification of the growth hormone-releasing hormone analogue [Pro1, Val14]-hGHRH with an incomplete C-term amidation in a confiscated product.

    Science.gov (United States)

    Esposito, Simone; Deventer, Koen; Van Eenoo, Peter

    2014-01-01

    In this work, a modified version of the 44 amino acid human growth hormone-releasing hormone (hGHRH(1-44)) containing an N-terminal proline extension, a valine residue in position 14, and a C-terminus amidation (sequence: PYADAIFTNSYRKVVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 ) has been identified in a confiscated product by liquid chromatography-high resolution mass spectrometry (LC-HRMS). Investigation of the product suggests also an incomplete C-term amidation. Similarly to other hGHRH analogues, available in black markets, this peptide can potentially be used as performance-enhancing drug due to its growth hormone releasing activity and therefore it should be considered as a prohibited substance in sport. Additionally, the presence of partially amidated molecule reveals the poor pharmaceutical quality of the preparation, an aspect which represents a big concern for public health as well. PMID:25283153

  11. Isolation of mRNA and a cell free protein synthesizing system for the synthesis of amidating enzyme from the nuclei of gamma irradiated potato buds

    International Nuclear Information System (INIS)

    mRNA required for the synthesis of amidating enzyme in the nuclear fraction of γ-irradiated potato buds, has been isolated using poly (U) sepharose 4B affinity chromatography, and sucrose density gradient centrifugation. A cell-free protein synthesizing system has been obtained from the irradiated potato bud nuclei, capable of in vitro synthesis of this enzyme protein in the presence of mRNA. Unirradiated bud tissue nuclei does not contain the mRNA for this protein. mRNA isolated can also be translated with wheat germ system to give the amidating enzyme. Separation of this mRNA on 5-20% sucrose density gradient shows that mRNA amidating enzyme is 9S type. (auth.)

  12. New optically active poly(amide-imide)s derived from N,N'-(4,4-diphthaloyl)-bis-L-leucine and hydantoin derivatives: Synthesis and properties

    Institute of Scientific and Technical Information of China (English)

    Khalil Faghihi

    2009-01-01

    Six new optically active poly(amide-imide)s (5a-f) were synthesized through the direct polycondensation reaction of N,N'-(4,4'-diphthaloyl)-bis-L-leucine (3) with six hydantoin derivatives (4a-f). Triphenyl phosphlte (TPP)/pyridine in the presence of calcium chloride (CaCl_2) and N-methyl-2-pyrrolidone (NMP) were successfully applied for direct polycondensation. The polycondensation reactions produce a series of new poly(amide-imide)s (Sa-f) in high yields, and inherent viscosity between 0.42 and 0.55 dL/g. The resulting poly(amide-imide)s (Sa-f) were characterized by elemental analysis, viscosity measurements, thermal gravimetric analysis (TGA and DTG), solubility test and FT-IR spectroscopy.

  13. Glucagonlike peptide-I-(7-36)-amide receptors only in islets of Langerhans. Autoradiographic survey of extracerebral tissues in rats

    DEFF Research Database (Denmark)

    Orskov, C; Poulsen, Steen Seier

    1991-01-01

    We demonstrated specific binding of the insulin-releasing hormone glucagonlike peptide (GLP)-I-(7-36)-amide, an intestinal product of proglucagon, to pancreatic islet cells by autoradiography using 125I-labeled GLP-I-(7-36)-amide incubated with tissue specimens of extracerebral rat organs. We also...... found binding of 125I-GLP-I to insulin-, glucagon-, and somatostatin-immunoreactive cells by combined autoradiographic and immunohistochemical analysis of pancreatic specimens using antisera against insulin, glucagon, and somatostatin. An accumulation of radioactivity was also observed in the stomach...... surface epithelium but could not be prevented by excess unlabeled peptide. No binding was found in other tissues investigated, including the lungs and the small intestinal mucosa. Localization of the binding sites identifies the pancreatic islets as the prime target for GLP-I-(7-36)-amide and suggests...

  14. The antagonistic metabolite of GLP-1, GLP-1 (9-36)amide, does not influence gastric emptying and hunger sensations in man

    DEFF Research Database (Denmark)

    Nagell, Carl Frederic; Pedersen, Jan F; Holst, Jens Juul

    2007-01-01

    OBJECTIVE: Glucagon-like peptide-1 (GLP-1 (7-36)amide) is an intestinal hormone that is released in response to meal ingestion. GLP-1 reduces postprandial gastric and exocrine pancreatic secretion and is believed to inhibit gastric emptying. Furthermore, GLP-1 may play a role in hunger and thirst......-36)amide (5 pmol/kg body wt/min) resulting in supraphysiological concentrations. RESULTS: Infusion of GLP-1 (9-36)amide had no effect on gastric emptying or the sensation of hunger compared to saline. CONCLUSIONS: Our findings suggests that the rapid formation of the antagonistic metabolite does...... not influence gastric emptying and hunger ratings in humans even when it is present in supraphysiological concentrations....

  15. Environmentally benign synthesis of amides and ureas via catalytic dehydrogenation coupling of volatile alcohols and amines in a Pd-Ag membrane reactor

    KAUST Repository

    Chen, Tao

    2016-05-31

    In this study, we report the direct synthesis of amides and ureas via the catalytic dehydrogenation of volatile alcohols and amines using the Milstein catalyst in a Pd-Ag/ceramic membrane reactor. A series of amides and ureas, which could not be synthesized in an open system by catalytic dehydrogenation coupling, were obtained in moderate to high yields via catalytic dehydrogenation of volatile alcohols and amines. This process could be monitored by the hydrogen produced. Compared to the traditional method of condensation, this catalytic system avoids the stoichiometric pre-activation or in situ activation of reagents, and is a much cleaner process with high atom economy. This methodology, only possible by employing the Pd-Ag/ceramic membrane reactor, not only provides a new environmentally benign synthetic approach of amides and ureas, but is also a potential method for hydrogen storage.

  16. Dielectric behaviour of some amides and formamides dissolved in nonpolar solvents under static electric field

    Indian Academy of Sciences (India)

    S Sahoo; S K Sit

    2011-08-01

    Structural and associational aspects of polar amides () like formamide, acetamide, Nmethyl acetamide (NMA), N,N-dimethyl formamide (DMF), N,N-dimethyl acetamide (DMA) and acetanilide dissolved in the nonpolar solvent () benzene or 1,4-dioxan have been estimated from the measured static relative permittivity 0 and high-frequency permittivity ∞ at different weight fractions s of polar solute at 35°C under static electric field using Debye model of polar liquid molecule. The static dipole moments s are compared with s reported from conductivity method and theoretical theos to get exact cal $\\cdot$ theos of the molecules are predicted from the available bond angles and bond moments where difference in electron affinity exists between two adjacent atoms of a polar group due to inductive, mesomeric and electromeric effects in them. Solute–solute molecular association for NMA in benzene and solute–solvent association for other amides are ascertained to arrive at their conformational structures.

  17. Intracellular Self-Assembly of Cyclic d-Luciferin Nanoparticles for Persistent Bioluminescence Imaging of Fatty Acid Amide Hydrolase.

    Science.gov (United States)

    Yuan, Yue; Wang, Fuqiang; Tang, Wei; Ding, Zhanling; Wang, Lin; Liang, Lili; Zheng, Zhen; Zhang, Huafeng; Liang, Gaolin

    2016-07-26

    Fatty acid amide hydrolase (FAAH) overexpression induces several disorder symptoms in nerve systems, and therefore long-term tracing of FAAH activity in vivo is of high importance but remains challenging. Current bioluminescence (BL) methods are limited in detecting FAAH activity within 5 h. Herein, by rational design of a latent BL probe (d-Cys-Lys-CBT)2 (1), we developed a "smart" method of intracellular reduction-controlled self-assembly and FAAH-directed disassembly of its cyclic d-luciferin-based nanoparticles (i.e., 1-NPs) for persistent BL imaging of FAAH activity in vitro, in cells, and in vivo. Using aminoluciferin methyl amide (AMA), Lys-amino-d-luciferin (Lys-Luc), and amino-d-luciferin (NH2-Luc) as control BL probes, we validated that the persistent BL of 1 from luciferase-expressing cells or tumors was controlled by the activity of intracellular FAAH. With the property of long-term tracing of FAAH activity in vivo of 1, we envision that our BL precursor 1 could probably be applied for in vivo screening of FAAH inhibitors and the diagnosis of their related diseases (or disorders) in the future. PMID:27348334

  18. Synthesis, characterization and properties of novel amide derivatives based open-chain crown ether and their Tb (III) complexes

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Yanhong; He, Wei [School of Chemistry and Chemical Engineering, Hunan University, Changsha 410082 (China); Yang, Zehui [School of Chemical Engineering, Ningbo University of Technology, Ningbo 315016 (China); Chen, Yanwen [Hunan Labour Protection Institute of Nonferrous Metals, Changsha 410014 (China); Wang, Xinwei [School of Chemistry and Chemical Engineering, Hunan University, Changsha 410082 (China); Guo, Dongcai, E-mail: dcguo2001@hnu.edu.cn [School of Chemistry and Chemical Engineering, Hunan University, Changsha 410082 (China)

    2015-04-15

    Six amide-based open-chain crown ether and their solid complexes with terbium nitrates were synthesized. The target complexes were characterized by elemental analysis, mass spectra, EDTA titrimetric analysis, thermal analysis, molar conductivity, infrared spectra and UV–vis spectra. Luminescence properties of the ligands and the corresponding complexes in solid were studied. The results showed that the introduction of electron-donating group to the ligand enhanced the luminescence intensity of the corresponding complex, but electron-withdrawing group conversely. Meanwhile, among all complexes, the luminescence quantum yield of the complex Tb(NO{sub 3}){sub 3}Y{sup 1} was highest up to 0.76. Electrochemical properties were also investigated, and the results showed that the introduction of electron-donating group to the ligand enhanced the highest occupied molecular orbit (HOMO) and the lowest unoccupied molecular orbit (LUMO) energy level, but electron-withdrawing group conversely. And these target complexes may possibly be useful for studying in organic light-emitting devices field. - Highlights: • Novel amide derivatives based open-chain crown ether and their Tb (III) complexes were prepared and characterized. • The target complexes presented high thermodynamic stability. • Influence of the substituent on luminescence intensity and electrochemical property were discussed.

  19. Preparation and surface active properties of oxypropylated diol monoesters of fatty acids with an amide oxime terminal group

    Directory of Open Access Journals (Sweden)

    Eissa, A. M.F.

    1994-10-01

    Full Text Available Locally produced non-edible oil, namely, rice bran oil (R.B.O. was utilized as starting materials for preparing new nonionic surfactant. Oxypropylated diol monoesters of linoleic and rice bran oil fatty acids were prepared. Also amide oxime derivatives were obtained. Surface active properties of these compounds were measured. Under neutral condition amide eximes served as nonionic surfactants and their properties were similar to other oxypropylated monoesters.

    Se ha utilizado un aceite no comestible de producción local, denominado, aceite de salvado de arroz (R.B.O. como materia prima para la preparación de nuevos tensioactivos no iónicos. Se prepararon diol monoésteres oxipropilados de ácido linoleico y ácidos grasos de aceite de salvado de arroz. También se obtuvieron los derivados de amido oxima. Se midieron las propiedades de tensión superficial de estos compuestos. Bajo condiciones neutras las amido eximas sirvieron como tensioactivos no iónicos y sus propiedades fueron similares a los de otros monoésteres oxipropilados.

  20. On the Formation of Amide Polymers via Carbonyl-Amino Group Linkages in Energetically Processed Ices of Astrophysical Relevance

    Science.gov (United States)

    Förstel, Marko; Maksyutenko, Pavlo; Jones, Brant M.; Sun, Bing J.; Lee, Huan C.; Chang, Agnes H. H.; Kaiser, Ralf I.

    2016-04-01

    We report on the formation of organic amide polymers via carbonyl-amino group linkages in carbon monoxide and ammonia bearing energetically processed ices of astrophysical relevance. The first group comprises molecules with one carboxyl group and an increasing number of amine moieties starting with formamide (45 u), urea (60 u), and hydrazine carboxamide (75 u). The second group consists of species with two carboxyl (58 u) and up to three amine groups (73 u, 88 u, and 103 u). The formation and polymerization of these linkages from simple inorganic molecules via formamide und urea toward amide polymers is discussed in an astrophysical and astrobiological context. Our results show that long chain molecules, which are closely related to polypeptides, easily form by energetically processing simple, inorganic ices at very low temperatures and can be released into the gas phase by sublimation of the ices in star-forming regions. Our experimental results were obtained by employing reflectron time-of-flight mass spectroscopy, coupled with soft, single photon vacuum ultraviolet photoionization; they are complemented by theoretical calculations.

  1. Effect of Amide Hydrogen Bonding Interaction on Supramolecular Self‐Assembly of Naphthalene Diimide Amphiphiles with Aggregation Induced Emission

    Science.gov (United States)

    Ghule, Namdev V.; La, Duong Duc; Bhosale, Rajesh S.; Al Kobaisi, Mohammad; Raynor, Aaron M.

    2016-01-01

    Abstract In the present work, two new naphthalene diimide (NDI) amphiphiles, NDI‐N and NDI‐NA, were successfully synthesized and employed to investigate their self‐assembly and optical properties. For NDI‐NA, which contains an amide group, aggregation‐induced emission enhancement (AIEE) was demonstrated in the presence of various ratios of methylcyclohexane (MCH) in chloroform, which led to the visual color changes. This new amide‐containing NDI‐NA amphiphile formed nanobelt structures in chloroform/MCH (10:90, v/v) and microcup‐like morphologies in chloroform/MCH (5:95, v/v). The closure of these microcups led to the formation of vesicles and microcapsules. The structural morphologies gained from the solvophobic control of NDI‐NA were confirmed by various complementary techniques such as infrared spectroscopy, X‐ray diffraction, and scanning and transmission electron microscopy. In the absence of the amide moiety in NDI‐N, no self‐assembly was observed, indicating the fundamental role of H‐bonding in the self‐association process.

  2. Synthesis, characterization and properties of novel amide derivatives based open-chain crown ether and their Tb (III) complexes

    International Nuclear Information System (INIS)

    Six amide-based open-chain crown ether and their solid complexes with terbium nitrates were synthesized. The target complexes were characterized by elemental analysis, mass spectra, EDTA titrimetric analysis, thermal analysis, molar conductivity, infrared spectra and UV–vis spectra. Luminescence properties of the ligands and the corresponding complexes in solid were studied. The results showed that the introduction of electron-donating group to the ligand enhanced the luminescence intensity of the corresponding complex, but electron-withdrawing group conversely. Meanwhile, among all complexes, the luminescence quantum yield of the complex Tb(NO3)3Y1 was highest up to 0.76. Electrochemical properties were also investigated, and the results showed that the introduction of electron-donating group to the ligand enhanced the highest occupied molecular orbit (HOMO) and the lowest unoccupied molecular orbit (LUMO) energy level, but electron-withdrawing group conversely. And these target complexes may possibly be useful for studying in organic light-emitting devices field. - Highlights: • Novel amide derivatives based open-chain crown ether and their Tb (III) complexes were prepared and characterized. • The target complexes presented high thermodynamic stability. • Influence of the substituent on luminescence intensity and electrochemical property were discussed

  3. Cysteine amide adduct formation from carboxylic acid drugs via UGT-mediated bioactivation in human liver microsomes.

    Science.gov (United States)

    Harada, H; Toyoda, Y; Endo, T; Kobayashi, M

    2015-10-01

    Although chemical trapping has been widely used to evaluate cytochrome P450-mediated drug bioactivation, thus far, only a few in vitro-trapping studies have been performed on UDP-glucuronosyltransferase (UGT)-mediated drug bioactivation. In this study, we used cysteine (Cys) as trapping agent to gain new insights into the UGT-mediated bioactivation involving acyl glucuronides of carboxylic acid drugs. Diclofenac, ketoprofen and ibuprofen were incubated in human liver microsomes with UDPGA and Cys, followed by analysis using ultra-performance liquid chromatography-quadrupole time-of-flight mass spectrometry (UPLC-QTOF/MS). The N-acyl-Cys amide adduct of diclofenac was characterized by mass analysis and was detectable even in photodiode array analysis. Our data indicated that the formation of such adducts reflects the reactivity of the corresponding acyl glucuronides. In addition, it was suggested that the adduct formation requires an N-terminal Cys moiety with both a free amine and a free thiol group, from the results using various cysteine derivatives. We propose that the S-acyl-Cys thioester adduct can form via transacylation of an acyl glucuronide and can then form to an N-acyl-Cys amide adduct through intramolecular S- to N-acyl rearrangement. This series of the reactions has important implications as a possible bioactivation mechanism for covalent binding of carboxylic acid drugs to macromolecules. PMID:26601426

  4. Three-Dimensional Protein Fold Determination from Backbone Amide Pseudocontact Shifts Generated by Lanthanide Tags at Multiple Sites

    KAUST Repository

    Yagi, Hiromasa

    2013-06-01

    Site-specific attachment of paramagnetic lanthanide ions to a protein generates pseudocontact shifts (PCS) in the nuclear magnetic resonance (NMR) spectra of the protein that are easily measured as changes in chemical shifts. By labeling the protein with lanthanide tags at four different sites, PCSs are observed for most amide protons and accurate information is obtained about their coordinates in three-dimensional space. The approach is demonstrated with the chaperone ERp29, for which large differences have been reported between X-ray and NMR structures of the C-terminal domain, ERp29-C. The results unambiguously show that the structure of rat ERp29-C in solution is similar to the crystal structure of human ERp29-C. PCSs of backbone amides were the only structural restraints required. Because these can be measured for more dilute protein solutions than other NMR restraints, the approach greatly widens the range of proteins amenable to structural studies in solution. © 2013 Elsevier Ltd. All rights reserved.

  5. Effects of electron beam irradiation on the property behaviour of poly(ether-block-amide) blended with various stabilisers

    International Nuclear Information System (INIS)

    Radiosterilisation can induce modifications and/or degradation to transpire in poly(ether-block-amide) (PEBA) following irradiation. The current investigation utilises combined synergistic mixtures of stabilisers to minimise these effects, by melt blending them with the PEBA material. Hindered amine stabilisers (HAS), primary antioxidants and secondary antioxidants were the stabilisers incorporate to reduce/eliminate the effects of 50 kGy electron beam irradiation dose on the material. Results were discussed by comparing the stabilising efficiency of mixtures on the PEBA material in contrast to the control sample. Dynamic frequency sweeps demonstrated the formation of crosslinks, where the degree of crosslinking was dependent on the combination of stabilisers mixed in the base material (PEBA). The storage modulus displayed that PEBA blended with Irganox 565 had very slight changes in contrast to all other samples following irradiation. However, since this sample is a phenol containing system, severe discolouration was observed in comparison to other samples due to the oxidation of the hindered phenol. Overall, this study provides compelling evidence that a combined synergistic mixture of Irganox 565 (multifunctional phenolic antioxidant) and Tinuvin 783 (hindered amide light stabiliser) with PEBA, resulted in the best radiation stability. - Highlights: • PEBA was melt blended with various stabilisers. • All virgin and blended PEBA samples were exposed to electron beam irradiation. • The incorporation of stabilisers into the PEBA material resulted in discolouration. • PEBA blended with Irganox 565 and Tinuvin 783 improved the radiation resistance

  6. Syntheses, characterization, and anti-cancer activities of pyridine-amide based compounds containing appended phenol or catechol groups

    Indian Academy of Sciences (India)

    Afsar Ali; Deepak Bansal; Nagendra K Kaushik; Neha Kaushik; Neha Kaushik; Eun Ha Choi; Rajeev Gupta

    2014-07-01

    Several pyridine-amide compounds appended with phenol/catechol groups are synthesized. These compounds consist of protected or deprotected phenol/catechol groups and offer pyridine, amide, and phenol/catechol functional groups. All compounds have been well-characterized by various spectroscopic methods, elemental analysis, thermal studies, and crystallography. The biological activities of all compounds were investigated while a few compounds significantly decreased the metabolic viability, growth and clonogenicity of T98G cells in dose dependent manner. Accumulation of ROS was observed in T98G cells, which displayed a compromised redox status as evident from increased cellular Caspase 3/7 activity and formation of micronuclei. The in silico pharmacokinetic studies suggest that all compounds have good bioavailability, water solubility and other drug-like parameters. A few compounds were identified as the lead molecules for future investigation due to their: (a) high activity against T98G brain, H-460 lung, and SNU-80 thyroid cancer cells; (b) low cytotoxicity in non-malignant HEK and MRC-5 cells; (c) low toxic risks based on in silico evaluation; (d) good theoretical oral bioavailability according to Lipinski ‘rule of five’ pharmacokinetic parameters; and (e) better drug-likeness and drug-score values.

  7. Analysis of Piperaceae germplasm by HPLC and LCMS: a method for isolating and identifying unsaturated amides from Piper spp extracts.

    Science.gov (United States)

    Scott, Ian M; Puniani, Evaloni; Jensen, Helen; Livesey, John F; Poveda, Luis; Sanchez-Vindas, Pablo; Durst, Tony; Arnason, John T

    2005-03-23

    A method for extraction and high performance liquid chromatography-mass spectrometer (HPLC-MS) analysis of the medicinally important genus Piper (Piperaceae) was developed. This allows for a rapid and accurate measure of unsaturated amides, or piperamides, in black pepper, Piper nigrum L., and in wild species from Central America. Reflux extraction provided the highest recovery of piperine (>80%) from leaf and peppercorn material. HPLC analysis using a binary gradient of acetonitrile and water separated the major amide peaks between 5 and 12 min. Atmospheric pressure chemical ionization (APCI)-MS improved the detection limit to 0.2 ng, 10-fold below the 2 ng limit of the HPLC-diode array detector (DAD) based on linear standard curves between 0.1 and 250 microg/mL (R2 = 0.999). The HPLC-MS method identified pellitorine, piperylin, 4,5-dihydropiperlonguminine, piperlonguminine, 4,5-dihydropiperine, piperine, and pipercide. The biological activity of six Costa Rican Piper species assessed by mosquito larval bioassays correlated well with piperamide content. PMID:15769112

  8. Physicochemical and electrochemical properties of N-methyl-N-methoxymethylpyrrolidinium bis(fluorosulfonyl)amide and its lithium salt composites

    Science.gov (United States)

    Horiuchi, Shunsuke; Yoshizawa-Fujita, Masahiro; Takeoka, Yuko; Rikukawa, Masahiro

    2016-09-01

    The ionic liquid (IL) N-Methyl-N-methoxymethylpyrrolidinium bis(fluorosulfonyl)amide ([Pyr1,1O1][FSA]) was synthesized, and its physicochemical and electrochemical properties were investigated with respect to its application as an electrolyte in lithium-ion secondary batteries operating over a wide temperature range. [Pyr1,1O1][FSA]/Li salt (0.34 mol kg-1) composites were prepared by adding lithium bis(trifluoromethylsulfonyl)amide (LiTFSA) into the IL. [Pyr1,1O1][FSA] and [Pyr1,1O1][FSA]/LiTFSA exhibited melting temperatures (Tm) below -30 °C. [Pyr1,1O1][FSA] exhibited a higher ionic conductivity value as compared with that of the corresponding IL with only alkyl substituents. The electrochemical window for both [Pyr1,1O1][FSA] and [Pyr1,1O1][FSA]/LiTFSA was 5.1 V. Stable lithium deposition and dissolution occurred on a Ni electrode at 25 °C.

  9. Synthesis and evaluation of fatty acid amides on the N-oleoylethanolamide-like activation of peroxisome proliferator activated receptor α.

    Science.gov (United States)

    Takao, Koichi; Noguchi, Kaori; Hashimoto, Yosuke; Shirahata, Akira; Sugita, Yoshiaki

    2015-01-01

    A series of fatty acid amides were synthesized and their peroxisome proliferator-activated receptor α (PPAR-α) agonistic activities were evaluated in a normal rat liver cell line, clone 9. The mRNAs of the PPAR-α downstream genes, carnitine-palmitoyltransferase-1 and mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase, were determined by real-time reverse transcription-polymerase chain reaction (RT-PCR) as PPAR-α agonistic activities. We prepared nine oleic acid amides. Their PPAR-α agonistic activities were, in decreasing order, N-oleoylhistamine (OLHA), N-oleoylglycine, Oleamide, N-oleoyltyramine, N-oleoylsertonin, and Olvanil. The highest activity was found with OLHA. We prepared and evaluated nine N-acylhistamines (N-acyl-HAs). Of these, OLHA, C16:0-HA, and C18:1Δ(9)-trans-HA showed similar activity. Activity due to the different chain length of the saturated fatty acid peaked at C16:0-HA. The PPAR-α antagonist, GW6471, inhibited the induction of the PPAR-α downstream genes by OLHA and N-oleoylethanolamide (OEA). These data suggest that N-acyl-HAs could be considered new PPAR-α agonists. PMID:25832022

  10. Study on Syntheses and Anti-bacterial Activities of Some New Transition Metal Complexes with Schiff Base Ligand Containing Pyridine and Amide Moieties

    Institute of Scientific and Technical Information of China (English)

    LI, Mei-Ying(李美英); HU, Pei-Zhi(胡培植); ZHU, Jun-Cheng(朱军成); LIU, Yi(刘义); XU,Kuo-Xi(徐括喜)

    2004-01-01

    Several new transition metal complexes using Schiff base containing pyridine and amide moieties (N, N'-bis(β- salicylaliminoethyl)-2, 6-pyridinedicarboxylic amide, H4L) as the ligand have been prepared. Their compositions and structures are corroborated by elemental analysis, IR, UV, 1H NMR, DTA-TG and molar conductivity data. Their anti-bacterial activities have been studied by microcalorimetry. The result shows that the ligand and all complexes are potential anti-bacteria reagent and their inhibitory capacities are concentration-depended. The Mn complex has the strongest inhibitory capacity.

  11. The dipeptide Phe-Phe amide attenuates signs of hyperalgesia, allodynia and nociception in diabetic mice using a mechanism involving the sigma receptor system

    OpenAIRE

    Ohsawa Masahiro; Carlsson Anna; Asato Megumi; Koizumi Takayuki; Nakanishi Yuki; Fransson Rebecca; Sandström Anja; Hallberg Mathias; Nyberg Fred; Kamei Junzo

    2011-01-01

    Abstract Background Previous studies have demonstrated that intrathecal administration of the substance P amino-terminal metabolite substance P1-7 (SP1-7) and its C-terminal amidated congener induced antihyperalgesic effects in diabetic mice. In this study, we studied a small synthetic dipeptide related to SP1-7 and endomorphin-2, i.e. Phe-Phe amide, using the tail-flick test and von Frey filament test in diabetic and non-diabetic mice. Results Intrathecal treatment with the dipeptide increas...

  12. Conserving agrobiodiversity amid global change, migration, and nontraditional livelihood networks: the dynamic uses of cultural landscape knowledge

    Directory of Open Access Journals (Sweden)

    Karl S. Zimmerer

    2014-06-01

    Full Text Available I examined agrobiodiversity in smallholder cultural landscapes with the goal of offering new insights into management and policy options for the resilience-based in situ conservation and social-ecological sustainability of local, food-producing crop types, i.e., landraces. I built a general, integrative approach to focus on both land use and livelihood functions of crop landraces in the context of nontraditional, migration-related livelihoods amid global change. The research involved a multimethod, case-study design focused on a cultural landscape of maize, i.e., corn, growing in the Andes of central Bolivia, which is a global hot spot for this crop’s agrobiodiversity. Central questions included the following: (1 What are major agroecological functions and food-related services of the agrobiodiversity of Andean maize landraces, and how are they related to cultural landscapes and associated knowledge systems? (2 What are new migration-related livelihood groups, and how are their dynamic livelihoods propelled through global change, in particular international and national migration, linked to the use and cultural landscapes of agrobiodiversity? (3 What are management and policy options derived from the previous questions? Combined social-ecological services as both cultivation and food resources are found to function in relation to the cultural landscape. Results demonstrated major variations of maturation-based, phenologic traits and food-use properties that are cornerstones of the landrace-level agrobiodiversity of Andean maize. Knowledge of these parameters is widespread. Linkage of these production and consumption functions yields a major insight into dynamics of Andean maize agrobiodiversity. Concurrently, this smallholder cultural landscape has become increasingly dependent on new rural conditions, especially increased livelihood diversification and migration amid growing peri-urban influences. Viability of landrace-level maize

  13. Detection and qualitative analysis of fatty acid amides in the urine of alcoholics using HPLC-QTOF-MS.

    Science.gov (United States)

    Dabur, Rajesh; Mittal, Ashwani

    2016-05-01

    Fatty acid amides (FAAs) in alcoholism lead to liver diseases. These amides have been reported in plasma and in other organs of the body, while their detection or presence in the urine is still unknown. Therefore, the focus of the current study was to detect and analyze FAAs qualitatively in urine samples of alcoholics. Furthermore, the effects of Tinospora cordifolia (hepatoprotective medicinal plant) intervention on FAA levels in moderate alcoholics were also analyzed. In the study, asymptomatic chronic alcoholics (n = 22) without chronic liver disease and nonalcoholic healthy volunteers (n = 24) with a mean age of 39 ± 2.0 years were selected. The first-pass urine and fasting blood samples were collected in the morning on day 0 and day 14 after T. cordifolia water extract (TCE) treatment and analyzed using automated biochemistry analyzer and HPLC-QTOF-MS. Results indicated the increased levels of serum triglycerides, cholesterol, and liver function enzymes in alcoholic subjects, which were significantly down-regulated by TCE intervention. Multivariate discrimination analysis of QTOF-MS data showed increased urinary levels of oleoamide (2.55-fold), palmitamide (5.6-fold), and erucamide (1.6-fold) in alcoholics as compared to control subjects. Levels of oleamide (1.8-fold), palmitamide (1.7-fold), and linoleamide (1.5-fold) were found to be increased in plasma. Treatment with TCE in alcoholics (3.0 g lyophilized water extract/day) significantly decreased the plasma and urinary levels of all FAAs except linoleamide. The HPLC-QTOF-MS approach for FAAs analysis in both urinary and plasma samples of alcoholics worked very well. Moreover, findings (i.e., increased levels of FAAs in urine and in plasma) further support other findings that these amides play a very important role in alcoholism. Further, like our previous findings, TCE proved its hepatoprotective effect against alcoholism not only by lowering the levels of these detected FAAs, but also by decreasing the

  14. In vitro activity of pipecolic acid amide of clindamycin (U-57930E) on anaerobic bacteria compared with those of clindamycin, cefoxitin, and chloramphenicol.

    OpenAIRE

    Dhawan, V K; Bansal, M B; Thadepalli, H

    1982-01-01

    In vitro activity of pipecolic acid amide of clindamycin (U-57930E) against 265 isolates of anaerobic bacteria, including 66 strains of Bacteroides fragilis, was compared with those of clindamycin, chloramphenicol, and cefoxitin. At therapeutically achievable concentrations, the activities of all four antibiotics against anaerobic bacteria were similar.

  15. Oxygenated metabolites of anandamide and 2-arachidonoylglycerol : conformational analysis and interaction with cannabinoid receptors, membrane transporter, and fatty acid amide hydrolase

    NARCIS (Netherlands)

    Vliegenthart, J.F.G.; Stelt, M. van der; Kuik, J.A. van; Zadelhoff, G. van; Leeflang, B.R.; Veldink, G.A.; Finazzi Agrò, A.; Maccarrone, M.

    2002-01-01

    This study was aimed at finding structural requirements for the interaction of the acyl chain of endocannabinoids with cannabinoid receptors, membrane transporter protein, and fatty acid amide hydrolase (FAAH). To this end, the flexibility of the acyl chain was restricted by introduction of an 1-hyd

  16. Collaborations between Foreign-Invested Enterprises and China's VET Schools: Making the System Work amid Localised Skill Shortages

    Science.gov (United States)

    Li, Yiqiong; Sheldon, Peter

    2014-01-01

    This article examines collaborative initiatives individual foreign-invested enterprises (FIEs) develop with China's vocational education and training (VET) schools amid localised shortages of skilled workers. It thus focuses on employer initiatives in responding to VET system weaknesses rather than, as is common, those weaknesses. Using…

  17. Underlying Mechanism of In vivo and In vitro Activity of C-terminal–amidated Thanatin Against Clinical Isolates of Extended-Spectrum β-lactamase–Producing Escherichia coli

    OpenAIRE

    Hou, Zheng; Lu, Jun; Fang, Chao; Zhou, Ying; Bai, Hui; Zhang, Xiaogong; Xue, Xiaoyan; Chen, Yingying; Luo, Xiaoxing

    2011-01-01

    Background. Infections with extended-spectrum β-lactamase–producing Escherichia coli (ESBL-EC) have developed resistance to current therapies. Therefore, the underlying mechanisms of in vivo and in vitro activity of C-terminal–amidated thanatin (A-thanatin) against clinical isolates of ESBL-EC were studied in an attempt to resolve this problem.

  18. Metal complexation by tripodal N-Acyl(thio)urea and picolin(thio)amide compounds: synthesis/extraction and potentiometric studies

    NARCIS (Netherlands)

    Reinoso-Garcia, Marta M.; Dijkman, Arjan; Verboom, Willem; Reinhoudt, David N.; Malinowska, Elzbieta; Wojciechowska, Dorota; Pietrzak, Mariusz; Selucky, Pavel

    2005-01-01

    The synthesis and binding properties towards different cations of a series of tripodal ligands functionalized with N-acyl(thio)urea and picolin(thio)amide moieties are described. For the extraction of Am3+ and Eu3+ the compounds are not efficient. However, N-acylurea derivative 10 exhibit a signific

  19. GLP-1-(9-36) amide reduces blood glucose in anesthetized pigs by a mechanism that does not involve insulin secretion

    DEFF Research Database (Denmark)

    Deacon, Carolyn F; Plamboeck, Astrid; Møller, Søren;

    2002-01-01

    impossible to assess its true efficacy in vivo. In chloralose-anesthetized pigs given valine-pyrrolidide (to block endogenous DPP IV activity), the independent effects of GLP-1-(7-36) amide on glucose and insulin responses to intravenous glucose were assessed, and the metabolite generated by DPP IV, GLP-1...

  20. Synthesis of P-stereogenic diarylphosphinic amides by directed lithiation: transformation into tertiary phosphine oxides via methanolysis, aryne chemistry and complexation behaviour toward zinc(ii).

    Science.gov (United States)

    del Águila-Sánchez, Miguel A; Navarro, Yolanda; García López, Jesús; Guedes, Guilherme P; López Ortiz, Fernando

    2016-02-01

    The highly diastereoselective synthesis of P-stereogenic phosphinic amides via directed ortho lithiation (DoLi) of (SC)-P,P-diphenylphosphinic amides with t-BuLi followed by electrophilic quench reactions is described. Functionalised derivatives containing a wide variety of ortho substituents (Cl, Br, I, OH, N3, SiMe3, SnMe3, P(O)Ph2, Me, allyl, (t)BuOCO) have been prepared in high yields with diastereomeric ratios up to 98 : 2. The X-ray diffraction structure of the ortho-stannylated and ortho-iodo compounds showed that the pro-S P-phenyl ring was stereoselectively ortho-deprotonated by the organolithium base. The usefulness of the method is supported by two key transformations, the synthesis of P-stereogenic methyl phosphinates through replacement of the chiral auxiliary by a methoxy group and the first example of the insertion of benzyne into the P-N bond of a P-stereogenic phosphinic amide. A DFT study of this reaction showed that the insertion proceeds through a [2 + 2] cycloaddition and a subsequent ring-opening with retention of the P-configuration. Explorative coordination chemistry of the new P-stereogenic ligands provided access to a chiral phosphinic amide-phosphine oxide Zn(ii) complex, the crystal structure of which is reported. PMID:26370566

  1. Self-assembly of 1,1'-biphenyl-2,2',6,6'-tetracarboxamides. Effect of substitution at the amidic nitrogen

    Czech Academy of Sciences Publication Activity Database

    Holý, Petr; Podlaha, J.; Císařová, I.; Závada, Jiří

    2001-01-01

    Roč. 66, č. 6 (2001), s. 947-958. ISSN 0010-0765 R&D Projects: GA ČR GA203/00/0138 Institutional research plan: CEZ:AV0Z4055905 Keywords : amides * crystal structure determination Subject RIV: CC - Organic Chemistry Impact factor: 0.778, year: 2001

  2. Distribution and seasonal variation in hypothalamic RF-amide peptides in a semi-desert rodent, the jerboa

    DEFF Research Database (Denmark)

    Janati, A; Talbi, R; Klosen, P; Mikkelsen, J D; Magoul, R; Simonneaux, V; El Ouezzani, S

    2013-01-01

    , kisspeptin (Kp) and RF-amide-related peptide (RFRP)-3, displays seasonal variation in jerboa. Kp and/or RFRP-3 immunoreactivity was investigated in the hypothalamus of jerboas captured in the field of the Middle Atlas mountain (Morocco), either in the spring or autumn. As in other rodents, the Kp......-immunoreactive (-IR) neurones were found in the anteroventro-periventricular and arcuate nuclei. RFRP-3 neurones were noted within the dorso/ventromedial hypothalamus. A marked sexual dimorphism in the expression of Kp (but not RFRP-3) was observed. The number of Kp-IR neurones was nine-fold higher, and the density....../dorsomedial hypothalamus was approximately three-fold higher in sexually active jerboa captured in the spring compared to sexually inactive autumn animals. Altogether, the present study reports the distribution of Kp and RFRP-3 neurones in the hypothalamus of a desert species and reveals a seasonal difference in their...

  3. Isolation and Total Synthesis of Stolonines A–C, Unique Taurine Amides from the Australian Marine Tunicate Cnemidocarpa stolonifera

    Directory of Open Access Journals (Sweden)

    Trong D. Tran

    2015-07-01

    Full Text Available Cnemidocarpa stolonifera is an underexplored marine tunicate that only occurs on the tropical to subtropical East Coast of Australia, with only two pyridoacridine compounds reported previously. Qualitative analysis of the lead-like enhanced fractions of C. stolonifera by LC-MS dual electrospray ionization coupled with PDA and ELSD detectors led to the identification of three new natural products, stolonines A–C (1–3, belonging to the taurine amide structure class. Structures of the new compounds were determined by NMR and MS analyses and later verified by total synthesis. This is the first time that the conjugates of taurine with 3-indoleglyoxylic acid, quinoline-2-carboxylic acid and β-carboline-3-carboxylic acid present in stolonines A–C (1–3, respectively, have been reported. An immunofluorescence assay on PC3 cells indicated that compounds 1 and 3 increased cell size, induced mitochondrial texture elongation, and caused apoptosis in PC3 cells.

  4. Isolation and Total Synthesis of Stolonines A-C, Unique Taurine Amides from the Australian Marine Tunicate Cnemidocarpa stolonifera.

    Science.gov (United States)

    Tran, Trong D; Pham, Ngoc B; Ekins, Merrick; Hooper, John N A; Quinn, Ronald J

    2015-07-01

    Cnemidocarpa stolonifera is an underexplored marine tunicate that only occurs on the tropical to subtropical East Coast of Australia, with only two pyridoacridine compounds reported previously. Qualitative analysis of the lead-like enhanced fractions of C. stolonifera by LC-MS dual electrospray ionization coupled with PDA and ELSD detectors led to the identification of three new natural products, stolonines A-C (1-3), belonging to the taurine amide structure class. Structures of the new compounds were determined by NMR and MS analyses and later verified by total synthesis. This is the first time that the conjugates of taurine with 3-indoleglyoxylic acid, quinoline-2-carboxylic acid and β-carboline-3-carboxylic acid present in stolonines A-C (1-3), respectively, have been reported. An immunofluorescence assay on PC3 cells indicated that compounds 1 and 3 increased cell size, induced mitochondrial texture elongation, and caused apoptosis in PC3 cells. PMID:26204949

  5. Synthesis of [14C]-labelled eicosa-5,8,11-triynoic acid and conversion to anti-inflammatory amides

    International Nuclear Information System (INIS)

    A four step synthesis of [5,6-14C]-eicosa-5,8,11-triynoic acid from [14C]-labelled acetylene is described. [14C2]-acetylene was converted to 5-chloro-[1,2-14C]-pentyne via reaction of its monolithium salt with 3-bromo-1-chloropropane. The doubly labelled 5-chloropentyne thus obtained was transformed to [5,6-14C]-hex-5-ynoic acid which was then coupled with 1-chloro-tetradeca-2,5-diyne to give the title compound. Using 2-(2-aminoethoxy)ethanol and 1-(2-hydroxyethyl)piperazine, amides which had previously been found to be potent inhibitors of the 5-lipoxygenase enzyme, were prepared from [14C-labelled eicosatriynoic acid by way of acylimidazole chemistry. (author)

  6. Electrochemical behavior of Ni(II)/Ni in a hydrophobic amide-type room-temperature ionic liquid

    International Nuclear Information System (INIS)

    Electrochemical reaction of Ni(II)/Ni was investigated in a hydrophobic room-temperature ionic liquid, 1-butyl-1-methylpyrrolidinium bis(trifluoromethylsulfonyl)amide (BMPTFSA) containing Ni(TFSA)2 as a Ni source. The UV-vis spectra showed that Ni(II) in BMPTFSA is octahedrally coordinated with TFSA- anions. The average activation energy for the diffusion coefficients of this Ni(II) complex was ∼26 kJ mol-1, which was close to that for the viscosity. The diffusion coefficient of Ni(II) was estimated to be 9.3 x 10-8 cm2 s-1. Chronoamperometric measurements showed that the electrodeposition of Ni on a platinum substrate involved three-dimensional instantaneous nucleation under diffusion control at room-temperature. The electrodeposits obtained by galvanostatic electrolysis with the current density of -0.046 mA cm-2 at 70 and 100 deg. C were identified as metallic Ni by XRD.

  7. Gd-Complexes of New Arylpiperazinyl Conjugates of DTPA-Bis(amides: Synthesis, Characterization and Magnetic Relaxation Properties

    Directory of Open Access Journals (Sweden)

    Abdullah O. Ba-Salem

    2015-04-01

    Full Text Available Two new DTPA-bis(amide based ligands conjugated with the arylpiperazinyl moiety were synthesized and subsequently transformed into their corresponding Gd(III complexes 1 and 2 of the type [Gd(LH2O]·nH2O. The relaxivity (R1 of these complexes was measured, which turned out to be comparable with that of Omniscan®, a commercially available MRI contrast agent. The cytotoxicity studies of these complexes indicated that they are non-toxic, which reveals their potential and physiological suitability as MRI contrast agents. All the synthesized ligands and complexes were characterized with the aid of analytical and spectroscopic methods, including elemental analysis, 1H-NMR, FT-IR, XPS and fast atom bombardment (FAB mass spectrometry.

  8. Conjugation of insulin onto the sidewalls of single-walled carbon nanotubes through functionalization and diimide-activated amidation

    Science.gov (United States)

    Ng, Chee Meng; Loh, Hwei-San; Muthoosamy, Kasturi; Sridewi, Nanthini; Manickam, Sivakumar

    2016-01-01

    Purpose The high aspect ratio of carbon nanotubes (CNTs) allows the attachment of compounds that enhance the functionality of the drug vehicle. Considering this, use of CNTs as a multifunctional insulin carrier may be an interesting prospect to explore. Materials and methods The carboxylic acid groups were functionalized on the sidewalls of single-walled CNTs (SWCNTs) followed by diimidation to form amide bonds with the amine groups of the insulin. Results Scanning transmission electron microscopy and transmission electron microscopy establish clear conjugation of insulin onto the surface of nanotube sidewalls. The incorporation of insulin further increased the solubility of SWCNTs in biological solution for the tested period of 5 months. Bicinchoninic acid assay confirms that 0.42 mg of insulin could be attached to every 1 mg of carboxylated SWCNTs. Conclusion With the successful conjugation of insulin to SWCNTs, it opens up the potential use of SWCNTs as an insulin carrier which in need of further biological studies.

  9. Synthesis, Properties and Applications of Biodegradable Polymers Derived from Diols and Dicarboxylic Acids: From Polyesters to Poly(ester amides

    Directory of Open Access Journals (Sweden)

    Angélica Díaz

    2014-04-01

    Full Text Available Poly(alkylene dicarboxylates constitute a family of biodegradable polymers with increasing interest for both commodity and speciality applications. Most of these polymers can be prepared from biobased diols and dicarboxylic acids such as 1,4-butanediol, succinic acid and carbohydrates. This review provides a current status report concerning synthesis, biodegradation and applications of a series of polymers that cover a wide range of properties, namely, materials from elastomeric to rigid characteristics that are suitable for applications such as hydrogels, soft tissue engineering, drug delivery systems and liquid crystals. Finally, the incorporation of aromatic units and α-amino acids is considered since stiffness of molecular chains and intermolecular interactions can be drastically changed. In fact, poly(ester amides derived from naturally occurring amino acids offer great possibilities as biodegradable materials for biomedical applications which are also extensively discussed.

  10. [The effect of magnesium pool isotopy on reactivation of mitochondrial ATP synthesis suppressed by 1-methyl-nicotine amide].

    Science.gov (United States)

    Kuznetsov, D A; Aliautdin, R N; Markarian, A A; Berdieva, A G; Khasigov, P Z; Gatagonova, T M; Ktsoeva, S A; Orlova, M A

    2006-01-01

    The ATP-generating activity of both rat myocardial mitochondria and intramitochondrial creatine phosphokinase (CPK) was examined as a function of the incubation medium magnesium pool isotopy. The in vitro systems tested were prepared from the hearts of animals treated with single injection of 1-methyl-nicotine amide (MNA) suppressing the NAD(P)-dependent reactions in vivo. The presense of the 25Mg paramagnetic cations leads to essential compensation of intramitochondrial ATP deficiency caused by the MNA induced blockade of oxidative phosphorylation. This effect is merely unreachable in those systems where the magnesium pool consists of isotopes with a zero nuclear spin (24Mg, 26Mg). The reactivation of mitochondrial ATP synthesis described here involves CPK activity which does not depends on MNA. In this case, a high efficiency of this reactivation seems to be a spin selective phenomenon which requires, predominantly, 25Mg2+ cations. PMID:16805385

  11. Self-assembly of gibberellic amide assemblies and their applications in the growth and fabrication of ordered gold nanoparticles

    Science.gov (United States)

    Smoak, Evan M.; Carlo, Andrew D.; Fowles, Catherine C.; Banerjee, Ipsita A.

    2010-01-01

    Gibberellins are a group of naturally occurring diterpenoid based phytohormones that play a vital role in plant growth and development. In this work, we have studied the self-assembly of gibberellic acid, a phytohormone, which belongs to the family of gibberellins, and designed amide derivatives of gibberellic acid (GA3) for the facile, green synthesis of gold nanoparticles. It was found that the derivatives self-assembled into nanofibers and nanoribbons in aqueous solutions at varying pH. Further, upon incubation with tetrachloroaurate, the self-assembled GA3-amide derivatives efficiently nucleated and formed gold nanoparticles when heated to 60 °C. Energy dispersive x-ray spectroscopy, transmission electron microscopy and scanning electron microscopy analyses revealed that uniform coatings of gold nanoparticles in the 10-20 nm range were obtained at low pH on the nanowire surfaces without the assistance of additional reducing agents. This simple method for the development of morphology controlled gold nanoparticles using a plant hormone derivative opens doors for a new class of plant biomaterials which can efficiently yield gold nanoparticles in an environmentally friendly manner. The gold encrusted nanowires formed using biomimetic methods may lead on to the formation of conductive nanowires, which may be useful for a wide range of applications such as in optoelectronics and sensors. Further, the spontaneous formation of highly organized nanostructures obtained from plant phytohormone derivatives such as gibberellic acid is of particular interest as it might help in further understanding the supramolecular assembly mechanism of more highly organized biological structures.

  12. Self-assembly of gibberellic amide assemblies and their applications in the growth and fabrication of ordered gold nanoparticles

    International Nuclear Information System (INIS)

    Gibberellins are a group of naturally occurring diterpenoid based phytohormones that play a vital role in plant growth and development. In this work, we have studied the self-assembly of gibberellic acid, a phytohormone, which belongs to the family of gibberellins, and designed amide derivatives of gibberellic acid (GA3) for the facile, green synthesis of gold nanoparticles. It was found that the derivatives self-assembled into nanofibers and nanoribbons in aqueous solutions at varying pH. Further, upon incubation with tetrachloroaurate, the self-assembled GA3-amide derivatives efficiently nucleated and formed gold nanoparticles when heated to 60 deg. C. Energy dispersive x-ray spectroscopy, transmission electron microscopy and scanning electron microscopy analyses revealed that uniform coatings of gold nanoparticles in the 10-20 nm range were obtained at low pH on the nanowire surfaces without the assistance of additional reducing agents. This simple method for the development of morphology controlled gold nanoparticles using a plant hormone derivative opens doors for a new class of plant biomaterials which can efficiently yield gold nanoparticles in an environmentally friendly manner. The gold encrusted nanowires formed using biomimetic methods may lead on to the formation of conductive nanowires, which may be useful for a wide range of applications such as in optoelectronics and sensors. Further, the spontaneous formation of highly organized nanostructures obtained from plant phytohormone derivatives such as gibberellic acid is of particular interest as it might help in further understanding the supramolecular assembly mechanism of more highly organized biological structures.

  13. Self-assembly of gibberellic amide assemblies and their applications in the growth and fabrication of ordered gold nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Smoak, Evan M; Carlo, Andrew D; Fowles, Catherine C; Banerjee, Ipsita A, E-mail: banerjee@fordham.edu [Department of Chemistry, Fordham University, 441 East Fordham Road, Bronx, NY 10458 (United States)

    2010-01-15

    Gibberellins are a group of naturally occurring diterpenoid based phytohormones that play a vital role in plant growth and development. In this work, we have studied the self-assembly of gibberellic acid, a phytohormone, which belongs to the family of gibberellins, and designed amide derivatives of gibberellic acid (GA{sub 3}) for the facile, green synthesis of gold nanoparticles. It was found that the derivatives self-assembled into nanofibers and nanoribbons in aqueous solutions at varying pH. Further, upon incubation with tetrachloroaurate, the self-assembled GA{sub 3}-amide derivatives efficiently nucleated and formed gold nanoparticles when heated to 60 deg. C. Energy dispersive x-ray spectroscopy, transmission electron microscopy and scanning electron microscopy analyses revealed that uniform coatings of gold nanoparticles in the 10-20 nm range were obtained at low pH on the nanowire surfaces without the assistance of additional reducing agents. This simple method for the development of morphology controlled gold nanoparticles using a plant hormone derivative opens doors for a new class of plant biomaterials which can efficiently yield gold nanoparticles in an environmentally friendly manner. The gold encrusted nanowires formed using biomimetic methods may lead on to the formation of conductive nanowires, which may be useful for a wide range of applications such as in optoelectronics and sensors. Further, the spontaneous formation of highly organized nanostructures obtained from plant phytohormone derivatives such as gibberellic acid is of particular interest as it might help in further understanding the supramolecular assembly mechanism of more highly organized biological structures.

  14. The role of C-terminal amidation in the membrane interactions of the anionic antimicrobial peptide, maximin H5.

    Science.gov (United States)

    Dennison, Sarah R; Mura, Manuela; Harris, Frederick; Morton, Leslie H G; Zvelindovsky, Andrei; Phoenix, David A

    2015-05-01

    Maximin H5 is an anionic antimicrobial peptide from amphibians, which carries a C-terminal amide moiety, and was found to be moderately haemolytic (20%). The α-helicity of the peptide was 42% in the presence of lipid mimics of erythrocyte membranes and was found able to penetrate (10.8 mN m(-1)) and lyse these model membranes (64 %). In contrast, the deaminated peptide exhibited lower levels of haemolysis (12%) and α-helicity (16%) along with a reduced ability to penetrate (7.8 m Nm(-1)) and lyse (55%) lipid mimics of erythrocyte membranes. Taken with molecular dynamic simulations and theoretical analysis, these data suggest that native maximin H5 primarily exerts its haemolytic action via the formation of an oblique orientated α-helical structure and tilted membrane insertion. However, the C-terminal deamination of maximin H5 induces a loss of tilted α-helical structure, which abolishes the ability of the peptide's N-terminal and C-terminal regions to H-bond and leads to a loss in haemolytic ability. Taken in combination, these observations strongly suggest that the C-terminal amide moiety carried by maximin H5 is required to stabilise the adoption of membrane interactive tilted structure by the peptide. Consistent with previous reports, these data show that the efficacy of interaction and specificity of maximin H5 for membranes can be attenuated by sequence modification and may assist in the development of variants of the peptide with the potential to serve as anti-infectives. PMID:25640709

  15. In vivo growth-inhibition of Sarcoma 180 by piplartine and piperine, two alkaloid amides from Piper

    Directory of Open Access Journals (Sweden)

    D.P. Bezerra

    2006-06-01

    Full Text Available Piplartine {5,6-dihydro-1-[1-oxo-3-(3,4,5-trimethoxyphenyl-2-propenyl]-2(1Hpyridinone} and piperine {1-5-(1,3-benzodioxol-5-yl-1-oxo-2,4-pentadienyl]piperidine} are alkaloid amides isolated from Piper. Both have been reported to show cytotoxic activity towards several tumor cell lines. In the present study, the in vivo antitumor activity of these compounds was evaluated in 60 female Swiss mice (N = 10 per group transplanted with Sarcoma 180. Histopathological and morphological analyses of the tumor and the organs, including liver, spleen, and kidney, were performed in order to evaluate the toxicological aspects of the treatment with these amides. Administration of piplartine or piperine (50 or 100 mg kg-1 day-1 intraperitoneally for 7 days starting 1 day after inoculation inhibited solid tumor development in mice transplanted with Sarcoma 180 cells. The inhibition rates were 28.7 and 52.3% for piplartine and 55.1 and 56.8% for piperine, after 7 days of treatment, at the lower and higher doses, respectively. The antitumor activity of piplartine was related to inhibition of the tumor proliferation rate, as observed by reduction of Ki67 staining, a nuclear antigen associated with G1, S, G2, and M cell cycle phases, in tumors from treated animals. However, piperine did not inhibit cell proliferation as observed in Ki67 immunohistochemical analysis. Histopathological analysis of liver and kidney showed that both organs were reversibly affected by piplartine and piperine treatment, but in a different way. Piperine was more toxic to the liver, leading to ballooning degeneration of hepatocytes, accompanied by microvesicular steatosis in some areas, than piplartine which, in turn, was more toxic to the kidney, leading to discrete hydropic changes of the proximal tubular and glomerular epithelium and tubular hemorrhage in treated animals.

  16. Amides as phase modifiers for N,N'-tetraalkylmalonamide extraction of actinides and lanthanides from nitric acid solutions

    International Nuclear Information System (INIS)

    The N,N'-tetraalkylmalonamides are a class of compounds under development for transuranic (TRU) separations under high nitric acid conditions. There are several issues that challenge the further development of these ligands. One is the development of improved synthetic procedures that lend themselves to commercial scale-up. Another major issue is the third-phase formation that occurs when the N,N'-tetraalkylmalonamides are contacted with medium-to-high nitric acid concentrations in hydrocarbon solvents. To address the synthesis issue, the authors have developed a new synthetic approach for preparing these materials. Third-phase formation can be eliminated by addition of diluent modifiers such as tributylphosphate (TBP). TBP is inappropriate if a nonphosphate-containing process stream is required. Amides have been proposed as alternatives for TBP in a variety of applications because of their ease of synthesis and the variety of substituents that can be generated. The authors have been able to develop an amide phase-modified system that extends the working process range of alkylinalonamides (0.5 M) in dodecane: from 3.5 M to 7.5 M nitric acid and in Isopar H (branched hydrocarbon) from 4.0 M to 10.0 M nitric acid using 1.0 M di-2-ethylhexylacetamide/0.5 M alkylmalonamide. The Kd values were comparable to extraction with alkylinalonamide in Isopar H or hydrogenated tetrapropylene (TPH) solvents. The overall extraction system was more robust than the phase-uninodified system allowing for greater temperature and acid concentration fluctuations without third-phase formation

  17. Conformation-Specific IR and UV Spectroscopy of the Amino Acid Glutamine: Amide-Stacking and Hydrogen Bonding in AN Important Residue in Neurodegenerative Diseases

    Science.gov (United States)

    Walsh, Patrick S.; Dean, Jacob C.; Zwier, Timothy S.

    2014-06-01

    Glutamine plays an important role in several neurodegenerative diseases including Huntington's disease (HD) and Alzheimer's disease (AD). An intriguing aspect of the structure of glutamine is its incorporation of an amide group in its side chain, thereby opening up the possibility of forming amide-amide H-bonds between the peptide backbone and side chain. In this study the conformational preferences of two capped gluatamines Z(carboxybenzyl)-Glutamine-X (X=OH, NHMe) are studied under jet-cooled conditions in the gas phase in order to unlock the intrinsic structural motifs that are favored by this flexible sidechain. Conformational assignments are made by comparing the hydride stretch ( 3100-3700 cm-1) and amide I and II ( 1400-1800 cm-1) resonant ion-dip infrared spectra with predictions from harmonic frequency calculations. Assigned structures will be compared to previously published results on both natural and unnatural residues. Particular emphasis will be placed on the comparison between glutamine and unconstrained γ-peptides due to the similar three-carbon spacing between backbone and side chain in glutamine to the backbone spacing in γ-peptides. The ability of the glutamine side-chain to form amide stacked conformations will be a main focus, along with the prevalence of extended backbone type structures. W. H. James, III, C W. Müller, E. G. Buchanan, M. G. D. Nix, L. Guo, L. Roskop, M. S. Gordon, L. V. Slipchenko, S. H. Gellman, and T. S. Zwier, J. Am. Chem. Soc., 2009, 131(40), 14243-14245.

  18. Understanding hydrogen sorption in a metal-organic framework with open-metal sites and amide functional groups

    KAUST Repository

    Pham, Tony T.

    2013-05-09

    Grand canonical Monte Carlo (GCMC) studies of the mechanism of hydrogen sorption in an rht-MOF known as Cu-TPBTM are presented. The MOF is a decorated/substituted isostructural analogue to the unembellished rht-MOF, PCN-61, that was studied previously [ Forrest, K. A.J. Phys. Chem. C 2012, 116, 15538-15549. ]. The simulations were performed using three different hydrogen potentials of increasing complexity. Simulated hydrogen sorption isotherms and calculated isosteric heat of adsorption, Qst, values were in excellent agreement with the reported experimental data for only a polarizable model in one of four experimentally observed crystal structure configurations. The study demonstrates the ability of modeling to distinguish the differential sorption of distinct strucures; one configuration is found to be dominant due to favorable interactions with substrates. In addition, it was discovered that the presence of polar amide groups had a significant effect on the electrostatics of the Cu2+ ions and directs the low-pressure physisorption of hydrogen in the MOF. This is in contrast to what was observed in PCN-61, where an exterior copper ion had a higher relative charge and was the favored loading site. This tunability of the electrostatics of the copper ions via chemical substitution on the MOF framework can be explained by the presence of the negatively charged oxygen atom of the amide group that causes the interior Cu2+ ion to exhibit a higher positive charge through an inductive effect. Further, control simulations, taking advantage of the flexibility afforded by theoretical modeling, include artificially modified charges for both Cu2+ ions chosen equal to or with a higher charge on the exterior Cu2+ ion. This choice resulted in distinctly different hydrogen sorption characteristics in Cu-TPBTM with no direct sorption on the open-metal sites. Thus, this study demonstrates both the tunable nature of MOF platforms and the possibility for rational design of sorption

  19. Influence of silica nanospheres on the separation performance of thin film composite poly(piperazine-amide) nanofiltration membranes

    Science.gov (United States)

    Li, Qiang; Wang, Yihua; Song, Jie; Guan, Yipeng; Yu, Hui; Pan, Xianhui; Wu, Feiyang; Zhang, Meng

    2015-01-01

    A novel thin film nanocomposite nanofiltration (TFNN) membrane was fabricated by introducing silica nanospheres (ca. 235 ± 11 nm) in the interfacial polymerization process of trimesoyl chloride (TMC) and piperazine (PIP) over polysulfone (PS) support for investigating the effect of silica nanofiller on the separation performance (i.e., permeability and salt rejection) of conventional thin film composite poly(piperazine-amide) nanofiltration (TFCN) membrane. The physicochemical characterization results show that all of the silica nanospheres are uniformly embedded on the surface of TFNN membrane. The introduction of silica nanospheres improves the hydrophilicity of the TFCN membrane and also causes its isoelectric point shift to a lower pH value. Moreover, the active poly(piperazine-amide) barrier layer of TFNN membrane (60.8 ± 2.3 nm) is thinner than that of the pristine TFCN membrane (72.1 ± 2.5 nm) as a control sample. The separation performance tests reveal that the addition of silica nanospheres can obviously elevate the salt rejection of the pristine TFCN membrane from 87.58 ± 0.15 to 94.81 ± 0.17% under 2000 ppm of MgSO4 solution and 0.5 MPa operating pressure, simultaneously accompanied by the increases of permeate flux from 19.36 ± 0.75 to 22.65 ± 0.68 L/m2 h. Additionally, compared with pristine TFCN membrane, the fabricated TFNN membrane has relatively low salt rejection (43.20 ± 0.27%) in 0.5 MPa operating pressure for 500 ppm of NaCl aqueous solution, which demonstrates that the introduction of silica nanospheres can dramatically promote the divalent-ionic separation selectivity. Furthermore, the experimental results suggest that the nanocomposite TFNN membrane possesses stable filtration performance in the softening process of MgSO4 aqueous solution. The separation performance improvement should be attributed to the optimizations of microstructures and surface features of active barrier layer of TFNN membrane, caused by the addition of silica

  20. Amides of non-steroidal anti-inflammatory drugs with thiomorpholine can yield hypolipidemic agents with improved anti-inflammatory activity.

    Science.gov (United States)

    Theodosis-Nobelos, Panagiotis; Kourti, Malamati; Gavalas, Antonios; Rekka, Eleni A

    2016-02-01

    Novel amides of non steroidal anti-inflammatory drugs (NSAIDs), α-lipoic acid and indole-3-acetic acid with thiomorpholine were synthesised by a simple method and at high yields (60-92%). All the NSAID derivatives highly decreased lipidemic indices in the plasma of Triton treated hyperlipidemic rats. The most potent compound was the indomethacin derivative, which decreased total cholesterol, triglycerides and LDL cholesterol by 73%, 80% and 83%, respectively. They reduced acute inflammation equally or more than most parent acids. Hence, it could be concluded that amides of common NSAIDs with thiomorpholine acquire considerable hypolipidemic potency, while they preserve or augment their anti-inflammatory activity, thus addressing significant risk factors for atherogenesis. PMID:26750253

  1. Effects of temperature, packaging and electron beam irradiation processing conditions on the property behaviour of Poly (ether-block-amide) blends.

    Science.gov (United States)

    Murray, Kieran A; Kennedy, James E; McEvoy, Brian; Vrain, Olivier; Ryan, Damien; Cowman, Richard; Higginbotham, Clement L

    2014-06-01

    The radiation stability of Poly (ether-block-amide) (PEBA) blended with a multifunctional phenolic antioxidant and a hindered amide light stabiliser was examined under various temperatures, packaging and electron beam processing conditions. FTIR revealed that there were slight alterations to the PEBA before irradiation; however, these became more pronounced following irradiation. The effect of varying the temperature, packaging and processing conditions on the resultant PEBA properties was apparent. For example, rheology demonstrated that the structural properties could be enhanced by manipulating the aforementioned criteria. Mechanical testing exhibited less radiation resistance when the PEBA samples were vacuum packed and exposed to irradiation. MFI and AFM confirmed that the melting strength and surface topography could be reduced/increased depending on the conditions employed. From this study it was concluded that virgin PEBA submerged in dry ice with non-vacuum packaging during the irradiation process, provided excellent radiation resistance (20.9% improvement) in contrast to the traditional method. PMID:24863239

  2. Gas-phase fragmentation of peptides by MALDI in-source decay with limited amide hydrogen (1H/2H) scrambling

    DEFF Research Database (Denmark)

    Bache, Nicolai; Rand, Kasper D; Roepstorff, Peter;

    2008-01-01

    To achieve a fundamental understanding of the function of proteins and protein complexes at the molecular level, it is crucial to obtain a detailed knowledge about their dynamic and structural properties. The kinetics of backbone amide hydrogen exchange is intimately linked to the structural...... dynamics of the protein, and in recent years, the monitoring of the isotopic exchange of these hydrogens by mass spectrometry has become a recognized method. At present, the resolution of this method is, however, limited and single-residue resolution is typically only obtained for a few residues in a...... protein. It would therefore be desirable if gas-phase fragmentation could be used to localize incorporated deuterons as this would ultimately lead to single-residue resolution. A central obstacle for this approach is, however, the occurrence of intramolecular migration of amide hydrogens upon activation...

  3. Investigation of the energy barrier to the rotation of amide CN bonds in ACE inhibitors by NMR, dynamic HPLC and DFT.

    Science.gov (United States)

    Bouabdallah, S; Ben Dhia, M T; Driss, M R; Touil, S

    2016-09-01

    The isomerizations of Enalapril, Perindopril, Enalaprilat and Lisinopril have been investigated using NMR spectroscopic, dynamic chromatographic, unified equation and DFT theoretical calculations. The thermodynamic parameters (ΔH, ΔS and ΔG) were determined by varying the temperature in the NMR experiments. At the coalescence temperature, we can evaluate the isomerization barrier to the rotation (ΔG(≠)) around the amide bond. Using dynamics chromatography and an unified equation introduced by Trap, we can determine isomerization rate constants and Gibbs activation energies. Molecular mechanics calculations also provided evidence for the presence of low energy conformers for the ACE due to restricted amide rotation. With the value of barriers (ΔE) between them of the order of (20kJmol(-1)), which is in agreement with the dynamic NMR results and DFT calculations. PMID:27344631

  4. Amino acid amides of piperic acid (PA) and 4-ethylpiperic acid (EPA) as NorA efflux pump inhibitors of Staphylococcus aureus.

    Science.gov (United States)

    Wani, Naiem Ahmad; Singh, Samsher; Farooq, Saleem; Shankar, Sudha; Koul, Surrinder; Khan, Inshad Ali; Rai, Rajkishor

    2016-09-01

    A total of eighteen piperic acid (PA) and 4-ethylpiperic acid (EPA) amides (C1-C18) with α-, β- and γ-amino acids were synthesized, characterized and evaluated for their efflux pump inhibitory activity against ciprofloxacin resistant Staphylococcus aureus. The amides were screened against NorA overexpressing S. aureus SA-1199B and wild type S. aureus SA-1199 using ethidium bromide as NorA efflux pump substrate. EPI C6 was found to be most potent and reduced the MIC of ciprofloxacin by 16 fold followed by C18 which showed 4 fold reduction of MIC. Ethidium bromide efflux inhibition and accumulation assay proved these compounds as NorA inhibitors. PMID:27503686

  5. Sub-Zero Temperature Chromatography for Reduced Back-Exchange and Improved Dynamic Range in Amide Hydrogen Deuterium Exchange Mass Spectrometry

    OpenAIRE

    Venable, John D.; Okach, Linda; Agarwalla, Sanjay; Brock, Ansgar

    2012-01-01

    Amide hydrogen/deuterium exchange is a commonly used technique for studying the dynamics of proteins and their interactions with other proteins or ligands. When coupled with liquid chromatography and mass spectrometry, hydrogen/deuterium exchange provides several unique advantages over other structural characterization techniques including very high sensitivity, the ability to analyze proteins in complex environments, and a large mass range. A fundamental limitation of the technique arises fr...

  6. An efficient and convenient synthesis of N-substituted amides under heterogeneous condition using Al(HSO4)3 via Ritter reaction

    Indian Academy of Sciences (India)

    Elnaz Karimian; Batool Akhlaghinia; Sara S E Ghodsinia

    2016-03-01

    An efficient and inexpensive synthesis of N-substituted amides from the reaction of aliphatic and aromatic nitriles with various benzylic alcohols (secondary and tertiary) and tert-butyl alcohol by refluxing nitromethane via the Ritter reaction catalyzed by aluminum hydrogen sulfate [Al(HSO4)3] is described. Thecatalyst which is an air-stable, cost-effective solid acid could be readily recycled by filtration and reused four times without any significant loss of its activity.

  7. Synthesis of the Amide Derivatives of 3-[1-(3-Pyridazinyl)-5-phenyl-1H-pyrazole-3-yl]propanoic Acids as Potential Analgesic Compounds

    OpenAIRE

    BANOĞLU, Erden; Şüküroğlu, Murat; ERGÜN, Burcu ÇALIŞKAN

    2007-01-01

    A series of structurally diverse amide derivatives of 3-[1-(3-pyridazinyl)-5-phenyl-1H-pyrazole-3-yl]propanoic acids were prepared and tested for their in vivo analgesic activity using an acetic acid induced writhing test. All the test compounds displayed approximately equipotent analgesic activity to aspirin. The results showed that the analgesic activity of 5a, 5f, 5n, and 5o is significantly higher than that of 5d.

  8. (E)-α,β-unsaturated amides from tertiary amines, olefins and CO via Pd/Cu-catalyzed aerobic oxidative N-dealkylation.

    Science.gov (United States)

    Shi, Renyi; Zhang, Hua; Lu, Lijun; Gan, Pei; Sha, Yuchen; Zhang, Heng; Liu, Qiang; Beller, Matthias; Lei, Aiwen

    2015-02-21

    A novel Pd/Cu-catalyzed chemoselective aerobic oxidative N-dealkylation/carbonylation reaction has been developed. Tertiary amines are utilized as a "reservoir" of "active" secondary amines in this transformation, which inhibits the formation of undesired by-products and the deactivation of the catalysts. This protocol allows for an efficient and straightforward construction of synthetically useful and bioactive (E)-α,β-unsaturated amide derivatives from easily available tertiary amines, olefins and CO. PMID:25610923

  9. New optically active poly(amide-imide)s based on N,N '-(pyromellitoyl)-bis-L-amino acid and methylene diphenyl-4,4 '-diisocyanate

    DEFF Research Database (Denmark)

    Tian, Xiaoyu; Yao, Jinshui; Zhang, Xian;

    2014-01-01

    Five new optically active poly(amide-imide)s were synthesized through the direct polycondensation reaction between chiral N,N-(pyromellitoyl)-bis-L-amino acids and methylene diphenyl-4,4-diisocyanate in a medium consisting of N-methyl-2-pyrrolidone (NMP) and xylene. The resulted polymers were ful......,N-dimethyl formamide, dimethyl sulfoxide (DMSO), NMP, sulfuric acid, and para-methyl phenol. Same specific rotations of these polymers in these different solvents were obtained....

  10. Influence of the O-phosphorylation of serine, threonine and tyrosine in proteins on the amidic N-15 chemical shielding anisotropy tensors

    Czech Academy of Sciences Publication Activity Database

    Emmer, J.; Vavrinská, A.; Sychrovský, Vladimír; Benda, Ladislav; Kříž, Z.; Koča, J.; Boelens, R.; Sklenář, V.; Trantírek, L.

    2013-01-01

    Roč. 55, č. 1 (2013), s. 59-70. ISSN 0925-2738 R&D Projects: GA ČR GAP205/10/0228 Grant ostatní: CEITEC(XE) CZ.1.05/1.1.00/02.0068 Institutional support: RVO:61388963 Keywords : CSA * phosphorylation * amidic nitrogen * serine * threonine * tyrosine * protein * NMR Subject RIV: CE - Biochemistry Impact factor: 3.305, year: 2013

  11. Anion Binding Properties of Alkynylplatinum(II) Complexes with Amide-Functionalized Terpyridine: Host–Guest Interactions and Fluoride Ion-Induced Deprotonation**

    OpenAIRE

    Yeung, Margaret Ching-Lam; Chu, Ben Wai-Kin; Yam, Vivian Wing-Wah

    2014-01-01

    Molecular sensors able to detect ions are of interest due to their potential application in areas such as pollutant sequestration. Alkynylplatinum(II) terpyridine complexes with an amide-based receptor moiety have been synthesized and characterized. Their anion binding properties based on host–guest interactions have been examined with the use of UV-vis absorption and emission spectral titration studies. Spectral changes were observed for both complexes upon the addition of spherical and nons...

  12. Inhibitors of monoacylglycerol lipase, fatty-acid amide hydrolase and endocannabinoid transport differentially suppress capsaicin-induced behavioral sensitization through peripheral endocannabinoid mechanisms

    OpenAIRE

    Spradley, Jessica M.; Guindon, Josée; Hohmann, Andrea G.

    2010-01-01

    Monoacylglycerol lipase (MGL) and fatty acid amide hydrolase (FAAH) degrade the endocannabinoids 2-arachidonoylglycerol (2-AG) and anandamide (AEA), respectively. Pharmacological inhibition of these enzymes in the periphery may elucidate the role of endocannabinoids in controlling nociceptive transmission. We compared effects of the MGL inhibitor JZL184, the FAAH inhibitor URB597, and the endocannabinoid uptake inhibitor VDM11, administered locally in the paw, on behavioral hypersensitivities...

  13. Crystal Structure, Vibrational Spectroscopy and ab Initio Density Functional Theory Calculations on the Ionic Liquid forming 1,1,3,3-Tetramethylguanidinium bis{(trifluoromethyl)sulfonyl}amide

    DEFF Research Database (Denmark)

    Berg, Rolf W.; Riisager, Anders; Nguyen van Buu, Olivier;

    2009-01-01

    The salt 1,1,3,3-tetramethylguanidinium bis{(trifluoromethyl)sulfonyl}amide, [((CH3)(2)N)(2)C=NH2](+)[N(SO2-CF3)(2)](-) or [tmgH][NTf2], easily forms an ionic liquid with high SO2 absorbing capacity. The crystal structure of the salt was determined at 120(2) K by X-ray diffraction. The structure...

  14. Amide proton signals as pH indicator for in vivo MRS and MRI of the brain-Responses to hypercapnia and hypothermia.

    Science.gov (United States)

    Watanabe, Takashi; Frahm, Jens; Michaelis, Thomas

    2016-06-01

    Using proton MRS and MRI of mouse brain at 9.4T, this work provides the first in vivo evidence of pH-dependent concurrent changes of three amide signals and related metabolic responses to hypercapnia and hypothermia. During hypercapnia, amide proton MRS signals of glutamine at 6.8-6.9ppm and 7.6ppm as well as of unspecific compounds at 8.1-8.3ppm increase by at least 50% both at 37°C and 22°C. These changes reflect a reduced proton exchange with water. They are strongly correlated with intracellular pH which ranges from 6.75±0.10 to 7.13±0.06 as determined from a shift in creatine phosphokinase equilibrium. In MRI, saturation transfer from aliphatic as well as aromatic and/or amide protons alters slightly during hypercapnia and significantly during hypothermia. The asymmetry in magnetization transfer ratios decreased slightly during hypercapnia and hypothermia. Regardless of pH or temperature, saturation transfer from aliphatic protons between -2 and -4ppm frequency offset to water protons is significantly greater than that from aromatic/amide protons at corresponding offsets between +2 and +4ppm. Irradiation of aliphatic compounds at -3.5ppm frequency offset from water predominantly saturates lipids and water associated with myelin. Taken together, the results indicate that, for the B1 power used in this study, dipolar coupling between aliphatic and water protons rather than proton exchange is the dominant factor in Z-spectra and magnetization transfer ratio asymmetry of the brain in vivo. PMID:26975553

  15. Does the Surface Matter? Hydrogen-Bonded Chain Formation of an Oxalic Amide Derivative in a Two- and Three-Dimensional Environment

    OpenAIRE

    Klappenberger, F.; Canas-Ventura, M. E.; Clair, S.; Pons, S.; Schlickum, U.; Qu, Z. R.; Strunskus, T.; Comisso, A.; Woll, C.; Brune, H.; Kern, K.; De Vita, A; Ruben, M.; Bartha, J. V.

    2008-01-01

    We report on a multi-technique investigation of the supramolecular organisation of N,N-diphenyl oxalic amide under differently dimensioned environments, namely three-dimensional (3D) in the bulk crystal, and in two dimensions on the Ag(111) surface as well as on the reconstructed Au(111) surface. With the help of Xray structure analysis and scanning tunneling microscopy (STM) we find that the molecules organize in hydrogen-bonded chains with the bonding motif qualitatively changed by the surf...

  16. Pharmacological blockade of the fatty acid amide hydrolase (FAAH) alters neural proliferation, apoptosis and gliosis in the rat hippocampus, hypothalamus and striatum in a negative energy context

    OpenAIRE

    Laura Bindila; Antoni Pastor; Margarita Pérez-Martín; Rafael De La Torre; Juan Suarez

    2015-01-01

    Endocannabinoids participate in the control of neurogenesis, neural cell death and gliosis. The pharmacological effect of the fatty acid amide hydrolase (FAAH) inhibitor URB597, which limits the endocannabinoid degradation, was investigated in the present study. Cell proliferation (phospho-H3+ or BrdU+ cells) of the main adult neurogenic zones as well as apoptosis (cleaved caspase-3+), astroglia (GFAP+), and microglia (Iba1+ cells) were analyzed in the hippocampus, hypothalamus and striatum o...

  17. Pharmacological blockade of the fatty acid amide hydrolase (FAAH) alters neural proliferation, apoptosis and gliosis in the rat hippocampus, hypothalamus and striatum in a negative energy context.

    OpenAIRE

    Rivera, Patricia; Bindila, Laura; Pastor, Antoni; Pérez-Martín, Margarita; Pavón, Francisco J.; Serrano, Antonia; de la Torre, Rafael; Lutz, Beat; Rodríguez de Fonseca, Fernando; Suárez, Juan

    2015-01-01

    Endocannabinoids participate in the control of neurogenesis, neural cell death and gliosis. The pharmacological effect of the fatty acid amide hydrolase (FAAH) inhibitor URB597, which limits the endocannabinoid degradation, was investigated in the present study. Cell proliferation (phospho-H3(+) or BrdU(+) cells) of the main adult neurogenic zones as well as apoptosis (cleaved caspase-3(+)), astroglia (GFAP(+)), and microglia (Iba1(+) cells) were analyzed in the hippocampus, hypothalamus and ...

  18. Synthesis of 1,2,4-triazolines: base-catalyzed hydrazination/cyclization cascade of α-isocyano esters and amides.

    Science.gov (United States)

    Monge, David; Jensen, Kim L; Marín, Irene; Jørgensen, Karl Anker

    2011-01-21

    A convenient, efficient synthesis of 1,2,4-triazolines from α-isocyano esters/amides and azodicarboxylates is presented. The developed reaction cascade is based on a base-catalyzed hydrazination-type reaction followed by a subsequent cyclization providing the triazolines in good to excellent yields (75-99%). Phosphine-catalyzed and preliminary asymmetric phase-transfer catalysis approaches have also been investigated. PMID:21166428

  19. Effect of the solvent type and polymerization conditions on the curing kinetics, thermal and viscoelastic performance of poly(amide-imide) resins

    OpenAIRE

    Z. Rasheva; L. Sorochynska; Grishchuk, S.; Friedrich, K.

    2015-01-01

    Isothermal and non-isothermal curing kinetics of both N-methyl-2-pyrrolidone (NMP) and N-methylimidazole (MI) based poly(amide-imide) (PAI) resins were investigated by DSC analysis using tightly closed high-pressure crucibles. Several exothermal peaks on the non-isothermal DSC-traces were observed and attributed to the reactions of different functional groups of PAI-resin. Furthermore the final conversion (polymerization degree) of PAI was determined under isothermal conditions, simulating th...

  20. Preparation and release study of ibuprofen-loaded porous matrices of a biodegradable poly(ester amide) derived from L -alanine units

    OpenAIRE

    Valle Mendoza, Luis Javier del; Roca, Diana; Franco García, María Lourdes; Puiggalí Bellalta, Jordi; Rodríguez Galán, Rafael Alfonso

    2011-01-01

    Scaffolds of a biodegradable poly(ester amide)constituted of L-alanine, sebacic acid, and 1,12-dodecanediol units (abbreviated as PADAS) were prepared by the compression-molding/particulate-leaching method. The influence of the type, size, and percentage of salt on the scaffold porosity and morphology was evaluated. The thermal behavior and crystallinity were also studied for samples obtained under different processing conditions. PADAS scaffolds were not cytotoxic because they showe...

  1. Antimicrobial and allelopathic potential of the amides isolated from the roots of Ottonia martiana miq., piperaceae; Potencial antimicrobiano e alelopatico das amidas isoladas do extrato das raizes de Ottonia martiana Miq

    Energy Technology Data Exchange (ETDEWEB)

    Cunico, Miriam Machado; Dias, Josiane G.; Miguel, Marilis D.; Miguel, Obdulio Gomes [Parana Univ., Curitiba, PR (Brazil). Dept. de Farmacia]. E-mail: obdulio@ufpr.br; Auer, Celso Garcia [Empresa Brasileira de Pesquisa Agropecuaria, EMBRAPA-Floresta, Colombo, PR (Brazil). Dept. de Fitopatologia; Cocco, Lilian C.; Lopes, Andre R.; Yamamoto, Carlos I. [Parana Univ., Curitiba, PR (Brazil). Dept. de Engenharia Quimica; Monache, Franco Delle [Santa Catarina Univ., Florianopolis, SC (Brazil). Dept. de Microbiologia e Parasitologia

    2006-07-15

    Two amides, piperovatine and isopiperlonguminine, were isolated from the roots of Ottonia martiana Miq., a herbaceous shrub commonly used in folk medicine in the treatment of toothache. The crude extract (CE) and isolated compounds were submitted to bioautography and allelopathic assay. The bioautograms allowed the detection of compounds with antibacterial activity and the identification of the bioactive substance piperovatine. The CE and amides exhibited an allelopathic effect on Lactuca sativa (lettuce) seedling growth but did not affect the seeds' germinability. (author)

  2. Subzero temperature chromatography for reduced back-exchange and improved dynamic range in amide hydrogen/deuterium exchange mass spectrometry.

    Science.gov (United States)

    Venable, John D; Okach, Linda; Agarwalla, Sanjay; Brock, Ansgar

    2012-11-01

    Amide hydrogen/deuterium exchange is a commonly used technique for studying the dynamics of proteins and their interactions with other proteins or ligands. When coupled with liquid chromatography and mass spectrometry, hydrogen/deuterium exchange provides several unique advantages over other structural characterization techniques including very high sensitivity, the ability to analyze proteins in complex environments, and a large mass range. A fundamental limitation of the technique arises from the loss of the deuterium label (back-exchange) during the course of the analysis. A method to limit loss of the label during the separation stage of the analysis using subzero temperature reversed-phase chromatography is presented. The approach is facilitated by the use of buffer modifiers that prevent freezing. We evaluated ethylene glycol, dimethyl formamide, formamide, and methanol for their freezing point suppression capabilities, effects on peptide retention, and their compatibilities with electrospray ionization. Ethylene glycol was used extensively because of its good electrospray ionization compatibility; however, formamide has potential to be a superior modifier if detrimental effects on ionization can be overcome. It is demonstrated using suitable buffer modifiers that separations can be performed at temperatures as low as -30 °C with negligible loss of the deuterium label, even during long chromatographic separations. The reduction in back-exchange is shown to increase the dynamic range of hydrogen/deuterium exchange mass spectrometry in terms of mixture complexity and the magnitude with which changes in deuteration level can be quantified. PMID:23025328

  3. Partially Fluorinated Sulfonated Poly(ether amide Fuel Cell Membranes: Influence of Chemical Structure on Membrane Properties

    Directory of Open Access Journals (Sweden)

    Chulsung Bae

    2011-01-01

    Full Text Available A series of fluorinated sulfonated poly (ether amides (SPAs were synthesized for proton exchange membrane fuel cell applications. A polycondensation reaction of 4,4’-oxydianiline, 2-sulfoterephthalic acid monosodium salt, and tetrafluorophenylene dicarboxylic acids (terephthalic and isophthalic or fluoroaliphatic dicarboxylic acids produced SPAs with sulfonation degrees of 80–90%. Controlling the feed ratio of the sulfonated and unsulfonated dicarboxylic acid monomers afforded random SPAs with ion exchange capacities between 1.7 and 2.2 meq/g and good solubility in polar aprotic solvents. Their structures were characterized using NMR and FT IR spectroscopies. Tough, flexible, and transparent films were obtained with dimethylsulfoxide using a solution casting method. Most SPA membranes with 90% sulfonation degree showed high proton conductivity (>100 mS/cm at 80 °C and 100% relative humidity. Among them, two outstanding ionomers (ODA-STA-TPA-90 and ODA-STA-IPA-90 showed proton conductivity comparable to that of Nafion 117 between 40 and 80 °C. The influence of chemical structure on the membrane properties was systematically investigated by comparing the fluorinated polymers to their hydrogenated counterparts. The results suggest that the incorporation of fluorinated moieties in the polymer backbone of the membrane reduces water absorption. High molecular weight and the resulting physical entanglement of the polymers chains played a more important role in improving stability in water, however.

  4. Separation of Binary Mixtures of Propylene and Propane by Facilitated Transport through Silver Incorporated Poly(Ether-Block-Amide Membranes

    Directory of Open Access Journals (Sweden)

    Surya Murali R.

    2015-02-01

    Full Text Available The separation of propylene and propane is a challenging task in petroleum refineries due to the similar molecular sizes and physical properties of two gases. Composite Poly(ether-block-amide (Pebax-1657 membranes incorporated with silver tetra fluoroborate (AgBF4 in concentrations of 0-50% of the polymer weight were prepared by solution casting and solvent evaporation technique. The membranes were characterized by Scanning Electron Microscopy (SEM, Fourier Transform InfraRed (FTIR and wide-angle X-ray Diffraction (XRD to study surface and cross-sectional morphologies, effect of incorporation on intermolecular interactions and degree of crystallinity, respectively. Experimental data was measured with an indigenously built high-pressure gas separation manifold having an effective membrane area of 42 cm2. Permeability and selectivity of membranes were determined for three different binary mixtures of propylene-propane at pressures varying in the range 2-6 bar. Selectivity of C3H6/C3H8 enhanced from 2.92 to 17.22 and 2.11 to 20.38 for 50/50 and 66/34 C3H6+C3H8 feed mixtures, respectively, with increasing loading of AgBF4. Pebax membranes incorporated with AgBF4 exhibit strong potential for the separation of C3H6/C3H8 mixtures in petroleum refineries.

  5. IDENTIFICATION OF THE FGL-AMIDE ALLATOSTATIN GENE OF THE PRIMITIVE TERMITE Mastotermes darwiniensis AND THE WOODROACH Cryptocercus darwini.

    Science.gov (United States)

    Wende, Franziska; Meyering-Vos, Martina; Hoffmann, Klaus H

    2016-02-01

    Allatostatins with the C-terminal ending Tyr/Phe-Xaa-Phe-Gly-Leu/Ile-amide (FGLa/ASTs) are widespread neuropeptides with multiple functions. The gene encoding the FGLa/AST polypeptide precursor was first isolated from cockroaches and since then could be identified in many insects and crustaceans. With its strictly conserved regions in combination with variable regions the gene seems to be a good candidate for phylogenetic analyses between closely and distantly related species. Here, the structure of the FGLa/AST gene of the most primitive termite, the giant northern termite Mastotermes darwiniensis Froggatt, was identified. The FGLa/AST gene of the woodroach Cryptocercus darwini was also determined. Precursor sequences of both species possess the general organization of dictyopteran FGLa/AST precursors containing 14 putative FGLa/AST peptides. In M. darwiniensis, only 11 out of the 14 FGLa/AST-like peptides possess the C-terminal conserved region Y/FXFGL/I/V/M and four of the putative peptide structures are not followed by a Gly residue that would lead to nonamidated peptides. Phylogenetic analyses show the high degree of similarity of dictyopteran FGLa/AST sequences. The position of termites, nested within the Blattaria, confirms that termites have evolved from primitive cockroaches. PMID:26513739

  6. Amidated pectin/sodium carboxymethylcellulose microspheres as a new carrier for colonic drug targeting: Development and optimization by factorial design.

    Science.gov (United States)

    Gadalla, Hytham H; El-Gibaly, Ibrahim; Soliman, Ghareb M; Mohamed, Fergany A; El-Sayed, Ahmed M

    2016-11-20

    The colon is a promising site for drug targeting owing to its long transit time and mild proteolytic activity. The aim of this study was to prepare new low methoxy amidated pectin/NaCMC microspheres cross-linked by a mixture of Zn(2+) and Al(3+) ions and test their potential for colonic targeting of progesterone. A 2(4) factorial design was carried out to optimize the preparation conditions. High drug entrapment efficiency (82-99%) was obtained and it increased with increasing drug concentration but decreased with increasing polymer concentration. Drug release rate was directly proportional to the microsphere drug content and inversely related to Al(3+) ion concentration. Drug release was minimal during the first 3h but was significantly improved in the presence of 1% rat caecal contents, confirming the microsphere potential for colonic delivery. The microspheres achieved >2.3-fold enhancement of colonic progesterone permeability. These results confirm the viability of the produced microspheres as colon-targeted drug delivery vehicle. PMID:27561525

  7. Quantifying the Sigma and Pi interactions between U(V) f orbitals and halide, alkyl, alkoxide, amide and ketimide ligands

    Energy Technology Data Exchange (ETDEWEB)

    University of California, Berkeley; Lukens, Wayne W.; Edelstein, Norman M.; Magnani, Nicola; Hayton, Trevor W.; Fortier, Skye; Seaman, Lani A.

    2013-06-20

    f Orbital bonding in actinide and lanthanide complexes is critical to their behavior in a variety of areas from separations to magnetic properties. Octahedral f1 hexahalide complexes have been extensively used to study f orbital bonding due to their simple electronic structure and extensive spectroscopic characterization. The recent expansion of this family to include alkyl, alkoxide, amide, and ketimide ligands presents the opportunity to extend this study to a wider variety of ligands. To better understand f orbital bonding in these complexes, the existing molecular orbital (MO) model was refined to include the effect of covalency on spin orbit coupling in addition to its effect on orbital angular momentum (orbital reduction). The new MO model as well as the existing MO model and the crystal field (CF) model were applied to the octahedral f1 complexes to determine the covalency and strengths of the ? and ? bonds formed by the f orbitals. When covalency is significant, MO models more precisely determined the strengths of the bonds derived from the f orbitals; however, when covalency was small, the CF model was better than either MO model. The covalency determined using the new MO model is in better agreement with both experiment and theory than that predicted by the existing MO model. The results emphasize the role played by the orbital energy in determining the strength and covalency of bonds formed by the f orbitals.

  8. Development of low methoxy amidated pectin-based mucoadhesive patches for buccal delivery of triclosan: effect of cyclodextrin complexation.

    Science.gov (United States)

    Jug, Mario; Kosalec, Ivan; Maestrelli, Francesca; Mura, Paola

    2012-11-01

    A novel mucoadhesive buccal patch formulation of triclosan (TR), a broad spectrum antibacterial agent, was developed using low methoxy amidated pectin (AMP). The integrity of AMP matrix was improved by addition of 20% (w/w) Carbopol (CAR). The efficiency of β-cyclodextrin-epichlorohydrin polymer (EPIβCD) and anionic carboxymethylated β-cyclodextrin-epichlorohydrin polymer (CMEPIβCD) in optimization of TR solubility and release from such a matrix was investigated and confronted to that of parent β-cyclodextrin (βCD). Loading of TR/βCD co-ground complex into AMP/CAR matrix resulted in a biphasic release profile which was sensitive upon the hydration degree of the matrix, due to lower solubilizing efficiency of βCD, while the drug release from patches loaded with TR/EPIβCD complex was significantly faster with a constant release rate. Microbiological studies evidenced faster onset and more pronounced antibacterial action of TR/EPIβCD loaded patches, clearly demonstrating their good therapeutic potential in eradication of Streptococcus mutans, a cariogenic bacteria, from the oral cavity. PMID:22944449

  9. The influence of electron beam irradiation on the mechanical and thermal properties of Poly (ether-block-amide) blends

    International Nuclear Information System (INIS)

    High energy electron beam irradiation of Poly (ether-block-amide) (Pebax) can induce modifications and/or degradation to transpire in the material subsequent to treatment. To minimise this, Pebax was blended with three stabilisers where each formulation was subjected to electron beam radiation at doses of 25, 50 and 75 kGy. Mechanical testing revealed that the virgin Pebax and the Pebax blended with Irganox B215 provided the best radiation resistance in terms of the tensile strength, elongation at break and Young's modulus. Upon increase in radiation dose from 25 to 75 kGy, a gradual diminution was observed for the melt flow index (MFI) of the virgin Pebax, whereas Pebax blended with Irganox B215 had a minute effect on the properties post irradiation. This study provides evidence that the stabilisers used can either promote undesirable effects or enhance the radiation resistance of Pebax material following radiation exposure. Highlights: • Mechanical properties of Pebax and Irganox 565 can be controlled by radiation dose • Virgin Pebax and Pebax blended with Irgnaox B215 provides good radiation resistance • MFI decreases gradually for the Virgin Pebax with an increase in radiation dose • Molecular weight of Pebax and Irganox B215 is less effected by radiation dose • Simultaneous chain scission and crosslinking/branching occurs during irradiation

  10. Physical Nature of Fatty Acid Amide Hydrolase Interactions with Its Inhibitors: Testing a Simple Nonempirical Scoring Model.

    Science.gov (United States)

    Giedroyć-Piasecka, Wiktoria; Dyguda-Kazimierowicz, Edyta; Beker, Wiktor; Mor, Marco; Lodola, Alessio; Sokalski, W Andrzej

    2014-12-26

    Fatty acid amide hydrolase (FAAH) is an enzyme responsible for the deactivating hydrolysis of fatty acid ethanolamide neuromodulators. FAAH inhibitors have gained considerable interest due to their possible application in the treatment of anxiety, inflammation, and pain. In the context of inhibitor design, the availability of reliable computational tools for predicting binding affinity is still a challenging task, and it is now well understood that empirical scoring functions have several limitations that in principle could be overcome by quantum mechanics. Herein, systematic ab initio analyses of FAAH interactions with a series of inhibitors belonging to the class of the N-alkylcarbamic acid aryl esters have been performed. In contrast to our earlier studies of other classes of enzyme-inhibitor complexes, reasonable correlation with experimental results required us to consider correlation effects along with electrostatic term. Therefore, the simplest comprehensive nonempirical model allowing for qualitative predictions of binding affinities for FAAH ligands consists of electrostatic multipole and second-order dispersion terms. Such a model has been validated against the relative stabilities of the benchmark S66 set of biomolecular complexes. As it does not involve parameters fitted to experimentally derived data, this model offers a unique opportunity for generally applicable inhibitor design and virtual screening. PMID:25420234

  11. Effect of polyethyleneglycol on CH4 permeation through poly(amide-b-ethylene oxide)-based nanocomposite membranes

    Science.gov (United States)

    Asghari, Morteza; Mahmudi, Amir; Zargar, Vida; Khanbabaei, Ghader

    2014-11-01

    A three-phase polymer/liquid/solid poly(amide-b-ethylene oxide) (PEBA)/polyethylene glycol (PEG)/zeolite X was fabricated and its gas permeability was investigated. CH4 permeability of neat PEBA, two-phase PEBA/NaX and three-phase PEBA/PEG/NaX were compared for different pressures within the range of 2-8 bar. The fabricated membranes were structurally characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and atomic force microscope (AFM). SEM images showed that the zeolite grain size was homogeneously smaller than 2 μm. They also revealed the dense structures of the membranes and no pores were observed at these magnifications. AFM surface images indicated that the membranes surface roughness increased significantly with increasing zeolite loading. CH4 permeability for single-, two- and three-phase membranes decreased from 3.13 to 2.81, from 3.96 to 2.31 and from 2.67 to 2.14 barrer, respectively.

  12. Dysfunction in fatty acid amide hydrolase is associated with depressive-like behavior in Wistar Kyoto rats.

    Directory of Open Access Journals (Sweden)

    K Yaragudri Vinod

    Full Text Available BACKGROUND: While the etiology of depression is not clearly understood at the present time, this mental disorder is thought be a complex and multifactorial trait with important genetic and environmental contributing factors. METHODOLOGY/PRINCIPAL FINDINGS: The role of the endocannabinoid (eCB system in depressive behavior was examined in Wistar Kyoto (WKY rat strain, a genetic model of depression. Our findings revealed selective abnormalities in the eCB system in the brains of WKY rats compared to Wistar (WIS rats. Immunoblot analysis indicated significantly higher levels of fatty acid amide hydrolase (FAAH in frontal cortex and hippocampus of WKY rats with no alteration in the level of N-arachidonyl phosphatidyl ethanolamine specific phospholipase-D (NAPE-PLD. Significantly higher levels of CB1 receptor-mediated G-protein coupling and lower levels of anandamide (AEA were found in frontal cortex and hippocampus of WKY rats. While the levels of brain derived neurotropic factor (BDNF were significantly lower in frontal cortex and hippocampus of WKY rats compared to WIS rats, pharmacological inhibition of FAAH elevated BDNF levels in WKY rats. Inhibition of FAAH enzyme also significantly increased sucrose consumption and decreased immobility in the forced swim test in WKY rats. CONCLUSIONS/SIGNIFICANCE: These findings suggest a critical role for the eCB system and BDNF in the genetic predisposition to depressive-like behavior in WKY rats and point to the potential therapeutic utility of eCB enhancing agents in depressive disorder.

  13. Effect of polyethyleneglycol on CH{sub 4} permeation through poly(amide-b-ethylene oxide)-based nanocomposite membranes

    Energy Technology Data Exchange (ETDEWEB)

    Asghari, Morteza, E-mail: asghari@kashanu.ac.ir [Separation Processes Research Group (SPRG), University of Kashan, Kashan (Iran, Islamic Republic of); Energy Research Institute, University of Kashan, Ghotb-e-Ravandi Avenue, Kashan (Iran, Islamic Republic of); Mahmudi, Amir; Zargar, Vida [Separation Processes Research Group (SPRG), University of Kashan, Kashan (Iran, Islamic Republic of); Khanbabaei, Ghader [Polymer Science and Technology Division, Research Institute of Petroleum Industry, Tehran (Iran, Islamic Republic of)

    2014-11-01

    Graphical abstract: - Highlights: • A three-phase polymer/liquid/solid (PEBA/PEG/zeolite X) membrane was fabricated. • Nanocrystalline zeolite X was used as filler to stabilize membrane polymeric matrix. • Introducing zeolite to PEBA matrix caused its total free volume to decrease. • A gradual decrease with pressure was observed in CH{sub 4} permeability for the membranes. • In all the experiments, operating pressures varied from 2 to 8 bar. - Abstract: A three-phase polymer/liquid/solid poly(amide-b-ethylene oxide) (PEBA)/polyethylene glycol (PEG)/zeolite X was fabricated and its gas permeability was investigated. CH{sub 4} permeability of neat PEBA, two-phase PEBA/NaX and three-phase PEBA/PEG/NaX were compared for different pressures within the range of 2–8 bar. The fabricated membranes were structurally characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and atomic force microscope (AFM). SEM images showed that the zeolite grain size was homogeneously smaller than 2 μm. They also revealed the dense structures of the membranes and no pores were observed at these magnifications. AFM surface images indicated that the membranes surface roughness increased significantly with increasing zeolite loading. CH{sub 4} permeability for single-, two- and three-phase membranes decreased from 3.13 to 2.81, from 3.96 to 2.31 and from 2.67 to 2.14 barrer, respectively.

  14. Methotrexate Promotes Platelet Apoptosis via JNK-Mediated Mitochondrial Damage: Alleviation by N-Acetylcysteine and N-Acetylcysteine Amide.

    Directory of Open Access Journals (Sweden)

    Manoj Paul

    Full Text Available Thrombocytopenia in methotrexate (MTX-treated cancer and rheumatoid arthritis (RA patients connotes the interference of MTX with platelets. Hence, it seemed appealing to appraise the effect of MTX on platelets. Thereby, the mechanism of action of MTX on platelets was dissected. MTX (10 μM induced activation of pro-apoptotic proteins Bid, Bax and Bad through JNK phosphorylation leading to ΔΨm dissipation, cytochrome c release and caspase activation, culminating in apoptosis. The use of specific inhibitor for JNK abrogates the MTX-induced activation of pro-apoptotic proteins and downstream events confirming JNK phosphorylation by MTX as a key event. We also demonstrate that platelet mitochondria as prime sources of ROS which plays a central role in MTX-induced apoptosis. Further, MTX induces oxidative stress by altering the levels of ROS and glutathione cycle. In parallel, the clinically approved thiol antioxidant N-acetylcysteine (NAC and its derivative N-acetylcysteine amide (NACA proficiently alleviate MTX-induced platelet apoptosis and oxidative damage. These findings underpin the dearth of research on interference of therapeutic drugs with platelets, despite their importance in human health and disease. Therefore, the use of antioxidants as supplementary therapy seems to be a safe bet in pathologies associated with altered platelet functions.

  15. Physicochemical properties of new amide-based protic ionic liquids and their use as materials for anhydrous proton conductors

    Energy Technology Data Exchange (ETDEWEB)

    Xiang Jin [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing Key Laboratory of Environmental Science and Engineering, Beijing 100081 (China); Chen Renjie, E-mail: chenrj@bit.edu.cn [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing Key Laboratory of Environmental Science and Engineering, Beijing 100081 (China); National Development Center of High Technology Green Materials, Beijing 100081 (China); Wu Feng, E-mail: wufeng863@vip.sina.com [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing Key Laboratory of Environmental Science and Engineering, Beijing 100081 (China); National Development Center of High Technology Green Materials, Beijing 100081 (China); Li Li; Chen Shi [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing Key Laboratory of Environmental Science and Engineering, Beijing 100081 (China); National Development Center of High Technology Green Materials, Beijing 100081 (China); Zou Qinqin [School of Chemical Engineering and Environment, Beijing Institute of Technology, Beijing Key Laboratory of Environmental Science and Engineering, Beijing 100081 (China)

    2011-09-01

    We prepared 3 protic ionic liquids based on trifluoromethanesulfonic acid and an amide, namely isobutyramide (ITSA), n-butyramide(NTSA), and benzamide(BTSA). All of the protic ionic liquids exhibit excellent thermal stability (above 200 deg. C). ITSA has the highest ionic conductivity, which is 32.6 mS/cm at 150 deg. C. ITSA was used to prepare anhydrous, conducting composite membranes based on polymers of polyvinylidene-fluoride (PVDF) to serve as intermediate temperature proton exchange membrane fuel cells. This type of composite membrane possesses good thermal stability, high ionic conductivity and good mechanical properties. Increasing the polymer content leads to the improvement of mechanical properties, but is accompanied by a reduction in ionic conductivity. We made efforts to eliminate the trade-off between strength and conductivity of the ITSA/PVDF composite membrane by adding polyamide imide, which resulted in a simultaneous increase in strength and conductivity. A conductivity of 7.5 mS/cm is achieved in a membrane containing 60 wt.% ITSA and 5 wt.% PAI in PVDF at 150 deg. C.

  16. Electrolysis of trichloromethylated organic compounds under aerobic conditions catalyzed by the B12 model complex for ester and amide formation.

    Science.gov (United States)

    Shimakoshi, Hisashi; Luo, Zhongli; Inaba, Takuya; Hisaeda, Yoshio

    2016-06-21

    The electrolysis of benzotrichloride at -0.9 V vs. Ag/AgCl in the presence of the B12 model complex, heptamethyl cobyrinate perchlorate, in ethanol under aerobic conditions using an undivided cell equipped with a platinum mesh cathode and a zinc plate anode produced ethylbenzoate in 56% yield with 92% selectivity. The corresponding esters were obtained when the electrolysis was carried out in various alcohols such as methanol, n-propanol, and i-propanol. Benzoyl chloride was detected by GC-MS during the electrolysis as an intermediate for the ester formation. When the electrolysis was carried out under anaerobic conditions, partially dechlorinated products, 1,1,2,2-tetrachloro-1,2-diphenylethane and 1,2-dichlorostilibenes (E and Z forms), were obtained instead of an ester. ESR spin-trapping experiments using 5,5,-dimethylpyrroline N-oxide (DMPO) revealed that the corresponding oxygen-centered radical and carbon-centered radical were steadily generated during the electrolyses under aerobic and anaerobic conditions, respectively. Applications of the aerobic electrolysis to various organic halides, such as substituted benzotrichlorides, are described. Furthermore, the formation of amides with moderate yields by the aerobic electrolysis of benzotrichloride catalyzed by the B12 model complex in the presence of amines in acetonitrile is reported. PMID:27071703

  17. Effect of glucagon-like peptide-1 (proglucagon 78-107amide) on hepatic glucose production in healthy man

    DEFF Research Database (Denmark)

    Hvidberg, A; Nielsen, M T; Hilsted, J;

    1994-01-01

    /L during the infusion, changes that were within physiologic limits. In a control experiment only saline was infused. During GLP-1 infusion, plasma glucose level decreased significantly (from 5.3 +/- 0.1 to 4.7 +/- 0.1 and 4.3 +/- 0.1 pmol/L at the end of the two infusion periods). Despite this, plasma......The newly discovered intestinal hormone, glucagon-like peptide-1 (GLP-1) (proglucagon 78-107amide), stimulates insulin secretion and inhibits glucagon secretion in man and may therefore be anticipated to influence hepatic glucose production. To study this, we infused synthetic GLP-1 sequentially at...... rates of 25 and 75 pmol.kg-1.h-1 into eight healthy volunteers after an overnight fast and measured plasma concentrations of glucose, insulin, and glucagon and glucose turnover by a technique involving infusion of 3-3H-glucose. Plasma levels of GLP-1 increased by 21.3 +/- 3.1 and 75.4 +/- 3.2 pmol...

  18. Differentiation of skeletal osteogenic progenitor cells to osteoblasts with 3,4-diarylbenzopyran based amide derivatives: Novel osteogenic agents.

    Science.gov (United States)

    Gupta, Atul; Ahmad, Imran; Kureel, Jyoti; John, Aijaz A; Sultan, Eram; Chanda, Debabrata; Agarwal, Naresh Kumar; Alauddin; Wahajuddin; Prabhaker, S; Verma, Amita; Singh, Divya

    2016-10-01

    A series of 3,4-diarylbenzopyran based amide derivatives was synthesized and evaluated for osteogenic activity in in vitro and in vivo models of osteoporosis. Compounds 17a, 21b-c and 22a-b showed significant osteogenic activity in osteoblast differentiation assay. Among the synthesized compounds, 22b was identified as lead molecule which showed significant osteogenic activity at 1 pM concentration in osteoblast differentiation assay and at 1 mg kg(-1) body weight dose in estrogen deficient balb/c mice model. In vitro bone mineralization and expression of osteogenic marker genes viz BMP-2, RUNX-2, OCN, and collagen type 1 further confirmed the osteogenic potential of 22b. Gene expression study for estrogen receptor α and β (ER-α and ER-β) in mouse calvarial osteoblasts (MCOs) unveiled that possibly 22b exerted osteogenic efficacy via activation of Estrogen receptor-β preferentially. In vivo pharmacokinetic, estrogenicity and acute toxicity studies of 22b showed that it had good bioavailability and was devoid of uterine estrogenicity at 1 mg kg(-1) and inherent toxicity up to 1000 mg kg(-1) body weight dose respectively. PMID:27236065

  19. Selective separation of uranium(VI) on a chelating styrene-DVB based resin containing quinaldinic acid amide group

    International Nuclear Information System (INIS)

    A new chelating styrene-DVB based resin containing quinaldinic acid amide functional group, has been synthesised and characterised. The sorption patterns of Na(I), K(I), Be(II), Ca(II), Mg(II), Zn(II), Cd(II), Cu(II), Pb(II), Ni(II), Bi(III), Fe(III), Ti(IV) and U(VI) have been studied as a function of pH. The resin sorbs U(VI) over a wide range of pH (1.0 to 4.0) with a maximum sorption of 0.32 mmol/g at pH 3.5 to 4.0. Zn(II), Cd(II), Cu(II), Na(II), Pb(II), Fe(III) and Ti(IV) are also sorbed to different extents by the resin while Na(I), K(I), Be(II), Ca(II), Mg(II) and Bi(III) are not sorbed. Conditions for separation of U(VI) from these metal ions have been identified. The eluting agent used for U(VI) is 3 N HNO3 and the recovery recorded is about 99.9 per cent (author). 12 refs., 3 tabs

  20. Relationship between chromatographic resolution and amide structure of chiral 2-hydroxy acids as O-(-)-menthoxycarbonylated diastereomeric derivatives for enantiomeric separation on achiral gas chromatography.

    Science.gov (United States)

    Cha, Eunju; Kim, Sohee; Lee, Kang Mi; Kim, Ho Jun; Kim, Ki Hun; Kwon, Oh-Seung; Park, Ki Duk; Lee, Jaeick

    2016-02-15

    The relationship between chromatographic resolution and amide structure of chiral 2-hydroxy acids as O-(-)-menthoxycarbonylated diastereomeric derivatives on achiral gas chromatography was investigated to elucidate the best diastereomeric conformation for enantiomeric separation of chiral 2-hydroxy acids. Thirteen chiral 2-hydroxy acids were converted into nine different diastereomeric O-(-)-menthoxycarbonylated amide derivatives using the primary, secondary and cyclic amines to achieve complete enantiomeric separation through an achiral column. Each enantiomeric pair of 2-hydroxy acids as O-(-)-menthoxycarbonylated tert-butylamide derivatives was resolved on both the DB-5 and DB-17 columns with resolution factors ranging from 1.7 to 4.8 and 1.7 to 3.4, respectively. The results revealed that the structure of the amide moiety is shown to significantly affect chromatographic resolution. In addition, O-(-)-menthoxycarbonylated tert-butylamide derivatives were shown to be the best diastereomeric conformations for enantiomeric separation of 2-hydroxy acids. When comparing with our previous O-trifluoroacetylated(-)-menthyl ester derivatization method, the present results suggested that size differences between groups attached to the chiral center and conformational rigidity can have stronger effects on resolution than the distance between chiral centers. The elution of R- and S-stereoisomers was affected by the class of amine; i.e., primary, secondary, or cyclic, regardless of the substituents on the amine group, the structure of the 2-hydroxy acid, and the polarity of the column. PMID:26800225