WorldWideScience

Sample records for americium 241

  1. Americium-241 - ED 4308

    International Nuclear Information System (INIS)

    Ammerich, M.; Frot, P.; Gambini, D.; Gauron, C.; Moureaux, P.; Herbelet, G.; Lahaye, T.; Le Guen, B.; Pihet, P.; Rannou, A.; Vidal, E.

    2012-12-01

    This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)

  2. Metabolism of americium-241 in dairy animals

    International Nuclear Information System (INIS)

    Sutton, W.W.; Patzer, R.G.; Mullen, A.A.; Hahn, P.B.; Potter, G.D.

    1978-10-01

    Groups of lactating cows and goats were used to examine americium-241 metabolism in dairy animals. Following either single oral or intravenous nuclide doses, samples of milk, urine, blood, and feces were taken over a 168-hr collection period and the americium concentrations were determined by gamma counting. Gastrointestinal uptake of americium by both cows and goats was estimated to be 0.014% of the respective oral doses. The cumulative percentage of oral dose transported to milk and urine was 4.4 x 10 -4 and 1.1 x 10 -3 respectively for cows and 4.4 x 10 -3 and 1.2 x 10 -3 respectively for goats. The relatively high americium concentrations noted in caprine milk following the oral doses are discussed. Plasma concentrations of americium decreased rapidly following all intravenous injections. The average percentage of injected americium transferred to milk, urine, and feces was 3, 6, and 2% respectively for cows and 2, 4, and 2% respectively for goats. In both intravenously dosed groups, approximately 30% of all americium released from the body was found in the urine during the first 24 hrs after injection. All animals were sacrificed 8 to 9 days after dosing. Bovine bone retained the greatest fraction of the administered dose followed by the liver. However, liver retained the greatest amount of americium in the goats following both oral and intravenous doses. Comparisons are presented between americium-241 and plutonium-238 transport in dairy cows

  3. Metabolism of americium-241 in dairy animals

    International Nuclear Information System (INIS)

    Sutton, W.W.; Patzer, R.G.; Mullen, A.A.; Hahn, P.B.; Potter, G.D.

    1978-01-01

    Groups of lactating cows and goats were used to examine americium-241 metabolism in dairy animals. Following either single oral or intravenous nuclide doses, samples of milk, urine, blood, and feces were taken over a 168-hour collection period, and the americium concentrations were determined by gamma counting. Gastrointestinal uptake of americium by cows and goats was estimated to be 0.014 and 0.016% of the oral dose, respectively. The cumulative percentage of oral dose transported to milk and urine was 4.4 x 10 -4 and 1.1 x 10 -3 , respectively, for cows and 5.6 x 10 -4 and 1.2 x 10 -3 , respectively, for goats. Plasma concentrations of americium decreased rapidly following all intravenous injections. The average percentage of injected americium transferred to milk, urine, and feces was 3, 6, and 2%, respectively, for cows, and 2, 4, and 2%, respectively, for goats. In both intravenously dosed groups, approximately 30% of all americium released from the body was found in the urine during the first 24 hours after injection. All animals were sacrificed 8 to 9 days after dosing. Bovine bone retained the greatest fraction of the administered dose followed by liver and kidney. However, liver retained the greatest amount of americium in the goats following both oral and intravenous doses. Comparisons are presented between americium-241 and plutonium-238 transport in dairy cows

  4. Contributions to the preparation of 241americium metal and a few 241americium silicides

    International Nuclear Information System (INIS)

    Wittmann, F.D.

    1980-01-01

    In order to take a closer look at the americium-silicon system, three further silicides of americium: Am 5 Si 3 , Am 2 Si 3 and AmSi 2 were prepared in addition to the already known americium monosilicide and starting from the knowledge gained from the latters preparation. Radiographic investigations were carried out into the temperature region of 900 0 C. They showed no change of structure in the three compounds. It was possible to prepare residue-free americium metal by reducing AmF 3 with Si, whereby the SiF 4 formed can be easily separated off as volatile compound, and the Am metal is brought into a very pure form by sublimation suitable for spectrochemical investigations. Attempts to prepare binary germanides and gallides of 241 americium were unsuccessful. (RB) [de

  5. Biosorption of americium-241 by Candida sp

    International Nuclear Information System (INIS)

    Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Liao Jiali

    2003-01-01

    As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high toxicity and long half-life. In this experiment, the biosorption of 241 Am from solution by Candida sp., and the effects of various experimental conditions on the adsorption were investigated. The preliminary results showed that the adsorption of 241 Am by Candida sp. was efficient. 241 Am could be removed by Candida sp. of 0.82 g/L (dry weight) from 241 Am solutions of 5.6-111 MBq/L (44.3-877.2 μg/L)(C 0 ), with maximum adsorption rate (R) of 98% and maximum adsorption capacities (W) of 63.5 MBq/g biomass (dry weight) (501.8 μg/g). The biosorption equilibrium was achieved within 4 hour and the optimum pH was pH = 2. No significant differences on 241 Am adsorption were observed at 10 C-45 C, or in solutions containing Au 3+ or Ag + , even 1500 times or 4500 times above the 241 Am concentration, respectively. The relationship between concentrations and adsorption capacities of 241 Am indicated the biosorption process should be described by a Langmuir adsorption isotherm. (orig.)

  6. Uptake of americium-241 by algae and bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Geisy, J P; Paine, D

    1978-01-01

    Algae and bacteria are important factors in the transport and mobilization of elements in the biosphere. These factors may be involved in trophic biomagnification, resulting in a potential human hazard or environmental degradation. Although americium, one of the most toxic elements known, is not required for plant growth, it may be concentrated by algae and bacteria. Therefore, the availability of americium-241 to algae and bacteria was studied to determine their role in the ultimate fate of this element released into the environment. Both algae and bacteria concentrated americium-241 to a high degree, making them important parts of the biomagnification process. The ability to concentrate americium-241 makes algae and bacteria potentially significant factors in cycling this element in the water column. (4 graphs, numerous references, 3 tables)

  7. Investigation of americium-241 metal alloys for target applications

    International Nuclear Information System (INIS)

    Conner, W.V.; Rockwell International Corp., Golden, CO

    1982-01-01

    Several 241 Am metal alloys have been investigated for possible use in the Lawrence Livermore National Laboratory Radiochemical Diagnostic Tracer Program. Several properties were desired for an alloy to be useful for tracer program applications. A suitable alloy would have a fairly high density, be ductile, homogeneous and easy to prepare. Alloys investigated have included uranium-americium, aluminium-americium, and cerium-americium. Uranium-americium alloys with the desired properties proved to be difficult to prepare, and work with this alloy was discontinued. Aluminium-americium alloys were much easier to prepare, but the alloy consisted of an aluminium-americium intermetallic compound (AmAl 4 ) in an aluminum matrix. This alloy could be cast and formed into shapes, but the low density of aluminum, and other problems, made the alloy unsuitable for the intended application. Americium metal was found to have a high solid solubility in cerium and alloys prepared from these two elements exhibited all of the properties desired for the tracer program application. Cerium-americium alloys containing up to 34 wt% americium have been prepared using both co-melting and co-reduction techniques. The latter technique involves co-reduction of cerium tetrafluoride and americium tetrafluoride with calcium metal in a sealed reduction vessel. Casting techniques have been developed for preparing up to eight 2.2 cm (0.87 in) diameter disks in a single casting, and cerium-americium metal alloy disks containing from 10 to 25 wt% 241 Am have been prepared using these techniques. (orig.)

  8. Uptake of americium-241 by algae and bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Giesy, Jr, J P; Paine, D [Savannah River Ecology Lab., Aiken, S.C. (USA)

    1978-01-01

    The uptake of americium by three algae, Scenedesmus obliguus, Selenastrum capricomutum and Chlorella pyrenosdosa and a bacterium Aeromonas hydrophila was studied. Live and fixed cells of each algal species and live bacterial cells were used. It is shown that algae and bacteria concentrate americium 241 to a high degree which makes them important links in the biomagnification phenomenon which may ultimately lead to a human hazard and be potentially important in recycling Am /sup 241/ in the water column and mobilization from sediments. Chemical fixation of algal cells caused increased uptake which indicated that uptake is by passive diffusion and probably due to chemical alteration of surface binding sites.

  9. Recovery of americium-241 from aged plutonium metal

    International Nuclear Information System (INIS)

    Gray, L.W.; Burney, G.A.; Reilly, T.A.; Wilson, T.W.; McKibben, J.M.

    1980-12-01

    About 5 kg of ingrown 241 Am was recovered from 850 kg of aged plutonium using a process developed specifically for Savannah River Plant application. The aged plutonium metal was first dissolved in sulfamic acid. Sodium nitrite was added to oxidize the plutonium to Pu(IV) and the residual sulfamate ion was oxidized to nitrogen gas and sulfate. The plutonium and americium were separated by one cycle of solvent extraction. The recovered products were subsequently purified by cation exchange chromatography, precipitated as oxalates, and calcined to the oxides. Plutonium processng was routine. Before cation exchange purification, the aqueous americium solution from solvent extraction was concentrated and stripped of nitric acid. More than 98% of the 241 Am was then recovered from the cation exchange column where it was effectively decontaminated from all major impurities except nickel and chromium. This partially purified product solution was concentrated further by evaporation and then denitrated by reaction with formic acid. Individual batches of americium oxalate were then precipitated, filtered, washed, and calcined. About 98.5% of the americium was recovered. The final product purity averaged 98% 241 AmO 2 ; residual impurities were primarily lead and nickel

  10. Americium-241 in bile and feces

    International Nuclear Information System (INIS)

    LoSasso, T.; Cohen, N.; Wrenn, M.E.

    1977-01-01

    In order to investigate the relationship between the excretion of Am-241 in bile and in feces, two young adult female baboons underwent cholecystopexy surgery to facilitate gallbladder bile sampling by needle puncture through the abdominal wall. Am-241 was injected intravenously in citrate form at dose levels of 0.090 and 0.098 μCi/kg. It has been observed that concentrations of Am-241 in bile increase gradually at early times post injection, reach a peak at 3 to 5 weeks and then decrease slowly over a period of several months, similar to the pattern of Am-241 excretion in feces. At times greater than one week post Am-241 injection, there is a 1 : 1 correlation between the activity measured in bile and that which appears in the feces a few days later, indicating that Am-241 excreted in feces represents elimination primarily from liver and that significant reabsorption by the intestines does not occur as is true for other bile constituents. At earlier times, less than one week post injection, Am-241 appears in feces via other pathways in addition to the biliary route

  11. Effect of americium-241 on luminous bacteria. Role of peroxides

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)

    2011-04-15

    The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.

  12. Evaluation of neutron data for americium-241

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M.; Sukhovitskij, E.Sh.; Porodzinskij, Yu.V.; Klepatskij, A.B.; Morogovskij, G.B. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The evaluation of neutron data for {sup 241}Am is made in the energy region from 10{sup -5} eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Y. Kikuchi (JAERI). (author). 60 refs.

  13. Americium-241 and -243 as an ion-engine propellant

    International Nuclear Information System (INIS)

    Schachter, M.M.

    1994-01-01

    Commercially available americium-241 and -243 can be obtained as the mixture of the two isotopes in 100-gram quantities--a product of reprocessing spent nuclear powerplant fuel elements along with plutonium. The half-lives of the isotopes are 450 years for the -241 and 8,000 years for the -243 (the plutonium half-life isotope so obtained is 24,000 years). Americium rolled out in thin foil sheets emits alpha-rays (helium-4 ions) and beta-rays--2 valence electrons for each helium ion. Electrons are also considered as ions. As a foil, the americium radiates only a minimal amount of gamma-rays via the Curie effect. With appropriately designed permanent magnet rings insulated with Wood's alloy, the + and - ions can be accelerated from their already 5.5 million electron-Volts to billion and even trillions of electron-Volts by electronic control grids powered by the magnetohydrodynamic effect of electrons and helium ions streaming at the post-rocket nozzle of the ion engine. Protocol for the estimated thrust of this ion rocket engine is more than ten kilograms continuously sustainable for several thousand years

  14. Americium-241 radioisotope thermoelectric generator development for space applications

    International Nuclear Information System (INIS)

    Ambrosi, Richard; Williams, Hugo; Samara-Ratna, Piyal

    2013-01-01

    Space nuclear power systems are under development in the UK in collaboration with European partners as part of a European Space Agency (ESA) programme. Radioisotope thermoelectric generators (RTG) are an important element of this new capability in Europe. RTG systems being developed in Europe are targeting the 10 W electric to 50 W electric power generation range adopting a modular scalable approach to the design. Radiogenic decay heat from radioisotopes can be converted to electrical power by using appropriate semiconductor based thermoelectric materials. The plan for Europe is to develop radioisotope space nuclear power systems based on both thermoelectric and Stirling power conversion systems. Although primarily focused on delivering up to 50 W of electrical power, the European radioisotope thermoelectric system development programme is targeting americium-241 as a fuel source and is maximizing the use of commercially available thermoelectric manufacturing processes in order to accelerate the development of power conversion systems. The use of americium provides an economic solution at high isotopic purity and is product of a separation process from stored plutonium produced during the reprocessing of civil nuclear fuel. A laboratory prototype that uses electrical heating as a substitute for the radioisotope was developed to validate the designs. This prototype has now been tested. This paper outlines the requirements for a European americium-241 fuelled RTG, describes the most recent updates in system design and provides further insight into recent laboratory prototype test campaigns. (author)

  15. Americium-241 radioisotope thermoelectric generator development for space applications

    Energy Technology Data Exchange (ETDEWEB)

    Ambrosi, Richard; Williams, Hugo; Samara-Ratna, Piyal, E-mail: rma8@le.ac.uk [University of Leicester, (United Kingdom); and others

    2013-07-01

    Space nuclear power systems are under development in the UK in collaboration with European partners as part of a European Space Agency (ESA) programme. Radioisotope thermoelectric generators (RTG) are an important element of this new capability in Europe. RTG systems being developed in Europe are targeting the 10 W electric to 50 W electric power generation range adopting a modular scalable approach to the design. Radiogenic decay heat from radioisotopes can be converted to electrical power by using appropriate semiconductor based thermoelectric materials. The plan for Europe is to develop radioisotope space nuclear power systems based on both thermoelectric and Stirling power conversion systems. Although primarily focused on delivering up to 50 W of electrical power, the European radioisotope thermoelectric system development programme is targeting americium-241 as a fuel source and is maximizing the use of commercially available thermoelectric manufacturing processes in order to accelerate the development of power conversion systems. The use of americium provides an economic solution at high isotopic purity and is product of a separation process from stored plutonium produced during the reprocessing of civil nuclear fuel. A laboratory prototype that uses electrical heating as a substitute for the radioisotope was developed to validate the designs. This prototype has now been tested. This paper outlines the requirements for a European americium-241 fuelled RTG, describes the most recent updates in system design and provides further insight into recent laboratory prototype test campaigns. (author)

  16. Effect of 241-americium on bone marrow stroma

    International Nuclear Information System (INIS)

    Heuvel, R. van den

    1990-01-01

    The regulation of haemopoiesis occurs via complex interactions between the stroma and the haemopoietic cells. An attempt to further clarifying the mechanisms and the exact role of the stroma in the regulation was made in a study. Results revealed that the murine bone marrow stromal cells are highly radiosensitive after injection with 241-americium and can thus be considered as a target population after internal contamination. In addition, observations are made which may be important for risk estimation for the developing animal and during pregnancy. Contamination in utero and by lactation shows persistent damage up to 1 year after contamination at an average annual dose of 5 cGy. (author)

  17. Airborne plutonium-239 and americium-241 concentrations measured from the 125-meter Hanford Meteorological Tower

    International Nuclear Information System (INIS)

    Sehmel, G.A.

    1978-01-01

    Airborne plutonium-239 and americium-241 concentrations and fluxes were measured at six heights from 1.9 to 122 m on the Hanford meteorological tower. The data show that plutonium-239 was transported on nonrespirable and small particles at all heights. Airborne americium-241 concentrations on small particles were maximum at the 91 m height

  18. National low-level waste management program radionuclide report series, Volume 14: Americium-241

    International Nuclear Information System (INIS)

    Winberg, M.R.; Garcia, R.S.

    1995-09-01

    This report, Volume 14 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of americium-241 ( 241 Am). This report also includes discussions about waste types and forms in which 241 Am can be found and 241 Am behavior in the environment and in the human body

  19. Elimination of americium-241 after a case of accidental inhalation

    International Nuclear Information System (INIS)

    Edvardsson, K.A.; Lindgren, L.

    1976-01-01

    In handling a 241 Am source one person received an internal contamination of about 140 nCi of americium oxide, which was deposited in the lung region. Elimination of the activity was followed for more than 3 months by external gamma counting and excreta analyses. During the first week after the inhalation about 80% of the total intake was eliminated with an effective half-life of less than 2 days. The remaining activity, deposited in the lung region, was eliminated with an effective half-life of about 17 days. About 15% of the activity eliminated from the lung region from the 10th to the 50th day was eliminated in the faeces. (author)

  20. Radiation protection data sheets for the use of Americium 241 in unsealed sources

    International Nuclear Information System (INIS)

    Anon.

    1993-01-01

    This radiation protection data sheet is intended for supervisors and staff in the different medical, hospital, pharmaceutical, university and industrial laboratories and departments where Americium 241 is handled, and also for all those involved in risk prevention in this field. It provides essential data on radiation protection measures during the use of Americium 241 in unsealed sources: physical characteristics, risk assessment, administrative procedures, recommendations, regulations and bibliography

  1. Status of Americium-241 recovery at Rocky Flats Plant

    International Nuclear Information System (INIS)

    Knighton, J.B.; Hagan, P.G.; Navratil, J.D.; Thompson, G.H.

    1981-01-01

    This paper is presented in two parts: Part I, Molten Salt Extraction of Americium from Molten Plutonium Metal, and Part II, Aqueous Recovery of Americium from Extraction Salts. The Rocky Flats recovery process used for waste salts includes (1) dilute hydrochloric acid dissolution of residues; (2) cation exchange to convert from the chloride to the nitrate system and to remove gross amounts of monovalent impurities; (3) anion exchange separation of plutonium; (4) oxalate precipitation of americium; and (5) calcination of the oxalate at 600 0 C to yield americium oxide. The aqueous process portion describes attempts to improve the recovery of americium. The first part deals with modifications to the cation exchange step; the second describes development of a solvent extractions process that will recovery americium from residues containing aluminium as well as other common impurities. Results of laboratory work are described. 3 figures, 6 tables. (DP)

  2. Environmental impact of a teratogenic actinide: a case study of americium-241

    Energy Technology Data Exchange (ETDEWEB)

    Wang, J.; Yang, J.Y.

    1985-10-16

    Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs.

  3. Environmental impact of a teratogenic actinide: a case study of americium-241

    International Nuclear Information System (INIS)

    Wang, J.; Yang, J.Y.

    1985-01-01

    Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. A previous report based on a worst-case scenario involving a hypothetical fire accident in a contaminated facility indicated that there could have been a significant impact on nearby residents from a unit release of americium-241 via atmospheric dispersion. However, because the facility is located in a rural region where most drinking water supplies are drawn from private wells, it is believed that deposition of americium-241 from the atmosphere might also have impacts via the groundwater pathway by infiltration of rainwater. In this analysis, a three-dimensional analytical mathematical model is used to assess several aspects of americium-241 contamination of groundwater, including radioactive transformation, advection, dispersion, and soil sorption. Simulation results indicate that no significant radiological impacts would occur to the nearby residents via the groundwater pathway. 15 refs., 2 figs., 2 tabs

  4. Recovery of Americium-241 from lightning rod by the method of chemical treatment

    International Nuclear Information System (INIS)

    Cruz, W.H.

    2013-01-01

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ( 241 Am), fewer and Radium 226 ( 226 Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241 Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241 Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241 Am technique was used electrodeposition. (author)

  5. Environmental impacts of the release of a transuranic actinide, americium-241, from a contaminated facility

    Energy Technology Data Exchange (ETDEWEB)

    Want, J.; Merry-Libby, P.

    1985-10-29

    Americium-241 is widely used as a radiation source, but it also has some potential risk if taken into the body because of its high dose conversion factor. Although the radiotoxicity of americium-241 is small compared to other transuranic actinides, its effects on the reproductive system and on development of the placenta are more damaging than the effects of plutonium-239. In Ohio, a gemologist's laboratory was contaminated with americium-241. Prior to decontamination of the laboratory, potential radiological impacts to the surrounding environment were assessed. A hypothetical fire accident resulting in a unit release (1 curie) was assumed. Potential radiological impacts were simulated using an atmospheric dispersion and dosimetry model with local meteorological data, population census data, and detailed information regarding the neighborhood. The results indicate that there could have been a significant impact on nearby residents from americium-241 via atmospheric dispersion if a major catastrophic release had occurred prior to contamination and decommissioning of the laboratory. 14 refs., 3 figs., 2 tabs.

  6. Accumulation of americium-241 in the biomass of aquatic plants of the Yenisei river: experimental study

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)

    2004-07-01

    Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including {sup 241}Am). {sup 241}Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of {sup 241}Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of {sup 241}Am from the biomass. The content of {sup 241}Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of {sup 241}Am in the plants were in inverse proportion to their biomass. We obtained new data on release of {sup 241}Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial {sup 241}Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of {sup 241}Am and retain americium for long periods of time in biomass. (author)

  7. Accumulation of americium-241 in the biomass of aquatic plants of the Yenisei river: experimental study

    International Nuclear Information System (INIS)

    Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G.

    2004-01-01

    Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including 241 Am). 241 Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of 241 Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of 241 Am from the biomass. The content of 241 Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of 241 Am in the plants were in inverse proportion to their biomass. We obtained new data on release of 241 Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial 241 Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of 241 Am and retain americium for long periods of time in biomass. (author)

  8. Americium-241: the most useful isotope of the actinide elements

    International Nuclear Information System (INIS)

    Navratil, J.D.

    1984-01-01

    Used extensively in nuclear gauges and in many other areas, this man-made element (Atomic Number 95) was first isolated in weighable amounts during World War II. Americium is now a very useful by-product of the nuclear industry and is produced in kilogram amounts by appropriate recovery, separation and purification processes. A review will be presented of its discovery, nuclear and chemical properties, and uses, with emphasis on its production process and separations chemistry

  9. Biosorption of americium-241 by immobilized Rhizopus arrihizus

    International Nuclear Information System (INIS)

    Liao Jiali; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji

    2004-01-01

    Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove 241 Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting 241 Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb 241 Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of 241 Am was removed from 241 Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of 241 Am. At this time, the total adsorption of 241 Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed 241 Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO 3

  10. Plutonium-239 and americium-241 uptake by plants from soil. Final report

    International Nuclear Information System (INIS)

    Brown, K.W.

    1979-03-01

    Alfalfa was grown in soil contaminated with plutonium-239 dioxide (239PuO2) at a concentration of 29.7 nanocuries per gram (nCi/g). In addition to alfalfa, radishes, wheat, rye, and tomatoes were grown in soils contaminated with americium-241 nitrate (241Am(NO3)3) at a concentration of 189 nCi/g. The length of exposure varied from 52 days for the radishes to 237 days for the alfalfa. The magnitude of plutonium incorporation by the alfalfa as indicated by the concentration ratio, 0.0000025, was similar to previously reported data using other chemical forms of plutonium. The results did indicate, however, that differences in the biological availability of plutonium isotopes do exist. All of the species exposed to americium-241 assimilated and translocated this radioisotope to the stem, leaf, and fruiting structures. The magnitude of incorporation as signified by the concentration ratios varied from 0.00001 for the wheat grass to 0.0152 for the radishes. An increase in the uptake of americium also occurred as a function of time for four of the five plant species. Evidence indicates that the predominant factor in plutonium and americium uptake by plants may involve the chelation of these elements in soils by the action of compounds such as citric acid and/or other similar chelating agents released from plant roots

  11. Recovery of americium-241 from aged plutonium metal

    International Nuclear Information System (INIS)

    Gray, L.W.; Burney, G.A.; Reilly, T.A.; Wilson, T.W.; McKibben, J.M.

    1980-01-01

    After separation and purification, both actinides were precipitated as oxalates and calcined. A large-scale process was developed using dissolution, separation, purification, precipitation, and calcination. Efforts were made to control corrosion, to avoid product contamination, to keep the volume of process and waste solutions manageable, and to denitrate solutions with formic acid. The Multipurpose Processing Facility (MPPF), designed for recovery of transplutonium isotopes, was used for the first time for the precipitation and calcination of americium. Also, for the first time,, large-scale formic acid denitration was performed in a canyon vessel at SRP

  12. Americium-241 in surface soil associated with the Hanford site and vicinity

    International Nuclear Information System (INIS)

    Price, K.R.; Gilbert, R.O.; Gano, K.A.

    1981-05-01

    Various kinds of surface soil samples were collected and analyzed for Americium-241 ( 241 Am) to examine the feasibility of improving soil sample data for the Hanford Surface Environmental Surveillance Program. Results do not indicate that a major improvement would occur if procedures were changed from the current practices. Conclusions from this study are somewhat tempered by the very low levels of 241 Am ( 241 Am in soil crust (0 to 1.0 cm deep) was greater than the corresponding subsurface layer (1.0 to 2.5 cm deep), and the average concentration of 241 Am in some onsite samples collected near the PUREX facility was greater than comparable samples collected 60 km upwind at an offsite location

  13. Speciation and bioavailability of Americium-241 in the fresh water environment

    International Nuclear Information System (INIS)

    Bierkens, J.

    1986-01-01

    Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241 Am in the freshwater environment aim to establish a relation between the behavior of 241 Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241 Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241 Am. Based on the registration of the 241 Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241 Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241 Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241 Am with some other metals ( 240 Pu, 64 Cu, 198 Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241 Am in organisms can be explained from its chemical characteristics

  14. Standard test method for quantitative determination of americium 241 in plutonium by Gamma-Ray spectrometry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    1994-01-01

    1.1 This test method covers the quantitative determination of americium 241 by gamma-ray spectrometry in plutonium nitrate solution samples that do not contain significant amounts of radioactive fission products or other high specific activity gamma-ray emitters. 1.2 This test method can be used to determine the americium 241 in samples of plutonium metal, oxide and other solid forms, when the solid is appropriately sampled and dissolved. 1.3 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  15. Limits of detection of americium-241 in air

    International Nuclear Information System (INIS)

    Bereznai, T.

    1995-01-01

    Seven semiconductor detectors with various characteristics (type, form, size, etc.) were tested and compared in gamma-spectrometric assays for Am-241 aerosols in air. The problem at hand (determining a low activity or attaining a set detection limit (approx. 2 mBq/m 3 ) as soon as possible after sampling) was solved best by a large-volume n-type detector with a Be-window. In addition to the detector parameters commonly used (energy resolution and effectiveness), the peak-to-background ratio and the background counting rate at the gamma-energy of the nuclide to be determined are important criteria influencing the choice of equipment. (orig.) [de

  16. Electric resistivity of 241-americium and 244-curium metals. Creation of defects and isochronous annealing of 241-americium metal after self-irradiation

    International Nuclear Information System (INIS)

    Schenkel, R.

    1977-03-01

    The temperature dependence of the electrical resistivity of thin films of bulk 241 Am metal were measured between 300 and 4.5 K. The room temperature resistivity was found to be 68.90μΩcm. At room temperature the electrical resistivity of americium increases with pressure (3% up to 13 kbar). The application of 13 kbar pressure did not change the low temperature power law in the electrical resistivity. The resistivity vs temperature curve can be explained by assuming s-d scattering of conduction electrons. The localized 5f electrons are considered to be about 5eV below the Fermi level. Americium therefore should be the first lanthanide-like element in the actinide series. The defect production due to self-irradiation damage was studied by measuring the increase of the resistivity at 4.2 K over a period of 738 h. A saturation resistivity of 16.036 μΩcm was found corresponding to a defect concentration of about 0.22 a/o. After isochronal annealing two recovery stages were observed at about 65 and 145 K. The two stages shift with increasing initial defect concentration to lower temperatures. Estimates of the activation energies and the reaction order were made and possible defect reactions suggested. The magnetic contribution to the electrical resistivity of curium, which shows an antiferromagnetic transition at 52.5 k, was obtained by subtracting the resistivity of americium (to be considered as phonon part). Comparison with theoretical models were made. At low temperatures the measurements are strongly affected by self-irradiation damage [drho/dt(t=0)=9.8μΩcm/h

  17. Uptake of americium-241 by plants from contaminated Chernobyl exclusive zone test site soils

    International Nuclear Information System (INIS)

    Rashydov, N.M.

    2002-01-01

    Americium-241 was found to accumulate in soils and biological objects of the environment. Its concentration has increased many times after the Chernobyl disaster and can be expected to increase about 40 times in the future. This research concentrated on the contaminated exclusive Chernobyl zone polluted by trace radionuclides, their behavior and accumulation by various plant species. Special attention is devoted to the bioavailability of 241 Am to the plants Galium rivale, G. tinctorium, G. aparine, G. intermedium, Berteroa incana, Artemisia absinthium, A. vulgaris, Centaurea borysthenica, C. arenaria, Cirsium arvense, Succissa pratensis, Solidago virgaurea, Linaria vulgaris, Lepidium ruderale, Stenactis annua, Veronica maxima, Verbascum lychnitis, Euphorbia cyparissias, Genista tinctoria, Erigeron canadensis, Oenothera biennis, Betula pendula and Quercus robur, which were collected from the Chernobyl, Kopachi, and Yanov districts. The plant samples of Oenothera biennis, Betula pendula and Quercus robur were collected from the Yanov district, where the soil contamination by 241 Am and 137 Cs was at the level of 660 and 27 MBq/m 2 , respectively. Gamma spectroscopy and radiochemical methods were used to estimate the activity concentration of 137 Cs, 90 Sr, 238 Pu, 239+240 Pu, 241 Am. The radionuclides were measured in the dry green mass of the plant samples and in the dry soils. The contamination of the Oenothera biennis, Betula pendula and Quercus robur samples by 137 Cs was (5.8±1,5)x10 6 , (7.4±1.1)x10 5 , and (2.6±0.2)x10 6 Bq/kg dry mass, respectively, and contamination by 241 Am was 47±5, 45±3 and 3.2±0.2 Bq/kg, respectively. The soil-to-plant transfer ratio for 137 Cs ranged lay within the interval of 0.2 to 0.03 Bq/kg : Bq/m 2 , the the transfer ratio for 241 Am did not exceed 7x10 -5 Bq/kg : Bq/m 2 . The coefficient of the relative contents of the 241 Am/ 239+240 Pu radionuclides in the various plant samples varied from 3.2 to 8.3, while for soil from

  18. Uptake and effects of americium-241 on a brackish-water amphipod

    Energy Technology Data Exchange (ETDEWEB)

    Hoppenheit, M.; Murray, C.N.; Woodhead, D.S.

    1980-01-01

    The present paper reports the results of experimental work undertaken using the brackish-water amphipod Gammarus duebeni duebeni and the transuranium nuclide americium-241. Data on the accumulation of this actinide showed that the larger fraction of the total body burden is associated with the exoskeleton. It was found that the body burden remained constant in the range pH 8.0-6.5 even though the water concentration changed markedly. It would thus appear that the concept of a concentration factor should be re-examined and it is proposed that a factor should be defined in terms of environmental and chemical parameters which represent the bioavailable fraction of the actinide. The effect of americium on survival and moulting was studied at two activity concentrations; the dose rates and absorbed doses under the experimental conditions employed have been estimated. The differences in survival rates between the control and irradiated groups were statistically analyzed and the significant difference at the higher concentration is believed to be due to a synergism between physiological stress and radiotoxicity of americium rather than the chemical toxicity of the element.

  19. Uptake and effects of americium-241 on a brackish-water amphipod

    International Nuclear Information System (INIS)

    Hoppenheit, M.; Murray, C.N.; Woodhead, D.S.

    1980-01-01

    The present paper reports the results of experimental work undertaken using the brackish-water amphipod Gammarus duebeni duebeni and the transuranium nuclide americium-241. Data on the accumulation of this actinide showed that the larger fraction of the total body burden is associated with the exoskeleton. It was found that the body burden remained constant in the range pH 8.0-6.5 even though the water concentration changed markedly. It would thus appear that the concept of a concentration factor should be re-examined and it is proposed that a factor should be defined in terms of environmental and chemical parameters which represent the bioavailable fraction of the actinide. The effect of americium on survival and moulting was studied at two activity concentrations; the dose rates and absorbed doses under the experimental conditions employed have been estimated. The differences in survival rates between the control and irradiated groups were statistically analyzed and the significant difference at the higher concentration is believed to be due to a synergism between physiological stress and radiotoxicity of americium rather than the chemical toxicity of the element. (orig.) [de

  20. Americium-241 use of measurement lead equivalent thickness for medical x-ray room: A review

    International Nuclear Information System (INIS)

    Mohd Khalid Matori; Husaini Saleh; Abd Aziz Mhd Ramli; Muhammad Jamal Md Isa; Mohd Firdaus Abd Rahman; Zainal Jamaluddin

    2010-01-01

    Lead equivalent thickness measurement of a shielding material in diagnostic radiology is very important to ensure that requirements for the purpose of radiation protection of patients, employees and the public are met. The Malaysian Ministry of Health (MOH) has established that the irradiation room must have sufficient shielding thickness, for example for general radiography it must be at least equal to 2.0 mm of Pb, for panoramic dental radiography at least equal to 1.5 mm of Pb and for mammography should be a minimum of 1.0 mm of Pb. This paper presents a technique using americium-241 source to test and verify the integrity of the shielding thickness in term of lead equivalent for X-ray room at health centres. Results of measurement of 30 irradiation rooms conducted from 2009 to mid 2010 were analyzed for this presentation. Technical comparison of the attenuation of gamma rays from Am-241 source through the walls of the irradiation room and pieces of lead were used to assess the lead equivalent thickness of the walls. Results showed that 96.7 % of the irradiation rooms tested meet the requirements of the Ministry of Health and is suitable for the installation of the intended diagnostic X-ray apparatus. Some specific positions such as door knobs and locks, electrical plug sockets were identified with potential to not met the required lead equivalent thickness hence may contribute to higher radiation exposure to workers and the public. (author)

  1. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1975-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  2. Study of biosorbents application on the treatment of radioactive liquid wastes with americium-241

    International Nuclear Information System (INIS)

    Borba, Tania Regina de

    2010-01-01

    The use of nuclear energy for many different purposes has been intensified and highlighted by the benefits that it provides. Medical diagnosis and therapy, agriculture, industry and electricity generation are examples of its application. However, nuclear energy generates radioactive wastes that require suitable treatment ensuring life and environmental safety. Biosorption and bioaccumulation represent an emergent alternative for the treatment of radioactive liquid wastes, providing volume reduction and physical state change. This work aimed to study biosorbents for the treatment of radioactive liquid wastes contaminated with americium-241 in order to reduce the volume and change the physical state from liquid to solid. The biosorbents evaluated were Saccharomyces cerevisiae immobilized in calcium alginate beads, inactivated and free cells of Saccharomyces cerevisiae, calcium alginate beads, Bacillus subtilis, Cupriavidus metallidurans and Ochrobactrum anthropi. The results were quite satisfactory, achieving 100% in some cases. The technique presented in this work may be useful and viable for implementing at the Waste Management Laboratory of IPEN - CNEN/SP in short term, since it is an easy and low cost method. (author)

  3. Assessment of radiation doses from residential smoke detectors that contain americium-241

    International Nuclear Information System (INIS)

    O'Donnell, F.R.; Etnier, E.L.; Holton, G.A.; Travis, C.C.

    1981-10-01

    External dose equivalents and internal dose commitments were estimated for individuals and populations from annual distribution, use, and disposal of 10 million ionization chamber smoke detectors that contain 110 kBq (3 μCi) americium-241 each. Under exposure scenarios developed for normal distribution, use, and disposal using the best available information, annual external dose equivalents to average individuals were estimated to range from 4 fSv (0.4 prem) to 20 nSv (2 μrem) for total body and from 7 fSv to 40 nSv for bone. Internal dose commitments to individuals under post disposal scenarios were estimated to range from 0.006 to 80 μSv (0.0006 to 8 mrem) to total body and from 0.06 to 800 μSv to bone. The total collective dose (the sum of external dose equivalents and 50-year internal dose commitments) for all individuals involved with distribution, use, or disposal of 10 million smoke detectors was estimated

  4. Investigation of the retention and distribution of americium-241 in the baboon and the enhanced removal of americium-241 from the body by diethylenetriaminepentaacetic acid (DTPA)

    International Nuclear Information System (INIS)

    Guilmette, R.A.; Cohen, N.; Wrenn, M.E.

    1975-01-01

    Experiments were performed to study the metabolism and distribution of intravenously administered 241 Am in the adult and juvenile baboon; in addition, decorporation therapy using Na 3 -CaDTPA was performed on selected baboons to assess the efficacy of this drug in removing systemic burdens of 241 Am from this primate species. Determination of the kinetics of 241 Am was accomplished principally by in vivo methodologies and by radiochemical analysis of 241 Am activity of biological material. The use of Na 3 -CaDTPA as a therapeutic agent for the removal of 241 Am from the body proved to be an effective form of treatment in the case of early administration. (U.S.)

  5. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Taylor, D.M.

    1988-01-01

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  6. Determination of americium in urine

    International Nuclear Information System (INIS)

    Shvydko, N.S.; Mikhajlova, O.A.; Popov, D.K.

    1988-01-01

    A technique has been developed for the determination of americium 241 in urine by a raiochemical purification of the nuclide from uranium (upon co-precipitation of americium 241 with calcium and lanthanum), plutonium, thorum, and polonium 210 (upon co-precipitation of these radionuclides with zirconium iodate). α-Radioactivity was measured either in a thick layer of the americium 241 precipitate with a nonisotope carrier or in thin-layer preparations after electrolytic precipitation of americium 241 on a cathode

  7. Comparative study of G2 delay and survival after /sup 241/Americium-. cap alpha. and /sup 60/Cobalt-. gamma. irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Luecke-Huhle, C.; Comper, W.; Hieber, L.; Pech, M.

    1982-06-01

    Survival and G2 delay following exposure to either /sup 60/Cobalt-..gamma..-rays or /sup 241/Americium-..cap alpha..-particles were studied in eight mammalian cell lines of human and animal origin including human fibroblasts from normal individuals and from patients with Ataxia telangiectasia or Fanconi's anemia. For both endpoints the effectiveness of alpha particle was greater as compared to ..gamma..-rays. RBE values for G2 delay (4.6-9.2) were in general comparable to RBE values derived from initial slopes of survival curves but higher compared to the ratio of mean inactivation doses. Ataxia cells were particularly sensitive to cell killing by ..gamma..-irradiation, however, showed average sensitivity to ..cap alpha..-particles of high LET. With the exception of Ataxia cells, cell killing and G2 delay seem to be related processes if individual cell cycle parameters are taken into account.

  8. Biosorption of radionuclide Americium-241 by A. niger spore and hyphae

    International Nuclear Information System (INIS)

    Yang Yuanyou; Liu Ning; Jin Jiannan; Hua Xinfeng; Zhang Taiming; Luo Shunzhong; Sun Qiling

    2002-01-01

    The biosorption of radionuclide 241 Am from solution was studied by a. niger spore and hyphae, and the effects of the operational conditions on the treatment were investigated. The results showed the treatment by A. niger spore and hyphae were very efficient. An average of 96% of the total 241 Am was removed from 241 Am solutions of 5.6-111 MBq/L (C 0 ), with adsorption capacities (W) of 7.2-142.4 MBq/g biomass, 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 h and the optimum pH value ranged 3-0.1 mol/L HNO 3 and 3-2 for spore and hyphae of A. niger, respectively. No significant effects on 241 Am biosorption were observed at 15 degree C-45 degree C, or challenged with containing Au 3+ or Ag + , even 2000 times above 241 Am amount. the index relationship between concentrations and adsorption capacities of 241 Am indicated that the 241 Am biosorption by A. niger spore and hyphae obey to Freundlich adsorption equation. The adsorption behavior of A. niger spore and hyphae were basically coincident

  9. The uptake of plutonium-239, 240, americium-241, strontium-90 into plants

    International Nuclear Information System (INIS)

    Popplewell, D.S.; Ham, G.J.; Johnson, T.E.

    1984-01-01

    This report describes the results of measurements on the uptake of plutonium, americium, strontium-90 and caesium-137 into peas, beet, oats, sweet corn, tomatoes and vegetable marrow grown in tubs containing radioactively-contaminated silts. The silts had been taken from an area of West Cumbria commonly referred to as the Ravenglass estuary. The experiments are categorised as being carried out under non-standard conditions because of the manner in which the radioactivity came to be incorporated into the growth medium. The growth medium was representative of conditions which could arise when the estuarine silt moves inland under the influence of wind and tide and mixes with the adjacent farm land. The silt had been contaminated by radioactive effluents from the nuclear fuels reprocessing plant at Sellafield and this contamination had been brought about by natural means. (Auth.)

  10. Inspection report of unauthorized possession and use of unsealed americium-241 and subsequent confiscation, J.C. Haynes Company, Newark, Ohio

    International Nuclear Information System (INIS)

    1985-11-01

    This US Nuclear Regulatory Commission report documents the circumstances surrounding the March 26, 1985, confiscation and subsequent decontamination activities related to the use of unauthorized quantities of americium-241 at the John C. Haynes Company (licensee) of Newark, Ohio. It focuses on the period from early February to July 26, 1985. The incident started when NRC Region III recieved information that John C. Haynes possessed unauthorized quantities of americium-241 and was conducting unauthorized activities (diamond irradiation). By July 26, 1985, the decontamination activities at the licensee's laboratory were concluded. The licensee's actions with diamond irradiation resulted in contamination in restricted and unrestricted areas of the facility. The confiscation and decontamination activities required the combined efforts of NRC, Federal Bureau of Investigation, US Department of Energy, Oak Ridge Associated Universities, the State of Ohio, and the US Environmental Protection Agency. The report describes the factual information and significant findings associated with the confiscation and decontamination activities

  11. Criteria Considered in Selecting Feed Items for Americium-241 Oxide Production Operations

    Energy Technology Data Exchange (ETDEWEB)

    Schulte, Louis D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-01-30

    The analysis in this document serves the purpose of defining a number of attributes in selection of feed items to be utilized in recovery/recycle of Pu and also production operations of 241AmO2 material intended to meet specification requirements. This document was written in response to a specific request on the part of the 2014 annual program review which took place over the dates of October 28-29, 2014. A number of feed attributes are noted including: (1) Non-interference with existing Pu recovery operations; (2) Content of sufficient 241Am to allow process efficiency in recovery operations; (3) Absence of indications that 243Am might be mixed in with the Pu/241Am material; (4) Absence of indications that Cm might be mixed in with the Pu/241Am material; (5) Absence of indications of other chemical elements that would present difficulty in chemical separation from 241Am; (6) Feed material not expected to present difficulty in dissolution; (7) Dose issues; (8) Process efficiency; (9) Size; (10) Hazard associated with items and package configuration in the vault; (11) Within existing NEPA documentation. The analysis in this document provides a baseline of attributes considered for feed materials, but does not presume to replace the need for technical expertise and judgment on the part of individuals responsible for selecting the material feed to be processed. This document is not comprehensive as regards all attributes that could prove to be important. The value of placing a formal QA hold point on accepting feed items versus more informal management of feed items is discussed in the summation of this analysis. The existing planned QA hold points on 241AmO2 products produced and packaged may be adequate as the entire project is based on QA of the product rather than QA of the process. The probability of introduction of items that would inherently cause the241

  12. Treatment of selected primary gynecologic and pelvic malignancies with 241Americium

    International Nuclear Information System (INIS)

    Chung, Joyce Y.; Peschel, Richard E.; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E.; Wilson, Lynn

    1995-01-01

    Purpose: To evaluate the efficacy of encapsulated 241 Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated 241 Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with 241 Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of 241 Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with 241 Am. Median surface dose of 241 Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S.E.=.14). Complications were

  13. Treatment of selected primary gynecologic and pelvic malignancies with {sup 241}Americium

    Energy Technology Data Exchange (ETDEWEB)

    Chung, Joyce Y; Peschel, Richard E; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E; Wilson, Lynn

    1995-07-01

    Purpose: To evaluate the efficacy of encapsulated {sup 241}Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated {sup 241}Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with {sup 241}Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of {sup 241}Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with {sup 241}Am. Median surface dose of {sup 241}Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S

  14. Experimental study of Americium-241 biokinetics in Homarus Gammarus lobster. Analysis of the accumulation and detoxication mechanisms at the sub-cellular level

    International Nuclear Information System (INIS)

    Paquet, F.

    1991-12-01

    The Americium 241 radioelement accumulation and elimination rate and mechanisms in the lobster organism have been experimentally studied; incorporation and detoxification capacities of each organ are evaluated. The existence of various biological compartments is shown; the major role of the digestive gland in accumulation of the radioelement, its distribution towards the various organs, and its resorption is comprehensively described, with an analysis at the subcellular and molecular levels. 401 p., 65 fig., 43 tab., 428 ref

  15. Standard test method for the radiochemical determination of americium-241 in soil by alpha spectrometry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2007-01-01

    1.1 This method covers the determination of americium–241 in soil by means of chemical separations and alpha spectrometry. It is designed to analyze up to ten grams of soil or other sample matrices that contain up to 30 mg of combined rare earths. This method allows the determination of americium–241 concentrations from ambient levels to applicable standards. The values stated in SI units are to be regarded as standard. 1.2 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use. For specific precaution statements, see Section 10.

  16. Survival of Acholeplasma laidlawii, strain S2 after irradiation with alpha particles of /sup 241/Americium

    Energy Technology Data Exchange (ETDEWEB)

    Liska, B.; Drasil, V.; Brza, I. (Ceskoslovenska Akademie Ved, Brno. Biofysikalni Ustav)

    1985-05-23

    A thin layer of dry Acholeplasma laidlawii, strain S2 cells was irradiated with /sup 241/Am alpha particles. D/sub 0/ was 2.54 x 10/sup 7/ - 2.63 x 10/sup 7/ alpha particles/mm/sup 2/ (48 - 50 minutes, 409 - 422 Gy). The extrapolation number was 1.05 - 3.1. The effective cross section at D/sub 0/ was 0.038 - 0.039 ..mu..m/sup 2//alpha particle. A method of preparing thin dry layers of Acholeplasma cells was developed.

  17. Post-Chernobyl contamination of Belarus biosphere with plutonium and americium-241 radionuclides

    International Nuclear Information System (INIS)

    Kudryashov, V.P.; Mironov, V.P.; Boulyga, S.F.; Lomonosova, E.M.; Kievets, M.K.; Yaroshevich, O.I.; Bazhanova, N.N.; Kanash, N.V.; Malenchenko, A.F.; Zhuk, I.V.

    2001-01-01

    The levels of Post-Chernobyl soil surface contamination in Belarus are presented, as well as the data on vertical migration of Pu and 241 Am in soils, on actinides concentrations in the near-ground air, sizes and the activity aerosol 'hot' particles, Pu content in organs and tissues in the inhabitants of Belarus. It is shown that hairs can be test-tissue for a lifetime assessment of the levels of Pu intake and content in the organism of a human being. (author)

  18. An experimental study of americium-241 biokinetics in the Lobster Homarus Gammarus. Analysis of the accumulation/storage and detoxification processes at the subcellular level

    International Nuclear Information System (INIS)

    Paquet, F.

    1993-01-01

    An experimental study of americium-241 kinetics has been conducted in the lobster Homarus gammmarus. The investigations were conducted at all the levels from the whole body to the subcellular and molecular levels. The animals were contaminated by a single or chronic ingestion of 241 Am labelled mussels. Assessments of accumulation, elimination and distribution of the radionuclide were established on organisms kept in the laboratory; they made it possible to demonstrate the importance of the digestive gland in the radionuclide transfer pathways. The preliminary results led to structural then ultrastructural investigations of the digestive gland in association with radioautographic studies and cellular extractions methods. Four cellular types were demonstrated, only two of them being implied in the radionuclide retention, the former being responsible for americium intake and the latter for its long-term retention. By means of biochemical techniques, subcellular accumulation was studied and the organelles implied in the nuclide retention were specified. Finally, a method of cellular nuclei dissociation was developed; it made it possible to analyse the molecular nature of americium ligands and to demonstrate the function of the protein nuclear matrix in the nuclide retention

  19. Theoretical and experimental study of the bio-geochemical behaviour of americium 241 in simplified rhizosphere conditions. Application to a calcareous agricultural soil

    International Nuclear Information System (INIS)

    Perrier, T.

    2004-06-01

    Americium 241, is one of the most radio-toxic contaminant produced during the nuclear fuel cycle. It can be found in all environmental compartments, in particular the soils. The main goals of this study are to identify, quantify and model the effect of the main factors controlling the mobility of 241 Am in the rhizosphere and the agricultural soils. The physico-chemical parameters of the soil and of the soil solution, the potential role of microorganisms on the sorption-desorption processes, and the speciation of americium in solution have been more particularly studied. 241 Am remobilization has been studied at the laboratory using leaching experiments performed in controlled conditions on reworked calcareous soils artificially contaminated with 241 Am. The soil samples have been washed out in different hydrodynamic conditions by solutions with various compositions. The eluted solution has been analyzed (pH, conductivity, ionic composition, Fe tot , organic acids, 241 Am) and its bacterial biomass content too. The overall results indicate that 241 Am remobilization is contrasted and strongly linked with the condition under study (pH, ionic strength, glucose and/or citrate concentration). Therefore, a solution in equilibrium with the soil or containing small exudate concentrations (10 -4 M) re-mobilizes only a very small part of the americium fixed on the solid phase. The desorption of 241 Am corresponds to a solid/liquid coefficient of partition (K d ) of about 10 5 L.kg -1 . A significant addition of glucose induces an important dissolution of soil carbonates by the indirect action of microorganisms, but does not significantly favor the 241 Am remobilization. On the other hand, the presence of strong citrate concentrations (≥ 10 -2 M) allows 300 to 10000 time greater re-mobilizations by the complexing of 241 Am released after the dissolution of the carrying phases. Finally, the colloidal transport of 241 Am has been systematically observed in a limited but

  20. Experimental study of Americium-241 biokinetics in Homarus Gammarus lobster. Analysis of the accumulation and detoxication mechanisms at the sub-cellular level; Etude experimentale des biocinetiques de l`americium-241 chez le homard homarus gammarus. Analyse des mecanismes d`accumulation et de detoxication au niveau subcellulaire

    Energy Technology Data Exchange (ETDEWEB)

    Paquet, F

    1991-12-01

    The Americium 241 radioelement accumulation and elimination rate and mechanisms in the lobster organism have been experimentally studied; incorporation and detoxification capacities of each organ are evaluated. The existence of various biological compartments is shown; the major role of the digestive gland in accumulation of the radioelement, its distribution towards the various organs, and its resorption is comprehensively described, with an analysis at the subcellular and molecular levels. 401 p., 65 fig., 43 tab., 428 ref.

  1. Americium-241 Decorporation Model

    Science.gov (United States)

    2014-10-01

    non- pyrogenic ampoules suitable for intravenous administration (FDA 2004, Hameln 2004). This is a standard formulation, which is a fixed parameter...4.4.6. Toxicity/Side Effects Treatment with DTPA can deplete endogenous metals, which is why the Zn salt is preferred for long-term treatment...However, other endogenous metals may be depleted if treatment spans several months. During prolonged treatments serum levels of essential metals should be

  2. An experimental study of americium-241 biokinetics in the Lobster Homarus Gammarus. Analysis of the accumulation/storage and detoxification processes at the subcellular level; Etude experimentale des biocinetiques de l`americium-241 chez le homard homarus gammarus. Analyse des mecanismes d`accumulation et de detoxication au niveau subcellulaire

    Energy Technology Data Exchange (ETDEWEB)

    Paquet, F

    1993-01-01

    An experimental study of americium-241 kinetics has been conducted in the lobster Homarus gammmarus. The investigations were conducted at all the levels from the whole body to the subcellular and molecular levels. The animals were contaminated by a single or chronic ingestion of {sup 241} Am labelled mussels. Assessments of accumulation, elimination and distribution of the radionuclide were established on organisms kept in the laboratory; they made it possible to demonstrate the importance of the digestive gland in the radionuclide transfer pathways. The preliminary results led to structural then ultrastructural investigations of the digestive gland in association with radioautographic studies and cellular extractions methods. Four cellular types were demonstrated, only two of them being implied in the radionuclide retention, the former being responsible for americium intake and the latter for its long-term retention. By means of biochemical techniques, subcellular accumulation was studied and the organelles implied in the nuclide retention were specified. Finally, a method of cellular nuclei dissociation was developed; it made it possible to analyse the molecular nature of americium ligands and to demonstrate the function of the protein nuclear matrix in the nuclide retention.

  3. Safe handling of kilogram amounts of fuel-grade plutonium and of gram amounts of plutonium-238, americium-241 and curium-244

    International Nuclear Information System (INIS)

    Louwrier, K.P.; Richter, K.

    1976-01-01

    During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239 Pu containing 8-12% 240 Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241 Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241 Am, 243 Am and 244 Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241 Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)

  4. The distribution of plutonium-239 and americium-241 in the Syrian hamster following its intravenous administration as citrate

    International Nuclear Information System (INIS)

    Rodwell, P.; Stather, J.W.

    1978-01-01

    Actinide distribution in various tissues and the skeleton of hamsters by liquid scintillation counting or isotope dilution. For plutonium 57% of activity was concentrated in the skeleton and more than 90% in the liver and skeleton after seven days. For americium the liver retained more than 50% of total activity and 25% was excreted in urine within seven days. (U.K.)

  5. Studies on the binding and transport processes of americium-241 hydroxide polymers in rat lung and bovine alveolar macrophages

    International Nuclear Information System (INIS)

    Taya, A.

    1986-03-01

    The binding of Am-241 hydroxide polymers to the cell components of rat lung was investigated using differential centrifugation, density gradient centrifugation with different media, gel chromatography, free flow electrophoresis and electron microscopic autoradiography with Pu-241. The bovine alveolar macrophage cultures were introduced as an in vitro test system for Am-241 uptake. Form the biochemical and electron microscopic studies it can be concluded that Am-241 is taken up by pulmonary macrophages, where its first storage site is probably the lysosome. Then the Am-241 seems to be solubilized in the lysosomes and to be bound to the cytosolic ferritin of macrophages. Am-241 might be released from the cells and crosses the alveolar membranes as bound to transferrin or as low molecular weight form. (orig.) [de

  6. Americium in the Finnish environment

    Energy Technology Data Exchange (ETDEWEB)

    Lehto, J. (Helsinki Univ., Lab. of Radiochemistry (Finland))

    2009-07-01

    This paper reviews studies on environmental americium,241 Am, in Finland. There are two sources of americium in the Finnish environment: fallouts from nuclear weapons tests in the 1950s and 1960s and from the Chernobyl accident in 1986, the former constituting around 98% of the total environmental load. The weapons test fallout was distributed more or less uniformly over Finland, while the Chernobyl fallout was deposited on a sector from southwestern coast to northeast. The total deposition of 241 Am in Finland is approximately 20 Bq m-2 and the amount is still somewhat increasing due to decay of 241 Pu. In this paper, the distribution and migration of americium in forest and aquatic environments is described. Americium concentrations in natural waters, sediments, soils, vegetation and fishes are given. In addition, the behaviour of americium in the food chain from lichen via reindeer into man is discussed. Radiation doses to humans due to the environmental americium in Finland are of no practical importance (orig.)

  7. Solubility of plutonium and americium-241 from rumen contents of cattle grazing on plutonium-contaminated desert vegetation in in vitro bovine gastrointestinal fluids - August 1975 to January 1977

    International Nuclear Information System (INIS)

    Barth, J.; Giles, K.R.; Brown, K.W.

    1985-01-01

    The alimentary solubility of plutonium and americium-241 ingested by cattle grazing at Area 13 of the Nevada Test Site and the Clean Slate II site on the Tonopah Test Range in Nevada was studied in a series of experiments. For each experiment, or trial, rumen contents collected from a fistulated steer or a normal animals at the time of sacrifice were incubated in simulated bovine gastrointestinal fluids, and the solubility of plutonium and americium was analyzed following the abomasal, duodenal, jejunal, and lower intestinal digestive states. For Area 13, the peak plutonium-238 solubilities ranged from 1.09 to 9.60 percent for animals grazing in the inner enclosure that surrounds ground zero (GZ); for animals grazing in the outer enclosure, the peaks ranged from 1.86 to 18.46%. The peak plutonium-239 solubilities ranged from 0.71 to 4.81% for animals from the inner enclosure and from 0.71 to 3.61% for animals from the outer enclosure. Plutonium-238 was generally more soluble than plutonium-239. Plutonium ingested by cattle grazing in the outer enclosure was usually more soluble than plutonium ingested by cattle grazing in the inner enclosure. The highest concentrations of plutonium in the rumen contents of cattle grazing in the inner enclosure were found in trials conducted during August and November 1975 and January 1976. These concentrations decreased during the February, May, and July 1976 trials. The decrease was followed by an increase in plutonium concentration during the November 1976 trial. The concentration of americium-241 followed the same trend. 13 references, 13 tables

  8. On the role of different biocomponents of bile and excretions in the elimination of plutonium and americium from the body

    International Nuclear Information System (INIS)

    Shvydko, N.S.

    1986-01-01

    A study was made of the role of biocomponents of bile, urine and feces in the elimination of plutonium and americium from the organism. Plutonium 239 and americium 241 were separated in bile due to higher tropism of plutonium to low molecular weight addends, and of americium, to a protein-containing fraction. The status of plutonium excreted in feces was the same as the physicochemical status of americium. Plutonium 239 and americium 241 eliminated in urine were in a completely ultrafiltered state

  9. Pattern of uptake of americium-241 by the rat skeleton and its subsequent redistribution and retention: implications for human dosimetry and toxicology.

    Science.gov (United States)

    Priest, N D; Howells, G; Green, D; Haines, J W

    1983-01-01

    The distribution and retention of intravenously injected 241Am in the skeleton of the female rat has been investigated using autoradiographic and radiochemical techniques. The studies were designed to assess the dosimetric and toxicologic implications of an 241Am intake by man. They showed that in the rat approximately one third of the intravenously injected 241Am was deposited in the skeleton where it appeared to be retained with a long biological half-time. The studies also showed: 1 241Am is initially deposited onto all types of bone surface including endosteal surfaces, periosteal surfaces and those of the vascular canals within cortical bone, but seems to be preferentially deposited onto those that are resorbing, 2 Bone accretion results in the burial of surface deposits of 241Am, 3 Bone resorption causes the removal of 241Am from surfaces, 4 Resorbed 241Am is retained by phagocytic cells (probably macrophages) in the bone marrow, 5 The transfer of 241Am from the phagocytic cells in the marrow to adjacent bone surfaces seems to occur, (local recycling). 6 The possibility that some of the 241Am removed from the bone surfaces enters the blood and is redeposited in bone, (systemic recycling) cannot be dismissed. These results show that 241Am deposition and redistribution in bone shares many characteristics with other 'bone surface-seeking radionuclides' typified by 239Pu. Consequently, it is suggested that a similar model to that used to calculate annual limits of intake for 239Pu in man would be suitable for the calculation of corresponding values for the 241Am isotopes.

  10. Production of americium isotopes in France

    International Nuclear Information System (INIS)

    Koehly, G.; Bourges, J.; Madic, C.; Nguyen, T.H.; Lecomte, M.

    1984-12-01

    The program of productions of americium 241 and 243 isotopes is based respectively on the retreatment of aged plutonium alloys or plutonium dioxide and on the treatment of plutonium targets irradiated either in CELESTIN reactors for Pu-Al alloys or OSIRIS reactor for plutonium 242 dioxide. All the operations, including americium final purifications, are carried out in hot cells equipped with remote manipulators. The chemical processes are based on the use of extraction chromatography with hydrophobic SiO 2 impregnated with extracting agents. Plutonium targets and aged plutonium alloys are dissolved in nitric acid using conventional techniques while plutonium dioxide dissolutions are performed routine at 300 grams scale with electrogenerated silver II in 4M HNO 3 at room temperature. The separation between plutonium and americium is performed by extraction of Pu(IV) either on TBP/SiO 2 or TOAHNO 3 /SiO 2 column. Americium recovery from waste streams rid of plutonium is realized by chromatographic extraction of Am(III) using mainly TBP and episodically DHDECMP as extractant. The final purification of both americium isotopes uses the selective extraction of Am(VI) on HDDiBMP/SiO 2 column at 60 grams scale. Using the overall process a total amount of 1000 grams of americium 241 and 100 grams of americium 243 has been produced nowadays and the AmO 2 final product indicates a purity better than 98.5%

  11. Preparation of americium source for smoke detector

    International Nuclear Information System (INIS)

    Ramaswami, A.; Singh, R.J.; Manohar, S.B.

    1994-01-01

    This report describes the method developed for the preparation of 241 Am source for smoke detector. Americium was electrodeposited from iso-propyl alcohol medium on silver backing. Thin layer of gold (few hundred micro gram thick) was plated on the americium source to make it safe for handling. The thickness of plated gold was such that the alpha radiations from the 241 Am source could escape out of the gold layer and cause ionisation in the surrounding air. The performance of the prepared sources were checked in a smoke detector and was found to be satisfactory and comparable to the imported sources. (author). 1 refs., 2 figs., 1 tab

  12. Studies of environmental radioactivity in Cumbria. Part 6. The chronology of discharges of caesium-137, plutonium and americium-241 from BNFL Sellafield, as recorded in lake sediments

    Energy Technology Data Exchange (ETDEWEB)

    Eakins, J D; Cambray, R S

    1985-04-01

    A study has been made of the radionuclide content of lake sediments from Cumbria in order to determine the history of discharges of /sup 137/Cs and actinides from the Sellafield works of British Nuclear Fuels plc (BNFL). Sediment cores have been taken from Ullswater and Grasmere, which are remote from Sellafield, in order to establish the behaviour of nuclear weapon fallout nuclides. Cores have also been taken from Barfield Tarn, which is 19 km SE of Sellafield but close to the sea, and from Ponsonby and Harnsey Moss Tarns, close to Sellafield. All sediments were analysed for /sup 137/Cs and sup(239+240)Pu. Additional measurements of /sup 238/Pu and /sup 241/Am were made on samples from the closer tarns. The sediment cores were dated by the /sup 210/Pb method and, where appropriate, by the /sup 137/Cs technique also. The amounts of /sup 137/Cs and sup(239+240)Pu in sediments from Barfield Tarn could be accounted for by fallout from nuclear weapons, although the levels of /sup 241/Am were marginally greater. However in Harnsey Moss Tarn the levels of actinides indicated that they were derived mainly from material originally discharged to sea from Sellafield. Sediment from Ponsonby Tarn contained material derived mainly from discharges to atmosphere.

  13. 1976 Hanford americium exposure incident: psychological aspects

    International Nuclear Information System (INIS)

    Brown, W.R.

    1982-01-01

    Accidents involving exposure to radiation or radioactive materials may involve an unusual degree of emotional trauma. Methods that may be employed in dealing with such trauma are discussed in relation to a specific accident in which a radiation worker was injured and seriously contaminated with americium-241

  14. Formation of americium and europium humate complexes

    International Nuclear Information System (INIS)

    Minai, Y.; Tominaga, T.; Meguro, Y.

    1991-01-01

    Binding constants of americium and europium with a humic acid were determined to study if complex formation of trivalent actinide-humates affects dissolved species of the actinides in hydrosphere. The purified humic acid was characterized by means of UV-vis, IR, and pH titration, indicating high carboxylate capacity and low aromaticity. Binding constants of americium and europium humates were determined at pH 4.6 and 6.0 by solvent extraction using 241 Am or 152 Eu as a tracer. The binding constants for americium-humate obtained preliminarily suggest that complexes with humic acid are not negligible in speciation of trivalent actinides in hydrosphere. The obtained binding constants were nearly identical with those determined previously by the same procedures, but with humic acids of different origin and compositions. (author)

  15. Biosorption of americium by alginate beads

    International Nuclear Information System (INIS)

    Borba, Tania Regina de; Marumo, Julio Takehiro; Goes, Marcos Maciel de; Ferreira, Rafael Vicente de Padua; Sakata, Solange Kazumi

    2009-01-01

    The use of biotechnology to remove heavy metals from wastes plays great potential in treatment of radioactive wastes and therefore the aim of this study was to evaluate the biosorption of americium by alginate beads. Biosorption has been defined as the property of certain biomolecules to bind and remove selected ions or other molecules from aqueous solutions. The calcium alginate beads as biosorbent were prepared and analyzed for americium uptaking. The experiments were performed in different solution activity concentrations, pH and exposure time. The results suggest that biosorption process is more efficient at pH 4 and for 75, 150, 300 Bq/mL and 120 minutes were necessary to remove almost 100% of the americium-241 from the solution. (author)

  16. 1976 Hanford americium-exposure incident: external decontamination procedures

    International Nuclear Information System (INIS)

    Jech, J.J.; Berry, J.R.; Breitenstein, B.D.

    1982-01-01

    An accident resulted in the deposition on an injured workman's skin surfaces, in acid-burned areas and in lacerations, of something in excess of 6 mCi americium-241. The external decontamination procedures used, the change in americium content of the skin during the course of treatment, and some of the unusual problems encountered from the extrusion of foreign material and flaking of skin and scar tissue are described

  17. Preparation of americium metal of high purity and determination of the heat of formation of the hydrated trivalent americium ion

    International Nuclear Information System (INIS)

    Spirlet, J.C.

    1975-10-01

    In order to redetermine some physical and chemical properties of americium metal, several grams of Am-241 have been prepared by two independent methods: lanthanum reduction of the oxide and thermal dissociation of the intermetallic compound Pt 5 Am. After its separation from excess lanthanum or alloy constituent by evaporation, americium metal was further purified by sublimation at 1100 deg C and 10 -6 Torr. Irrespective of the method of preparation, the americium samples displayed the same d.h.c.p. crystal structure. As determined by vacuum hot extraction, the oxygen, nitrogen and hydrogen contents are equal to or smaller than 250, 50 and 20 ppm, respectively. The heats of solution of americium metal (d.c.h.p. structure) in aqueous hydrochloric acid solutions have been measured at 298.15+-0.05K. The standard enthalpy of formation of Am 3+ (aq) is obtained as -616.7+-1.2 kJ mol -1 [fr

  18. Americium recovery from reduction residues

    Science.gov (United States)

    Conner, W.V.; Proctor, S.G.

    1973-12-25

    A process for separation and recovery of americium values from container or bomb'' reduction residues comprising dissolving the residues in a suitable acid, adjusting the hydrogen ion concentration to a desired level by adding a base, precipitating the americium as americium oxalate by adding oxalic acid, digesting the solution, separating the precipitate, and thereafter calcining the americium oxalate precipitate to form americium oxide. (Official Gazette)

  19. Accidental exposure to americium

    International Nuclear Information System (INIS)

    Heid, K.R.

    1985-04-01

    This report desribes an accident in which a 64-year old Hanford nuclear worker was exposed to high levels of americium while working in an americium recovery facility in 1976. As a result of the accident, he was heavily externally contaminated with americium, sustained with a substantial internal deposition of this isotope, and was burned with concentrated nitric acid and injured by flying debris about the face and neck. The immediate and longer-term treatment given the patient, including the decontamination efforts and clinical laboratory studies, are discussed. Special in-vivo equipment and techniques were used to measure the americium deposited in the patient. These and subsequent in-vivo measurements were used to estimate the dose rates and the accumulated doses to body organs. Urinary and fecal excreta were collected and analyzed for americium content. The interpretation of these data was complicated by the fact that the intake resulted both from inhalation and from solubilization of the americium embedded in facial tissues as a result of the accident. A total of 1100 μCi was excreted in urine and feces during the first 2 years following the accident. The long-term use of diethylenetriaminepentaacetic acid (DTPA), used principally as the zinc salt, is discussed including the method, route of administration, and effectiveness. To date, the patient has apparently experienced no complications attributable to this extensive course of therapy, even though he was given approximately 560 g of DTPA. 6 refs

  20. The ingestion of plutonium and americium by range cattle

    International Nuclear Information System (INIS)

    Blincoe, C.; Bohman, V.R.; Smith, D.D.

    1981-01-01

    The intake of plutonium and americium in the diet of cattle grazing on plutonium contaminated desert range was determined. Daily feed intake of the grazing animals was also determined so that the amount of nuclides ingested daily could be ascertained. Soil ingested by range cattle constituted the principal and possibly only source of ingested plutonium and americium and resulted in a daily intake of 3600-6600 pCi 238 Pu, 85,000-400,000 pCi 239 Pu, and 11,000-31,000 pCi 241 Am daily. Determining transuranic intake by direct measurement and from the composition and contamination of the diet gave identical results. (author)

  1. Alpha spectrum analysis of 241Am in the urine

    International Nuclear Information System (INIS)

    Qiu Yongmei; Yang Yong

    2006-10-01

    With 241 Am as indicator, americium in the urine was concentrated by the method of codeposition, then it was purified by the method of anion exchange, at last, the americium was electroplated. 241 Am in the urine was analysed by six channel low level alpha measuring instrument and Alpha Spectrometer. The results show that the recovering ratio is beyond 60% under the condition that the indicator added to the urine is at the level of mBq. So, 241 Am in the urine can be quantitatively analysed by this method, uncertainty of the result is under 40%, detection limit of the instrument is under 10 -4 Bq. (authors)

  2. Chemistry of americium

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.

    1976-01-01

    Essential features of the descriptive chemistry of americium are reviewed. Chapter titles are: discovery, atomic and nuclear properties, collateral reading, production and uses, chemistry in aqueous solution, metal, alloys, and compounds, and, recovery, separation, purification. Author and subject indexes are included. (JCB)

  3. 1976 Hanford americium accident

    International Nuclear Information System (INIS)

    Heid, K.R.; Breitenstein, B.D.; Palmer, H.E.; McMurray, B.J.; Wald, N.

    1979-01-01

    This report presents the 2.5-year medical course of a 64-year-old Hanford nuclear chemical operator who was involved in an accident in an americium recovery facility in August 1976. He was heavily externally contaminated with americium, sustained a substantial internal deposition of this isotope, and was burned with concentrated nitric acid and injured by flying debris about the face and neck. The medical care given the patient, including the decontamination efforts and clinical laboratory studies, are discussed. In-vivo measurements were used to estimate the dose rates and the accumulated doses to body organs. Urinary and fecal excreta were collected and analyzed for americium content. Interpretation of these data was complicated by the fact that the intake resulted both from inhalation and from solubilization of the americium embedded in facial tissues. A total of 1100 μCi was excreted in urine and feces during the first 2 years following the accident. The long-term use of diethylenetriaminepentate (DTPA), used principally as the zinc salt, is discussed including the method, route of administration, and effectiveness. To date, the patient has apparently experienced no complications attributable to this extensive course of therapy, even though he has been given approximately 560 grams of DTPA. 4 figures, 1 table

  4. 1976 Hanford americium-exposure incident: decontamination and treatment facility

    International Nuclear Information System (INIS)

    Berry, J.R.; McMurray, B.J.; Jech, J.J.; Breitenstein, B.D.; Quigley, E.J.

    1982-01-01

    An injured worker, contaminated with over 6 mCi of americium-241, required special treatment and housing for 4 months. This paper is a description of the design and management of the facility in which most of the treatment and housing occurred. The problems associated with contamination control, waste handling, supplies, and radiological concerns during the two-stage transfer of the patient from a controlled situation to his normal living environment are discussed in detail

  5. Inhaled americium dioxide

    International Nuclear Information System (INIS)

    Park, J.F.

    1982-01-01

    This project includes experiments to determine the effects of Zn-DTPA therapy on the retention, translocation and biological effects of inhaled 241 AmO 2 . Beagle dogs that received inhalation exposure to 241 AmO 2 developed leukopenia, clincial chemistry changes associated with hepatocellular damage, and were euthanized due to respiratory insufficiency caused by radiation pneumonitis 120 to 131 days after pulmonary deposition of 22 to 65 μCi 241 Am. Another group of dogs that received inhalation exposure to 241 AmO 2 and were treated daily with Zn-DTPA had initial pulmonary deposition of 19 to 26 μCi 241 Am. These dogs did not develop respiratory insufficiency, and hematologic and clinical chemistry changes were less severe than in the non-DTPA-treated dogs

  6. Biochemical fractionation and cellular distribution of americium and plutonium in the biomass of freshwater macrophytes

    International Nuclear Information System (INIS)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.Ya.

    2011-01-01

    Accumulation of americium ( 241 Am) and plutonium ( 238,242 Pu) and their distribution in cell compartments and biochemical components of the biomass of freshwater aquatic plants Elodea canadensis, Ceratophyllum demersum and Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory experiments. Americium and plutonium taken up from water by Elodea canadensis apical shoots were mainly absorbed by structural components of plant cells (90% for 241 Am; 89% for 238 Pu and 82-87% for 242 Pu). About 10-18% of isotope activity was recorded in the cytosol fraction. The major concentration (76-92%) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-24% of americium activity was registered in the fraction of proteins and carbohydrates, and just a minor concentration (<1%) in the lipid fraction. The distribution of plutonium in the biomass fractions of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides of cell walls of freshwater submerged macrophytes. (author)

  7. Determination of 241Am in reindeer bone

    International Nuclear Information System (INIS)

    Tahtinen, P.; Hakanen, M.; Jaakkola, T.; Nikula, A.

    1978-01-01

    The purpose of this work was to develop a procedure to separate americium from other alpha active nuclides present in reindeer bone samples, especially 228 Th and its daughter nuclides. The 241 Am-spectrum of a reindeer bone sample analyzed using the proposed method is given. The α-spectrum was measured one week after electrodeposition. The absence of the alpha peak of 224 Ra, the daughter nuclide of 228 Th, indicates that no 228 Th was electrodeposited onto the platinum disc. Four reindeer bone samples were analyzed for 241 Am using the method developed. The 241 Am/ 239 240 Pu activity ratio in reindeer bone was 0.9 :- 0.4. These results indicate that compared to plutonium, americium is accumulated in reindeer bone more heavily than in liver. All 241 Am values presented are concentrations at the time of radioassay, and no correction has been made for the ingrowth of 241 Am formed by the decay of 241 Pu during stockpilling. However, all 241 Am determinations were made 1 to 3 yrs after sample collection, and thus the corrections due to the ingrowth can be considered slight. About 60% of plutonium body burden is located in liver and 20% in skeleton. The activity ratio 241 Am/ 239 240 Pu in these animals was about 0.2 and 1.0 in liver and skeleton, respectively. This indicates that about 60% of the 241 Am body burden is located in skeleton and about 30% in liver. It can be roughly estimated that the whole-body activity of 241 Am is thus about 40% of the 239 240 Pu body burden

  8. On the americium oxalate solubility

    International Nuclear Information System (INIS)

    Zakolupin, S.A.; Korablin, Eh.V.

    1977-01-01

    The americium oxalate solubility at different nitric (0.0-1 M) and oxalic (0.0-0.4 M) acid concentrations was investigated in the temperature range from 14 to 60 deg C. The dependence of americium oxalate solubility on the oxalic acid concentration was determined. Increasing oxalic acid concentration was found to reduce the americium oxalate solubility. The dependence of americium oxalate solubility on the oxalic acid concentration was noted to be a minimum at low acidity (0.1-0.3 M nitric acid). This is most likely due to Am(C 2 O 4 ) + , Am(C 2 O 4 ) 2 - and Am(C 2 O 4 ) 3 3- complex ion formation which have different unstability constants. On the basis of the data obtained, a preliminary estimate was carried out for the product of americium oxalate solubility in nitric acid medium (10 -29 -10 -31 ) and of the one in water (6.4x10 -20 )

  9. Recycling of americium

    International Nuclear Information System (INIS)

    Hagstroem, Ingela

    1999-12-01

    Separation of actinides from spent nuclear fuel is a part of the process of recycling fissile material. Extracting agents for partitioning the high level liquid waste (HLLW) from conventional PUREX reprocessing is studied. The CTH-process is based on three consecutive extraction cycles. In the first cycle protactinium, uranium, neptunium and plutonium are removed by extraction with di-2-ethylhexyl-phosphoric acid (HDEHP) from a 6 M nitric acid HLLW solution. Distribution ratios for actinides, fission products and corrosion products between HLLW and 1 M HDEHP in an aliphatic diluent have been investigated. To avoid addition of chemicals the acidity is reduced by a tributylphosphate (TBP) extraction cycle. The distribution ratios of elements present in HLLW have been measured between 50 % TBP in an aliphatic diluent and synthetic HLLW in range 0.1-6 M nitric acid. In the third extraction cycle americium and curium are extracted. To separate trivalent actinides from lanthanides a method based on selective stripping of the actinides from 1 M HDEHP is proposed. The aqueous phase containing ammonia, diethylenetriaminepentaacetic acid (DTPA) and lactic acid is recycled in a closed loop after reextraction of the actinides into a second organic phase also containing 1 M HDEHP. Distribution ratios for americium and neodymium have been measured at varying DTPA and lactic acid concentrations and at varying pH. Nitrogen-donor reagents have been shown to have a potential to separate trivalent actinides from lanthanides. 2,2':6,2''-terpyridine as extractant follows the CHON-principle and can in synergy with 2-bromodecanoic acid separate americium from europium. Distribution ratios for americium and europium, in the range of 0.02-0.12 M nitric acid, between nitric acid and 0.02 M terpyridine with 1 M 2-bromodecanoic acid in tert-butylbenzene (TBB) was investigated. Comparison with other nitrogen-donor reagents show that increasing lipophilicity of the molecule, by substitution of

  10. Rare earth elements during diagenesis of abyssal sediments: analogies with a transuranic element americium

    International Nuclear Information System (INIS)

    Boust, D.

    1987-03-01

    One of the possibilities for the storage of high-level radioactive wastes consists in burying them into abyssal sediments, the sediments being supposed to barrier out radionuclides migration. The objective of the work was to estimate the efficiency of sediment barrier with respect to americium. As there is no americium in abyssal sediments, an indirect approach was used: the behaviour of the rare earth elements, the best natural analogs of americium. They were analysed in a 15 m long core, from the Cap Verde abyssal plateau. The terrigenous phase derived from the African continent was modified by short-term processes (1-1000 years); the intermediate rare earth elements were dissolved. Mineral coatings, enriched in rare earth appeared. After burial, the evolution continued at a much slower rate (10 5 - 10 6 years). The rare elements of the mineral coatings derived from the dissolution of the terrigenous phase and from an additional source, deeper in the sediment column. The fluxes of rare earth elements from sediment to water column were estimated. In suboxic sediments, the dissolved particulate equilibrium was related to redox conditions. The short-term reactivity of americium was studied in laboratory experiments. Simple americium migration models showed that the sediments barrier was totally efficient with respect to americium. In the conditions, neptunium 237 a daughter product of americium 241 could induce fluxes of 10 16 atoms per year per ton of stored waste (10 -8 Ci y-1), during millions years, towards the water column [fr

  11. Americium Separations from High-Salt Solutions Using Anion Exchange

    International Nuclear Information System (INIS)

    Barr, Mary E.; Jarvinen, Gordon D.; Stark, Peter C.; Chamberlin, Rebecca M.; Bartsch, Richard A.; Zhang, Z.Y.; Zhao, W.

    2001-01-01

    The aging of the US nuclear stockpile presents a number of challenges, including the increasing radioactivity of plutonium residues due to the ingrowth of 241 Am from the β-decay of 241 Pu. We investigated parameters that affect the sorption of Am onto anion-exchange resins from concentrated effluents derived from nitric acid processing of plutonium residues. These postevaporator wastes are nearly saturated solutions of acidic nitrate salts, and americium removal is complicated by physical factors, such as solution viscosity and particulates, as well as by the presence of large quantities of competing metals and acid. Single- and double-contact batch distribution coefficients for americium and neodymium from simple and complex surrogate solutions are presented. Varied parameters include the nitrate salt concentration and composition and the nitric acid concentration. We find that under these extremely concentrated conditions, Am(III) removal efficiencies can surpass 50% per contact. Distribution coefficients for both neodymium and americium are insensitive to solution acidity and appear to be driven primarily by low water activities of the solutions

  12. Possibility of obtaining enriched americium-242g by the elution of recoil atoms from zeolite

    Energy Technology Data Exchange (ETDEWEB)

    Shafiev, A I; Vityutnev, V M; Ivanov, V M; Yakovlev, G N

    1974-12-31

    On the example of production the possibility of obtaining enriched actinide isotopes by the elution of recotl atoms with the use of a zeolite- americium-241 target was shown. The enrichment factor and the recoil atoms of / sup 242g/Am yield depend on preliminary target treatment and solution composition used for elution. (auth)

  13. Radiochemical separation and alpha-spectrometric determination of Americium in different matrixes

    International Nuclear Information System (INIS)

    Radenkovic, M.; Joksic, J.; Paligoric, D.

    2009-01-01

    A method of separation and alpha-spectrometric determination of americium, developed in VINCA Institute of Nuclear Sciences is described in the paper. The procedure is convenient to be used for 241 Am determination in environmental matrixes as well as samples of human origin if a very small concentrations are expected, using 243 Am as a tracer for radiochemical yield recovery. (author) [sr

  14. Americium product solidification and disposal

    International Nuclear Information System (INIS)

    Mailen, J.C.; Campbell, D.O.; Bell, J.T.; Collins, E.D.

    1987-01-01

    The americium product from the TRUEX processing plant needs to be converted into a form suitable for ultimate disposal. An evaluation of the disposal based on safety, number of process steps, demonstrated operability of the processes, production of low-level alpha waste streams, and simplicity of maintenance with low radiation exposures to personnel during maintenance, has been made. The best process is to load the americium on a cation exchange resin followed by calcination or oxidation of the resin after loading

  15. Study of the properties of the Am-O system in view of the transmutation of Am 241 in fast reactors; Etude des proprietes du systeme Am-O en vue de la transmutation de l`americium 241 en reacteur a neutrons rapides

    Energy Technology Data Exchange (ETDEWEB)

    Casalta, S

    1996-04-01

    To reduce the long term toxicity of Am 241 it was considered to transmute this isotope in fast reactor. The first part of this thesis is an introduction at this problem. In the second part we give the experimental techniques used for the realisation of an AmO{sub 2}-MgO target (powder metallurgy under inert, oxidizing or reducing atmosphere). The properties of the Am-O system has been analyzed by X diffraction, thermodynamic and ceramography, in the Am{sub 2}O{sub 3}-AmO{sub 2} field. In the third part we study the external exposure risk created by the manufacturing of this target and in the last part the behavior of this target in a fast reactor. 66 refs., 28 figs., 25 tabs., 1 append.

  16. Lifetime followup of the 1976 americium accident victim: [Final report

    International Nuclear Information System (INIS)

    Breitenstein, B.D. Jr.; Palmer, H.E.

    1988-05-01

    This report describes the 11 year medical course of Harold R. McCluskey, a Hanford nuclear chemical operator, who, at age 64, was involved in an accident in an americium recovery facility in August 1976. As a result of the accident, he was heavily contaminated with americium (Am-241), sustained a substantial internal deposition of this isotope, and was burned with concentrated nitric acid and injured by flying debris about the face and neck. The immediate and long-term medical care is summarized, including decontamination procedures, chelation therapy, and routine and special clinical laboratories studies. The estimates of the operator's Am-241 deposition, post accident and during the remainder of his life and the special techniques and equipment used to make the estimates, are reported. Post-accident, the total amount of Am-241 excreted in his urine and feces was 41 MBq (1.1 mCi). He died of complications of chronic coronary artery disease on August 17, 1987. 20 refs., 2 figs

  17. The availability of plutonium and americium in Irish Sea sediments for re-dissolution

    International Nuclear Information System (INIS)

    McDonald, P.; Vives i Batlle, J.; Bousher, A.; Whittall, A.; Chambers, N.

    2001-01-01

    The availability of plutonium and americium, for re-dissolution from offshore sediments into Irish Sea water, has been examined. Sediments collected from the mud-patch near the Cumbrian coast were characterized in terms of spatial location, particle size, partitioning of radionuclides with respect to physico-chemical bonds and availability of actinides for release into seawater. Sequential extraction investigations revealed that plutonium was predominantly associated with strongly bound sesquioxide and organic complex fractions. Americium was associated mainly with the organic complex fraction, but a significant fraction was in carbonate form. Sediment/water re-dissolution experiments with and without stirring were compared to simulate the effect of disturbing bed sediment. After 1 week, neither set of re-dissolution data provided significant trends between dissolved activity and time. Stirred systems appeared to release 2.5 times more plutonium and americium into seawater than unstirred systems. Measured 239,240Pu and 241Am distribution coefficients (K d values) were both typically approximately 10 5 l kg -1 . 241Am K d values are an order of magnitude lower than previously reported for the north-eastern Irish Sea, but similar to western Irish Sea values. Overall, the fractions of plutonium and americium available for re-dissolution from bed sediment are very low at <0.1%, with proportionally more plutonium being released than americium. These findings lend further support for the extrapolation of laboratory-derived information to environmental conditions

  18. Distribution of uranium, americium and plutonium in the biomass of freshwater macrophytes

    International Nuclear Information System (INIS)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.YA.

    2010-01-01

    Accumulation of uranium ( 238 U), americium ( 241 Am) and plutonium ( 242 Pu) and their distribution in cell compartments and biochemical components of the biomass of aquatic plants Elodea canadensis, Ceratophyllum demersum, Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory batch experiments. Isotopes of uranium, americium and plutonium taken up from the water by Elodea canadensis apical shoots were mainly absorbed by cell walls, plasmalemma and organelles. A small portion of isotopes (about 6-13 %) could be dissolved in cytoplasm. The major portion (76-92 %) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-23 % of americium activity was registered in the fraction of proteins and carbohydrates, and just a small portion (< 1%) in lipid fraction. The distribution of plutonium in the biomass fraction of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides in Elodea biomass. Distribution of uranium in the biomass of Elodea differed essentially from that of transuranium elements: a considerable portion of uranium was recorded in the fraction of protein and carbohydrates (51 %). From our data we can assume that uranium has higher affinity to carbohydrates than proteins. (authors)

  19. Distribution of uranium, americium and plutonium in the biomass of freshwater macrophytes

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.YA. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)

    2010-07-01

    Accumulation of uranium ({sup 238}U), americium ({sup 241}Am) and plutonium ({sup 242}Pu) and their distribution in cell compartments and biochemical components of the biomass of aquatic plants Elodea canadensis, Ceratophyllum demersum, Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory batch experiments. Isotopes of uranium, americium and plutonium taken up from the water by Elodea canadensis apical shoots were mainly absorbed by cell walls, plasmalemma and organelles. A small portion of isotopes (about 6-13 %) could be dissolved in cytoplasm. The major portion (76-92 %) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-23 % of americium activity was registered in the fraction of proteins and carbohydrates, and just a small portion (< 1%) in lipid fraction. The distribution of plutonium in the biomass fraction of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides in Elodea biomass. Distribution of uranium in the biomass of Elodea differed essentially from that of transuranium elements: a considerable portion of uranium was recorded in the fraction of protein and carbohydrates (51 %). From our data we can assume that uranium has higher affinity to carbohydrates than proteins. (authors)

  20. Plutonium and americium separation from salts

    International Nuclear Information System (INIS)

    Hagan, P.G.; Miner, F.J.

    1976-01-01

    Salts or materials containing plutonium and americium are dissolved in hydrochloric acid, heated, and contacted with an alkali metal carbonate solution to precipitate plutonium and americium carbonates which are thereafter readily separable from the solution

  1. Airborne plutonium and americium concentrations measured from the top of Rattlesnake Mountain

    International Nuclear Information System (INIS)

    Sehmel, G.A.

    1979-01-01

    Airborne plutonium-239+240 and americium-241 blowing from offsite was measured in an initial experiment at the top of Rattlesnake Mountain. Average airborne concentration measured was similar to fallout concentrations. Airborne plutonium concentrations were independent of wind speed for seven wind speed increments between 0.5 and 31 m/sec. In contrast the airborne americium concentration was a minimum at a wind speed of approximately 7 m/sec. Similarly, the airborne solids concentration in μg/m 3 was a minimum at an intermediate wind speed increment of 7 to 11 m/sec

  2. The biokinetics and radiotoxicology of curium: A comparison with americium

    Energy Technology Data Exchange (ETDEWEB)

    Menetrier, F. [CEA, Fontenay-aux-Roses (France); Taylor, D.M. [School of Chemistry, Cardiff University, Cardiff CF10 3AT (United Kingdom)], E-mail: davtay@btinternet.com; Comte, A. [CEA, Fontenay-aux-Roses (France)

    2008-05-15

    The human and animal data on the biokinetics of {sup 242}Cm and {sup 244}Cm are reviewed and shown to be very similar to those for {sup 241}Am. Liver and skeleton are the main organs of deposition and the retention of curium in the skeleton is very prolonged in all the species examined. Retention of both curium and americium in the liver appears to be species-dependent, being relatively rapidly removed from the liver of rats, and probably humans, but being tenaciously retained in dogs and some other species. The radiotoxicity of curium is also reviewed and it is shown that, as with {sup 241}Am, lung and bone tumour induction are the major hazards from inhaled and systemically deposited {sup 244}Cm. The use of chelating agents for the treatment of accidental contamination of the human body with {sup 242,244}Cm is also discussed.

  3. Organic components and plutonium and americium state in soils and soil solutions

    International Nuclear Information System (INIS)

    Sokolik, G.A.; Ovsyannikova, S.V.; Kimlenko, I.M.

    2002-01-01

    The fraction composition of humus substances of different type soils and soil solutions have been studied. A distribution of Pu 239, 240 and Am 241 between humus substances fractions of different dispersity and mobility in soil-vegetation cover has been established. It was shown that humus of organic soils fixes plutonium and americium in soil medium in greater extent than humus of mineral soils. That leads to lower migration ability of radionuclides in organic soils. The lower ability of americium to form difficultly soluble organic and organic-mineral complexes and predomination of its anion complexes in soil solutions may be a reason of higher mobility and biological availability of americium in comparison to plutonium during soil-plant transfer (authors)

  4. Isolation of high purity americium metal via distillation

    Science.gov (United States)

    Squires, Leah N.; King, James A.; Fielding, Randall S.; Lessing, Paul

    2018-03-01

    Pure americium metal is a crucial component for the fabrication of transmutation fuels. Unfortunately, americium in pure metal form is not available; however, a number of mixed metals and mixed oxides that include americium are available. In this manuscript a method is described to obtain high purity americium metal from a mixture of americium and neptunium metals with lead impurity via distillation.

  5. Determination of specific activity of americium and plutonium in selected environmental samples

    International Nuclear Information System (INIS)

    Trebunova, T.

    1999-01-01

    The aim of this work was development of method for determination of americium and plutonium in environmental samples. Developed method was evaluated on soil samples and after they was applied on selected samples of fishes (smoked mackerel, herring and fillet from Alaska hake). The method for separation of americium is based on liquid separation with Aliquate-336, precipitation with oxalic acid and using of chromatographic material TRU-Spec TM .The intervals of radiochemical yields were from 13.0% to 80.9% for plutonium-236 and from 10.5% to 100% for americium-241. Determined specific activities of plutonium-239,240 were from (2.3 ± 1.4) mBq/kg to (82 ± 29) mBq/kg, the specific activities of plutonium-238 were from (14.2 ± 3.7) mBq/kg to (708 ± 86) mBq/kg. The specific activities of americium-241 were from (1.4 ± 0.9) mBq/kg to (3360 ± 210) mBq/kg. The fishes from Baltic Sea as well as from North Sea show highest specific activities then fresh-water fishes from Slovakia. Therefore the monitoring of alpha radionuclides in foods imported from territories with nuclear testing is recommended

  6. Distribution and Excretion of Am-241 in Rats

    International Nuclear Information System (INIS)

    Alatas, Z; Nurhayati, S; Rahardjo, T

    1996-01-01

    Determination of the activity content of Am-241 administered oral y in several organs and tissues of white rats including the excretion had been carried out. The observation of Am-241 activity was carried out through surgery and for the excretion of the radionuclide by collecting urine and faces. The surgeries were conducted on the 0 (6 hours), 1, 2, 3, 4, 5, 15 and 30th day post administration of 2.965 kBq Am-241, whereas the urine and faces collections were done every other day for 30 days using metabolism cage. The result indicated that the distribution of Am-241 which found in all tested organs/tissues with various fraction is considered as the initial distribution of Am-241 in rats. The content of americium in gastrointestinal tract and lung is relatively high within the first week post contamination. And, americium activities in other organs/tissues are various with time. The excretion of Am-241 is higher via feces than that of urin, i.e up to 20% in 30 days

  7. Transmutation of Americium in Fast Neutron Facilities

    OpenAIRE

    Zhang, Youpeng

    2011-01-01

    In this thesis, the feasibility to use a medium sized sodium cooled fast reactor fully loaded with MOX fuel for efficient transmutation of americium is investigated by simulating the safety performance of a BN600-type fast reactor loaded with different fractions of americium in the fuel, using the safety parameters obtained with the SERPENT Monte Carlo code. The focus is on americium mainly due to its long-term contribution to the radiotoxicity of spent nuclear fuel and its deterioration on c...

  8. Analysis of Americium in Transplutonium Process Solutions

    International Nuclear Information System (INIS)

    Ferguson, R.B.

    2001-01-01

    One of the more difficult analyses in the transplutonium field is the determination of americium at trace levels in a complex matrix such as a process dissolver solution. Because of these conditions a highly selective separation must precede the measurement of americium. The separation technique should be mechanically simple to permit remote operation with master-slave manipulators. For subsequent americium measurement by the mass spectroscopic isotopic-dilution technique, plutonium and curium interferences must also have been removed

  9. Experimental studies on the biokinetics of plutonium and americium in the cephalopod Octopus vulgaris

    International Nuclear Information System (INIS)

    Guary, J.C.; Fowler, S.W.

    1982-01-01

    Radiotracer experiments using the photon-emitters 237 Pu and 241 Am were performed to examine uptake, tissue distribution and retention of plutonium and americium in the cephalopod Octopus vulgaris Cuvier. A 2 wk exposure in contaminated sea water resulted in twice as much 237 Pu being taken up by whole octopus as 241 Am. Immediately following uptake approximately 41% and 73% of the 237 Pu and 241 Am respectively were located in the branchial hearts. Depuration rates for both radionuclides were identical; approximately 46% of both radionuclides initially incorporated were associated with a long-lived compartment which turned over very slowly (Tbsub(1/2) = 1.5 yr). Longer exposures to 241 Am resulted in an increase in the size of the slowly exchanging 241 Am pool in the octopus. After 2 mo depuration, the majority of the residual activity of both radionuclides was in the branchial hearts. On average 33% of the 241 Am ingested with food was assimilated into tissues, primarily the hepatopancreas. Different whole-body 241 Am excretion rates were observed at different times following assimilation and were related to transfer processes taking place within internal tissues, most notably between hepatopancreas and the branchial hearts. Relationships between circulatory and excretory functions of these 2 organs are discussed and a physiological mechanism is proposed to explain the observed patterns of 241 Am excretion in O. vulgaris. (orig.)

  10. Experimental studies on the biokinetics of plutonium and americium in the cephalopod Octopus vulgaris

    Energy Technology Data Exchange (ETDEWEB)

    Guary, J.C.; Fowler, S.W.

    1982-03-05

    Radiotracer experiments using the photon-emitters /sup 237/Pu and /sup 241/Am were performed to examine uptake, tissue distribution and retention of plutonium and americium in the cephalopod Octopus vulgaris Cuvier. A 2 wk exposure in contaminated sea water resulted in twice as much /sup 237/Pu being taken up by whole octopus as /sup 241/Am. Immediately following uptake approximately 41% and 73% of the /sup 237/Pu and /sup 241/Am respectively were located in the branchial hearts. Depuration rates for both radionuclides were identical; approximately 46% of both radionuclides initially incorporated were associated with a long-lived compartment which turned over very slowly (Tbsub(1/2) = 1.5 yr). Longer exposures to /sup 241/Am resulted in an increase in the size of the slowly exchanging /sup 241/Am pool in the octopus. After 2 mo depuration, the majority of the residual activity of both radionuclides was in the branchial hearts. On average 33% of the /sup 241/Am ingested with food was assimilated into tissues, primarily the hepatopancreas. Different whole-body /sup 241/Am excretion rates were observed at different times following assimilation and were related to transfer processes taking place within internal tissues, most notably between hepatopancreas and the branchial hearts. Relationships between circulatory and excretory functions of these 2 organs are discussed and a physiological mechanism is proposed to explain the observed patterns of /sup 241/Am excretion in O. vulgaris.

  11. Americium behaviour in plastic vessels

    International Nuclear Information System (INIS)

    Legarda, F.; Herranz, M.; Idoeta, R.; Abelairas, A.

    2010-01-01

    The adsorption of 241 Am dissolved in water in different plastic storage vessels was determined. Three different plastics were investigated with natural and distilled waters and the retention of 241 Am by these plastics was studied. The same was done by varying vessel agitation time, vessel agitation speed, surface/volume ratio of water in the vessels and water pH. Adsorptions were measured to be between 0% and 70%. The adsorption of 241 Am is minimized with no water agitation, with PET or PVC plastics, and by water acidification.

  12. Americium behaviour in plastic vessels

    Energy Technology Data Exchange (ETDEWEB)

    Legarda, F.; Herranz, M. [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain); Idoeta, R., E-mail: raquel.idoeta@ehu.e [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain); Abelairas, A. [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain)

    2010-07-15

    The adsorption of {sup 241}Am dissolved in water in different plastic storage vessels was determined. Three different plastics were investigated with natural and distilled waters and the retention of {sup 241}Am by these plastics was studied. The same was done by varying vessel agitation time, vessel agitation speed, surface/volume ratio of water in the vessels and water pH. Adsorptions were measured to be between 0% and 70%. The adsorption of {sup 241}Am is minimized with no water agitation, with PET or PVC plastics, and by water acidification.

  13. Americium behaviour in plastic vessels.

    Science.gov (United States)

    Legarda, F; Herranz, M; Idoeta, R; Abelairas, A

    2010-01-01

    The adsorption of (241)Am dissolved in water in different plastic storage vessels was determined. Three different plastics were investigated with natural and distilled waters and the retention of (241)Am by these plastics was studied. The same was done by varying vessel agitation time, vessel agitation speed, surface/volume ratio of water in the vessels and water pH. Adsorptions were measured to be between 0% and 70%. The adsorption of (241)Am is minimized with no water agitation, with PET or PVC plastics, and by water acidification. Copyright 2009 Elsevier Ltd. All rights reserved.

  14. Transportability Class of Americium in K Basin Sludge under Ambient and Hydrothermal Processing Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Delegard, Calvin H.; Schmitt, Bruce E.; Schmidt, Andrew J.

    2006-08-01

    This report establishes the technical bases for using a ''slow uptake'' instead of a ''moderate uptake'' transportability class for americium-241 (241Am) for the K Basin Sludge Treatment Project (STP) dose consequence analysis. Slow uptake classes are used for most uranium and plutonium oxides. A moderate uptake class has been used in prior STP analyses for 241Am based on the properties of separated 241Am and its associated oxide. However, when 241Am exists as an ingrown progeny (and as a small mass fraction) within plutonium mixtures, it is appropriate to assign transportability factors of the predominant plutonium mixtures (typically slow) to the Am241. It is argued that the transportability factor for 241Am in sludge likewise should be slow because it exists as a small mass fraction as the ingrown progeny within the uranium oxide in sludge. In this report, the transportability class assignment for 241Am is underpinned with radiochemical characterization data on K Basin sludge and with studies conducted with other irradiated fuel exposed to elevated temperatures and conditions similar to the STP. Key findings and conclusions from evaluation of the characterization data and published literature are summarized here. Plutonium and 241Am make up very small fractions of the uranium within the K Basin sludge matrix. Plutonium is present at about 1 atom per 500 atoms of uranium and 241Am at about 1 atom per 19000 of uranium. Plutonium and americium are found to remain with uranium in the solid phase in all of the {approx}60 samples taken and analyzed from various sources of K Basin sludge. The uranium-specific concentrations of plutonium and americium also remain approximately constant over a uranium concentration range (in the dry sludge solids) from 0.2 to 94 wt%, a factor of {approx}460. This invariability demonstrates that 241Am does not partition from the uranium or plutonium fraction for any characterized sludge matrix. Most

  15. Estimates of dose to systematic organs and GI tract based on data from miniature swine orally intubated with a single dose of Am-241 citrate

    International Nuclear Information System (INIS)

    Bernard, S.R.; Nestor, C.W. Jr.; Eisele, G.R.; Eckerman, K.F.

    1982-01-01

    A model is presented for the internal radiation dose to the small intestine wall of miniature swine given Americium 241 citrate by oral intubation. The model incorporates the uptake of the Am-241 by the intestinal wall. About equal contributions of dose to the small intestine were observed from the intestinal contents and the wall itself

  16. Determination of Am-241 in lung and bone by gamma spectrometry with semiconductor detectors LEGe

    International Nuclear Information System (INIS)

    Perez Lopez, B.

    2014-01-01

    Americium is produced from neutron absorption plutonium atoms within nuclear reactors. The work of dismantling and decontamination of the installations and radioactive waste management makes workers exposed acquire risk of internal exposure and therefore can incorporate Am-241 in his body. (Author)

  17. Solubility of Plutonium (IV) Oxalate During Americium/Curium Pretreatment

    International Nuclear Information System (INIS)

    Rudisill, T.S.

    1999-01-01

    Approximately 15,000 L of solution containing isotopes of americium and curium (Am/Cm) will undergo stabilization by vitrification at the Savannah River Site (SRS). Prior to vitrification, an in-tank pretreatment will be used to remove metal impurities from the solution using an oxalate precipitation process. Material balance calculations for this process, based on solubility data in pure nitric acid, predict approximately 80 percent of the plutonium in the solution will be lost to waste. Due to the uncertainty associated with the plutonium losses during processing, solubility experiments were performed to measure the recovery of plutonium during pretreatment and a subsequent precipitation process to prepare a slurry feed for a batch melter. A good estimate of the plutonium content of the glass is required for planning the shipment of the vitrified Am/Cm product to Oak Ridge National Laboratory (ORNL).The plutonium solubility in the oxalate precipitation supernate during pretreatment was 10 mg/mL at 35 degrees C. In two subsequent washes with a 0.25M oxalic acid/0.5M nitric acid solution, the solubility dropped to less than 5 mg/mL. During the precipitation and washing steps, lanthanide fission products in the solution were mostly insoluble. Uranium, and alkali, alkaline earth, and transition metal impurities were soluble as expected. An elemental material balance for plutonium showed that greater than 94 percent of the plutonium was recovered in the dissolved precipitate. The recovery of the lanthanide elements was generally 94 percent or higher except for the more soluble lanthanum. The recovery of soluble metal impurities from the precipitate slurry ranged from 15 to 22 percent. Theoretically, 16 percent of the soluble oxalates should have been present in the dissolved slurry based on the dilution effects and volumes of supernate and wash solutions removed. A trace level material balance showed greater than 97 percent recovery of americium-241 (from the beta dec

  18. Comparative study of plutonium and americium bioaccumulation from two marine sediments contaminated in the natural environment

    International Nuclear Information System (INIS)

    Hamilton, T.F.; Smith, J.D.

    1991-01-01

    Plutonium and americium sediment-animal transfer was studied under controlled laboratory conditions by exposure of the benthic polychaete Nereis diversicolor (O. F. Mueller) to marine sediments contaminated by a nuclear bomb accident (near Thule, Greenland) and nuclear weapons testing (Enewetak Atoll). In both sediment regimes, the bioavailability of plutonium and 241 Am was low, with specific activity in the tissues 241 Am occurred and 241 Am uptake from the Thule sediment was enhanced compared to that from lagoon sediments of Enewetak Atoll. Autoradiography studies indicated the presence of hot particles of plutonium in the sediments. The results highlight the importance of purging animals of their gut contents in order to obtain accurate estimates of transuranic transfer from ingested sediments into tissue. It is further suggested that enhanced transuranic uptake by some benthic species could arise from ingestion of highly activity particles and organic-rich detritus present in the sediments. (author)

  19. An experimental investigation of accumulation and transmutation behavior of americium in the MOX fuel irradiated in a fast reactor

    International Nuclear Information System (INIS)

    Osaka, Masahiko; Koyama, Shin-ichi; Maeda, Shigetaka; Mitsugashira, Toshiaki

    2005-01-01

    Americium isotopes generated in the MOX fuel irradiated in the experimental fast reactor JOYO were analyzed by applying a sophisticated radiochemical technique. Americium was isolated from the irradiated MOX fuel by a combined method of anion-exchange chromatography and oxidation of Am. The isotopic ratios of americium and its content were determined by thermal ionization mass spectroscopy and α-spectrometry, respectively. The americium isotopic ratio was similar for all the specimens, but was significantly different from that of PWR-MOX. On the basis of present analytical results, the accumulation and transmutation behavior of americium nuclides in a fast reactor is discussed from the viewpoints of neutron spectrum dependence and the isomeric ratio of the 241 Am capture reaction. The estimated isomeric ratio is about 87%, which is close to the latest evaluated value. A rapid estimation method of Am content by using the 240 Pu to 239 Pu ratio was adopted and proved to be valid for the spent fuel irradiated in the fast reactor

  20. Mycoremediation. The study of transfer factor for plutonium and americium uptake from the ground

    International Nuclear Information System (INIS)

    Dusan Galanda; Lubomir Matel; Jana Strisovska; Silvia Dulanska

    2014-01-01

    In our scientific research we have monitored mycoremediation's properties of oyster mushrooms in cultivation on the soil what is contaminated by solutions with radioactive isotopes of 239 Pu and 241 Am with known activity. We monitored specific activities of absorbed radionuclides in fruiting bodies and chemical forms of radionuclides which were compared to calculated specific activities of two background samples of oyster mushrooms intended for consumer purpose. We determined distributive coefficients between the ground and the fruiting body of oyster mushrooms. The average value which was obtained for the transfer factor for plutonium was 0.72 and for americium 3.97. To evaluate a quantity of absorbed radionuclides we used a method of liquid extraction. The emitting alpha radiation of alpha radionuclides was detected by spectrometry. For defining individual fractions of plutonium and americium that are contained in mushroom bodies was used the sequential leaching method. (author)

  1. Effects of Organic Acids and Sylvite on Phytoextraction of 241Am Contaminated Soil.

    Science.gov (United States)

    Wang, Ping; Du, Liang; Tan, Zhaoyi; Su, Rongbo; Li, Taowen

    2017-03-01

    Contamination of soil with Americium ( 241 Am) at nuclear sites in China poses a serious problem. We screened six plants, from five families, for their 241 Am-enrichment potential. Europium (Eu), which is morphologically and chemically similar to the highly toxic 241 Am, was used in its place. Moreover, the effects of sylvite, citric acid (CA), malic acid (MA), and humic acid (HA) on the absorption of 241 Am by the plants, and its transport within them, were evaluated along with their effect on plant biomass and 241 Am extraction volume. Barley and cabbage showed relatively stronger Eu accumulation capacities. Citric acid promoted the absorption of 241 Am by barley roots and its transport within the plants. The effects of sylvite were not obvious and those of HA were the weakest in case of sunflower; HA, however, maximally increased the biomass of the plants. Our results could provide the basis for future radionuclide phytoremediation of contaminated soils.

  2. Distribution of 239Pu and 241Am in the human skeleton

    International Nuclear Information System (INIS)

    McInroy, J.F.; Swint, M.J.

    1984-01-01

    The 241 Am and 239 Pu distribution in the skeletons of two former nuclear workers has been measured. The skeletons of both individuals appear to be within normal limits for Caucasian men about 50 y old. Both had lower limb bones that were heavier than the age controls and Case I had upper-body bones that were lighter than the age control group. The distribution of americium in the skeleton of Case I, 25 years post exposure, indicated that a more rapid turnover of initially deposited americium on the bone surfaces of cancellous bone, as compared to that deposited on the bone surfaces of compact bone, had occurred. This resulted in a larger proportion of americium located in the compact bone of the extremities and a lesser quantity in the more cancellous bones of the vertebral column, pelvis and rib cage. A similar shift in the distribution of plutonium occurred in Case II in the 35 y since initial deposition, but at a slower rate than that for americium. The ratio of each actinide in the liver to that in the systemic system (liver content/systemic system content) was 0.065 and 0.436, for americium and plutonium, respectively, suggesting that a much more rapid turnover of americium in the liver, compared to plutonium, provided a much larger fraction of that nuclide for circulatory feedback to the remodeling skeletal system. 8 references, 3 tables

  3. Consideration of the effect of lymph-node deposition upon the measurement of plutonium and americium in the lungs

    International Nuclear Information System (INIS)

    Falk, R.B.; Lagerquist, C.R.

    1975-01-01

    Measurement of an inhaled radionuclide by external photon counting includes quantities which may be contained in lymph nodes, as well as quantities in the lungs. An overestimate of the lung burden can result, if a portion of the radionuclide were present in the lymph nodes. This problem is analyzed with respect to the measurement of inhaled plutonium containing plutonium-241 and americium-241, when americium-241 has been used as a tracer for the plutonium. Equations are derived which yield the amounts of americium and of plutonium in the lungs and in the lymph nodes as a function of time after exposure and for various translocation and retention parameters. Count histories (count profiles) of actual exposure cases are compared with calculated count profiles in order to gain insight into possible values of the translocation and retention parameters. Comparison is also made with calculated count profiles using values of translocation and retention parameters recommended by the International Commission on Radiological Protection (ICRP) for use with the Task Group Lung Model. The magnitude of the possible overestimate (error factor) was calculated for combinations o []parameters which yielded matches to the observed count histories. (auth)

  4. Remobilization of americium in soil columns under experimental rhizo-spheric conditions

    Energy Technology Data Exchange (ETDEWEB)

    Perrier, T.; Martin-Garin, A.; Morello, M. [CEA Cadarache (DEI/SECRE/LRE), Laboratory of Radioecology and Ecotoxicology, Institute for Radioprotection and Nuclear Safety, 13 - Saint-Paul-lez-Durance (France)

    2004-07-01

    The biogeochemical behaviour of americium in subsurface soils plays a dominant role on the potential migration of this actinide, but is currently poorly known. The identification and understanding of these processes is of major concern for this highly (radio)toxic element and can allow the determination of its impact on the natural media. This research investigates the relevant processes controlling americium biogeochemical speciation in the rhizosphere of an agricultural soil. Lixiviation tests were performed on columns packed with a 2 mm-sieved calcareous soil contaminated with {sup 241}Am (500 Bq.g{sup -1}), under steady-state unsaturated or saturated hydric flow conditions. The columns were percolated with soil solution of varied compositions, containing citrate and/or glucose simulating root exudates in non-sterile conditions. The physico-chemical parameters of the outlet solution (pH, conductivity, major ions, organic acids) were monitored, as well as the microbial activity. Inorganic and organic speciation of {sup 241}Am is supported by geochemical modeling with JChess, using a thermodynamic database based on NEA database and the latest PSI recommendations. The percolation of a solution in equilibrium with the soil released small amount of americium (<5 mBq/cm{sup 3}), as predicted by the high {sup 241}Am K{sub d} values. 10{sup -4} M concentrations of citrate, glucose or both combined did not enhance remobilization either. Poor remobilization was also observed at high glucose concentrations (10{sup -2} M), despite an effective glucose microbial degradation, the production of ligands such as acetate, and important changes in the chemistry of the solution. On the contrary, high concentrations of citrate (10{sup -2} M) released 1000 times more americium, which is in accordance with previous studies. Even greater releases (10000 times) were observed when 10{sup -2} M glucose was added to 10{sup -2} M citrate. The remobilization of americium resulting from the

  5. Isolating 241Am from waste solutions containing Al, Ca, Fe, and Cr

    International Nuclear Information System (INIS)

    Gray, L.W.; Burney, G.A.; King, C.M.

    1982-01-01

    About 2.4 kg of 241 Am contaminated with calcium and aluminum had been recovered from low-activity waste during recycle of 11% 240 Pu. A process was developed and demonstrated to purify the americium before shipment as 241 AmO 2 . The americium and some of the calcium were batch extracted into 50% TBP-n-paraffin from 2.2M Al(NO 3 ) 3 - 0.3M HNO 3 solution in a canyon tank. Pregnant solvent was scrubbed first with 2.1M Al 3+ -0.3M Li + -6.7M NO 3 - and then with 7M LiNO 3 to reduce the calcium content and to displace the aluminum. Americium was then stripped from the solvent with water and concentrated by evaporation. Before precipitating the americium with oxalic acid, the nitric acid was adjusted with NH 4 OH to yield a 1M NH 4 NO 3 solution. Recovery across the batch extraction step was 97.8%, while 93% of the calcium and >99% of the aluminum was rejected. Recovery across precipitation averaged >96% while producing a product which was >99.3% pure 241 AmO 2 . The major impurities were water, carbon, calcium, iron, and zinc

  6. Distribution coefficients for plutonium and americium on particulates in aquatic environments

    International Nuclear Information System (INIS)

    Sanchez, A.L.; Schell, W.R.; Sibley, T.H.

    1982-01-01

    The distribution coefficients of two transuranic elements, plutonium and americium, were measured experimentally in laboratory systems of selected freshwater, estuarine, and marine environments. Gamma-ray emitting isotopes of these radionuclides, 237 Pu and 241 Am, were significantly greater than the sorption Ksub(d) values, suggesting some irreversibility in the sorption of these radionuclides onto sediments. The effects of pH and of sediment concentration on the distribution coefficients were also investigated. There were significant changes in the Ksub(d) values as these parameters were varied. Experiments using sterilized and nonsterilized samples for some of the sediment/water systems indicate possible bacterial effects on Ksub(d) values. (author)

  7. Recovery of americium from slag and crucible wastes and its purification

    International Nuclear Information System (INIS)

    Michael, K.M.; Dabholkar, G.M.; Vijayan, K.; Ramamoorthy, N.; Narayanan, C.V.; Jambunathan, U.; Kapoor, S.C.

    1990-01-01

    A method of recovery and purification of americium-241 from slag waste streams is described. Extraction of Am from slag solution of 0.16 M HNO 3 was carried out by tri-n-butyl phosphate. After stripping with acetic acid, Am was precipitated at pH 1. This was followed by metathesis to remove Ca. Final separation of Pu from Am solution was achieved by anion exchange method using Dowex 1x4 anion exchange resin. Details of large scale recovery of Am from slag are also described. (author). 12 refs., 11 tabs., 1 fig

  8. Americium removal from nitric acid waste streams

    International Nuclear Information System (INIS)

    Muscatello, A.C.; Navratil, J.D.

    1986-01-01

    Separations research at the Rocky Flats Plant (RFP) has found ways to significantly improve americium removal from nitric acid (7M) waste streams generated by plutonium purification operations. Partial neutralization of the acid waste followed by solid supported liquid membranes (SLM) are useful in transferring and concentrating americium from nitrate solutions. Specifically, DHDECMP (dihexyl-N,N-diethylcarbamoylmethylphosphonate) supported on Accurel polypropylene hollow fibers assembled in modular form transfers >95% of the americium from high nitrate (6.9M), low acid (0.1M) feeds into 0.25M oxalic acid stripping solution. Maximum permeabilities were observed to be 0.001 cm/sec, consistent with typical values for other systems. The feed:strip volume ratio shows an inverse relationship to the fraction of metal ion transferred. Cation exchangers may be used to concentrate americium from the strip solution. Furthermore, O0D (iB)CMPO (or CMPO) (octylphenyl-N-N-diisobutylcarbamoylmethylphosphine oxide) has been tested in an extraction chromatography mode. Preliminary results show CMPO to be effective in removing americium if the feed is neutralized to 1.0M acidity and iron(III) is complexed with 0.20M oxalic acid. 3 figs

  9. Americium thermodynamic data for the EQ3/6 database

    International Nuclear Information System (INIS)

    Kerrisk, J.F.

    1984-07-01

    Existing thermodynamic data for aqueous and solid species of americium have been reviewed and collected in a form that can be used with the EQ3/6 database. Data that are important in solubility calculations for americium at a proposed Yucca Mountain nuclear waste repository were emphasized. Conflicting data exist for americium complexes with carbonates. Essentially no data are available for americium solids or complexes at temperatures greater than 25 0 C. 17 references, 4 figures

  10. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-22

    Acqueous Chloride mission is to recover plutonium and americium from pyrochemical residues (undesirable form for utilization and storage) and generate plutonium oxide and americium oxide. Plutonium oxide is recycled into Pu metal production flowsheet. It is suitable for storage. Americium oxide is a valuable product, sold through the DOE-OS isotope sales program.

  11. Adsorption-Desorption Characteristics of Plutonium and Americium with Sediment Particles in the Estuarine Environment

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1976-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45pm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  12. Transmutation of Americium in Fast Neutron Facilities

    International Nuclear Information System (INIS)

    Zhang, Youpeng

    2011-01-01

    In this thesis, the feasibility to use a medium sized sodium cooled fast reactor fully loaded with MOX fuel for efficient transmutation of americium is investigated by simulating the safety performance of a BN600-type fast reactor loaded with different fractions of americium in the fuel, using the safety parameters obtained with the SERPENT Monte Carlo code. The focus is on americium mainly due to its long-term contribution to the radiotoxicity of spent nuclear fuel and its deterioration on core's safety parameters. Applying the SAS4A/SASSYS transient analysis code, it is demonstrated that the power rating needs to be reduced by 6% for each percent additional americium introduction into the reference MOX fuel, maintaining 100 K margin to fuel melting, which is the most limiting failure mechanism. Safety analysis of a new Accelerator Driven System design with a smaller pin pitch-to-diameter ratio comparing to the reference EFIT-400 design, aiming at improving neutron source efficiency, was also performed by simulating performance for unprotected loss of flow, unprotected transient overpower, and protected loss-of-heat-sink transients, using neutronic parameters obtained from MCNP calculations. Thanks to the introduction of the austenitic 15/15Ti stainless steel with enhanced creep rupture resistance and acceptable irradiation swelling rate, the suggested ADS design loaded with nitride fuel and cooled by lead-bismuth eutectic could survive the full set of transients, preserving a margin of 130 K to cladding rupture during the most limiting transient. The thesis concludes that efficient transmutation of americium in a medium sized sodium cooled fast reactor loaded with MOX fuel is possible but leads to a severe power penalty. Instead, preserving transmutation rates of minor actinides up to 42 kg/TWh th , the suggested ADS design with enhanced proton source efficiency appears like a better option for americium transmutation

  13. Redox chemistry of americium in nitric acid media

    Energy Technology Data Exchange (ETDEWEB)

    Picart, S.; Jobelin, I.; Armengol, G.; Adnet, JM

    2004-07-01

    The redox properties of the actinides are very important parameters for speciation studies and spent nuclear fuel reprocessing based on liquid-liquid extraction of actinides at different oxidation states (as in the Purex or Sesame process). They are also very useful for developing analytical tools including coulometry and redox titration. This study addressed the americium(IV)/americium(III) and americium(VI)/americium(V) redox couples, focusing on exhaustive acquisition of the thermodynamic and kinetic parameters of americium oxidation at an electrode in a complexing nitric acid medium. (authors)

  14. Redox chemistry of americium in nitric acid media

    International Nuclear Information System (INIS)

    Picart, S.; Jobelin, I.; Armengol, G.; Adnet, JM.

    2004-01-01

    The redox properties of the actinides are very important parameters for speciation studies and spent nuclear fuel reprocessing based on liquid-liquid extraction of actinides at different oxidation states (as in the Purex or Sesame process). They are also very useful for developing analytical tools including coulometry and redox titration. This study addressed the americium(IV)/americium(III) and americium(VI)/americium(V) redox couples, focusing on exhaustive acquisition of the thermodynamic and kinetic parameters of americium oxidation at an electrode in a complexing nitric acid medium. (authors)

  15. Contemporary state of plutonium and americium in the soils of Palesse state radiation-ecological reserve

    International Nuclear Information System (INIS)

    Papenia, M.V.; Sokolik, G.A.; Ovsiannikova, S.V.; Voinikava, E.V.; Svirschevsky, S.F.; Brown, J.; Skipperud, L.

    2010-01-01

    Full text: At present, the most important alpha-emitting radionuclides of Chernobyl origin are Pu 238, Pu 239, Pu 240 and Am 241. They are classified as the most dangerous group of radionuclides in view of the long half-lives and high radiotoxicity. The main part of alpha-emitted radionuclides is located within the Palesse State Radiation-Ecological Reserve. One of the most important factors determining the radioecological situation in the contaminated ecosystems is the physicochemical forms of radionuclides in a soil medium. Radionuclide species determine the radionuclide entrance into the soil solutions, their redistribution in soil profiles and the 'soil - plant' and the 'soil - surface, ground or underground water' systems as well as spreading beyond the contaminated area. The present work is devoted to investigation of state and migration ability of plutonium and americium in soils of the Palesse state radiation-ecological reserve after more than 20 years from the Chernobyl accident. The objects of investigation were mineral and organic soils sampled in 2008 with the step of 5 cm to the depth of 25-30 cm. The forms of plutonium and americium distinguishing by association with the different components of soil and by potential for migration in the soil medium were studied using the method of sequential selective extraction according to the modified Tessier scheme. Activities of Pu 238, Pu 239, Pu 240 and Am 241 in the samples were determined by the method of radiochemical analysis with alpha-spectrometer radionuclide identification. The dominant part of plutonium and americium in the soils is in immobile forms. Nowadays, radionuclide portions in water soluble and reversibly bound forms do not exceed 9.4 % of radionuclide content in the soil. In mineral soil samples, the radionuclide portions in these fractions exceed the corresponding portions in organic ones. In both mineral and organic soils, the portions of mobile americium are higher than plutonium. The

  16. On the influence of the americium isotopic vector on the cooling time of minor actinides bearing blankets in fast reactors

    Directory of Open Access Journals (Sweden)

    Kooyman Timothée

    2018-01-01

    Full Text Available In the heterogeneous minor actinides transmutation approach, the nuclei to be transmuted are loaded in dedicated targets often located at the core periphery, so that long-lived heavy nuclides are turned into shorter-lived fission products by fission. To compensate for low flux level at the core periphery, the minor actinides content in the targets is set relatively high (around 20 at.%, which has a negative impact on the reprocessing of the targets due to their important decay heat level. After a complete analysis of the main contributors to the heat load of the irradiated targets, it is shown here that the choice of the reprocessing order of the various feeds of americium from the fuel cycle depends on the actual limit for fuel reprocessing. If reprocessing of hot targets is possible, it is more interesting to reprocess first the americium feed with a high 243Am content in order to limit the total cooling time of the targets, while if reprocessing of targets is limited by their decay heat, it is more interesting to wait for an increase in the 241Am content before loading the americium in the core. An optimization of the reprocessing order appears to lead to a decrease of the total cooling time by 15 years compared to a situation where all the americium feeds are mixed together when two feeds from SFR are considered with a high reprocessing limit.

  17. Final Radiological Assessment of External Exposure for CLEAR-Line Americium Recovery Operations

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Adam C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Belooussova, Olga N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hetrick, Lucas Duane [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-11-12

    Los Alamos National Laboratory is currently planning to implement an americium recovery program. The americium, ordinarily isotopically pure 241Am, would be extracted from existing Pu materials, converted to an oxide and shipped to support fabrication of americium oxide-beryllium neutron sources. These operations would occur in the currently proposed Chloride Extraction and Actinide Recovery (CLEAR) line of glove boxes. This glove box line would be collocated with the currently-operational Experimental Chloride Extraction Line (EXCEL). The focus of this document is to provide an in-depth assessment of the currently planned radiation protection measures and to determine whether or not further design work is required to satisfy design-goal and ALARA requirements. Further, this document presents a history of americium recovery operations in the Department of Energy and high-level descriptions of the CLEAR line operations to provide a basis of comparison. Under the working assumptions adopted by this study, it was found that the evaluated design appears to mitigate doses to a level that satisfies the ALARA-in-design requirements of 10 CFR 835 as implemented by the Los Alamos National Laboratory procedure P121. The analyses indicate that extremity doses would also meet design requirements. Dose-rate calculations were performed using the radiation transport code MCNP5 and doses were estimated using a time-motion study developed in consort with the subject matter expert. A copy of this report and all supporting documentation are located on the Radiological Engineering server at Y:\\Rad Engineering\\2013 PROJECTS\\TA-55 Clear Line.

  18. Measurements of α-emitting plutonium and americium in the intertidal sands of west Cumbria, UK

    International Nuclear Information System (INIS)

    Eakins, J.D.; Morgan, A.; Baston, G.M.N.; Pratley, F.W.; Strange, L.P.; Burton, P.J.

    1990-01-01

    Samples of surface sand and sand cores were collected from intertidal regions of west Cumbria between Silloth and Walney Island (including the Duddon Estuary) between 1982 and 1984 and analysed for 238 Pu, 239+240 Pu and 241 Am. Generally, more than 95% of the α-emitting transuranic nuclides were associated with the sand and less than 5% with entrained silt. The greatest concentrations of both plutonium and americium were found at Braystones. Concentrations declined with distance from the Sellafield Works. The largest actinide deposits occurred at Drigg (320 and 720 kBq m -2 of 239+240 Pu and 241 Am respectively). The integrated deposits in intertidal sand between Silloth and Walney Island were about 4.2 and 7.0 TBq respectively, which represent about 1% of the total α-emitting activity discharged to sea from Sellafield Works up to 1982. The corresponding value for the Duddon Estuary is about 0.3%. Only on beaches close to Sellafield did levels of man-made α-emitters exceed those of natural α-emitting nuclides. The radiological consequences of the intertidal inventory of plutonium and americium are shown to be very small and much less than from the seafood pathway. (author)

  19. Measurements of. alpha. -emitting plutonium and americium in the intertidal sands of west Cumbria, UK

    Energy Technology Data Exchange (ETDEWEB)

    Eakins, J.D.; Morgan, A.; Baston, G.M.N.; Pratley, F.W.; Strange, L.P.; Burton, P.J. (UKAEA Harwell Lab. (UK). Environmental and Medical Science Div.)

    1990-01-01

    Samples of surface sand and sand cores were collected from intertidal regions of west Cumbria between Silloth and Walney Island (including the Duddon Estuary) between 1982 and 1984 and analysed for {sup 238}Pu, {sup 239+240}Pu and {sup 241}Am. Generally, more than 95% of the {alpha}-emitting transuranic nuclides were associated with the sand and less than 5% with entrained silt. The greatest concentrations of both plutonium and americium were found at Braystones. Concentrations declined with distance from the Sellafield Works. The largest actinide deposits occurred at Drigg (320 and 720 kBq m{sup -2} of {sup 239+240}Pu and {sup 241}Am respectively). The integrated deposits in intertidal sand between Silloth and Walney Island were about 4.2 and 7.0 TBq respectively, which represent about 1% of the total {alpha}-emitting activity discharged to sea from Sellafield Works up to 1982. The corresponding value for the Duddon Estuary is about 0.3%. Only on beaches close to Sellafield did levels of man-made {alpha}-emitters exceed those of natural {alpha}-emitting nuclides. The radiological consequences of the intertidal inventory of plutonium and americium are shown to be very small and much less than from the seafood pathway. (author).

  20. Migration study of americium in porous medium

    International Nuclear Information System (INIS)

    Tanaka, Tadao; Ogawa, Hiromichi

    1999-01-01

    Migration experiments of 241 Am 3+ had been performed by a column system, to investigate migration behavior of 241 Am through a column packed porous sedimentary materials: a coastal sandy soil and a reddish soil. Most 241 Am loaded into the column packed the reddish soil sorbed on the influent edge of the column. In the case of the sandy soil, however, considerable amount of 241 Am was passed through the column. This shows that there is colloidal 241 Am species which may move without effective interaction with the sandy soil. Such a migration behavior of colloidal 241 Am in the sandy soil column could be evaluated by a sorption model based on filtration theory. Sorption mechanisms of 241 Am on the sedimentary materials were examined by a chemical extraction method, for 241 Am sorbed on the sandy soil and the reddish soil at any sections in the column. The 241 Am sorbed on the reddish soil was mainly controlled by a reversible ion exchange reaction. On the other hand, the 241 Am sorbed on the sandy soil ws controlled by irreversible reactions, such as the selective chemical sorptions onto Fe and Mn oxyhydroxide/oxide. The experimental results support that the migration of 241 Am in the reddish soil layer can be estimated by using the K d , whereas that in the sandy soil can not be explained by the K d concept. (author)

  1. Americium separations from high salt solutions

    International Nuclear Information System (INIS)

    Barr, Mary E.; Jarvinen, Gordon D.; Schulte, Louis D.; Stark, Peter C.; Chamberlin, Rebecca M.; Abney, Kent D.; Ricketts, Thomas E.; Valdez, Yvette E.; Bartsch, Richard A.

    2000-01-01

    Americium (III) exhibits an unexpectedly high affinity for anion-exchange material from the high-salt evaporator bottoms solutions--an effect which has not been duplicated using simple salt solutions. Similar behavior is observed for its lanthanide homologue, Nd(III), in complex evaporator bottoms surrogate solutions. There appears to be no single controlling factor--acid concentration, total nitrate concentration or solution ionic strength--which accounts for the approximately 2-fold increase in retention of the trivalent ions from complex solutions relative to simple solutions. Calculation of species activities (i.e., water, proton and nitrate) in such concentrated mixed salt solutions is difficult and of questionable accuracy, but it is likely that the answer to forcing formation of anionic nitrate complexes of americium lies in the relative activities of water and nitrate. From a practical viewpoint, the modest americium removal needs (ca. 50--75%) from nitric acid evaporator bottoms allow sufficient latitude for the use of non-optimized conditions such as running existing columns filled with older, well-used Reillex HPQ. Newer materials, such as HPQ-100 and the experimental bifunctional resins, which exhibit higher distribution coefficients, would allow for either increased Am removal or the use of smaller columns. It is also of interest that one of the experimental neutral-donor solid-support extractants, DHDECMP, exhibits a similarly high level of americium (total alpha) removal from EV bottoms and is much less sensitive to total acid content than commercially-available material

  2. Transmutation of americium in critical reactors

    International Nuclear Information System (INIS)

    Wallenius, J.

    2005-01-01

    Already in 1974, a Los Alamos report suggested that the recycling of higher actinides would be detrimental for the safety of critical reactors. Later investigations confirmed this understanding, and stringent limits on the fraction of minor actinides allowed to be present in the fuel of fast neutron reactors were established. In recent years, and in particular in connection with the generation IV initiative, it has been advocated that recycling of americium in critical reactors is not only feasible, but also a recommendable approach. In the present contribution, it is shown, to the contrary, that introduction of americium into reactors with uranium based fuels deteriorates the safety margin of these reactors to a degree that will not allow consumption of the americium sources present in any economically competitive nuclear fuel cycle. Further, it is shown that uranium and thorium free cores with plutonium based fuels may be designed, that features excellent safety characteristics, as long as americium is not present in the feed. Hence, a closed fuel cycle is suggested, that consists of commercial power production in light water reactors, plutonium burning in uranium and thorium free fast neutron critical reactors, and higher actinide consumption in accelerator driven systems with inert matrix fuel. It is argued that such a fuel cycle (being a refinement of the Double Strata fuel cycle proposed by JAERI and further developed by M. Salvatores) provides a minimum cost penalty for implementing P and T under realistic boundary conditions. (author)

  3. Interaction and diffusion transport of americium in soils

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    The final disposal of High Level Radioactive Wastes (HLRW) is based on its long-term storage in underground facilities located in geological stable sites with a multi-barrier system, the so called Deep Geological Repositories (DGR), that will keep HLRW confined for >10.000 years. After this period of time, leachates rich in long-live radioisotopes might escape from DGR and start to transport towards the biosphere. There is still a lack of information concerning the interaction and transport in soils of some radionuclides present in HLRW, especially for radionuclides that present a high sorption, such as americium (Am). Having reliable information about the mobility of radionuclides in soils is crucial in order to develop risk assessment models and to take proper decisions in case of soil contamination. The aim of the present work was, by means of laboratory scale experiments, to study the interaction and, for first time, to evaluate the diffusion transport of {sup 241}Am in soils. The {sup 241}Am interaction in soils was assessed by applying sorption batch assays to 20 soil samples with contrasted edaphic properties which allowed us to quantify the solid-liquid distribution coefficient (K{sub d}) and desorption percentage. K{sub d} (Am) values ranged from 10{sup 3} to 10{sup 5} L kg{sup -1} and desorption percentages were always less than 2% which denoted a high capacity of the soil to incorporate the Am and a low reversibility of the sorption process. The influence of soil properties in {sup 241}Am interaction was studied by means of multiple linear and multivariate regressions. Although a single correlation between K{sub d} (Am) values and a soil property was not found, the main properties affecting {sup 241}Am interaction in soils were soil pH, carbonate and organic matter contents in the soil. Finally, additional batch assays at different controlled pH were done to study Am sorption as a function of the contact solution pH. A variation of the Am sorption

  4. Decontaminaion of metals containing plutonium and americium

    International Nuclear Information System (INIS)

    Seitz, M.G.; Gerding, T.J.; Steindler, M.J.

    1979-06-01

    Melt-slagging (melt-refining) techniques were evaluated as a decontamination and consolidation step for metals contaminated with oxides of plutonium and americium. Experiments were performed in which mild steel, stainless steel, and nickel contaminated with oxides of plutonium and americium were melted in the presence of silicate slags of various compositions. The metal products were low in contamination, with the plutonium and americium strongly fractionated to the slags. Partition coefficients (plutonium in slag/plutonium in steel) of 7 x 10 6 were measured with boro-silicate slag and of 3 x 10 6 with calcium, magnesium silicate slag. Decontamination of metals containing as much as 14,000 ppM plutonium appears to be as efficient as for metals with plutonium levels of 400 ppM. Staged extraction, that is, a remelting of processed metal with clean slag, results in further decontamination of the metal. The second extraction is effective with either resistance-furnace melting or electric-arc melting. Slag adhering to the metal ingots and in defects within the ingots is in the important contributors to plutonium retained in processed metals. If these sources of plutonium are controlled, the melt-refining process can be used on a large scale to convert highly contaminated metals to homogeneous and compact forms with very low concentrations of plutonium and americium. A conceptual design of a melt-refining process to decontaminate plutonium- and americium-contaminated metals is described. The process includes single-stage refining of contaminated metals to produce a metal product which would have less than 10 nCi/g of TRU-element contamination. Two plant sizes were considered. The smaller conceptual plant processes 77 kg of metal per 8-h period and may be portable.The larger one processes 140 kg of metal per 8-h period, is stationary, and may be near te maximum size that is practical for a metal decontamination process

  5. Accumulation of {sup 241}Am by suspended matter, diatoms and aquatic weeds of the Yenisei River

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A., E-mail: t_zotina@ibp.r [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk 660036 (Russian Federation); Bolsunovsky, A.Ya.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk 660036 (Russian Federation)

    2010-02-15

    In this work we experimentally estimated the capacities of the key components of the Yenisei River (Russia): particulate suspended matter (seston), diatom microalgae, and submerged macrophytes for accumulating {sup 241}Am from water. In our experiments large particles of seston (>8 mum), comparable in size with diatoms, took up most of americium from water. The accumulation of americium by isolated diatom algae (Asterionella formosa and Diatoma vulgare) was lower than by total seston. The concentration factors (CFs) of {sup 241}Am for seston of the Yenisei River in our experiments were (2.8-6.9).10{sup 5}; for diatoms - (1.5-4.2).10{sup 4}. The CFs for aquatic plant Elodea canadensis were within the same order of magnitude as those for diatoms. Activity concentration and CFs of {sup 241}Am were nearly the same in experiments under dark and light conditions. This is indicative of an energy independent mechanism of americium uptake from the water by diatoms and submerged macrophytes.

  6. Behavior of 241Am in fast reactor systems - a safeguards perspective

    International Nuclear Information System (INIS)

    Beddingfield, David H.; Lafleur, Adrienne M.

    2009-01-01

    Advanced fuel-cycle developments around the world currently under development are exploring the possibility of disposing of 241 Am from spent fuel recycle processes by burning this material in fast reactors. For safeguards practitioners, this approach could potentially complicate both fresh- and spent-fuel safeguards measurements. The increased (α,n) production in oxide fuels from the 241 Am increases the uncertainty in coincidence assay of Pu in MOX assemblies and will require additional information to make use of totals-based neutron assay of these assemblies. We have studied the behavior of 241 Am-bearing MOX fuel in the fast reactor system and the effect on neutron and gamma-ray source-terms for safeguards measurements. In this paper, we will present the results of simulations of the behavior of 241 Am in a fast breeder reactor system. Because of the increased use of MOX fuel in thermal reactors and advances in fuel-cycle designs aimed at americium disposal in fast reactors, we have undertaken a brief study of the behavior of americium in these systems to better understand the safeguards impacts of these new approaches. In this paper we will examine the behavior of 241 Am in a variety of nuclear systems to provide insight into the safeguards implications of proposed Am disposition schemes.

  7. Americium migration in basalt and implications to repository risk analysis

    International Nuclear Information System (INIS)

    Rickert, P.G.

    1980-01-01

    Experiments were performed with americium as a minor component in groundwater. Batch adsorption, migration through column, and filtration experiments were performed. It was determined in batch experiments that americium is strongly adsorbed from solution. It was determined with filtration experiments that large percentages of the americium concentrations suspended by the contact solutions in batch experiments and suspended by the infiltrating groundwater in migration experiments were associated with particulate. Filtration was determined to be the primary mode of removal of americium from infiltrating groundwater in a column of granulated basalt (20 to 50 mesh) and an intact core of permeable basalt. Fractionally, 0.46 and 0.22 of the americium component in the infiltrating groundwater was transported through the column and core respectively. In view of these filtration and migration experiment results, the concept of K/sub d/ in the chromatographic sense is meaningless for predicting americium migration in bedrock by groundwater transport at near neutral pH

  8. Procedure for the analysis of americium in complex matrices

    International Nuclear Information System (INIS)

    Knab, D.

    1978-02-01

    A radioanalytical procedure for the analysis of americium in complex matrices has been developed. Clean separations of americium can be obtained from up to 100 g of sample ash, regardless of the starting material. The ability to analyze large masses of material provides the increased sensitivity necessary to detect americium in many environmental samples. The procedure adequately decontaminates from rare earth elements and natural radioactive nuclides that interfere with the alpha spectrometric measurements

  9. Recovery and purification of americium from molten salt extraction residues

    International Nuclear Information System (INIS)

    Navratil, J.D.; Martella, L.L.; Thompson, G.H.

    1980-01-01

    Americium recovery and purification development at Rocky Flats involves the testing of a combined anion exchange - bidentate organophosphorus liquid - liquid extraction or extraction chromatography process for separating americium from molten salt extraction residues. Laboratory-scale and preliminary pilot-plant results have shown that americium can be effectively recovered and purified from impurity elements such as aluminum, calcium, magnesium, plutonium, potassium, sodium, and zinc. The purified americium oxide product from the liquid - liquid extraction process contained greater than 95% AmO 2 with less than 1% of any individual impurity element

  10. Analysis procedure for americium in environmental samples

    International Nuclear Information System (INIS)

    Holloway, R.W.; Hayes, D.W.

    1982-01-01

    Several methods for the analysis of 241 Am in environmental samples were evaluated and a preferred method was selected. This method was modified and used to determine the 241 Am content in sediments, biota, and water. The advantages and limitations of the method are discussed. The method is also suitable for 244 Cm analysis

  11. Decorporation of 241Am in beagles by DTPA

    International Nuclear Information System (INIS)

    Lloyd, R.D.; McFarland, S.S.; Taylor, G.N.; Williams, J.L.; Mays, C.W.

    1975-01-01

    Chelation treatments using daily subcutaneous injections of ZnNa 3 -DTPA were begun 2 wk after the intravenous administration of 0.3 μCi/kg 241 Am citrate to six female beagles averaging 505 days of age. Retention of americium in the liver and in non-liver tissue (mainly skeleton) was followed serially in the living dogs by a combination of total-body and partial-body counting. During the first 13 mo of DTPA therapy, the removal of 241 Am from two dogs given one DTPA injection each day of 0.027 or 0.034 mmole/kg was similar to the fraction removed from two other dogs given a similar total of 0.035 or 0.037 mmole/kg/day in five fractionated injections each day. Increasing the daily amount of DTPA to 0.36 and 5.0 mmole/kg/day in the two remaining dogs only slightly increased the removal of 241 Am. At the beginning of chelation therapy, all six dogs averaged 43 percent of the injected 241 Am in the liver and 46 percent in nonliver tissue. 241 Am retention in liver at 2 mo of therapy was about 2 percent of pretreatment liver retention, decreased to roughly 1 percent of pretreatment retention by 5 mo of DTPA administration, and was undetectable at 13 months. Nonliver retention at 2 mo was 53 percent of pretreatment retention in nonliver tissue, at 5 mo averaged about 40 percent, and had decreased to 27 percent of pretreatment values by 13 mo of chelation therapy. In contrast, for beagles of our colony not treated with DTPA, 241 Am in the liver and in nonliver tissue exhibited a biological half-time in the order of 10 yr. (U.S.)

  12. Concentration and vertical distribution of plutonium and americium in Italian mosses and lichens

    International Nuclear Information System (INIS)

    Jia, G.; Desideri, D.; Guerra, F.; Meli, M.A.; Testa, C.

    1997-01-01

    The plutonium and americium concentration and vertical distribution in some Italian mosses and lichens have been determined. The 239,240 Pu, 238 Pu and 241 Am concentration ranges in tree trunk lichens 0.83-1.87, 0.052-0.154 and 0.180-0.770 Bq/kg, respectively. The corresponding values in tree mosses are higher and more scattered ranging from 0.321 to 4.96, from 0.029 to 0.171 and from 0.200 to 1.93 Bq/kg. The mean 238 Pu/ 239,240 Pu and 241 Am/ 239,240 Pu ratios are 0.088±0.037 and 0.38 ± 0.13 in lichens and 0.091±0.072 and 0.54±0.16 in tree mosses. The Pu and Am concentrations are relatively low in terrestrial mosses. The 239,240 Pu, 238 Pu and 241 Am vertical distributions in a terrestrial moss core (Neckera Crispa) collected near Urbino (central Italy) show an exponential decrease with the height. On the contrary the 241 Am vertical distribution in another terrestrial moss core (Sphagnum Compactum) collected in the Alps (northern Italy) shows an interesting peak at 16 cm which corresponds to the deposition of fallout from the nuclear weapon tests in 1960's. The 241 Am movement upward and downward in the moss core is also studied. The results show once again that both mosses and lichens are very effective accumulators of Pu and Am and that they can be used as good biological indicators of the radionuclide airborne pollution from nuclear facilities and nuclear weapon tests. They can play a very important role in cycling naturally or artificially enhanced radionuclides in the atmosphere over long time scales. (author)

  13. Comparative study of plutonium and americium bioaccumulation from two marine sediments contaminated in the natural environment

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, T.F.; Smith, J.D. (Melbourne Univ., Parkville (Australia). Dept. of Inorganic Chemistry); Fowler, S.W.; LaRosa, J.; Holm, E. (International Atomic Energy Agency, Monaco-Ville (Monaco). Lab. of Marine Radioactivity); Aarkrog, A.; Dahlgaard, H. (Risoe National Lab., Roskilde (Denmark))

    1991-01-01

    Plutonium and americium sediment-animal transfer was studied under controlled laboratory conditions by exposure of the benthic polychaete Nereis diversicolor (O. F. Mueller) to marine sediments contaminated by a nuclear bomb accident (near Thule, Greenland) and nuclear weapons testing (Enewetak Atoll). In both sediment regimes, the bioavailability of plutonium and {sup 241}Am was low, with specific activity in the tissues <1% (dry wt) than in the sediments. Over the first three months, a slight preference in transfer of plutonium over {sup 241}Am occurred and {sup 241}Am uptake from the Thule sediment was enhanced compared to that from lagoon sediments of Enewetak Atoll. Autoradiography studies indicated the presence of hot particles of plutonium in the sediments. The results highlight the importance of purging animals of their gut contents in order to obtain accurate estimates of transuranic transfer from ingested sediments into tissue. It is further suggested that enhanced transuranic uptake by some benthic species could arise from ingestion of highly activity particles and organic-rich detritus present in the sediments. (author).

  14. Investigation of factors affecting the quality of americium electroplating.

    Science.gov (United States)

    Trdin, M; Benedik, L; Samardžija, Z; Pihlar, B

    2012-09-01

    Four different electrolyte solutions were used in the electrodeposition of americium and their influences on the quality of the thin layer of deposited americium isotopes in combination with three different cathode disc materials were investigated. The relations between alpha spectral resolution and disc surface properties were established. Copyright © 2012 Elsevier Ltd. All rights reserved.

  15. Transmutation of Americium in Light and Heavy Water Reactors

    Energy Technology Data Exchange (ETDEWEB)

    Hyland, B.; Dyck, G.R.; Edwards, G.W.R. [Chalk River Laboratories, Atomic Energy of Canada Limited (Canada); Ellis, R.J.; Gehin, J.C. [Oak Ridge National Laboratory (ORNL), Oak Ridge, Tennessee (United States); Maldonado, G.I. [University of Tennessee (Knoxville)/ORNL, Tennessee (United States)

    2009-06-15

    There is interest worldwide in reducing the burden on geological nuclear fuel disposal sites. In most disposal scenarios the decay heat loading of the surrounding rock limits the capacity of these sites. On the long term, this decay heat is generated primarily by actinides, and a major contributor 100 to 1000 years after discharge from the reactor is {sup 241}Am. One possible approach to reducing the decay-heat burden is to reprocess spent reactor fuel and use thermal spectrum reactors to 'burn' the Am nuclides. The viability of this approach is dependent upon the detailed changes in chemical and isotopic composition of actinide-bearing fuels after irradiation in thermal reactor spectra. The currently available thermal spectrum reactor options include light water-reactors (LWRs) and heavy-water reactors (HWRs) such as the CANDU{sup R} designs. In addition, as a result of the recycle of spent LWR fuel, there would be a considerable amount of potential recycled uranium (RU). One proposed solution for the recycled uranium is to use it as fuel in Candu reactors. This paper investigates the possibilities of transmuting americium in 'spiked' bundles in pressurized water reactors (PWRs) and in boiling water reactors (BWRs). Transmutation of Am in Candu reactors is also examined. One scenario studies a full core fuelled with homogeneous bundles of Am mixed with recycled uranium, while a second scenario places Am in an inert matrix in target channels in a Candu reactor, with the rest of the reactor fuelled with RU. A comparison of the transmutation in LWRs and HWRs is made, in terms of the fraction of Am that is transmuted and the impact on the decay heat of the spent nuclear fuel. CANDU{sup R} is a registered trademark of Atomic Energy of Canada Limited (AECL). (authors)

  16. The behaviour under irradiation of molybdenum matrix for inert matrix fuel containing americium oxide (CerMet concept)

    Energy Technology Data Exchange (ETDEWEB)

    D' Agata, E., E-mail: elio.dagata@ec.europa.eu [European Commission, Joint Research Centre, Institute for Energy and Transport, P.O. Box 2, 1755 ZG Petten (Netherlands); Knol, S.; Fedorov, A.V. [Nuclear Research and Consultancy Group, P.O. Box 25, 1755 ZG Petten (Netherlands); Fernandez, A.; Somers, J. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Klaassen, F. [Nuclear Research and Consultancy Group, P.O. Box 25, 1755 ZG Petten (Netherlands)

    2015-10-15

    Americium is a strong contributor to the long term radiotoxicity of high activity nuclear waste. Transmutation by irradiation in nuclear reactors or Accelerator Driven System (ADS, subcritical reactors dedicated to transmutation) of long-lived nuclides like {sup 241}Am is therefore an option for the reduction of radiotoxicity of waste packages to be stored in a repository. In order to safely burn americium in a fast reactor or ADS, it must be incorporated in a matrix that could be metallic (CerMet target) or ceramic (CerCer target). One of the most promising matrix to incorporate Am is molybdenum. In order to address the issues (swelling, stability under irradiation, gas retention and release) of using Mo as matrix to transmute Am, two irradiation experiments have been conducted recently at the High Flux Reactor (HFR) in Petten (The Netherland) namely HELIOS and BODEX. The BODEX experiment is a separate effect test, where the molybdenum behaviour is studied without the presence of fission products using {sup 10}B to “produce” helium, the HELIOS experiment included a more representative fuel target with the presence of Am and fission product. This paper covers the results of Post Irradiation Examination (PIE) of the two irradiation experiments mentioned above where molybdenum behaviour has been deeply investigated as possible matrix to transmute americium (CerMet fuel target). The behaviour of molybdenum looks satisfying at operating temperature but at high temperature (above 1000 °C) more investigation should be performed.

  17. Application of extraction chromatography to the recovery of neptunium, plutonium and americium from an industrial waste

    International Nuclear Information System (INIS)

    Madic, C.; Kertesz, C.; Sontag, R.; Koehly, G.

    1980-01-01

    A pilot scale investigation was made to evaluate the possible application of the extraction chromatographic method (LLC) to the partitioning of alpha emitters from liquid wastes containing traces of transuranium elements. A secondary purpose was to obtain pure Am0 2 , which is used to produce alpha, gamma, and neutron sources. The process developed for alpha partitioning consists essentially of the extraction of macro amounts of uranium with 30% TBP in dodecane in mixer-settlers, then coextraction of Np-237, Pu-239, and Am-241 by LLC on a macro column filled with di-n-hexyl-octoxy-methyl-phosphine oxide (POX.11) adsorbed on an inert support. In each run about 200 liters of initial waste are decontaminated of alpha emitters. The loading step is followed by selective elution of americium, neptunium, and plutonium. The americium eluate is then subjected to the following operations: (1) separation of Am from Fe and Cd by LLC on a TBP column and (2) separation of Am from lanthanide traces by LLC on an HD(DiBM)P column after oxidation of Am(III) to Am(VI). The Am in the eluate is subsequently reduced to Am(III) and precipitated as oxalate with oxalic acid. The oxalate is then filtered and calcined to yield pure AmO 2

  18. Plutonium and americium concentrations and vertical profiles in some Italian mosses used as bioindicators

    International Nuclear Information System (INIS)

    Testa, C.; Desideri, D.; Meli, M.A.; Guerra, F.; Degetto, S.; Jia, G.; Gerdol, R.

    1998-01-01

    We have examined the uptake of actinide elements Am and Pu by different species of lichen and moss collected in two locations (Urbino, Central Italy; Alps region, North-east Italy). Plutonium and americium were separated and determined by extraction chromatography, electrodeposition and alpha-spectrometry. This paper summarizes our results with a special emphasis on the vertical profiles of these actinides in two different species of mosses. Several 1-2 cm depth sections were obtained and dated by 210 Pb method. A typical peak for 239,240 Pu and 241 Am was found in the very old moss species ('Sphagnum Compactum') at a depth corresponding to the period 1960-1970 which was the period characterized by the maximum nuclear weapon tests. In a younger moss species ('Neckeria Crispa') no peak was observed and the regression curves showed that Am is more mobile than 239,240 Pu and 238 Pu. (author)

  19. Liver cancer induction by 241Am and thorotrast in deer mice and grasshopper mice

    International Nuclear Information System (INIS)

    Taylor, G.N.; Mays, C.W.; Lloyd, R.D.; Jones, C.W.; Rojas, J.; Wrenn, M.E.; Ayoroa, G.; Kaul, A.; Riedel, W.

    1986-01-01

    The carcinogenicity of 241 Am, relative to thorotrast, has been determined in two species of mice: the grasshopper mouse (Onychomys leucogaster) and the deer mouse (Peromyscus maniculatus). These species were used since both have high uptakes of Pu and Am and, unlike conventional mice and rats, both retain relatively high concentrations of plutonium and americium in their livers. The study indicated that the liver carcinogenicity of comparable rad doses of 241 Am or thorotrast is approximately equal. The toxicity ratio ( 241 Am/thorotrast) for liver cancer induction approximated 1.2 with a range of about 0.6 to 1.6. This suggested that nonradiation factors of thorotrast were not significant in liver tumor induction. (orig.)

  20. Validation of Am-241 measurement in ion chamber type smoke detector by using gamma spectrometry system

    International Nuclear Information System (INIS)

    Yii Mei Wo; Khairul Nizam Razali

    2005-01-01

    Smoke detectors are useful devices in modern days that able to save many lives. Even though, the use of ion chamber type smoke detector (usually contain Americium-241) was exempted in Malaysia, but the trading of this device was controlled by regulation, under the Atomic Energy Licensing Act (Act 304). The activity of the Am-241 can be measured by using the Gamma Spectrometry System since it was much easier, compared to Alpha Spectrometry System. To do so, the system was first need to be calibrated using the standard reference source to find the efficiency of the germanium detector. The method used for the measurement was first validated for several relevant parameters, which include specificity, precision (repeatability), bias (accuracy), linearity, working range, detection limit, robustness and ruggedness to ensure it was fit for the purpose. The measured Am-241 activity inside the smoke detector will be reported together with a reasonable expanded uncertainty arise from the measurement. (Author)

  1. Americium/curium bushing melter drain tests

    International Nuclear Information System (INIS)

    Smith, M.E.; Hardy, B.J.; Smith, M.E.

    1997-01-01

    Americium and curium were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. They have been stored in a nitric acid solution in an SRS reprocessing facility for a number of years. Vitrification of the americium/curium (Am/Cm) solution will allow the material to be safely stored or transported to the DOE Oak Ridge Reservation. Oak Ridge is responsible for marketing radionuclides for research and medical applications. The bushing melter technology being used in the Am/Cm vitrification research work is also under consideration for the stabilization of other actinides such as neptunium and plutonium. A series of melter drain tests were conducted at the Savannah River Technology Center to determine the relationship between the drain tube assembly operating variables and the resulting pour initiation times, glass flowrates, drain tube temperatures, and stop pour times. Performance criteria such as ability to start and stop pours in a controlled manner were also evaluated. The tests were also intended to provide support of oil modeling of drain tube performance predictions and thermal modeling of the drain tube and drain tube heater assembly. These drain tests were instrumental in the design of subsequent melter drain tube and drain tube heaters for the Am/Cm bushing melter, and therefore in the success of the Am/Cm vitrification and plutonium immobilization programs

  2. XRD monitoring of α self-irradiation in uranium-americium mixed oxides.

    Science.gov (United States)

    Horlait, Denis; Lebreton, Florent; Roussel, Pascal; Delahaye, Thibaud

    2013-12-16

    The structural evolution under (241)Am self-irradiation of U(1-x)Am(x)O(2±δ) transmutation fuels (with x ≤ 0.5) was studied by X-ray diffraction (XRD). Samples first underwent a preliminary heat treatment performed under a reducing atmosphere (Ar/H2(4%)) aiming to recover the previously accumulated structural defects. Over all measurements (carried out over up to a full year and for integrated doses up to 1.5 × 10(18) α-decay events·g(-1)), only fluorite U(1-x)Am(x)O(2±δ) solid solutions were observed. Within a few days after the end of the heat treatment, each of the five studied samples was slowly oxidized as a consequence of their move to air atmosphere, which is evidenced by XRD by an initial sharp decrease of the unit cell parameter. For the compounds with x ≤ 0.15, this oxidation occurred without any phase transitions, but for U0.6Am0.4O(2±δ) and U0.5Am0.5O(2±δ), this process is accompanied by a transition from a first fluorite solid solution to a second oxidized one, as the latter is thermodynamically stable in ambient conditions. In the meantime and after the oxidation process, (241)Am α self-irradiation caused a structural swelling up to ∼0.8 vol %, independently of the sample composition. The kinetic constants of swelling were also determined by regression of experimental data and are, as expected, dependent on x and thus on the dose rate. The normalization of these kinetic constants by sample α-activity, however, leads to very close swelling rates among the samples. Finally, evolutions of microstrain and crystallite size were also monitored, but for the considered dose rates and cumulated doses, α self-irradiation was found, within the limits of the diffractometer used, to have almost no impact on these characteristics. Microstrain was found to be influenced instead by the americium content in the materials (i.e., by the impurities associated with americium starting material and the increase of cationic charge heterogeneity with

  3. Investigation of factors affecting the quality of americium electroplating

    International Nuclear Information System (INIS)

    Trdin, M.; Benedik, L.; Samardžija, Z.; Pihlar, B.

    2012-01-01

    Four different electrolyte solutions were used in the electrodeposition of americium and their influences on the quality of the thin layer of deposited americium isotopes in combination with three different cathode disc materials were investigated. The relations between alpha spectral resolution and disc surface properties were established. - Highlights: ► Compared alpha spectra of americium radioisotopes obtained by electrodeposition. ► Various cathode materials and electrolyte solutions were used. ► Homogeneity and peak area resolution were investigated. ► Electron microscope images show surface structure of electrodeposited material.

  4. Measurement of plutonium and americium in molten salt residues

    International Nuclear Information System (INIS)

    Haas, F.X.; Lawless, J.L.; Herren, W.E.; Hughes, M.E.

    1979-01-01

    The measurement of plutonium and americium in molten salt residues using a segmented gamma-ray scanning device is described. This system was calibrated using artificially fabricated as well as process generated samples. All samples were calorimetered and the americium to plutonium content of the samples determined by gamma-ray spectroscopy. For the nine samples calorimetered thus far, no significant biases are present in the comparison of the segmented gamma-ray assay and the calorimetric assay. Estimated errors are of the order of 10 percent and is dependent on the americium to plutonium ratio determination

  5. Test plan for headspace gas concentration measurement and headspace ventilation rate measurement for DCRTs 241-A-244, 241-BX-244, 241-S-244, 241-TX-244

    International Nuclear Information System (INIS)

    Bauer, R.E.

    1998-01-01

    This test plan provides the directions to characterize the headspace gas concentrations and the headspace ventilation rate for double contained receiver tanks 241-A-244, 241-BX-244, 241-S-244, and 241-TX-244

  6. Behavior of americium in aqueous carbonate systems

    Energy Technology Data Exchange (ETDEWEB)

    Silva, R.J.

    1983-11-01

    The solubilities of crystalline Am(OH)/sub 3/ and AmOHCO/sub 3/ were measured at 25/sup 0/C in aqueous solutions of 0.1 M NaClO/sub 4/ by determination of the solution concentrations of Am. Prior to use in the measurements, the solid materials were characterized by their x-ray powder diffraction patterns. The solubility product quotients were calculated from the experimental data. The hydrolysis quotients of Am/sup 3 +/ were also estimated from the hydroxide solubility data. Using the thermodynamic data derived from these experiments and the recently reported formation constants for the Am/sup 3 +/ carbonate complexes, the solid phases and concentrations of solution species of americium in several aqueous carbonate systems were calculated using the computer code MINEQL. 20 references, 1 figure, 1 table.

  7. Higher Americium Oxidation State Research Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    Mincher, Bruce J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Law, Jack D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Goff, George S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Moyer, Bruce A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Lumetta, Gregg J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shehee, Thomas C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hobbs, David T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-12-18

    The partitioning of hexavalent Am from dissolved nuclear fuel requires the ability to efficiently oxidize Am(III) to Am(VI) and to maintain that oxidation state for a length of time sufficient to perform the separation. Several oxidants have been, or are being developed. Chemical oxidants include Ag-catalyzed ozone, Ag-catalyzed peroxydisulfate, Cu(III) periodate, and sodium bismuthate. Hexavalent americium has also now successfully been prepared by electrolysis, using functionalized electrodes. So-called auto-reduction rates of Am(VI) are sufficiently slow to allow for separations. However, for separations based on solvent extraction or ion exchange using organic resins, the high valence state must be maintained under the reducing conditions of the organic phase contact, and a holding oxidant is probably necessary. Until now, only Cu(III) periodate and sodium bismuthate oxidation have been successfully combined with solvent extraction separations. Bismuthate oxidation provided the higher DAm, since it acts as its own holding oxidant, and a successful hot test using centrifugal contactors was performed. For the other oxidants, Ag-catalyzed peroxydisulfate will not oxidize americium in nitric acid concentrations above 0.3 M, and it is not being further investigated. Peroxydisulfate in the absence of Ag catalysis is being used to prepare Am(V) in ion exchange work, discussed below. Preliminary work with Ag-catalyzed ozone has been unsuccessful for extractions of Am(VI) from 6.5 M HNO3, and only one attempt at extraction, also from 6.5 M HNO3, using the electrolytic oxidation has been attempted. However, this high acid concentration was based on the highest Am extraction efficiency using the bismuthate oxidant; which is only sparingly soluble, and thus the oxidation yield is based on bismuthate solubility. Lower acid concentrations may be sufficient with alternative oxidants and work with Ag-ozone, Cu(III) and electrolysis is on-going. Two non

  8. PROCESS FOR SEPARATING AMERICIUM AND CURIUM FROM RARE EARTH ELEMENTS

    Science.gov (United States)

    Baybarz, R.D.; Lloyd, M.H.

    1963-02-26

    This invention relates to methods of separating americium and curium values from rare earth values. In accordance with the invention americium, curium, and rare earth values are sorbed on an anion exchange resin. A major portion of the rare earth values are selectively stripped from the resin with a concentrated aqueous solution of lithium chloride, and americium, curium, and a minor portion of rare earth values are then stripped from the resin with a dilute aqueous solution of lithium chloride. The americium and curium values are further purified by increasing the concentration of lithium chloride in the solution to at least 8 molar and selectively extracting rare earth values from the resulting solution with a monoalkylphosphoric acid. (AEC)

  9. Sorption of americium and neptunium by deep-sea sediments

    International Nuclear Information System (INIS)

    Higgo, J.J.W.; Rees, L.V.C.; Cronan, D.S.

    1983-01-01

    The sorption and desorption of americium and neptunium by a wide range of deep-sea sediments from natural sea water at 4 0 C has been studied using a carefully controlled batch technique. All the sediments studied should form an excellent barrier to the migration of americium since distribution coefficients were uniformly greater than 10 5 and the sorption-desorption reaction may not be reversible. The sorption of neptunium was reversible and, except for one red clay, the distribution coefficients were greater than 10 3 for all the sediments investigated. Nevertheless the migration of neptunium should also be effectively retarded by most deep-sea sediments even under relatively oxidizing conditions. The neptunium in solution remained in the V oxidation state throughout the experiments. Under the experimental conditions used colloidal americium was trapped by the sediment and solubility did not seem to be the controlling factor in the desorption of americium. (Auth.)

  10. Americium/Curium Disposition Life Cycle Planning Study

    International Nuclear Information System (INIS)

    Jackson, W.N.; Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.

    1998-01-01

    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS)

  11. Comparative behavior of americium and plutonium in wastewater

    International Nuclear Information System (INIS)

    Tsvetaeva, N.E.; Filin, V.M.; Ragimov, T.K.; Rudaya, L.Y.; Shapiro, K.Y.; Shcherbakov, B.Y.

    1986-01-01

    This paper studies the behavior of trace americium and plutoniumin wastewater fed into purification systems. Activities of the elements were determined on a semiconductive alpha-ray spectrometer. the distributio nonuniformity, or heterogeneity, of americium and plutonium per unit volume of wastewater was determined quantitatively before and after passage through filter papers. The two elements were found to be in a colloidal or pseudocolloidal state in the original wastewater sample at pH 6. On acidifying the wastewater from pH 4 to 1 M nitric acid the americium passed quantitatively into the water phase but the most plutonium remained in the colloidal or pseudocolloidal state. the plutonium also passed quantitatively into the water phase in wastewater at a 1 M nitric acid acidity but only after a prolonged (12-day) hold. A knowledge of the heterogeneity of plutonium and americium in wastewaters made it possible to quickly distinguish their state, i.e., colloidal, pseudocolloidal, or in true solution

  12. Plutonium and Americium Geochemistry at Hanford: A Site Wide Review

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Felmy, Andrew R.

    2012-08-23

    This report was produced to provide a systematic review of the state-of-knowledge of plutonium and americium geochemistry at the Hanford Site. The report integrates existing knowledge of the subsurface migration behavior of plutonium and americium at the Hanford Site with available information in the scientific literature regarding the geochemistry of plutonium and americium in systems that are environmentally relevant to the Hanford Site. As a part of the report, key research needs are identified and prioritized, with the ultimate goal of developing a science-based capability to quantitatively assess risk at sites contaminated with plutonium and americium at the Hanford Site and the impact of remediation technologies and closure strategies.

  13. Routine radiochemical method for the determination of 90Sr, 238Pu, 239+240Pu, 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    Ageyev, V.A.; Sajeniouk, A.D.

    2005-01-01

    Routine analytical procedures have been developed for the reliable simultaneous determination of 90 Sr, 238 Pu, 239+240 Pu, 241 Am and 242-244 Cm, Chernobyl derived radioisotopes and fallout after nuclear weapon tests in a wide range of environmental samples: soil (100-200 g), sediments, aerosols, water and vegetation. This procedure has been applied to thousands of soil and sediment samples and hundreds of biological and water samples taken in the exclusive zone of Chernobyl NPP and different regions of Ukraine from 1989 to the present. After the sample has been properly prepared and isotopic tracers added, plutonium, americium and curium are precipitated with calcium oxalate and then lanthanum fluoride. Plutonium is separated from americium and curium by anion-exchange. Americium and curium are separated from rare earths by cation-exchange with gradient elute α-hydroxy-iso-butyric acid. During projects by AQCS IAEA 'Evaluation of Methods for 90 Sr in a Mineral Matrix' and 'Proficiency Test for 239 Pu, 241 Pu and 241 Am Measurement in a Mineral Matrix' accuracy and precision for 90 Sr, 239 Pu and 241 Am by present procedure was evaluated. Advantages, difficulties and limitations of the method are discussed. (author)

  14. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, Kyle Shelton [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-09-28

    These are a set of slides intended for an information session as part of recruiting activities at Brigham Young University. It gives an overview of aqueous chloride operations, specifically on plutonium and americium purification/recovery. This presentation details the steps taken perform these processes, from plutonium size reduction, dissolution, solvent extraction, oxalate precipitation, to calcination. For americium recovery, it details the CLEAR (chloride extraction and actinide recovery) Line, oxalate precipitation and calcination.

  15. Pyrochemical investigations into recovering plutonium from americium extraction salt residues

    International Nuclear Information System (INIS)

    Fife, K.W.; West, M.H.

    1987-05-01

    Progress into developing a pyrochemical technique for separating and recovering plutonium from spent americium extraction waste salts has concentrated on selective chemical reduction with lanthanum metal and calcium metal and on the solvent extraction of americium with calcium metal. Both techniques are effective for recovering plutonium from the waste salt, although neither appears suitable as a separation technique for recycling a plutonium stream back to mainline purification processes. 17 refs., 13 figs., 2 tabs

  16. Americium and plutonium in water, biota, and sediment from the central Oregon coast

    International Nuclear Information System (INIS)

    Nielsen, R.D.

    1982-06-01

    Plutonium-239, 240 and americium-241 were measured in the mussel Mytilus californianus from the region of Coos Bay, OR. The flesh of this species has a plutonium concentration of about 90 fCi/kg, and an Am-241/Pu-239, 240 ratio that is high relative to mixed fallout, ranging between two and three. Transuranic concentrations in sediment, unfiltered water, and filterable particulates were also measured; none of these materials has an Am/Pu ratio as greatly elevated as the mussels, and there is no apparent difference in the Am/Pu ratio of terrestrial runoff and coastal water. Sediment core profiles do not allow accumulation rates or depositional histories to be identified, but it does not appear that material characterized by a high Am/Pu ratio has ever been introduced to this estuary. Other bivalves (Tresus capax and Macoma nasuta) and a polychaete (Abarenicola sp.) do not have an elevated Am/Pu ratio, although the absolute activity of plutonium in the infaunal bivalves is roughly four times that in the mussels

  17. Plutonium and americium in Lake Michigan sediments

    International Nuclear Information System (INIS)

    Edgington, D.N.; Alberts, J.J.; Wahlgren, M.A.; Karttunen, J.O.; Reeve, C.A.

    1975-01-01

    The vertical distributions of 239 , 240 Pu, 238 Pu, and 137 Cs have been measured in sediment cores taken from Lake Michigan. Sections from a limited number of cores have been analyzed for 241 Am. In addition, grab samples from ten locations in the southern basin of the lake have been analyzed for phase distribution of 239 , 240 Pu using a sequential extraction technique. The results indicate that the 239 , 240 Pu, 238 Pu, and 137 Cs from weapons testing, and the 241 Am formed in situ are concentrated in the sediments. A comparison of the total deposition of 239 , 240 Pu and 137 Cs indicates that 137 Cs may be valuable as a monitor for 239 , 240 Pu deposition in the sediments. Values of the 238 Pu/ 239 , 240 Pu ratio are in agreement with values reported in Lake Ontario sediments (and Lake Michigan plankton) and show little variation with depth. 241 Am data support the concept of in situ production with little preferential mobility after formation. Studies of sedimentary phase distributions show that 239 , 240 Pu is associated with hydrous oxide phases which are chemically stable under the prevailing conditions in lake sediments. Since Lake Michigan sediments remain aerobic, relatively little 239 , 240 Pu is available for chemical mobilization from the hydrous oxide or organic phases present in the sediments

  18. Citric complexes, neodymium citrate and americium citrate

    International Nuclear Information System (INIS)

    Bouhlassa, Saidati.

    1981-06-01

    The behaviour of neodymium and americium has been studied in citric aqueous medium by two methods: solvent extraction of elements at tracer scale as chelates and by potentiometry. So range of pH and concentrations of elements and citric acid never reached before have been explored: 10 -7 -1 M, 10 -10 -3 , Csub(H3 Cit) -1 M, 1 2 O; AmCit, xH 2 O; NdCit 2 Co(NH 3 ) 6 , 8H 2 O; AmCit 2 Co(NH 3 ) 6 , xH 2 O and Nd 3 (OH) 4 (Cit) 4 NH 4 (Co(NH 3 ) 6 ) 2 , 18H 2 O. Their spectroscopic and crystallographic characteristics have been listed and studied. The nephelauxetic effect has been estimated from citric complexes as well as from citrates of these elements. The structure of the complexes in solution has been discussed on the basis of analysis of hypersensitive transition in different complexes [fr

  19. Americium-curium vitrification process development

    International Nuclear Information System (INIS)

    Fellinger, A.P.; Baich, M.A.; Hardy, B.J

    1999-01-01

    The successful demonstration of sequentially drying, calcining and vitrifying an oxalate slurry in the Drain Tube Test Stand (DTTS) vessel provided the process basis for testing on a larger scale in a cylindrical induction heated melter. A single processing issue, that of batch volume expansion, was encountered during the initial stage of testing. The increase in batch volume centered on a sintered frit cap and high temperature bubble formation. The formation of a sintered frit cap expansion was eliminated with the use of cullet. Volume expansions due to high temperature bubble formation (oxygen liberation from cerium reduction) were mitigated in the DTTS melter vessel through a vessel temperature profile that effectively separated the softening point of the glass cullet and the evolving oxygen from cerium reduction. An increased processing temperature of 1,470 C and a two hour hold time to find any remaining bubbles successfully reduced bubbles in the poured glass to an acceptable level. The success of the preliminary process demonstrations provided a workable process basis that was directly applicable to the newly installed Cylindrical Induction Melter (CIM) system, making the batch flowsheet the preferred option for vitrification of the americium-curium surrogate feed stream

  20. Sorption of 241Am onto montmorillonite, illite and hematite colloids

    International Nuclear Information System (INIS)

    Degueldre, C.; Ulrich, H.J.; Silby, H.

    1994-01-01

    Actinide sorption on colloids may be described as a competition between the formation of complexes in solution and the build up of surface complexes. The role of particle and of carbonate concentrations on the sorption/desorption of 241 Am on montmorillonite, illite and hematite colloids is investigated. Since the partition coefficient (K p ) values are virtually independent of the colloid concentrations, within the range 1 to 300 ppm, no significant aggregation takes place in the sorption/desorption experiment. At pH 8, a slight decrease of K p is observed if the concentration of total carbonate exceeds 10 -2 M. The formation of the carbonato- (and hydroxo-carbonato-) complexes in the solution competes with the formation of surface complexes on the colloids. A relationship between the sorption coefficient and the complexation of 241 Am in the solution has been found. This leads to the conclusion that, besides free americium cation, the hydroxo-, and carbonato- as well as the mixed hydroxo-carbonato-complexes are sorbed. Only when the tricarbonatocomplex [Am(CO 3 ) 3 ] 3- prevails (total carbonate concentration > 10 -2 M), a significant decrease of the distribution coefficient is observed. At pH 10 this decrease disappears because under these conditions the strong hydroxo-complexes dominate. A pragmatic and relatively simple application of surface complexation model describes the observed features. (orig.)

  1. Chemical compatibility of tank wastes in 241-C-106, 241-AY-101, and 241-AY-102

    International Nuclear Information System (INIS)

    Sederburg, J.P.

    1994-01-01

    This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank C-106 waste to tank AY-102 utilizing supernatant from AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation

  2. SPHERE: Irradiation of sphere-pac fuel of UPuO2−x containing 3% Americium

    International Nuclear Information System (INIS)

    D’Agata, E.; Hania, P.R.; McGinley, J.; Somers, J.; Sciolla, C.; Baas, P.J.; Kamer, S.; Okel, R.A.F.; Bobeldijk, I.; Delage, F.; Bejaoui, S.

    2014-01-01

    Highlights: • SPHERE is designed to check the behaviour of MADF sphere-pac concept. • MADF sphere-pac are compared with MADF pellet. • Swelling, helium release and restructuring behaviour will be the main output of the experiment. • An experiment to check sphere-pac MABB fuel behaviour is now under design. - Abstract: Americium is a strong contributor to the long term radiotoxicity of high activity nuclear waste. Transmutation by irradiation in nuclear reactors of long-lived nuclides like 241 Am is therefore an option for the reduction of radiotoxicity of waste packages to be stored in a repository. The SPHERE irradiation experiment is the latest of a series of European experiments on americium transmutation (e.g. EFTTRA-T4, EFTTRA-T4bis, HELIOS, MARIOS) performed in the HFR (High Flux Reactor). The SPHERE experiment is carried out in the framework of the 4-year project FAIRFUELS of the EURATOM 7th Framework Programme (FP7). During the past years of experimental works in the field of transmutation and tests of innovative nuclear fuels, the release or trapping of helium as well as helium induced fuel swelling have been shown to be the key issues for the design of Am-bearing targets. The main objective of the SPHERE experiment is to study the in-pile behaviour of fuel containing 3% of americium and to compare the behaviour of sphere-pac fuel to pellet fuel, in particular the role of microstructure and temperature on fission gas release (mainly He) and on fuel swelling. The SPHERE experiment is being irradiated since September 2013 in the HFR in Petten (The Netherlands) and is expected to be terminated in spring 2015. The experiment has been designed to last up to 18 reactor cycles (corresponding to 18 months) but may reach its target earlier. This paper discusses the rationale and objective of the SPHERE experiment and provides a general description of its design

  3. Beneficial uses of 241Am

    International Nuclear Information System (INIS)

    Mangeng, C.A.; Thayer, G.R.

    1984-05-01

    This report assesses the uses of 241 Am and the associated costs and supply. The study shows that 241 Am-fueled radioisotope thermoelectric generators in the range of 1 to 5 W electrical provide the most promising use of kilogram amounts of this isotope. For medical uses, where purity is essential, irradiation of 241 Am can produce 97% pure 238 Pu at $21,000/g. Using a pyro-metallurgical process, 241 Am could be recovered from molten salt extraction (MSE) residues at an estimated incremental cost of $83/g adjusted to reflect the disposal costs of waste products. This cost of recovery is less than the $300/g cost for disposal of the 241 Am contained in the MSE residues

  4. Chemical compatibility of tank wastes in tanks 241-C-106, 241-AY-101, and 241-AY-102

    International Nuclear Information System (INIS)

    Sederburg, J.P.

    1994-01-01

    This report documents the chemical compatibility of waste types within tanks 241-C-106, 241-AY-101, and 241-AY-102. This information was compiled to facilitate the transfer of tank 241-C-106 waste to tank 241-AY-102 utilizing supernatant from tank 241-AY-101 as the sluicing medium. This document justifies that no chemical compatibility safety issues currently understood, or theorized from thermodynamic modeling, will result from the intended sluice transfer operation

  5. Supported extractant membranes for americium and plutonium recovery

    International Nuclear Information System (INIS)

    Muscatello, A.C.; Navratil, J.D.; Killion, M.E.; Price, M.Y.

    1987-01-01

    Solid supported liquid membranes(SLM) are useful in transferring and concentrating americium and plutonium from nitrate solutions. Specifically, DHDECMP(dihexyl-N,N-diethylcarbamoylmethylphosphonate) supported on Accurel or Celgard polypropylene hollow fibers assembled in modular form transfers >95% of the americium and >70% of the plutonium from high nitrate (6.9 M), low acid (0.1 M) feeds into 0.25 M oxalic acid stripping solution. Membranes supporting TBP (tri-n-butylphosphate) also transfer these metal ions. Maximum permeabilities were observed to be 1 x 10 -3 cm sec -1 , similar to the values for other systems. The feed:strip volume ratio shows an inverse relationship to the fraction of metal ion transferred. Cation exchangers may be used to concentrate americium from the strip solution

  6. Synergistic extraction behaviour of americium from simulated acidic waste solutions

    International Nuclear Information System (INIS)

    Pathak, P.N.; Veeraraghavan, R.; Mohapatra, P.K.; Manchanda, V.K.

    1998-01-01

    The extraction behaviour of americium has been investigated with mixtures of 3-phenyl-4-benzoyl-5-isoxazolone (PBI) and oxodonors viz. tri-n-butyl phosphate (TBP), tri-n-octyl phosphine oxide (TOPO) and di-n-butyl octanamide (DBOA) using dodecane as the diluent from 1-6 M HNO 3 media. It is observed that D Am remains unaltered with PBI concentration (in the range 0.06-0.1 M) at 1.47 M TBP in the entire range of HNO 3 concentration. PBI and TBP in combination appears more promising compared to other synergistic systems. The possibility of using this mixture for americium removal from high level liquid waste solution has been explored. Extraction studies indicated that prior removal of uranium by 20% TBP in dodecane is helpful in the quantitative recovery of americium in three contacts. Effect of lanthanides on D Am is found to be marginal. (orig.)

  7. Plutonium, americium, 90Sr and 137Cs in bones of red fox (Vulpes vulpes) from Eastern Poland

    International Nuclear Information System (INIS)

    Mietelski, J.W.; Tomankiewicz, E.; Gaca, P.; Blazej, S.; Kitowski, I.

    2008-01-01

    90 Sr, 238,239+240 Pu, 241 Am and 137 Cs activity concentrations are presented in the jaw bones of red fox (Vulpes vulpes) from eastern Poland. The short description of the applied radiochemical method is presented. Activity concentrations for 90 Sr ranged between 2.2±0.7 and 41.4±4.7 Bq/kg (aw = ash weight). Average results for plutonium and americium are on the level of 10 mBq/kg (aw). No clear relationship was observed among the radionuclide concentrations. The samples analyzed do not show elevated contamination levels when compared with results of bones of small animals (rodent or insectivorous mammals) determined previously, so no accumulation of bone seeking isotopes on higher step of food-chain is concluded. (author)

  8. Method of isolation of traces of americium by using the +6 oxidation state properties

    International Nuclear Information System (INIS)

    Kwinta, Jean; Michel, Jean-Jacques

    1969-05-01

    The authors present a method to separate traces of americium from a solution containing fission products and actinides. This method comprises the following steps: firstly, the oxidation of americium at the +6 state by ammonium persulfate and carrying over of actinides and III and IV lanthanides by lanthanum fluoride; secondly, the reduction by hydrazine of the oxidized americium and carrying over of the reduced americium by lutetium fluoride; and thirdly, the americium-lutetium separation by selective extractions either with di 2 ethyl hexyl phosphoric acid, or by fractionated elution on an anionic resin column by a mixture of nitric acid and methanol [fr

  9. Determination of plutonium, americium and curium in the marine environment

    International Nuclear Information System (INIS)

    Grenaut, CLaude; Germain, Pierre; Miramand, Pierre.

    1982-01-01

    The method used in the Laboratory for plutonium, americium and curium determination in marine samples (water, sediments, animals, plants) is presented. It is a modification of a procedure based on adsorption on ion exchange resins developed by other authors. The preliminary preparation of the samples, the radiochemical procedures and electrodeposition are described so as to be used as a practical handbook [fr

  10. 1976 Hanford americium exposure incident: overview and perspective

    International Nuclear Information System (INIS)

    Thompson, R.C.

    1982-01-01

    Salient features of the 1976 Hanford americium exposure incident are discussed. Comparisons are made with previous human and animal exposure data, and conclusions drawn relative to the injured workman, to health physics practices, and to the adequacy of current exposure limits

  11. Thermodynamic systematics of oxides of americium, curium, and neighboring elements

    International Nuclear Information System (INIS)

    Morss, L.R.

    1984-01-01

    Recently-obtained calorimetric data on the sesquioxides and dioxides of americium and curium are summarized. These data are combined with other properties of the actinide elements to elucidate the stability relationships among these oxides and to predict the behavior of neighboring actinide oxides. 45 references, 4 figures, 5 tables

  12. A study of plutonium and americium concentrations in seaspray on the southern Scottish coast

    International Nuclear Information System (INIS)

    McKay, W.A.; Strange, L.; Walker, M.I.; Halliwell, C.M.

    1992-01-01

    Seaspray and seawater have been collected from the southern Scottish coast and, for comparison, Cumbria in northwest England during 1989 and 1991. The occurrence of sea-to-land transfer of the actinides plutonium and americium in seaspray was observed on these coasts using muslin screens (a semi-quantitative technique most efficient for collecting large spray droplets) and high volume conventional air samplers. The actinides and fine particulate in the spray were present in relatively higher concentrations than measured in the adjacent seawater, i.e. the spray was enriched in particulate actinides. The net efficiency of the muslim screens in collecting airborne plutonium isotopes and 241 Am generally appeared to be about 20%. A review of earlier published concentrations of 239+240 Pu and 241 Am measured in aerosol and deposition for over a year several tens of metres inland was carried out. This suggested that airborne activities are up to a factor of 5 times higher in Cumbria than southern Scotland. However, neither the new data collected in 1989 and 1991 nor this older data suggests any enhancement of seaspray actinide enrichment in southern Scotland compared to Cumbria. This finding contrasts with earlier, more limited, comparisons that have been carried out which suggested such a difference. There is clear evidence of considerable localised spatial and temporal variability in aerosol actinide enrichment over the beaches in both areas. Enrichments varies between 20 and 500 relative to the adjacent surf zone waters. However, the average enrichment in spray based on the continuous measurements made further inland is likely to be at the lower end of this range. (author)

  13. Observations on the redistribution of plutonium and americium in the Irish Sea sediments, 1978 to 1996: concentrations and inventories

    International Nuclear Information System (INIS)

    Kershaw, P.J.; Denoon, D.C.; Woodhead, D.S.

    1999-01-01

    The distribution of plutonium and americium in the sub-tidal sediments of the Irish Sea is described following major surveys in 1978, 1983, 1988 and 1995. Concentrations in surface sediments have declined near the source at Sellafield since 1988. Time-series of inter-tidal surface sediment concentrations are presented from 1977 onwards, revealing the importance of sediment reworking and transport in controlling the evolution of the environmental signal. The surface and near-surface sediments, in the eastern Irish Sea 'mud-patch', are generally well mixed with respect to Pu (α) and 241 Am distributions but show increasing variability with depth - up to 4 orders of magnitude in concentration. The inventories of 239,240 Pu and 241 Am in the sub-tidal sediments have been estimated and compared with the reported decay-corrected discharges. These amounted to 360 and 545 TBq respectively, in 1995, about 60% of the total decay-corrected discharge. Part of the unaccounted fraction may be due to unrepresentative sampling of the seabed. It is speculated that some tens of TBq of plutonium and 241 Am reside undetected in the large volumes of coarse-grained, sub-tidal and inter-tidal sediment which characterise much of the Irish Sea. This has been due to the inability of the available corers to penetrate to the base of contamination in these mobile sediments. Further observations are needed to verify and quantify the missing amount. A budget of plutonium-α and 241 Am has been estimated based on published observations in the three main compartments: water column, sub-tidal and inter-tidal sediments. This amounts to 460-540 TBq and 575-586 TBq respectively, or 64-75% and 60-61%, of the decay-corrected reported discharge. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  14. Reduction Rates for Higher Americium Oxidation States in Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Grimes, Travis Shane [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mincher, Bruce Jay [Idaho National Lab. (INL), Idaho Falls, ID (United States); Schmitt, Nicholas C [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-30

    The stability of hexavalent americium was measured using multiple americium concentrations and nitric acid concentrations after contact with the strong oxidant sodium bismuthate. Contrary to our hypotheses Am(VI) was not reduced faster at higher americium concentrations, and the reduction was only zero-order at short time scales. Attempts to model the reduction kinetics using zero order kinetic models showed Am(VI) reduction in nitric acid is more complex than the autoreduction processes reported by others in perchloric acid. The classical zero-order reduction of Am(VI) was found here only for short times on the order of a few hours. We did show that the rate of Am(V) production was less than the rate of Am(VI) reduction, indicating that some Am(VI) undergoes two electron-reduction to Am(IV). We also monitored the Am(VI) reduction in contact with the organic diluent dodecane. A direct comparison of these results with those in the absence of the organic diluent showed the reduction rates for Am(VI) were not statistically different for both systems. Additional americium oxidations conducted in the presence of Ce(IV)/Ce(III) ions showed that Am(VI) is reduced without the typical growth of Am(V) observed in the systems sans Ce ion. This was an interesting result which suggests a potential new reduction/oxidation pathway for Am in the presence of Ce; however, these results were very preliminary, and will require additional experiments to understand the mechanism by which this occurs. Overall, these studies have shown that hexavalent americium is fundamentally stable enough in nitric acid to run a separations process. However, the complicated nature of the reduction pathways based on the system components is far from being rigorously understood.

  15. Incorporation of plutonium, americium and curium into the Irish Sea seabed by biological activity

    Energy Technology Data Exchange (ETDEWEB)

    Kershaw, P J; Swift, D J; Pentreath, R J; Lovett, M B

    1984-12-01

    Bioturbation was considered as a potentially significant mechanism for the incorporation of long-lived radionuclides into the seabed and in particular the activities of a large echiuran Maximulleria lankesteri. Radionuclides of the transuranium elements plutonium, americium and cirium are discharged into the Irish Sea under authorization as part of the low-level liquid effluent from the British Nuclear Fuels plc reprocessing plant at Sellafield, Cumbria, England. The distribution of Pu-239, 240, Pu-238, Am-241, Cm-244 and Cm-242 concentrations and the Pu-239, 240/Pu-238 quotient in samples taken in April and May 1983 from the sediment surface, burrow linings, sediments adjacent to burrows, and the gut contents and body of a large M. lankesteri clearly indicate that bioturbation is responsible, at least in part, for the incorporation of these radionuclides to depths of up to 140 cm. This area of sediments represents a significant present-day sink, but the permanence of this sink and the likelihood that radioactivity will be remobilized and be returned to man, depends on a large number of factors. 15 references, 18 figures.

  16. Decision Document for the Low Activity Waste Retrieval Strategy for Tanks 241-AN-103 and 241-AN-104 and 241-AN-105 and 241-AW-101

    International Nuclear Information System (INIS)

    RASMUSSEN, O.R.

    2000-01-01

    This report documents the preferred approach (retrieval strategy) to prepare and transfer waste from low-activity waste source tanks containing soluble solids (Tanks 241-AN-103, 241-AN-104, 241-AN-105 and 241-AW-101) to the vitrification plant. Several opportunities to further refine the selected retrieval strategy were identified; these were recommended for follow-on studies

  17. 24 CFR 241.1005 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Insurance for Equity Loans and Acquisition Loans-Eligibility Requirements § 241.1005 Definitions. (a) All of the definitions of § 241.1 apply to equity and... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.1005 Section 241...

  18. 24 CFR 241.260 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations § 241.260 Definitions. All of the definitions contained in § 241.1 shall apply to this subpart. In addition, the term contract... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.260 Section 241...

  19. 1976 Hanford Americium exposure incident: hematologic effects

    International Nuclear Information System (INIS)

    Ragan, H.A.; Mahaffey, J.A.; Breitenstein, B.D.

    1982-05-01

    Hematologic evaluation of an individual with an initial systemic body burden of approx. 200 μCi 241 Am revealed a significant (P < 0.01) reduction of total leukocytes, neutrophils, and lymphocytes. This effect on total leukocytes and neutrophils was evident approx. 30 days after exposure, appeared to stabilize at about 3 months after exposure, and remained at this lower level thorugh a 52-months observation period. The effect on lymphocytes was apparent by 3 days after exposure, stabilizing at approx. 50% of pre-exposure values for about 7 months, with a return to pre-exposure levels in the following 4 y. There was a progressive and significant (P < 0.001) decline in platelet counts during the 52-months postexposure period. The pattern of response in erythrocyte parameters was complex. Immediately after the accident, these values were less than the pre-exposure mean level; they gradually increased (P < 0.001) for approx. 2 y and then began a progressive decline (P < 0.001)

  20. Plutonium and americium in the Rhone sediment

    International Nuclear Information System (INIS)

    Foulquier, L.; Jourd'Heuil, L.; Lambrechts, A.; Morello, M.; Miara, P.; Pally, M.

    1996-01-01

    238,239,240 Pu and 241 Am are measured in sediments from river ecosystems. These artificial radioisotopes are related to military and civilian activities. Small concentrations require an original radiochemical process followed by alpha spectrometry. 104 analysis on sediment from the Rhone have been taken since 1989. The transuranic elements present in sediment from the Rhone originate principally from the atmospheric nuclear tests carried out between 1945 and 1975, fallout from which spread some 1.2 x 10 16 Bq of 239 , 240 Pu and 2.9 x 10 13 Bq of 238 Pu into the atmosphere, 80 % of which was in the Northern Hemisphere (1). Various accidents have also released transuranic elements into the environment. Such was the case with the SNAP-9A satellite, which burned up in April 1964 and released 5.1 x 10 14 Bq of 238 Pu, 40 % of that in the Northern Hemisphere. Fallout from the Chernobyl accident containing α emitters was negligible in France. Irradiated-fuel reprocessing plants (La Hague and Marcoule) are authorized to release a emitters in their liquid effluent. The Marcoule plant is authorized to release 150 GBq per year into the Rhone. In 1991 the Marcoule facility renovated its liquid effluent treatment station. The activities released diminished considerably. (author)

  1. Intake and subsequent fate of a ceramic particle containing 2. 85 microCi /sup 241/Am: a case study

    Energy Technology Data Exchange (ETDEWEB)

    Smith, L R; Sullivan, P A; Laferriere, J; Cumming, E; Demis, D

    1983-04-01

    Intake of /sup 241/Am was reported in a young female technologist. External monitoring, whole body counting, urinalysis and fecal analysis were performed to determine the subsequent fate of the contaminant. Five days later, more than 99.5% of the radioactivity was voided in a fecal sample. A single particle, containing 2.85 microCi of /sup 241/AmO2 incorporated in a ceramic matrix, was isolated from the fecal sample. Brief descriptions of the radioanalytical results and dosimetry implications are presented. A shadow shield whole body counter was conveniently used to make an early estimate of the intake. This initial estimate enabled staff to decide that it was not necessary to artifically remove the contaminant. It was estimated that the lower large intestine was the organ which received the highest dose due to the passage of the ceramic particle. Systemic uptake of /sup 241/JAm was indicated by urinalysis. The fractional transfer of /sup 241/Am from the GI tract to the blood was estimated to be less than 6 X 10(-5). This maximum estimate is limited by the MDA of the analytical procedures used. The fractional transfer of the /sup 241/Am from the GI tract to blood in this case is about an order of magnitude less than recent ICRP recommendations for ''all compounds of americium''.

  2. Contribution to the study of higher valency states of americium

    International Nuclear Information System (INIS)

    Langlet, Jean.

    1976-01-01

    Study of the chemistry of the higher valencies of americium in aqueous solutions and especially the autoreduction phenomenon. First a purification method of americium solutions is studied by precipitation, solvent extraction and ion exchange chromatography. Studies of higher valency states chemical properties are disturbed by the autoreduction phenomenon changing Am VI and Am V in Am III more stable. Stabilization of higher valency states, characterized by a steady concentration of Am VI in solution, can be done by complexation of Am VI and Am V ions or by a protecting effect of foreign ions. The original medium used has a complexing effect by SO 4 2- ions and a protecting effect by the system S 2 O 8 2- -Ag + consuming H 2 O 2 main reducing agent produced by water radiolysis. These effects are shown by the study of Am VI in acid and basic solutions. A mechanism of the stabilization effect is given [fr

  3. Research program on development of advanced treatment technology for americium-containing aqueous waste in NUCEF

    Energy Technology Data Exchange (ETDEWEB)

    Mineo, Hideaki; Matsumura, Tatsuro; Tsubata, Yasuhiro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1996-10-01

    A research program was prepared on the development of an advanced treatment process for the americium-containing concentrated aqueous waste in NUCEF, than allows americium recovery for the reuse and the reduction of TRU waste generation. A preliminary analysis was conducted on the separation requirements based on the components estimated for the waste. An R and D strategy was proposed from the view to reduce TRU waste generated in the processing that the highest priority is given on the control of TRU leakage such as americium into the effluent stream after americium recovery and the minimization of salt used in the separation over the decontamination of impurities from americium. The extraction chromatographic method was selected as a candidate technology for americium separation under the principle to use reagents that are functional in acidic conditions such as bidentate extractants of DHEDECMP, CMPO or diamides, considering the larger flexibilities in process modification and possible multi-component separation with compact equipment and the past achievements on the recovery of kg quantities of americium. Major R and D items extracted are screening and evaluation of extractants for americium and plutonium, optimization of separation conditions, selection of denitration method, equipment developments and development of solidification methods of discarded americium after reuse and of various kinds of separation residues. In order to cope these items, four steps of R and D program were proposed, i.e., fundamental experiment in beaker-scale on screening and evaluation of extractants, flowsheet study in bench-scale using simulated and small amount of americium aqueous waste solution to evaluate candidate process, americium recovery test in iron-shielded cell to be installed in NUCEF. It is objected to make recovery of 100g orders of americium used for research on fundamental TRU fuel properties. (J.P.N.)

  4. Separation of Americium from plutonium, Annex 3; Prilog 3: Odvajanje amercijuma od plutonijuma

    Energy Technology Data Exchange (ETDEWEB)

    Cvjeticanin, D; Milic, N; Janicijevic, P; Ratkovic, S [Institute of Nuclear Sciences Boris Kidric, Laboratorija za visoku aktivnost, Vinca, Beograd (Serbia and Montenegro)

    1963-12-15

    Since there was the possibility of working with plutonium milligram quantities, it was possible to study plutonium with contents of americium, which was expected in the about two years old plutonium solutions. Method for separation of the micro quantities of americium and plutonium was needed as well as a multichannel alpha-pulse analyzer. Method for separation of americium from plutonium by thenol trifluoro-acetone (TTA) and anion exchange was adopted.

  5. Transfer of environmental plutonium and americium across the human gut

    International Nuclear Information System (INIS)

    Hunt, G.J.; Leonard, D.R.P.; Lovett, M.B.

    1989-01-01

    Following the ingestion of winkles obtained from a coastal area near Sellafield nuclear reprocessing plant, a group of volunteers provided urine for the next 7 days to be analysed for plutonium and americium. From this, estimates of the intake and gut transfer factors for these isotopes were determined. Preliminary estimates of gut transfer factors from a previous study by the same authors were then re-interpreted and combined with the results from the present study. (UK)

  6. Ingestion Pathway Transfer Factors for Plutonium and Americium

    International Nuclear Information System (INIS)

    Blanchard, A.

    1999-01-01

    Overall transfer factors for major ingestion pathways are derived for plutonium and americium. These transfer factors relate the radionuclide concentration in a given foodstuff to deposition on the soil. Equations describing basic relationships consistent with Regulatory Guide 1.109 are followed. Updated values and coefficients from IAEA Technical Reports Series No. 364 are used when a available. Preference is given to using factors specific to the Savannah River Site

  7. Extraction separation of americium and curium. A review

    International Nuclear Information System (INIS)

    Petrzilova, H.

    1976-11-01

    A survey is given of extraction systems suitable for transplutonium element separation and preparation as well as for the practical application of their nuclear properties. Methods are discussed in detail of separating the actinide and the lanthanide fractions from fission and corrosion products and of separating americium from curium. The description is completed with flowsheets showing the separation of transplutonium elements from irradiated targets and waste solutions after spent fuel reprocessing. (L.K.)

  8. Supercritical Fluid Extraction of Plutonium and Americium from Soil

    International Nuclear Information System (INIS)

    Fox, R.V.; Mincher, B.J.

    2002-01-01

    Supercritical fluid extraction (SFE) of plutonium and americium from soil was successfully demonstrated using supercritical fluid carbon dioxide solvent augmented with organophosphorus and beta-diketone complexants. Spiked Idaho soils were chemically and radiologically characterized, then extracted with supercritical fluid carbon dioxide at 2,900 psi and 65 C containing varying concentrations of tributyl phosphate (TBP) and thenoyltrifluoroacetone (TTA). A single 45 minute SFE with 2.7 mol% TBP and 3.2 mol% TTA provided as much as 88% ± 6.0 extraction of americium and 69% ± 5.0 extraction of plutonium. Use of 5.3 mol% TBP with 6.8 mol% of the more acidic beta-diketone hexafluoroacetylacetone (HFA) provided 95% ± 3.0 extraction of americium and 83% ± 5.0 extraction of plutonium in a single 45 minute SFE at 3,750 psi and 95 C. Sequential chemical extraction techniques were used to chemically characterize soil partitioning of plutonium and americium in pre-SFE soil samples. Sequential chemical extraction techniques demonstrated that spiked plutonium resides primarily (76.6%) in the sesquioxide fraction with minor amounts being absorbed by the oxidizable fraction (10.6%) and residual fractions (12.8%). Post-SFE soils subjected to sequential chemical extraction characterization demonstrated that 97% of the oxidizable, 78% of the sesquioxide and 80% of the residual plutonium could be removed using SFE. These preliminary results show that SFE may be an effective solvent extraction technique for removal of actinide contaminants from soil

  9. Extraction of americium from acid aqueous solutions by diethyl-2-hexyl-pyro-phosphoric acid

    International Nuclear Information System (INIS)

    Guillaume, Bernard

    1971-02-01

    After having outlined the interesting properties of americium and the difficulties of its recovery, the author reports the study of the mechanism of extraction of americium from acid aqueous solutions by using the diethyl-2hexyl-pyro-phosphoric acid. Several aspects are thus discussed: influence of concentration of H 2 DEHPP, influence of the acidity of the aqueous phase, saturation of extracting agent, influence of the diluting agent, complexing of americium, influence of other cations. In a second part, the author reports the application to the recovery of americium from effluents, and discusses the obtained results

  10. Gut uptake factors for plutonium, americium and curium

    International Nuclear Information System (INIS)

    Harrison, J.D.

    1982-01-01

    Data on estimates of the absorption of plutonium, americium and curium from the human gut based on measurements of uptake in other mammalian species are reviewed. It is proposed that for all adult members of the public ingesting low concentrations of plutonium in food and water, 0.05% would be an appropriate value of absorption except when the conditions of exposure are known and a lower value can be justified. For dietary intakes of americium and curium, the available data do not warrant a change from the ICRP value of 0.05%. For newborn children ingesting americium, curium and soluble forms of plutonium, a value of 1% absorption is proposed for the first 3 months of life during which the infant is maintained on a milk diet. It is proposed that a value of 0.5% should be used for the first year of life to take account of the gradual maturation of the gut. In considering the ingestion of insoluble oxides of plutonium by infants, it is proposed that absorption is taken as 0.1% for the first 3 months and 0.05% for the first year. (author)

  11. On the structure of thorium and americium adenosine triphosphate complexes

    International Nuclear Information System (INIS)

    Mostapha, Sarah; Berton, Laurence; Boubals, Nathalie; Zorz, Nicole; Charbonnel, Marie-Christine; Fontaine-Vive, Fabien; Den Auwer, Christophe; Solari, Pier Lorenzo

    2014-01-01

    The actinides are chemical poisons and radiological hazards. One challenge to better appraise their toxicity and develop countermeasures in case of exposure of living organisms is to better assess pathways of contamination. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, nucleotides and in particular adenosine triphosphate nucleotide (ATP) may be considered critical target building blocks for actinides. Combinations of spectroscopic techniques (Fourier transformed Infra Red [FTIR], Electro-spray Ionization Mass Spectrometry [ESI-MS], and Extended X-ray Absorption Fine Structure [EXAFS]) with quantum chemical calculations have been implemented in order to assess the actinides coordination arrangement with ATP. We describe and compare herein the interaction of ATP with thorium and americium; thorium(IV) as a representative of actinide(IV) like plutonium(IV) and americium(III) as a representative of all heavier actinides. In the case of thorium, an insoluble complex is readily formed. In the case of americium, a behavior identical to that described previously for lutetium has been observed with insoluble and soluble complexes. The comparative study of ATP complexation with Th(IV) and Am(III) shows their ability to form insoluble complexes for which a structural model has been proposed by analogy with previously described Lu(III) complexes. (authors)

  12. On the structure of thorium and americium adenosine triphosphate complexes.

    Science.gov (United States)

    Mostapha, Sarah; Fontaine-Vive, Fabien; Berthon, Laurence; Boubals, Nathalie; Zorz, Nicole; Solari, Pier Lorenzo; Charbonnel, Marie Christine; Den Auwer, Christophe

    2014-11-01

    The actinides are chemical poisons and radiological hazards. One challenge to better appraise their toxicity and develop countermeasures in case of exposure of living organisms is to better assess pathways of contamination. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, nucleotides and in particular adenosine triphosphate nucleotide (ATP) may be considered critical target building blocks for actinides. Combinations of spectroscopic techniques (Fourier transformed Infra Red [FTIR], Electrospray Ionization Mass Spectrometry [ESI-MS], and Extended X-ray Absorption Fine Structure [EXAFS]) with quantum chemical calculations have been implemented in order to assess the actinides coordination arrangement with ATP. We describe and compare herein the interaction of ATP with thorium and americium; thorium(IV) as a representative of actinide(IV) like plutonium(IV) and americium(III) as a representative of all heavier actinides. In the case of thorium, an insoluble complex is readily formed. In the case of americium, a behavior identical to that described previously for lutetium has been observed with insoluble and soluble complexes. The comparative study of ATP complexation with Th(IV) and Am(III) shows their ability to form insoluble complexes for which a structural model has been proposed by analogy with previously described Lu(III) complexes.

  13. 1976 Hanford americium-exposure incident: accident description

    International Nuclear Information System (INIS)

    McMurray, B.J.

    1982-01-01

    An accident is described, involving the explosion of an ion-exchange column containing about 100 g of 241 Am. A chemical operator was injured in this accident, receiving acid burns and superficial cuts on the upper part of his body. From 1 to 5 curies of 241 Am is estimated to have been deposited on the injured worker and on his clothing

  14. Determination of 238Pu, 239+240Pu, 241Pu and 241Am in radioactive waste from IPEN reactor

    International Nuclear Information System (INIS)

    Geraldo, Bianca; Taddei, Maria Helena T.; Cheberle, Sandra M.; Ferreira, Marcelo T.

    2011-01-01

    Ion exchange resin is a common type of radioactive waste arising from treatment of coolant water of the main circuit of research and nuclear power reactors. This waste contains high concentrations of fission and activation products. The management of this waste includes its characterization in order to determine and quantify specific radionuclides including those known as difficult-to-measure radionuclides (RDM). The analysis of RDMs generally involves expensive and time-consuming complex radiochemical analysis for purification and separation of the radionuclides. The objective of this work is to show an easy methodology for quantifying plutonium and americium isotopes in spent ion exchange resin, used for purification of the cooling water of the IEA-R1 reactor located at the Nuclear and Energy Research Institute, IPEN-CNEN/SP. The resins were destroyed by acid digestion, followed by purification and separation of the Pu and Am isotopes with anionic and chromatographic resins. 238 Pu, 239 + 24 '0Pu, and 24 '1Am isotopes were analyzed in an alpha spectrometer equipped with surface barrier detectors. 241 Pu isotope was analyzed by liquid scintillation counting. Chemical recovery yield ranged from 73 to 98% for Pu and 77 to 98% for Am, demonstrating that the methodology is suitable for identification and quantification of the isotopes studied in spent resins. (author)

  15. Bioaccumulation, distribution, and dose of 241Am, 244Cm, and 238Pu in developing fish embryos

    International Nuclear Information System (INIS)

    Till, J.E.; Frank, M.L.

    1977-01-01

    The dose from several actinide elements to a sensitive stage in the development of one type of aquatic biota, the fish egg, was assessed. An investigation was made of the uptake and distribution of 241 Am, 244 Cm and 238 Pu by developing embryos of fish. Eggs from ripe carp, Cyprinos carpio, that had been spawned in the laboratory were placed in dishes containing 241 Am(III)- 244 Cm(III)-, or 238 Pu(IV)-citrate in solution at an activity concentration of approximately 10 -3 μCi/ml. Samples of eggs were taken at seven intervals during the 72-hour period of embryogenesis. Egg contents were separated from the membrane prior to analysis to quantify the activity that penetrated the chorion. Autoradiographs of 16-μm thick egg sections confirmed that alpha radioactivity was present in the egg contents and permitted the distribution of activity to be determined. Concentration factors were calculated based on activity ratios for the egg contents (excluding the chorion) over the development period. Maximum concentration factors occurred at hatching and were found to be 25, 40 and 3 for 241 Am, 244 Cm and 238 Pu, respectively. Collectively, these data were used to estimate the dose from americium, curium and plutonium in natural ecosystems to developing fish eggs which have similar embryological characteristics as carp

  16. Critical mass calculations for 241Am, 242mAm and 243Am

    International Nuclear Information System (INIS)

    Dias, Hemanth; Tancock, Nigel; Clayton, Angela

    2003-01-01

    Criticality mass calculations are reported for 241 Am, 242m Am and 243 Am using the MONK and MCNP computer codes with the UKNDL, JEF-2.2, ENDF/B-VI and JENDL-3.2 nuclear data libraries. Results are reported for spheres of americium metal and dioxide in bare, water reflected and steel reflected systems. Comparison of results led to the identification of a serious inconsistency in the 241 Am ENDF/B-VI DICE library used by MONK - this demonstrates the importance of using different codes to verify critical mass calculations. The 241 Am critical mass estimates obtained using UKNDL and ENDF/B-VI show good agreement with experimentally inferred data, whilst both JEF-2.2 and JENDL-3.2 produce higher estimates of critical mass. The computed critical mass estimates for 242m Am obtained using ENDF/B-VI are lower than the results produced using the other nuclear data libraries - the ENDF/B-VI fission cross-section for 242m Am is significantly higher than the other evaluations in the fast region and is not supported by recent experimental data. There is wide variation in the computed 243 Am critical mass estimates suggesting that there is still considerable uncertainty in the 243 Am nuclear data. (author)

  17. A radiochemical procedure for a low-level measurement of ''241 Am in environmental samples using a supported functional organo phosphorus extractant

    International Nuclear Information System (INIS)

    Gasco, C.; Anton, M.A.; Alvarez, A.; Navarro, N.; Salvador, S.

    1994-01-01

    The transuranides analysis in environmental samples is carried out by CIEMAT using standardized methods based on sequential separation with ionic-exchange resins. The americium fraction is purified through a two-layer ion exchange column and lately in an anion-exchange column in nitric acid methanol medium. The technique is time-consuming and the results are not completely satisfactory (low recovery and loss of alpha-resolution) for some samples. The chemical compound CMPO (octyl(phenyl).N,N-diisobutyl carbomoylmethyiphosphine oxide) dissolved in TPB (tributyl phosphate) and supported on an inert substrate has been tested directly for ''241 Am analysis by a large number of laboratories. A new method that combines both procedures has been developed. The details of the improved procedure are described in this paper. The advantages of its application to environmental samples (urine, faeces and sediments) are discussed. The utilization of standard, with americium certified concentrations confirms the reliability of our measurements

  18. A radiochemical procedure for a low-level measurement of ''241Am in environmental samples using a supported functional organo phosphorus extractant

    International Nuclear Information System (INIS)

    Gasco, C.; Anton, M. P.; Alvarez, A.; Navarro, N.; Salvador, S.

    1994-01-01

    The transuranides analysis in environmental samples is carried out by CIEMAT using standardized methods based on sequential separation with ionic-exchange resins. The americium fraction is purified through a two-layer ion exchange column and lately in an anion-exchange column in nitric acid methanol medium. The technique is time consuming and the results are not completely satisfactory (low recovery and loss of a-resolution) for some samples. The chemical compound CMPO (octyl(phenyl)-N,N-diisobutyl carbomoylmethyiphosphine oxide) dissolved in TPB (tributyl phosphate) and supported on an inert substrate has been tested directly for ''241Am analysis by a large number of laboratories. A new method that combines both procedures has been developed. The details of the improved procedure are described in this paper. The advantages of its application to environmental samples (urine, faeces and sediments) are discussed. The utilization of standard samples, with americium certified concentrations confirms the reliability of our measurements. (Author) 8 refs

  19. 46 CFR 108.241 - Visual aids.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 4 2010-10-01 2010-10-01 false Visual aids. 108.241 Section 108.241 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.241 Visual aids. (a) Each helicopter deck must— (1...

  20. 12 CFR 19.241 - Scope.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Scope. 19.241 Section 19.241 Banks and Banking..., and Debarment of Accountants From Performing Audit Services § 19.241 Scope. This subpart, which... their accounting firms from performing independent audit and attestation services required by section 36...

  1. 43 CFR 24.1 - Introduction.

    Science.gov (United States)

    2010-10-01

    ... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Introduction. 24.1 Section 24.1 Public Lands: Interior Office of the Secretary of the Interior DEPARTMENT OF THE INTERIOR FISH AND WILDLIFE POLICY: STATE-FEDERAL RELATIONSHIPS § 24.1 Introduction. (a) In 1970, the Secretary of the Interior...

  2. 49 CFR 241.17 - Preemptive effect.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Preemptive effect. 241.17 Section 241.17 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... OPERATIONS § 241.17 Preemptive effect. Under 49 U.S.C. 20106, the regulations in this part preempt any State...

  3. 24 CFR 241.1235 - Cross default.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Cross default. 241.1235 Section 241... Rights and Obligations § 241.1235 Cross default. In the event the borrower commits a default under a prior recorded insured mortgage and the holder thereof initiates a foreclosure proceeding, said default...

  4. 12 CFR 335.241 - Unlisted trading.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Unlisted trading. 335.241 Section 335.241 Banks and Banking FEDERAL DEPOSIT INSURANCE CORPORATION REGULATIONS AND STATEMENTS OF GENERAL POLICY SECURITIES OF NONMEMBER INSURED BANKS § 335.241 Unlisted trading. The provisions of the applicable and...

  5. 42 CFR 413.241 - Pharmacy arrangements.

    Science.gov (United States)

    2010-10-01

    ... 42 Public Health 2 2010-10-01 2010-10-01 false Pharmacy arrangements. 413.241 Section 413.241... Disease (ESRD) Services and Organ Procurement Costs § 413.241 Pharmacy arrangements. Effective January 1, 2011, an ESRD facility that enters into an arrangement with a pharmacy to furnish renal dialysis...

  6. 7 CFR 1220.241 - Reports.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 10 2010-01-01 2010-01-01 false Reports. 1220.241 Section 1220.241 Agriculture... CONSUMER INFORMATION Soybean Promotion and Research Order Reports, Books, and Records § 1220.241 Reports... to report to the Board periodically such information as may be required by the regulations...

  7. 24 CFR 241.800 - Definitions.

    Science.gov (United States)

    2010-04-01

    ... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects Without a HUD-Insured or HUD-Held Mortgage § 241.800 Definitions. All of the definitions contained in... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 241.800 Section 241...

  8. 40 CFR 436.241 - Specialized definitions.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Specialized definitions. 436.241 Section 436.241 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS MINERAL MINING AND PROCESSING POINT SOURCE CATEGORY Diatomite Subcategory § 436.241...

  9. 10 CFR 600.241 - Financial reporting.

    Science.gov (United States)

    2010-01-01

    ... 10 Energy 4 2010-01-01 2010-01-01 false Financial reporting. 600.241 Section 600.241 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative....241 Financial reporting. (a) General. (1) Except as provided in paragraphs (a) (2) and (5) of this...

  10. Twelve years of follow up of cases with old 241Am internal contamination.

    Science.gov (United States)

    Malátová, Irena; Vrba, Tomás; Becková, Vera; Pospísilová, Helena

    2010-10-01

    A group of workers internally contaminated with Am have been followed for about 12 years. The source of contamination was AmO2 powder used for production of AmBe neutron sources and other applications. The production of some radionuclide sources included chemical treatment of the original material, which transformed the americium into the nitrate, but mostly powder metallurgy was used for production of sources for smoke detectors. In vivo measurement of the workers was performed with two LEGe detectors placed near the head of the measured person. Calibration was performed with four different physical skull phantoms of different origin and a voxel phantom with Monte Carlo simulation, which was developed to fit the head sizes of individual persons. Samples of urine and feces were analyzed by means of radiochemical separation followed by alpha-spectrometry. Separation of 241Am from mineralized excreta was performed by combined anion exchange and extraction chromatographic techniques. As a tracer, 243Am was used. When the measured data (83 data on skeletal activity, activity in 389 bioassay samples) were compared with International Commission on Radiological Protection's and Leggett's biokinetic models of americium, it was found that in most cases, after more than 15 y since the intake, the excretion rate was lower (or skeletal activity higher) than predicted. On the other hand, the ratio of excreted activity in urine and feces agrees well with model predictions.

  11. Design of Alpha Voltaic Power Source Using Americium 241 (241Am) and Diamond with a Power Density of 10 mW/cm3

    Science.gov (United States)

    2017-10-19

    Carroll JJ , Bayne S. Alpha Schottky junction energy source. SPIE; 2012. 29. Summers GP, Burke EA, Shapiro P, Messenger SR, Walters RJ. Damage...Elec Dev. 1694;11(1):2–8. 38. Loferski JJ , Rappaport P. Radiation damage in Ge and Si detected by carrier lifetime changes: damage thresholds. Phys

  12. Hanford Single-Shell Tank Leak Causes and Locations - 241-BY and 241-TY Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L.; Harlow, Donald G.

    2014-09-04

    This document identifies 241-BY Tank Farm (BY Farm) and 241-TY Tank Farm (TY Farm) lead causes and locations for the 100 series leaking tanks (241-BY-103, 241-TY-103, 241-TY-104, 241-TY-105 and 241-TY-106) identified in RPP-RPT-43704, Hanford BY Farm Leak Assessments Report, and in RPP-RPT-42296, Hanford TY Farm Leak Assessments Report. This document satisfies the BY and TY Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  13. In situ determination of 241Am on Enewetak Atoll. Date of survey: July 1977-December 1979

    International Nuclear Information System (INIS)

    Tipton, W.J.; Fritzsche, A.E.; Jaffe, R.J.; Villaire, A.E.

    1981-11-01

    An in situ gamma ray spectrometer system was operated at Enewetak Atoll from July 1977 to December 1979 in support of the Enewetak Cleanup Project. The system employed a high purity germanium planar detector suspended at a height of 7.4 m above ground. Conversion factors were established to relate measured photopeak count rate data to source concentration in the soil. Data obtained for 241 Am, together with plutonium-to-americium ratios obtained from soil sample analyses, were used to establish area-averaged surface (0 to 3 cm) transuranic concentration values. In areas which exceeded cleanup criteria, measurements were made in an iterative fashion to guide soil removal until levels were reduced below the cleanup criteria. Final measurements made after soil removal had been completed were used to document remaining surface transuranic concentration values and to establish external exposure rate levels due to 137 Cs and 60 Co

  14. Concentrations of plutonium and americium in plankton from the western Mediterranean Sea.

    Science.gov (United States)

    Sanchez-Cabeza, Joan-Albert; Merino, Juan; Masqué, Pere; Mitchell, Peter I; Vintró, L León; Schell, William R; Cross, Lluïsa; Calbet, Albert

    2003-07-20

    Understanding the transfer of radionuclides through the food chain leading to man and in particular, the uptake of transuranic nuclides by plankton, is basic to assess the potential radiological risk of the consumption of marine products by man. The main sources of transuranic elements in the Mediterranean Sea in the past were global fallout and the Palomares accident, although at present smaller amounts are released from nuclear establishments in the northwestern region. Plankton from the western Mediterranean Sea was collected and analyzed for plutonium and americium in order to study their biological uptake. The microplankton fractions accounted for approximately 50% of the total plutonium contents in particulate form. At Garrucha (Palomares area), microplankton showed much higher 239,240 Pu activity, indicating the contamination with plutonium from the bottom sediments. Concentration factors were within the range of the values recommended by the International Atomic Energy Agency. Continental shelf mesoplankton was observed to efficiently concentrate transuranics. In open seawaters, concentrations were much lower. We speculate that sediments might play a role in the transfer of transuranics to mesoplankton in coastal waters, although we cannot discard that the difference in species composition may also play a role. In Palomares, both 239,240 Pu and 241Am showed activities five times higher than the mean values observed in continental shelf mesoplankton. As the plutonium isotopic ratios in the contaminated sample were similar to those found in material related to the accident, the contamination was attributed to bomb debris from the Palomares accident. Concentration factors in mesoplankton were also in relatively good agreement with the ranges recommended by IAEA. In the Palomares station the highest concentration factor was observed in the sample that showed predominance of the dynoflagellate Ceratium spp. Mean values of the enrichment factors showed, on

  15. Transfer of plutonium and americium to grass vegetation as a function of radionuclide solid - solution portioning in soil

    International Nuclear Information System (INIS)

    Sokolik, G.; Ovsiannikova, S.; Ivanova, T.; Leinova, S.; Kimlenka, I.; Zakharenkov, V.; Zakharenkova, N.

    2004-01-01

    The aim of investigation is to determine the main parameters influencing the plutonium and americium migration in the soil plant system including concentration factor Cf and distribution coefficient K d . The C f factor characterising the ratio of radionuclide activity concentration in the plant specie (A p , Bq/kg) and root-inhabited layer of soil (A s , Bq/kg) has been used as a measure of biological availability of TUE. The K d coefficient estimating the ratio between radionuclide activity concentration in the equilibrium solid phase (A s.ph. ) and pore solution (A sol. , Bq/l) is considered as a measure of sorption ability of soil in respect to the radionuclide. The biological availability of 239,240 Pu and 241 Am for different grass species in various mineral and organic soils of natural and agrarian systems has been studied. The soils and grass vegetation were sampled in 1994 - 2001 in Bragin, Narovla, Khoiniki districts of Belarus (12 - 53 km from ChNPP). Since plant uptake depends primarily on radionuclide portion in the pore soil solution the proper solutions were separated from the soil samples of root-inhabited layer with the method of high-speed centrifugation. 239,240 Pu and 241 Am in the samples were determined radiochemically using alpha-spectrometer ALPHA-KING 676 A. Influence of composition of soil solution on the radionuclide soil plant transfer has been analysed. The interrelationships between the concentration factor (C f ), portion of radionuclide in the soil solution and coefficient K d have been considered. The results of investigations clearly demonstrated the dependence of TUE concentration factors for meadow sedge-herbaceous association of soil sorbing complex. As a rule, C f of americium is higher than that of plutonium. Differentiating of soils according to the C f value and the forecast of grass vegetation contamination by TUE in the different periods after catastrophe has been done. The levels of various soils contamination to receive

  16. Novel Americium Treatment Process for Surface Water and Dust Suppression Water

    International Nuclear Information System (INIS)

    Tiepel, E.W.; Pigeon, P.; Nesta, S.; Anderson, J.

    2006-01-01

    The Rocky Flats Environmental Technology Site (RFETS), a former nuclear weapons production plant, has been remediated under CERCLA and decommissioned to become a National Wildlife Refuge. The site conducted this cleanup effort under the Rocky Flats Cleanup Agreement (RFCA) that established limits for the discharge of surface and process waters from the site. At the end of 2004, while a number of process buildings were undergoing decommissioning, routine monitoring of a discharge pond (Pond A-4) containing approximately 28 million gallons of water was discovered to have been contaminated with a trace amount of Americium-241 (Am-241). While the amount of Am-241 in the pond waters was very low (0.5 - 0.7 pCi/l), it was above the established Colorado stream standard of 0.15 pCi/l for release to off site drainage waters. The rapid successful treatment of these waters to the regulatory limit was important to the site for two reasons. The first was that the pond was approaching its hold-up limit. Without rapid treatment and release of the Pond A-4 water, typical spring run-off would require water management actions to other drainages onsite or a mass shuttling of water for disposal. The second reason was that this type of contaminated water had not been treated to the stringent stream standard at Rocky Flats before. Technical challenges in treatment could translate to impacts on water and secondary waste management, and ultimately, cost impacts. All of the technical challenges and specific site criteria led to the conclusion that a different approach to the treatment of this problem was necessary and a crash treatability program to identify applicable treatment techniques was undertaken. The goal of this program was to develop treatment options that could be implemented very quickly and would result in the generation of no high volume secondary waste that would be costly to dispose. A novel chemical treatment system was developed and implemented at the RFETS to treat Am

  17. The transmutation of americium: the Ecrix experiments in Phenix

    International Nuclear Information System (INIS)

    Garnier, J.C.; Schmidt, N.; Croixmarie, Y.; Ottaviani, J.P.; Varaine, F.; Saint Jean, C. de

    1999-01-01

    The first americium transmutation experiment in a specific target in PHENIX will occur with the ECRIX-B and ECRIX-H experiments. Beside material testing, the objective is also to represent a concept of transmutation whose specificity is to enhance the kinetics of transmutation by using a moderated spectrum. The moderator materials will be 11 B 4 C and CaH 2 for ECRIX-B and ECRIXH respectively, the irradiation conditions have been predicted for both the neutronics and thermal. The targets (MgO-AmO X pellets) are manufactured in the ATALANTE laboratory and the design is performed according to the PHENIX operating conditions. (authors)

  18. Robotic sample preparation for radiochemical plutonium and americium analyses

    International Nuclear Information System (INIS)

    Stalnaker, N.; Beugelsdijk, T.; Thurston, A.; Quintana, J.

    1985-01-01

    A Zymate robotic system has been assembled and programmed to prepare samples for plutonium and americium analyses by radioactivity counting. The system performs two procedures: a simple dilution procedure and a TTA (xylene) extraction of plutonium. To perform the procedures, the robotic system executes 11 unit operations such as weighing, pipetting, mixing, etc. Approximately 150 programs, which require 64 kilobytes of memory, control the system. The system is now being tested with high-purity plutonium metal and plutonium oxide samples. Our studies indicate that the system can give results that agree within 5% at the 95% confidence level with determinations performed manually. 1 ref., 1 fig., 1 tab

  19. Implications of plutonium and americium recycling on MOX fuel fabrication

    International Nuclear Information System (INIS)

    Renard, A.; Pilate, S.; Maldague, Th.; La Fuente, A.; Evrard, G.

    1995-01-01

    The impact of the multiple recycling of plutonium in power reactors on the radiation dose rates is analyzed for the most critical stage in a MOX fuel fabrication plant. The limitation of the number of Pu recycling in light water reactors would rather stem from reactor core physics features. The case of recovering americium with plutonium is also considered and the necessary additions of shielding are evaluated. A comparison between the recycling of Pu in fast reactors and in light water reactors is presented. (author)

  20. Analysis of americium, plutonium and technetium solubility in groundwater

    International Nuclear Information System (INIS)

    Takeda, Seiji

    1999-08-01

    Safety assessments for geologic disposal of radioactive waste generally use solubilities of radioactive elements as the parameter restricting the dissolution of the elements from a waste matrix. This study evaluated americium, plutonium and technetium solubilities under a variety of geochemical conditions using the geochemical model EQ3/6. Thermodynamic data of elements used in the analysis were provided in the JAERI-data base. Chemical properties of both natural groundwater and interstitial water in buffer materials (bentonite and concrete) were investigated to determine the variations in Eh, pH and ligand concentrations (CO 3 2- , F - , PO 4 3- , SO 4 2- , NO 3 - and NH 4 + ). These properties can play an important role in the complexation of radioactive elements. Effect of the groundwater chemical properties on the solubility and formation of chemical species for americium, plutonium and technetium was predicted based on the solubility analyses under a variety of geochemical conditions. The solubility and speciation of the radioactive elements were estimated, taking into account the possible range of chemical compositions determined from the groundwater investigation. (author)

  1. Plutonium and americium extraction studies with bifunctional organophosphorus extractants

    International Nuclear Information System (INIS)

    Navratil, J.D.

    1985-01-01

    Neutral bifunctional organophosphorus extractants, such as octylphenyl-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) and dihexyl-N,N-diethylcarbamoylmethylphosphonate (CMP), are under study at the Rocky Flats Plant (RFP) to remove plutonium and americium from the 7M nitric acid waste. These compounds extract trivalent actinides from strong nitric acid, a property which distinguishes them from monofunctional organiphosphorus reagents. Furthermore, the reagents extract hydroytic plutonium (IV) polymer which is present in the acid waste stream. The compounds extract trivalent actinides with a 3:1 stoichiometry, whereas tetra- and hexavalent actinides extract with a stoichiometry of 2:1. Preliminary studies indicate that the extracted plutonium polymer complex contains one to two molecules of CMP per plutonium ion and the plutonium(IV) maintains a polymeric structure. Recent studies by Horwitz and co-workers conclude that the CMPO and CMP reagents behave as monodentate ligands. At RFP, three techniques are being tested for using CMP and CMPO to remove plutonium and americium from nitric acid waste streams. The different techniques are liquid-liquid extraction, extraction chromatography, and solid-supported liquid membranes. Recent tests of the last two techniques will be briefly described. In all the experiments, CMP was an 84% pure material from Bray Oil Co. and CMPO was 98% pure from M and T Chemicals

  2. Plant uptake of americium, curium, and the chemical analog neodymium

    International Nuclear Information System (INIS)

    Weimer, W.C.; Laul, J.C.; Kutt, J.C.; Bondietti, E.A.

    1977-01-01

    The plant uptake from several bulk soils has been determined for neodymium, a chemical analog to the transuranium elements americium and curium, and several other native rare earth elements as well. These investigations have demonstrated that neodymium, which has very similar chemical properties to amercium and curium and should have a similar environmental behavior, does behave indistinguishably under both laboratory and field conditions. The uptake of the weathered or mobile forms of these elements from soils is expected to be governed primarily by their identical oxidation states and nearly identical ionic radii. This hypothesis is strongly supported by the chondritic (primordial) normalized rare earth element patterns in several plants. In these samples, the entire series of rare earth elements behaves as a smooth function of the REE ionic radii, as is also seen in the contiguous soils. This behavior suggests that the plant uptake of other ions with similar chemical properties (i.e., americium and curium) would also be governed by ionic size and charge

  3. Uptake and recovery of americium and uranium by Anacystis biomass

    International Nuclear Information System (INIS)

    Liu, H.H.; Jiunntzong Wu

    1993-01-01

    The optimum conditions for the uptake of americium and uranium from wastewater solutions by Anacystis nidulans cells, and the recovery of these radionuclides were studied. The optimum pH range for both actinides was in the acidic region between 3.0 and 5.0. In a pH 3.5 solution with an algal biomass of 70 μg/mL, up to 95% of the Am and U were taken up by the cells. However, the uptake levels were lowered considerably when ethylene dinitrilotetraacetic acid (EDTA) or iron or calcium ions were present in the solutions. Most of the radionuclides taken up by the cells could also be desorbed by washing with salt solutions. Of nine salt solutions tested, ammonium carbonate was the most effective. Our experiments using algal biomass to remove radionuclides from wastewater showed that about 92% of americium and 85% of uranium in wastewater could be taken up by algal biomass, from which about 46% of the Am and 82% of the U originally present in the wastewater could be recovered by elution with a salt solution. 17 refs., 7 figs., 2 tabs

  4. The bioavailability of the transuranic elements 237Pu and 241Am for the pond snail, Lymnaea stagnalis L., and their behaviour in selected natural surface waters

    International Nuclear Information System (INIS)

    Thiels, G.M.

    1983-01-01

    An attempt was made to characterise the bioavailability of 237 Pu and 241 Am for the pond snail Lymnaea stagnalis L. in selected surface waters. The uptake, distribution and retention patterns were studied through the contamination route water-snail. The effects of a number of parameters, such as seasonal variation, water type (pH, conductivity, ionic composition) and presence of food, on the bioavailability of the transuranics were evaluated. Finally, an assessment was made concerning the chemical speciation of plutonium and americium in the selected freshwaters

  5. Radiotoxicological analyses of 239+240Pu and 241Am in biological samples by anion-exchange and extraction chromatography: a preliminary study for internal contamination evaluations

    International Nuclear Information System (INIS)

    Ridone, S.; Arginelli, D.; Bortoluzzi, S.; Canuto, G.; Montalto, M.; Nocente, M.; Vegro, M.

    2006-01-01

    Many biological samples (urines and faeces) have been analysed by means of chromatographic extraction columns, utilising two different resins (AG 1-X2 resin chloride and T.R.U.), in order to detect the possible internal contamination of 239 + 240 Pu and 241 Am, for some workers of a reprocessing nuclear plant in the decommissioning phase. The results obtained show on one hand the great suitability of the first resin for the determination of plutonium, and on the other the great selectivity of the second one for the determination of americium

  6. Modelling of curium and americium behaviour during separation with displacing complexing chromatography

    International Nuclear Information System (INIS)

    Chuveleva, Eh.A.; Kharitonov, O.V.; Firsova, L.A.

    1994-01-01

    Certain heavy rare earths, curium and americium were separated by the method of displacement complexing chromatography using DTPA solutions and solutions containing DTPA and citric acid as eluents. Separation factors of rare earths and curium (americium) were calculated. Imitators for curium and americium separation were suggested: thulium for curium elution using 0.025 mol/l DTPA, holmium-for curium elution using 0.025 mol/l DTPA in the presence of 0.025 mol/l citric acid; terbium can serve as the imitator in both cases. 5 refs., 5 figs

  7. Influence of organic components on plutonium and americium speciation in soils and soil solutions

    International Nuclear Information System (INIS)

    Sokolik, G.A.; Ovsyannikova, S.V.; Kimlenko, I.M.

    2003-01-01

    Group composition of humic substances of organic and mineral soils sampled in the 30-km zone of the Chernobyl accident was analyzed for studying influence of organic components on migration properties of plutonium and americium in soils and soil solutions by the method of gel-chromatography and chemical fractionation. It was ascertained that humus of organic soils binds plutonium and americium stronger than humus of mineral soils. Elevated mobility of americium compared to plutonium one stems from lower ability of the latter to from hard to solve organic and organomineral complexes, as well as from its ability to form anionic complexes in soil solutions [ru

  8. Analytical separation of americium and curium, using high performance liquid chromatography

    International Nuclear Information System (INIS)

    Billon, A.

    1978-01-01

    Americium and curium are separated on a column of cation exchange resin (Aminex) using hydroxyisobutyric acid (α HIBA) as eluent, at a temperature of 80 0 C. Americium and curium were detected in line using their α emission: the separation was performed in a shielded glove box whose setting-up is given. Finally, the time necessary for a separation is comprised between 30 min and 1 hr. The purity of separated fractions was assayed by mass-spectrometry. An application in the determination of isotopic composition of americium and curium in fuels is described

  9. Selective leaching studies of deep-sea sediments loaded with americium, neptunium and plutonium

    International Nuclear Information System (INIS)

    Cole, T.G.; Higgo, J.J.W.; Cronan, D.S.; Rees, L.V.C.

    1984-07-01

    A series of selective leaching experiments were undertaken to investigate the solid phase speciation and distribution of americium, neptunium and plutonium which had been experimentally loaded onto different marine sediment types. The chemical leaches employed showed rather poor selectivity but certain trends were evident. Adsorption was not by ion exchange. Americium showed a preferential affinity for carbonate and plutonium for organic matter. Neptunium appeared to have no preferential affinities. Americium was sorbed by acetic acid residues (CaCO 3 removed) and by unleached carbonate-rich sediments with equal efficiency. This indicates that it is able to diversify its solid phase affinity/distribution depending upon which solid phases are available. (author)

  10. Am-241 buildup in nematode organisms

    International Nuclear Information System (INIS)

    Martyushov, V.Z.; Tarasov, O.V.

    1990-01-01

    The process of Am-241 intake into earthworm organisms from chernozem leached in their presence in soil contaminated with this radionuclide is studied. The data on Am-241 buildup values during long-time radionuclide intake into earthworm organisms from soil are given. It s shown that Am-241 buildup in earthworm organisms do not exceed its concentration in soil for the whole observation period (as Am-241 presents in soil in state unavailable for animals). Intensive extraction of the radionuclide from the organisms is observed when earthworm contacts with soil are stopped

  11. Evaluation of synthetic water-soluble metal-binding polymers with ultrafiltration for selective concentration of americium and plutonium

    International Nuclear Information System (INIS)

    Smith, B.F.; Gibson, R.R.; Jarvinen, G.D.; Jones, M.M.; Lu, M.T.; Robison, T.W.; Schroeder, N.C.; Stalnaker, N.

    1997-01-01

    Routine counting methods and ICP-MS are unable to directly measure the new US Department of Energy (DOE) regulatory level for discharge waters containing alpha-emitting radionuclides of 30 pCi/L total alpha or the 0.05 pCi/L regulatory level for Pu or Am activity required for surface waters at the Rocky Flats site by the State of Colorado. This inability indicates the need to develop rapid, reliable, and robust analytical techniques for measuring actinide metal ions, particularly americium and plutonium. Selective separation or preconcentration techniques would aid in this effort. Water-soluble metal-binding polymers in combination with ultrafiltration are shown to be an effective method for selectively removing dilute actinide ions from acidic solutions of high ionic strength. The actinide-binding properties of commercially available water-soluble polymers and several polymers which have been reported in the literature were evaluated. The functional groups incorporated in the polymers were pyrrolidone, amine, oxime, and carboxylic, phosphonic, or sulfonic acid. The polymer containing phosphonic acid groups gave the best results with high distribution coefficients and concentration factors for 241 Am(III) and 238 Pu(III)/(IV) at pH 4 to 6 and ionic strengths of 0.1 to 4

  12. Vertical transport of particulate-associated plutonium and americium in the upper water column of the Northeast Pacific

    International Nuclear Information System (INIS)

    Fowler, S.W.; Ballestra, S.; La Rosa, J.; Fukai, R.

    1983-01-01

    Concentrations of plutonium (Pu) and americium (Am) were determined in seawater, suspended particulate matter, sediment trap samples, and biogenic material collected at the VERTEX I site in the North Pacific off central California. From a vertical profile taken over the upper 1500 m, the presence of sub-surface maxima of sup(239+240)Pu and 241 Am were identified between 100 to 750 m and 250 to 750 m, respectively. A large fraction (32%) of the filterable sup(239+240)Pu in surface waters was associated with cells during a phytoplankton bloom; Pu:Am activity ratios in surface water and the suspended particles indicated that Pu was concentrated by the cells to a greater degree than Am. However, similar measurements beneath the surface layer showed an overall enrichment of Am over Pu on fine suspended particles with depth. Freshly produced zooplankton fecal pellets and large, fast sinking particles collected in PITS contained relatively high concentrations of Pu and Am. Both transuranic concentrations in trapped particles and transuranic flux tended to increase with depth down to 750 m, suggesting that their scavenging is in the upper water column. Am appeared to be scavenged by sinking biogenic particles to a greater extent than Pu. The results are discussed. (author)

  13. Tank 241-AZ-102 Privatization Push Mode Core Sampling and Analysis Plan

    International Nuclear Information System (INIS)

    RASMUSSEN, J.H.

    1999-01-01

    This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AZ-102. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AZ-102 required to satisfy the Data Quality Objectives For TWRS Privatization Phase I : Confirm Tank TIS An Appropriate Feed Source For High-Level Waste Feed Batch X(HLW DQO) (Nguyen 1999a), Data Quality Objectives For TWRS Privatization Phase 1: Confirm Tank TIS An Appropriate Feed Source For Low-Activity Waste Feed Batch X (LAW DQO) (Nguyen 1999b), Low Activity Waste and High Level Waste Feed Data Quality Objectives (L and H DQO) (Patello et al. 1999) and Characterization Data Needs for Development, Design, and Operation of Retrieval Equipment Developed through the Data Quality Objective Process (Equipment DQO) (Bloom 1996). The Tank Characterization Technical Sampling Basis document (Brown et al. 1998) indicates that these issues, except the Equipment DQO apply to tank 241-AZ-102 for this sampling event. The Equipment DQO is applied for shear strength measurements of the solids segments only. Poppiti (1999) requires additional americium-241 analyses of the sludge segments. Brown et al. (1998) also identify safety screening, regulatory issues and provision of samples to the Privatization Contractor(s) as applicable issues for this tank. However, these issues will not be addressed via this sampling event. Reynolds et al. (1999) concluded that information from previous sampling events was sufficient to satisfy the safety screening requirements for tank 241-AZ-102. Push mode core samples will be obtained from risers 15C and 24A to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives. The 222-S Laboratory will extrude core samples, composite the liquids and solids, perform chemical analyses

  14. Americium/Curium Vitrification Pilot Tests - Part II

    International Nuclear Information System (INIS)

    Marra, J.E.; Baich, M.A.; Fellinger, A.P.; Hardy, B.J.; Herman, D.T.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T. K.; Stone, M.E.

    1998-05-01

    Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. A previous paper described operation results from the Am-Cm Melter 2A pilot system, a full-scale non-radioactive pilot facility. This paper presents the results from continued testing in the Pilot Facility and also describes efforts taken to look at alternative vitrification process operations and flowsheets designed to address the problems observed during melter 2A pilot testing

  15. Pretreatment of americium/curium solutions for vitrification

    International Nuclear Information System (INIS)

    Rudisill, T.S.

    1996-01-01

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment

  16. Determination of the oxygen-metal-ratio of uranium-americium mixed oxides

    International Nuclear Information System (INIS)

    Bartscher, W.

    1982-01-01

    During the dissolution of uranium-americium mixed oxides in phosphoric acid under nitrogen tetravalent uranium is oxidized by tetravalent americium. The obtained hexavalent uranium is determined by constant potential coulometry. The coulombs measured are equivalent to the oxygen in excess of the minimum composition of UO 2 x AmO 1 . 5 . The total uranium content of the sample is determined in a subsequent coulometric titration. The oxygen-metal ratio of the sample can be calculated for a given uranium-americium ratio. An excess of uranium dioxide is necessary in order to suppress the oxidation of water by tetravalent americium. The standard deviation of the method is 0.0017 O/M units. (orig.) [de

  17. Calibration procedures for in vivo sodium iodide spectrometry of plutonium and americium in the human lung

    International Nuclear Information System (INIS)

    Umbarger, C.J.; Jett, J.H.

    1976-01-01

    This paper describes the calibration techniques and associated error analysis for the in vivo measurement by NaI spectrometry of heavy elements in the lung, specifically plutonium and americium. A very brief description of the instrumentation system is included

  18. 24 CFR 241.1245 - Insurance endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.1245... Rights and Obligations § 241.1245 Insurance endorsement. (a) Endorsement. The Commissioner shall indicate his insurance of the equity loan or acquisition loan by endorsing the original credit instrument and...

  19. 24 CFR 241.570 - Insurance endorsement.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 241.570... § 241.570 Insurance endorsement. (a) Initial endorsement. The Commissioner shall indicate his/her insurance of the mortgage by endorsing the original credit instrument and identifying the section of the Act...

  20. 40 CFR 86.241-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.241-94 Section 86.241-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...

  1. 24 CFR 241.885 - Insurance benefits.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 241.885 Section... § 241.885 Insurance benefits. (a) Method of payment. Payment of claims shall be made in the following... acceptable assignment of the note and security instrument to the Commissioner, the insurance benefits shall...

  2. 24 CFR 241.805 - Insurance premiums.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance premiums. 241.805 Section... Without a HUD-Insured or HUD-Held Mortgage Premiums § 241.805 Insurance premiums. (a) First premium. The... insurance premium equal to one percent of the original face amount of the note. (b) Second premium. The...

  3. Kinetics of americium(VI) mass transfer through solid supported liquid membrane with HDEHP

    International Nuclear Information System (INIS)

    Mikheeva, M.N.; Novicoov, P.; Myasoedov, B.F.; Tikhomirov, S.V.

    1994-01-01

    The main regularities of membrane extraction of americium under conditions of different redox potentials in aqueous phases have been studied. The physico-chemical model of the process including steps of americium oxidation in feed solution, extraction by membrane, partial reduction on membrane surface, trans-membrane diffusion and reextraction to strip solution has been developed. The calculation of reduction rate constant on membrane surface has been carried out. (author) 9 refs.; 4 figs.; 3 tabs

  4. In-line measurement of plutonium and americium in mixed solutions

    International Nuclear Information System (INIS)

    Li, T.K.

    1981-01-01

    A solution assay instrument (SAI) has been developed at the Los Alamos National Laboratory and installed in the plutonium purification and americium recovery process area in the Los Alamos Plutonium Processing Facility. The instrument is designed for accurate, timely, and simultaneous nondestructive analysis of plutonium and americium in process solutions that have a wide range of concentrations and Am/Pu ratios. For a 25-mL sample, the assay precision is 5 g/L within a 2000-s count time

  5. The transmutation of americium: the Ecrix experiments in Phenix; Transmutation de l'americium: les experiences ecrix dans Phenix

    Energy Technology Data Exchange (ETDEWEB)

    Garnier, J.C.; Schmidt, N. [CEA Cadarache, Dept. d' Etudes des Combustibles (DEC/SESC), 13 - Saint-Paul-lez-Durance (France); Croixmarie, Y.; Ottaviani, J.P. [CEA Cadarache, Dept. d' Etudes des Combustibles (DEC/SPUA), 13 - Saint-Paul-lez-Durance (France); Varaine, F.; Saint Jean, C. de [CEA Cadarache, Dept. d' Etudes des Reacteurs (DER/SPRC), 13 - Saint-Paul-lez-Durance (France)

    1999-07-01

    The first americium transmutation experiment in a specific target in PHENIX will occur with the ECRIX-B and ECRIX-H experiments. Beside material testing, the objective is also to represent a concept of transmutation whose specificity is to enhance the kinetics of transmutation by using a moderated spectrum. The moderator materials will be {sup 11}B{sub 4}C and CaH{sub 2} for ECRIX-B and ECRIXH respectively, the irradiation conditions have been predicted for both the neutronics and thermal. The targets (MgO-AmO{sub X} pellets) are manufactured in the ATALANTE laboratory and the design is performed according to the PHENIX operating conditions. (authors)

  6. The transmutation of americium: the Ecrix experiments in Phenix; Transmutation de l'americium: les experiences ecrix dans Phenix

    Energy Technology Data Exchange (ETDEWEB)

    Garnier, J C; Schmidt, N [CEA Cadarache, Dept. d' Etudes des Combustibles (DEC/SESC), 13 - Saint-Paul-lez-Durance (France); Croixmarie, Y; Ottaviani, J P [CEA Cadarache, Dept. d' Etudes des Combustibles (DEC/SPUA), 13 - Saint-Paul-lez-Durance (France); Varaine, F; Saint Jean, C de [CEA Cadarache, Dept. d' Etudes des Reacteurs (DER/SPRC), 13 - Saint-Paul-lez-Durance (France)

    1999-07-01

    The first americium transmutation experiment in a specific target in PHENIX will occur with the ECRIX-B and ECRIX-H experiments. Beside material testing, the objective is also to represent a concept of transmutation whose specificity is to enhance the kinetics of transmutation by using a moderated spectrum. The moderator materials will be {sup 11}B{sub 4}C and CaH{sub 2} for ECRIX-B and ECRIXH respectively, the irradiation conditions have been predicted for both the neutronics and thermal. The targets (MgO-AmO{sub X} pellets) are manufactured in the ATALANTE laboratory and the design is performed according to the PHENIX operating conditions. (authors)

  7. Thermal modeling of tanks 241-AW-101 and 241-AN-104 with the TEMPEST code

    International Nuclear Information System (INIS)

    Antoniak, Z.I.; Recknagle, K.P.

    1995-07-01

    The TEMPEST code was exercised in a preliminary study of double-shell Tanks 241 -AW-101 and 241-AN-104 thermal behavior. The two-dimensional model used is derived from our earlier studies on heat transfer from Tank 241-SY-101. Several changes were made to the model to simulate the waste and conditions in 241-AW-101 and 241-AN-104. The nonconvective waste layer was assumed to be 254 cm (100 in.) thick for Tank 241-AW-101, and 381 cm (150 in.) in Tank 241-AN-104. The remaining waste was assumed, for each tank, to consist of a convective layer with a 7.6-cm (3-inch) crust on top. The waste heat loads for 241-AW-101 and 241-AN-104 were taken to be 10 kW (3.4E4 Btu/hr) and 12 kW (4.0E4 Btu/hr), respectively. Present model predictions of maximum and convecting waste temperatures are within 1.7 degrees C (3 degrees F) of those measured in Tanks 241-AW-101 and 241-AN-104. The difference between the predicted and measured temperature is comparable to the uncertainty of the measurement equipment. These models, therefore, are suitable for estimating the temperatures within the tanks in the event of changing air flows, waste levels, and/or waste configurations

  8. Americium, plutonium and uranium contamination and speciation in well waters, streams and atomic lakes in the Sarzhal region of the Semipalatinsk Nuclear Test Site, Kazakhstan.

    Science.gov (United States)

    León Vintró, L; Mitchell, P I; Omarova, A; Burkitbayev, M; Jiménez Nápoles, H; Priest, N D

    2009-04-01

    New data are reported on the concentrations, isotopic composition and speciation of americium, plutonium and uranium in surface and ground waters in the Sarzhal region of the Semipalatinsk Test Site, and an adjacent area including the settlement of Sarzhal. The data relate to filtered water and suspended particulate from (a) streams originating in the Degelen Mountains, (b) the Tel'kem 1 and Tel'kem 2 atomic craters, and (c) wells on farms located within the study area and at Sarzhal. The measurements show that (241)Am, (239,240)Pu and (238)U concentrations in well waters within the study area are in the range 0.04-87mBq dm(-3), 0.7-99mBq dm(-3), and 74-213mBq dm(-3), respectively, and for (241)Am and (239,240)Pu are elevated above the levels expected solely on the basis of global fallout. Concentrations in streams sourced in the Degelen Mountains are similar, while concentrations in the two water-filled atomic craters are somewhat higher. Suspended particulate concentrations in well waters vary considerably, though median values are very low, at 0.01mBq dm(-3), 0.08mBq dm(-3) and 0.32mBq dm(-3) for (241)Am, (239,240)Pu and (238)U, respectively. The (235)U/(238)U isotopic ratio in almost all well and stream waters is slightly elevated above the 'best estimate' value for natural uranium worldwide, suggesting that some of the uranium in these waters is of test-site provenance. Redox analysis shows that on average most of the plutonium present in the microfiltered fraction of these waters is in a chemically reduced form (mean 69%; 95% confidence interval 53-85%). In the case of the atomic craters, the proportion is even higher. As expected, all of the americium present appears to be in a reduced form. Calculations suggest that annual committed effective doses to individual adults arising from the daily ingestion of these well waters are in the range 11-42microSv (mean 21microSv). Presently, the ground water feeding these wells would not appear to be contaminated with

  9. Americium, plutonium and uranium contamination and speciation in well waters, streams and atomic lakes in the Sarzhal region of the Semipalatinsk Nuclear Test Site, Kazakhstan

    Energy Technology Data Exchange (ETDEWEB)

    Leon Vintro, L. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland)], E-mail: luis.leon@ucd.ie; Mitchell, P.I.; Omarova, A. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Burkitbayev, M. [Department of Inorganic Chemistry, Al-Faraby Kazakh National University, Almaty (Kazakhstan); Jimenez Napoles, H. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Priest, N.D. [School of Health and Social Sciences, Middlesex University, Enfield, EN3 4SA (United Kingdom)

    2009-04-15

    New data are reported on the concentrations, isotopic composition and speciation of americium, plutonium and uranium in surface and ground waters in the Sarzhal region of the Semipalatinsk Test Site, and an adjacent area including the settlement of Sarzhal. The data relate to filtered water and suspended particulate from (a) streams originating in the Degelen Mountains, (b) the Tel'kem 1 and Tel'kem 2 atomic craters, and (c) wells on farms located within the study area and at Sarzhal. The measurements show that {sup 241}Am, {sup 239,240}Pu and {sup 238}U concentrations in well waters within the study area are in the range 0.04-87 mBq dm{sup -3}, 0.7-99 mBq dm{sup -3}, and 74-213 mBq dm{sup -3}, respectively, and for {sup 241}Am and {sup 239,240}Pu are elevated above the levels expected solely on the basis of global fallout. Concentrations in streams sourced in the Degelen Mountains are similar, while concentrations in the two water-filled atomic craters are somewhat higher. Suspended particulate concentrations in well waters vary considerably, though median values are very low, at 0.01 mBq dm{sup -3}, 0.08 mBq dm{sup -3} and 0.32 mBq dm{sup -3} for {sup 241}Am, {sup 239,240}Pu and {sup 238}U, respectively. The {sup 235}U/{sup 238}U isotopic ratio in almost all well and stream waters is slightly elevated above the 'best estimate' value for natural uranium worldwide, suggesting that some of the uranium in these waters is of test-site provenance. Redox analysis shows that on average most of the plutonium present in the microfiltered fraction of these waters is in a chemically reduced form (mean 69%; 95% confidence interval 53-85%). In the case of the atomic craters, the proportion is even higher. As expected, all of the americium present appears to be in a reduced form. Calculations suggest that annual committed effective doses to individual adults arising from the daily ingestion of these well waters are in the range 11-42 {mu}Sv (mean 21 {mu

  10. Dicty_cDB: SLH241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLH241 (Link to dictyBase) - - - Contig-U15835-1 SLH241E (Link... to Original site) - - - - - - SLH241E 371 Show SLH241 Library SL (Link to library) Clone ID SLH241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-B/SLH241Q.Seq.d/ Representative seq. ID SLH24...1E (Link to Original site) Representative DNA sequence >SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH241Q.Seq.d/ GAAGT....Seq.d/ 638 0.0 VFE160 (VFE160Q) /CSM/VF/VFE1-C/VFE160Q.Seq.d/ 638 0.0 SLH241 (SLH241Q) /CSM/SL/SLH2-B/SLH24

  11. ELECTROCHEMICAL CORROSION TESTING OF TANKS 241-AN-102 & 241-AP-107 & 241-AP-108 IN SUPPORT OF ULTRASONIC TESTING

    Energy Technology Data Exchange (ETDEWEB)

    WYRWAS RB; DUNCAN JB

    2008-11-20

    This report presents the results of the corrosion rates that were measured using electrochemical methods for tanks 241-AN-102 (AN-102), 241-AP-107 (AP 107), and 241-AP-108 (AP-108) performed under test plant RPP-PLAN-38215. The steel used as materials of construction for AN and AP tank farms was A537 Class 1. Test coupons of A537 Class 1 carbon steel were used for corrosion testing in the AN-107, AP-107, and AP-108 tank waste. Supernate will be tested from AN-102, AP-107, and Ap-108. Saltcake testing was performed on AP-108 only.

  12. Tank 241-C-103 headspace flammability

    International Nuclear Information System (INIS)

    Huckaby, J.L.

    1994-01-01

    Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report

  13. Tank 241-C-103 headspace flammability

    Energy Technology Data Exchange (ETDEWEB)

    Huckaby, J.L.

    1994-01-01

    Information regarding flammable vapors, gases, and aerosols is presented for the purpose of resolving the tank 241-C-103 headspace flammability issue. Analyses of recent vapor and liquid samples, as well as visual inspections of the tank headspace, are discussed in the context of tank dynamics. This document is restricted to issues regarding the flammability of gases, vapors, and an aerosol that may exist in the headspace of tank 241-C-103. While discussing certain information about the organic liquid present in tank 241-C-103, this document addresses neither the potential for, nor consequences of, a pool fire involving this organic liquid; they will be discussed in a separate report.

  14. Comparative behavior of plutonium and americium in the equatorial Pacific

    International Nuclear Information System (INIS)

    Noshkin, V.E.; Wong, K.M.; Jokela, T.A.; Brunk, J.L.; Eagle, R.J.

    1983-01-01

    Inventories of 239 + 240 Pu and 241 Am greatly in excess of global fallout levels persist in the benthic environments of Bikini and Enewetak Atolls. The amount of 239 + 240 Pu mobilized to solution at the atolls can be predicted from a distribution coefficient K/sub d/ of 2.3 x 10 5 and the mean sediment concentrations. The mobilized 239 + 240 Pu has solute-like characteristics and different valence states coexist in solution - the largest fraction of the soluble plutonium is in an oxidized form (+V,VI). The adsorption of plutonium to sediments is not completely reversible because of changes that occur in the relative amounts of the mixed oxidation states in solution with time. Characteristics of 239 + 240 Pu described at one location may not necessarily describe its behavior elsewhere. The relative amounts of 241 Am to 239 + 240 Pu may be altered in future years because of mobilization and radiological decay

  15. Ecological behavior of plutonium and americium in a freshwater pond

    International Nuclear Information System (INIS)

    Emery, R.M.; Klopfer, D.C.; Garland, T.R.; Weimer, W.C.

    1976-01-01

    A plutonium (Pu) processing waste pond on the Hanford Reservation has been studied since mid-1973 to characterize the pond's limnology and determine the ecological behavior of transuranics in this ecosystem. This ultra-eutrophic pond has a water inflow rate of 10 m 3 /min, of which 95% leaves the pond by percolation. Macrophytes (mainly Potamogeton), algae (mainly Cladophora), benthic invertebrates (mainly dipteran and odonate larvae, hemipterans, amphipods and gastropods) and goldfish are the major biotic components of the system. Sediments appear to be the principal repository of Pu and Am, having mean concentrations for 238 Pu, 239 240 Pu and 241 Am of 112, 121 and 71 pCi/g (dry), respectively. Mean ratios of isotopes in the sediments are 0.85 for 238 Pu to 239 240 Pu, and 0.49 for 241 Am to 239 240 Pu. Algal floc (decomposing algal material) is the major concentrator of Pu and Am in the pond having mean concentrations of 238 Pu of 986 pCi/g, for 239 240 Pu of 615 pCi/g, and for 241 Am of 256 pCi/g. Watercress (Rorippa) had Pu levels about equal to those of the sediments, while dragonfly larvae (Libellula) and snails (Lymnaea) along with watercress had Am levels approximating those of the sediments. The remaining biota had Pu and Am levels which were generally well below those of the sediments.Preliminary in situ experiments indicate that goldfish reach an equilibrium level for Pu of about 15 pCi/g within a few days of exposure to the pond, after which they may remain active in the pond for many months without further accumulation. Experimental goldfish established ratios of 238 Pu to 239 240 Pu and 241 Am to 239 240 Pu that were similar to all other pond biota within 2 weeks of pond residence, suggesting a common source of biologically available Pu and Am

  16. Ecological behavior of plutonium and americium in a freshwater pond

    International Nuclear Information System (INIS)

    Emery, R.M.; Klopfer, D.C.; Garland, T.R.; Weimer, W.C.

    1975-03-01

    A Pu processing waste pond on the Hanford Reservation has been studied since mid-1973 to characterize the pond's limnology and determine the ecological behavior in this ecosystem. About 8.1 kg of Pu was reported to have been discharged into waste trenches leading to the pond. Mean ratios of isotopes in the sediments are 0.85 for 238 Pu to 239 240 Pu, 0.61 for 241 Am to 238 Pu, and 0.49 for 241 Am to 239 240 Pu. Levels of Pu and Am in the interstitial water range from 0.5 to 13 pCi/g (dry wt. of sediment). For 238 Pu in pond water the mean concentration is 0.007 pCi/l, for 239 240 Pu it is 0.002 pCi/l, and for 241 Am it is 1.08 pCi/l. The remaining biota had Pu and Am levels which were generally well below those of the sediments. (U.S.)

  17. Plutonium and americium behavior in coral atoll environments

    International Nuclear Information System (INIS)

    Noshkin, V.E.; Wong, K.M.; Jokela, T.A.; Brunk, J.L.; Eagle, R.J.

    1984-01-01

    Inventories of 239+240 Pu and 241 Am greatly in excess of global fallout levels persist in the benthic environments of Bikini and Enewetak Atolls. Quantities of 239+240 Pu and lesser amounts of 241 Am are continuously mobilizing from these sedimentary reservoirs. The amount of 239+240 Pu mobilized to solution at any time represents 0.08 to 0.09% of the sediment inventories to a depth of 16 cm. The mobilized 239+240 Pu has solute-like characteristics and different valence states coexist in solution - the largest fraction of the soluble plutonium is in an oxidized form (+V,VI). The adsorption of plutonium to sediments is not completely reversible because of changes that occur in the relative amounts of the mixed oxidation states in solution with time. Further, any characteristics of 239+240 Pu described at one location may not necessarily be relevant in describing its behavior elsewhere following mobilization and migration. The relative amounts of 241 Am to 239+240 Pu in the sedimentary deposits at Enewetak and Bikini may be altered in future years because of mobilization and radiological decay. Mobilization of 239+240 Pu is not a process unique to these atolls, and quantities in solution derived from sedimentary deposits can be found at other global sites. These studies in the equatorial Pacific have significance in assessing the long-term behavior of the transuranics in any marine environment. 22 references, 1 figure, 13 tables

  18. Tank 241-AP-104 tank characterization plan

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-11-01

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Double-Shell Tank (DST) 241-AP-104

  19. Density of simulated americium/curium melter feed solution

    International Nuclear Information System (INIS)

    Rudisill, T.S.

    1997-01-01

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70 degrees C. The measured density decreased linearly at a rate of 0.0007 g/cm3/degree C from an average value of 1.2326 g/cm 3 at 20 degrees C to an average value of 1.1973g/cm 3 at 70 degrees C

  20. Americium/Curium Melter 2A Pilot Tests

    International Nuclear Information System (INIS)

    Smith, M.E.; Fellinger, A.P.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T.K.; Stone, M.E.; Witt, D.C.

    1998-05-01

    Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. To this end, the Am/Cm Melter 2A pilot system, a full-scale non- radioactive pilot plant of the system to be installed at the reprocessing facility, was designed, constructed and tested. The full- scale pilot system has a frit and aqueous feed delivery system, a dual zone bushing melter, and an off-gas treatment system. The main items which were tested included the dual zone bushing melter, the drain tube with dual heating and cooling zones, glass compositions, and the off-gas system which used for the first time a film cooler/lower melter plenum. Most of the process and equipment were proven to function properly, but several problems were found which will need further work. A system description and a discussion of test results will be given

  1. Americium adsorption on the surface of macrophytic algae

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, F.P.; Fowler, S.W.

    1985-01-01

    Data are presented on the rates at which americium (Am) deposits upon blade surfaces of three benthic algal species (Ulva rigida, Fucus vesiculosus and Gigartina stellata) following short-term exposures (1-6 h). Am is taken up in direct proportion to the ambient radionuclide concentration in sea water. Uptake by the green alga was 3 to 5 times greater than that for the brown and red species. Experimental evidence indicated that Am accumulation is a passive process and that adsorption takes place mainly on the thin outer organic coating of the seaweed. The Am transport coefficients are quite similar to that previously found for the naturally occurring ..cap alpha..-emitter /sup 210/Po, but are an order of magnitude lower than a plutonium transport coefficient reported in the literature. Release of labelled extracellular products associated with the algal surface coating is considered to be responsible for the rapid loss of Am observed previously in macroalgae and may in fact serve as a mechanism for transferring Am to filter feeding zooplankton. (author).

  2. Americium adsorption on the surface of macrophytic algae

    International Nuclear Information System (INIS)

    Carvalho, F.P.; Fowler, S.W.

    1985-01-01

    Data are presented on the rates at which americium (Am) deposits upon blade surfaces of three benthic algal species (Ulva rigida, Fucus vesiculosus and Gigartina stellata) following short-term exposures (1-6 h). Am is taken up in direct proportion to the ambient radionuclide concentration in sea water. Uptake by the green alga was 3 to 5 times greater than that for the brown and red species. Experimental evidence indicated that Am accumulation is a passive process and that adsorption takes place mainly on the thin outer organic coating of the seaweed. The Am transport coefficients are quite similar to that previously found for the naturally occurring α-emitter 210 Po, but are an order of magnitude lower than a plutonium transport coefficient reported in the literature. Release of labelled extracellular products associated with the algal surface coating is considered to be responsible for the rapid loss of Am observed previously in macroalgae and may in fact serve as a mechanism for transferring Am to filter feeding zooplankton. (author)

  3. Density of simulated americium/curium melter feed solution

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.S.

    1997-09-22

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70{degrees} C. The measured density decreased linearly at a rate of 0.0007 g/cm3/{degree} C from an average value of 1.2326 g/cm{sup 3} at 20{degrees} C to an average value of 1.1973g/cm{sup 3} at 70{degrees} C.

  4. Plant uptake and transport of 241Am

    International Nuclear Information System (INIS)

    Wallace, A.; Romney, E.M.; Mueller, R.T. Sr.; soufi, S.M.

    1981-01-01

    We conducted several experiments with 241 Am to obtain a more complete understanding of how this transuranium element is absorbed and transported in plants. In a plant species (Tamarix pentandra Pall.) that has salt glands in the leaves excreting NaCl and other ions, 241 Am was not pumped through these glands. Cyanide, which forms complexes with any metals, when applied to a calcareous soil, greatly increased the transport of 241 Am into stems and leaves of bush bean plants. Radioactive cyanide ( 14 C) was also transported to leaves and stems. When radish was grown in both calcareous and noncalcareous soils, 241 Am appeared to be fixed on the peel so firmly that it was resistant to removal by HNO 3 washing. The chelating agent DTPA induced increased transport of 241 Am to leaves and into the fleshy roots of the radish. Data for Golden Cross hybrid corn grown in solution culture showed at least seven times as much 241 Am transport to the xylem exudatields are corrected by recovery of added tracers

  5. Biosorption of 241Am by Candida sp

    International Nuclear Information System (INIS)

    Luo Shunzhong; Zhang Taiming; Liu Ning; Yang Yuanyou; Jin Jiannan; Hua Xinfeng

    2003-01-01

    The biosorption of radionuclide 241 Am from solutions by Candida sp., and the influences of experimental conditions on the adsorption were studied. The results showed that the adsorption equilibrium was achieved within 4h and the optimum pH=2. No significant differences on 241 Am biosorption were observed at 10-45 degree C, or challenged with Au 3+ or Ag + , even 1500 times or 4500 times over 241 Am, respectively. The adsorption rate could reach 97.8% by dry Candida sp. of 0.82 g/L in 241 Am solutions (pH=2) of 5.6-111 MBq/L (44.04-873.0 μg/L) (C 0 ), with maximum adsorption capacity (W) of 63.5 MBq/g (501.8 μg/g), implying that the removal of 241 Am by Candida sp. from solutions was feasible. The relationship between activities (C 0 ) and adsorption capacities (W) of 241 Am indicated that the biosorption process could be described by Langmuir adsorption isotherm

  6. The MARINE experiment: Irradiation of sphere-pac fuel and pellets of UO{sub 2−x} for americium breeding blanket concept

    Energy Technology Data Exchange (ETDEWEB)

    D' Agata, E., E-mail: elio.dagata@ec.europa.eu [European Commission, Joint Research Centre, Institute for Energy and Transport, P.O. Box 2, NL-1755 ZG Petten (Netherlands); Hania, P.R. [Nuclear Research and Consultancy Group, P.O. Box 25, NL-1755 ZG Petten (Netherlands); Freis, D.; Somers, J. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, D-76125 Karlsruhe (Germany); Bejaoui, S. [Commissariat à l’Energie Atomique et aux Energies Alternatives, DEN/DEC, F-13108 St. Paul lez Durance Cedex (France); Charpin, F.F.; Baas, P.J.; Okel, R.A.F.; Til, S. van [Nuclear Research and Consultancy Group, P.O. Box 25, NL-1755 ZG Petten (Netherlands); Lapetite, J.-M. [European Commission, Joint Research Centre, Institute for Energy and Transport, P.O. Box 2, NL-1755 ZG Petten (Netherlands); Delage, F. [Commissariat à l’Energie Atomique et aux Energies Alternatives, DEN/DEC, F-13108 St. Paul lez Durance Cedex (France)

    2017-01-15

    Highlights: • MARINE is designed to check the behaviour of MABB sphere-pac concept. • MABB sphere-pac are compared with MABB pellet. • Swelling and helium release behaviour will be the main output of the experiment. • An experiment to check sphere-pac MADF fuel behaviour has been already performed. - Abstract: Americium is a strong contributor to the long term radiotoxicity of high activity nuclear waste. Transmutation by irradiation in nuclear reactors of long-lived nuclides like {sup 241}Am is therefore an option for the reduction of radiotoxicity and heat production of waste packages to be stored in a repository. The MARINE irradiation experiment is the latest of a series of European experiments on americium transmutation (e.g. EFTTRA-T4, EFTTRA-T4bis, HELIOS, MARIOS, SPHERE) performed in the High Flux Reactor (HFR). The MARINE experiment is developed and carried out in the framework of the collaborative research project PELGRIMM of the EURATOM 7th Framework Programme (FP7). During the past years of experimental works in the field of transmutation and tests of innovative nuclear fuels, the release or trapping of helium as well as swelling have been shown to be the key issues for the design of such kind of fuel both as drivers and even more for Am-bearing blanket targets (due to the higher Am contents). The main objective of the MARINE experiment is to study the in-pile behaviour of uranium oxide fuel containing 13% of americium and to compare the behaviour of sphere-pac versus pellet fuel, in particular the role of microstructure and temperature on fission gas release and He on fuel swelling. The MARINE experiment will be irradiated in 2016 in the HFR in Petten (The Netherlands) and is expected to be completed in spring 2017. This paper discusses the rationale and objective of the MARINE experiment and provides a general description of its design for which some innovative features have been adopted.

  7. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences; Localisation moleculaire de l'americium, du technetium et du cesium chez des animaux marins comestibles leur comportement metabolique et ses consequences

    Energy Technology Data Exchange (ETDEWEB)

    Pieri, J; Goudard, F; Milcent, M C [Laboratoire de Biochimie et Radiochimie, Faculte des Sciences et des Techniques, Nantes Cedex (France)

    1992-07-01

    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  8. Mobility of plutonium and americium through a shallow aquifer in a semiarid region

    International Nuclear Information System (INIS)

    Penrose, W.R.; Polzer, W.L.; Essington, E.H.; Nelson, D.M.; Orlandini, K.A.

    1990-01-01

    Treated liquid wastes containing traces of plutonium and americium are released into Mortandad Canyon, within the site of Los Alamos National Laboratory, NM. The wastes infiltrate a small aquifer within the canyon. Although laboratory studies have predicted that the movement of actinides in subsurface environments will be limited to less than a few meters, both plutonium and americium are detectable in monitoring wells as far as 3,390 m downgradient from the discharge. Between the first and last monitoring wells (1.8 and 3.4 km from the discharge), plutonium concentrations decreased exponentially from 1,400 to 0.55 mBq/L. Americium concentrations ranged between 94 and 1,240 mBq/L, but did not appear to vary in a systematic way with distance. Investigation of the properties of the mobile actinides indicates that the plutonium and part of the americium are tightly or irreversibly associated with colloidal material between 25 and 450 nm in size. The colloidally bound actinides are removed only gradually from the groundwater. The fraction of the americium not associated with colloids exists in a low molecular weight form (diameter, ≤ 2 nm) and appears to be a stable, anionic complex of unknown composition. The mobile forms of these actinides defeat the forces that normally act to retard their movement through groundwater systems

  9. Dicty_cDB: AFK241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available AF (Link to library) AFK241 (Link to dictyBase) - - - Contig-U16322-1 AFK241Z (Link... to Original site) - - AFK241Z 753 - - - - Show AFK241 Library AF (Link to library) Clone ID AFK241 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/AF/AFK2-B/AFK241Q.Seq.d/ Representative seq. ID AFK24...1Z (Link to Original site) Representative DNA sequence >AFK241 (AFK241Q) /CSM/AF/AFK2-B/AFK241Q.Seq.d/ XXXXX...llhfsmkilvpfkrkdqpqlvsklkqv lxinkalsqxhhi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value AFK2

  10. Molecular localisation of americium, technetium and cesium in edible marine animals. Their metabolic behavior and their consequences

    International Nuclear Information System (INIS)

    Pieri, J.; Goudard, F.; Milcent, M.C.

    1992-01-01

    We show the molecular behavior of americium, technetium and cesium on the chromatographic pattern of each cytosol in the digestive gland of eel and lobster. The contamination by cadmium seems to compete with americium in the fractions of MW 10,000. Cesium shows an ionic behavior. (author)

  11. Radiotoxicological analyses of {sup 239+240}Pu and {sup 241}Am in biological samples by anion-exchange and extraction chromatography: a preliminary study for internal contamination evaluations

    Energy Technology Data Exchange (ETDEWEB)

    Ridone, S.; Arginelli, D.; Bortoluzzi, S.; Canuto, G.; Montalto, M.; Nocente, M.; Vegro, M. [Italian National Agency for New Technologies, Energy and the Environment (ENEA), Research Centre of Saluggia, Radiation Protection Institute, Saluggia, VC (Italy)

    2006-07-01

    Many biological samples (urines and faeces) have been analysed by means of chromatographic extraction columns, utilising two different resins (AG 1-X2 resin chloride and T.R.U.), in order to detect the possible internal contamination of {sup 239{sup +}}{sup 240}Pu and {sup 241}Am, for some workers of a reprocessing nuclear plant in the decommissioning phase. The results obtained show on one hand the great suitability of the first resin for the determination of plutonium, and on the other the great selectivity of the second one for the determination of americium.

  12. Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107

    Energy Technology Data Exchange (ETDEWEB)

    BLACKER, S.M.

    2000-04-13

    This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented.

  13. Waste Feed Delivery Strategy for Tanks 241-AN-102 and 241-AN-107

    International Nuclear Information System (INIS)

    BLACKER, S.M.

    2000-01-01

    This engineering study establishes the detailed retrieval strategy, equipment requirements, and key parameters for preparing detailed process flowsheets; evaluates the technical and programmatic risks associated with processing, certifying, transferring, and delivering waste from Tanks 241-AN-102 and 241-AN-107 to BNFL; and provides a list of necessary follow-on actions so that program direction from ORP can be successfully implemented

  14. Cesium Removal From Tanks 241-AN-103 and 241-SX-105 and 241-AZ-101 and 241-AZ-102 Composite For Testing In Bench Scale Steam Reformer

    International Nuclear Information System (INIS)

    Duncan, J.B.; Huber, H.J.

    2011-01-01

    This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using

  15. CESIUM REMOVAL FROM TANKS 241-AN-103 & 241-SX-105 & 241-AZ-101 & 241AZ-102 COMPOSITE FOR TESTING IN BENCH SCALE STEAM REFORMER

    Energy Technology Data Exchange (ETDEWEB)

    DUNCAN JB; HUBER HJ

    2011-04-21

    This report documents the preparation of three actual Hanford tank waste samples for shipment to the Savannah River National Laboratory (SRNL). Two of the samples were dissolved saltcakes from tank 241-AN-103 (hereafter AN-103) and tank 241-SX-105 (hereafter SX-105); one sample was a supernate composite from tanks 241-AZ-101 and 241-AZ-102 (hereafter AZ-101/102). The preparation of the samples was executed following the test plans LAB-PLAN-10-00006, Test Plan for the Preparation of Samples from Hanford Tanks 241-SX-105, 241-AN-103, 241-AN-107, and LAB-PLN-l0-00014, Test Plan for the Preparation of a Composite Sample from Hanford Tanks 241-AZ-101 and 241-AZ-102 for Steam Reformer Testing at the Savannah River National Laboratory. All procedural steps were recorded in laboratory notebook HNF-N-274 3. Sample breakdown diagrams for AN-103 and SX-105 are presented in Appendix A. The tank samples were prepared in support of a series of treatability studies of the Fluidized Bed Steam Reforming (FBSR) process using a Bench-Scale Reformer (BSR) at SRNL. Tests with simulants have shown that the FBSR mineralized waste form is comparable to low-activity waste glass with respect to environmental durability (WSRC-STI-2008-00268, Mineralization of Radioactive Wastes by Fluidized Bed Steam Reforming (FBSR): Comparisons to Vitreous Waste Forms and Pertinent Durability Testing). However, a rigorous assessment requires long-term performance data from FBSR product formed from actual Hanford tank waste. Washington River Protection Solutions, LLC (WRPS) has initiated a Waste Form Qualification Program (WP-5.2.1-2010-001, Fluidized Bed Steam Reformer Low-level Waste Form Qualification) to gather the data required to demonstrate that an adequate FBSR mineralized waste form can be produced. The documentation of the selection process of the three tank samples has been separately reported in RPP-48824, Sample Selection Process for Bench-Scale Steam Reforming Treatability Studies Using

  16. Acceptance test procedure, 241-SY-101/241-C-106 shot loading system

    International Nuclear Information System (INIS)

    Ostrom, M.J.

    1994-01-01

    This Acceptance Test Procedure is for the 241-SY-101/241-C-106 Shot Loading System. The procedure will test the components of the Shot Loading System and its capability of adequately loading shot into the annular space of the Container. The loaded shot will provide shielding as required for transporting and storage of a contaminated pump after removal from the tank. This test serves as verification that the SLS is acceptable for use in the pump removal operations for Tanks 241-SY-101, 241-C-106 and 241-AY-102. The pump removal operation for these three tanks will be performed by two different organizations with different equipment, but the Shot Loading System will be compatible between the two operations

  17. The rapid determination of americium curium, and uranium in urine by ultrafiltration

    International Nuclear Information System (INIS)

    Stradling, G.N.; Popplewell, D.S.; Ham, G.J.; Griffin, R.

    1975-01-01

    The rapid ultrafiltration method developed for the assay of plutonium has been extended to the determination of americium, curium and uranium in urine. The limits of detection for americium and curium, and uranium are 0.09 and 0.12 dm -1 l -1 respectively, and the analysis time excluding counting less than 2 hours. The method can therefor be effectively used as a rapid screening procedure. When the reference level for plutonium is exceeded, the α activity may require to be characterised. The single ultrafiltration technique must be modified for turbid urine samples. The method is inappropriate, except for uranium, when the urine contains DTPA. (author)

  18. Carbamoyl methylphosphine oxide derivatives of adamantane as americium and europium extractants

    International Nuclear Information System (INIS)

    Babain, V.A.; Alyapyshev, M.Yu.; Novakov, I.A.; Orlinson, B.S.; Savel'ev, E.N.; Shokova, Eh.A.; Serebrayannikova, A.E.; Kovalev, V.V.

    2007-01-01

    Adamantane di-1,3-carbamoyl methylphosphine oxide (CMPO) derivatives, where CMPO-groups connect with 1,3-positions of rigid adamantane platform by methylene and ethylene bridges, are synthesized, and their efficiency as extractants of americium(III) and europium(III) from nitric acid solutions is demonstrated. Distribution function of Am 3+ and Eu + during extraction from 3M HNO 3 are measured in the investigation of extraction properties. It is noted that first synthesized adamantane CMPO derivatives are more effective for the extraction of americium(III) and europium(III) from 3MHNO 3 [ru

  19. Radioactive Air Emissions Notice of Construction Application for Installation and Operation of a Waste Retrieval System in Tanks 241-AN-101, 241-AN--102, 241-AN--103, 241-AN--104, 241-AN--105, and 241-AN--107

    International Nuclear Information System (INIS)

    HILL, J.S.

    2000-01-01

    This document serves as a notice of construction (NOC) pursuant to the requirements of Washington Administrative Code (WAC) 246-247-060, and as a request for approval to modify pursuant to 40 Code of Federal Regulations (CFR) 61.07, for the installation and operation of one waste retrieval system in each of the following tanks; 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107. Pursuant to 40 CFR 61.09 (aXI), this application is also intended to provide anticipated initial start-up notification. It is requested that EPA approval of this application will also constitute EPA acceptance of the initial start-up notification. This NOC covers the installation and operation o f a waste retrieval system in tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107, and the 241-AN-A/-B Valve Pits. Generally, this includes removal of existing equipment, installation of new equipment, and construction of new ancillary equipment and buildings between now and the year2011. Tanks 241-AN-101, -AN-102, -AN-103, -AN-104, -AN-105 and -AN-107 will provide waste feed for immobilization into a low activity waste (LAW) product

  20. Production of monodisperse respirable aerosols of 241AmO2 and evaluation of in vitro dissolution

    International Nuclear Information System (INIS)

    Boyd, H.A.; Raabe, O.G.; Peterson, P.K.

    1974-01-01

    A method is described for production of monodisperse (sigma//sub g/ less than 1.2) particles of 241 AmO 2 for use in inhalation experiments with dogs and rodents. The effects of physical and chemical factors on the production of polydisperse aerosols of 241 AmO 2 were studied and evaluated. The best aerosol was achieved when a suspension of americium hydroxide with 2.5 mg Am/ml at pH = 7.3 was aerosolized and passed through two heating columns in succession, the first at 300 0 C and the second at 1050 0 C. The particles were roughly spherical and had densities near 8 gm/cm 3 ; the aerosol AMAD and sigma/sub g/ were about 1.5 μm and 1.7, respectively. Monodisperse particles were separated and collected with the Lovelace Aerosol Particle Separator (LAPS) and subsequently suspended in deionized water with pH adjusted to 10.2 with NH 3 for nebulization to produce monodisperse aerosols for inhalation exposures. Particles collected on filters during inhalation experiments were used for evaluation of in vitro dissolution rates with two systems and various forms of a lung fluid simulant. The important role of phosphate ions in such dissolution systems was demonstrated, suggesting the potential for the equally important role of free phosphate in retarding dissolution of AmO 2 particles in the lung. (U.S.)

  1. Valuation of contamination of Am-241 by smear test and characterization of waste by scintillation liquid medium

    Energy Technology Data Exchange (ETDEWEB)

    Cardoso, Gabriella Souza [Pontificia Universidade Catolica de Goias (PUC-GO), Goiania, GO (Brazil). Dept. Matematica, Fisica, Quimica e Engenharia de Alimentos; Santos, Eliane Eugenia dos; Mingote, Raquel Maia; Barbosa, Rugles Cesar, E-mail: esantos@cnen.gov.b, E-mail: mingote@cnen.gov.b, E-mail: rbarbosa@cnen.gov.b [Centro Regional de Ciencias Nucleares do Centro Oeste (CRCN-CO/CNEN-GO), Abadia de Goias, GO (Brazil). Lab. de Radioprotecao

    2011-07-01

    The radioactive lightning rods Interim storage facility receives Midwest Regional Center for Nuclear Science - CRCN-CO, and contains the majority of devices called radioactive lightning rods, and so is our main study object with an interest in be adapt of Interim storage facility (ID) Radiation Protection requirements and management of radioactive waste. The radioactive lightning rods are devices that contain Americium 241 that fall under the categorization of radioactive sources (IAEA-TECDOC-1191) in category 4 (same device category of the static Eliminator type). The handling, transportation, maintenance, segregation and disposal of accessories and devices emitting ionizing radiation in which involve procedures require: special types of packaged, storage techniques, cleaning/hygiene and inventoried and equipment for Radiation Protection. Cleaning and hygiene as well as the disposition criterion of accessories makes it necessary for the introduction of safe cleanup criterion and more specific that the criterion for exemption. The radioactive lightning rods have brackets that represent physical danger in shipping and handling as well as liabilities of contamination as well as in the case of being contaminated, agents in the transfer of contaminants (Am-241) it is necessary to adopt analysis methodologies and procedures and criterion for the management of radioactive and nonradioactive materials. (author)

  2. Valuation of contamination of Am-241 by smear test and characterization of waste by scintillation liquid medium

    International Nuclear Information System (INIS)

    Cardoso, Gabriella Souza; Santos, Eliane Eugenia dos; Mingote, Raquel Maia; Barbosa, Rugles Cesar

    2011-01-01

    The radioactive lightning rods Interim storage facility receives Midwest Regional Center for Nuclear Science - CRCN-CO, and contains the majority of devices called radioactive lightning rods, and so is our main study object with an interest in be adapt of Interim storage facility (ID) Radiation Protection requirements and management of radioactive waste. The radioactive lightning rods are devices that contain Americium 241 that fall under the categorization of radioactive sources (IAEA-TECDOC-1191) in category 4 (same device category of the static Eliminator type). The handling, transportation, maintenance, segregation and disposal of accessories and devices emitting ionizing radiation in which involve procedures require: special types of packaged, storage techniques, cleaning/hygiene and inventoried and equipment for Radiation Protection. Cleaning and hygiene as well as the disposition criterion of accessories makes it necessary for the introduction of safe cleanup criterion and more specific that the criterion for exemption. The radioactive lightning rods have brackets that represent physical danger in shipping and handling as well as liabilities of contamination as well as in the case of being contaminated, agents in the transfer of contaminants (Am-241) it is necessary to adopt analysis methodologies and procedures and criterion for the management of radioactive and nonradioactive materials. (author)

  3. Multilevel resonance parameters of 241Pu

    International Nuclear Information System (INIS)

    Weston, L.W.; Todd, J.H.

    1978-01-01

    The data previously reported by the authors on the neutron fission and capture cross sections of 241 Pu were simultaneously fit with the Adler formalism to obtain multilevel resonance parameters. The neutron energy range of the fit was 0.01 to 100 eV. The 241 Pu cross sections in the resonance region of neutron energies are complex, and the Adler parameters present an efficient method of representing these cross sections, which are important for plutonium-fueled reactors. The parameters represent the data to an accuracy within the quoted experimental errors. 5 figures, 2 tables

  4. Experimental studies to validate model calculations and maximum solubility limits for Plutonium and Americium; Experimentelle Arbeiten zur Absicherung von Modellrechnungen und Maximalkonzentrationen fuer Plutonium und Americium

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2017-02-16

    This report focuses on studies of KIT-INE to derive a significantly improved description of the chemical behaviour of Americium and Plutonium in saline NaCl, MgCl{sub 2} and CaCl{sub 2} brine systems. The studies are based on new experimental data and aim at deriving reliable Am and Pu solubility limits for the investigated systems as well as deriving comprehensive thermodynamic model descriptions. Both aspects are of high relevance in the context of potential source term estimations for Americium and Plutonium in aqueous brine systems and related scenarios. Americium and Plutonium are long-lived alpha emitting radionuclides which due to their high radiotoxicity need to be accounted for in a reliable and traceable way. The hydrolysis of trivalent actinides and the effect of highly alkaline pH conditions on the solubility of trivalent actinides in calcium chloride rich brine solutions were investigated and a thermodynamic model derived. The solubility of Plutonium in saline brine systems was studied under reducing and non-reducing conditions and is described within a new thermodynamic model. The influence of dissolved carbonate on Americium and Plutonium solubility in MgCl{sub 2} solutions was investigated and quantitative information on Am and Pu solubility limits in these systems derived. Thermodynamic constants and model parameter derived in this work are implemented in the Thermodynamic Reference Database THEREDA owned by BfS. According to the quality assurance approach in THEREDA, is was necessary to publish parts of this work in peer-reviewed scientific journals. The publications are focused on solubility experiments, spectroscopy of aquatic and solid species and thermodynamic data. (Neck et al., Pure Appl. Chem., Vol. 81, (2009), pp. 1555-1568., Altmaier et al., Radiochimica Acta, 97, (2009), pp. 187-192., Altmaier et al., Actinide Research Quarterly, No 2., (2011), pp. 29-32.).

  5. Solubilization of 241AmO2 in alveolar macrophage cultures

    International Nuclear Information System (INIS)

    Robinson, A.V.; Schneider, R.P.

    1980-01-01

    Cultured rabbit alveolar macrophages were used to study the effect of phagocytosis on the solubilization of 241 AmO 2 . A comparison was made of the solubility of phagocytized AmO 2 and AmO 2 in cell-free media, in the presence and absence of 0.1 mM DTPA. A time-dependent increase of 26% in the soluble (0.1-μm filtrate) intracellular americium fraction was seen in macrophages cultured for 3 days. The addition of 0.1mM DTPA to culture medium resulted in an increase of 36% over the same time period. In contrast, cell-free media without DTPA resulted in less than a 2% increase in solubility after 4 days of incubation, while addition of 0.1mM DTPA resulted in a 5% increase over the same time period. These results indicate cell-mediated solbuilization of phagocytized AmO 2 by macrophages

  6. 'Americium(III)/trivalent lanthanides' separation using organothiophosphinic acids

    International Nuclear Information System (INIS)

    Hill, C.; Madic, C.; Baron, P.; Ozawa, Masaki; Tanaka, Yasumasa.

    1997-01-01

    The present paper describes the extraction of neodymium and other lanthanides by saponified Cyanex 301 acid. The saponification of commercial Cyanex 301 acid favoured the extraction of macro concentrations of neodymium from sodium nitrate aqueous solutions (pH eq ∼ 4). The amount of lanthanide extracted in the organic phase always reached the third of the initial concentration of saponified Cyanex 301 acid, which assumed a cation exchange mechanism to occur during the extraction. No nitrate anion took part in the complex formation. This paper also compares the abilities of purified Cyanex 301, Cyanex 302 and Cyanex 272 acids to extract and separate 241 Am(III) from 152 Eu(III). Very high separation factors S.F. Am/Eu were observed in the case of purified Cyanex 301 acid. Finally some studies are presented herein using tri-n-butylphosphate (TBP) as a synergistic extractant with Cyanex 301 acid to separate actinides from trivalent lanthanide. (author)

  7. Explosion of cation exchange column in americium recovery service, Hanford plant, August 30, 1976

    International Nuclear Information System (INIS)

    1976-01-01

    This document is a collection of thirty references related to the explosion of the cation exchange column in the Americium Recovery Service of the Hanford Atomic Products Operation, Richland, Washington, on August 30, 1976. Some of the documents are related to the design and safety studies, while others refer to the accident and resulting decontamination efforts, investigations, and legal consequences

  8. Total and Compound Formation Cross Sections for Americium Nuclei: Recommendations for Coupled-Channels Calculations

    Energy Technology Data Exchange (ETDEWEB)

    Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-04-11

    Calculations for total cross sections and compound-nucleus (CN) formation cross sections for americium isotopes are described, for use in the 2017 NA-22 evaluation effort. The code ECIS 2006 was used in conjunction with Frank Dietrich's wrapper `runtemplate'.

  9. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning

    1986-01-01

    Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were co...

  10. Biokinetic study of plutonium and americium associated to the particulates of soil

    International Nuclear Information System (INIS)

    Espinosa, A.; Aragon, A.; Martinez, J.; Iranzo, C.E.

    1996-01-01

    The object of this study is to determine the biokinetic parameters of different Plutonium isotopes and Americium inhaled in the state in which they are found in the environment as a result of their deposition in the soil, from an aviation accident that generated different plutonium oxides. to achieve this objective, two lines of work planned. One was the determination of the mineralogical composition and associations that plutonium and americium present in that soil 22 years after the nuclear accident. Other studies were directed to determine the biokinetic of the plutonium isotopes and americium (contained in the dust) deposited tracheally and inhaled by laboratory animals (rats) and in vitro experiments by pulmonary leaching simulation. The in vivo tests have been developed in NRPB (U.K.) and the in vitro experiment, geochemical associations studies, assessment of internal doses to humans resulting from intake of plutonium and americium bearing dusts present in the contaminated area and establishment of ALIs for inhalation, were carried out in CIEMAT (Spain). In this work only determinations and experiments carried out by CIEMAT are includes as a part of the EU Project ''INHALATION AND INGESTION OF RADIONUCLIDES'' contract: FI3P-CT920064a. (Author) 10 refs

  11. Speciation and bioavailability of plutonium and americium in the Irish Sea and other marine ecosystems

    International Nuclear Information System (INIS)

    Vives i Batlle, J.

    1993-12-01

    Since the late 1960s, the Irish Sea has become a repository for a variety of radio-elements originating mainly in discharges from the British Nuclear Fuels (BNF) plc. Sellafield reprocessing complex located on the Cumbrian coast. In particular, transuranium nuclides such as plutonium, americium and curium (the main constituents of the α-emitting discharges) have become incorporated into every marine compartment by a variety of mechanisms, many of which are not well understood. Although extensive studies have been carried out in the near-field (eastern Irish Sea, especially in the vicinity of the discharge point and collateral muddy sediments), comparatively little had been done to assess the long-term behaviour and bioavailability of plutonium and americium in the far-field, e.g., the western Irish Sea, prior to the present study. In this dissertation, the results of an extensive research programme, undertaken in order to improve and refine our understanding of the behaviour of plutonium and americium in the marine environment, are presented. Specifically, the thesis details the results of (and conclusions deduced from) a series of experiments in which the physical and chemical speciation, colloidal association, mobility and bioavailability of plutonium and americium were examined in diverse environments including the Irish Sea and the Mediterranean. (author)

  12. Tank 241-C-105 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-105

  13. Tank 241-BY-106 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, PNL 325 Analytical Chemistry Laboratory, and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-106

  14. Tank 241-AX-104 tank characterization plan

    International Nuclear Information System (INIS)

    Sathyanarayana, P.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-104

  15. Tank 241-AX-102 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-AX-102

  16. Tank 241-U-111 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-111

  17. Tank 241-C-101 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-101

  18. Tank 241-T-111 tank characterization plan

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-T-111

  19. Tank 241-U-103 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-U-103

  20. Tank 241-TX-118 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-118

  1. Tank 241-AP-107 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-AP-107

  2. Tank 241-BX-104 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-BX-104

  3. Tank 241-TY-101 Tank Characterization Plan

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TY-101

  4. Tank 241-T-107 tank characterization plan

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-T-107

  5. Review of 241 Pu resonance parameters

    International Nuclear Information System (INIS)

    Derrien, H.

    1981-10-01

    The status of 241 Pu resonance parameters is reviewed. The most important recent results are compared in some energy ranges, both from single level and multilevel point of view. It appears that an accurate set of resonance parameters is not still obtained for a general description of the cross-sections in the resonance region. Some recommendations are given for further experiments or evaluations

  6. Tank 241-TX-105 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, Oak Ridge National Laboratory, and PNL tank vapor program. The scope of this plan is to provide guidance for the sampling and analysis of vapor samples from tank 241-TX-105

  7. Retention and translocation of foliar applied {sup 239,240}Pu and {sup 241}Am, as compared to {sup 137}Cs and {sup 85}Sr, into bean plants (Phaseolus vulgaris)

    Energy Technology Data Exchange (ETDEWEB)

    Henner, P. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)]. E-mail: pascale.henner@irsn.fr; Colle, C. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France); Morello, M. [Institute for Radioprotection and Nuclear Safety, Environment and Emergency Operations Division, Department for the Study of Radionuclides Behaviour in Ecosystems, Laboratory of Radioecology and Ecotoxicology, IRSN/DPRE/SECRE/LRE, Cadarache Centre, Building 186, BP 3, 13115 Saint-Paul-lez-Durance (France)

    2005-07-01

    Foliar transfer of {sup 241}Am, {sup 239,240}Pu, {sup 137}Cs and {sup 85}Sr was evaluated after contamination of bean plants (Phaseolus vulgaris) at the flowering development stage, by soaking their first two trifoliate leaves into contaminated solutions. Initial retentions of {sup 241}Am (27%) and {sup 239,240}Pu (37%) were higher than those of {sup 137}Cs and {sup 85}Sr (10-15%). Mean fraction of retained activity redistributed among bean organs was higher for {sup 137}Cs (20.3%) than for {sup 239,240}Pu (2.2%), {sup 241}Am (1%) or {sup 85}Sr (0.1%). Mean leaf-to-pod translocation factors (Bq kg{sup -1}dry weight pod/Bq kg{sup -1}dry weight contaminated leaves) were 5.0 x 10{sup -4} for {sup 241}Am, 2.7 x 10{sup -6} for {sup 239,240}Pu, 5.4 x 10{sup -2} for {sup 137}Cs and 3.6 x 10{sup -4} for {sup 85}Sr. Caesium was mainly recovered in pods (12.8%). Americium and strontium were uniformly redistributed among leaves, stems and pods. Plutonium showed preferential redistribution in oldest bean organs, leaves and stems, and very little redistribution in forming pods. Results for americium and plutonium were compared to those of strontium and caesium to evaluate the consistency of the attribution of behaviour of strontium to transuranium elements towards foliar transfer, based on translocation factors, as stated in two radioecological models, ECOSYS-87 and ASTRAL.

  8. Human bones obtained from routine joint replacement surgery as a tool for studies of plutonium, americium and {sup 90}Sr body-burden in general public

    Energy Technology Data Exchange (ETDEWEB)

    Mietelski, Jerzy W., E-mail: jerzy.mietelski@ifj.edu.pl [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Edward B. [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Department of Physical Therapy Basics, Faculty of Physical Therapy, Administration College, Bielsko-Biala (Poland); Tomankiewicz, Ewa [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Joanna [Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Nowak, Sebastian [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Szczygiel, Elzbieta [Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Brudecki, Kamil [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland)

    2011-06-15

    The paper presents a new sampling method for studying in-body radioactive contamination by bone-seeking radionuclides such as {sup 90}Sr, {sup 239+240}Pu, {sup 238}Pu, {sup 241}Am and selected gamma-emitters, in human bones. The presented results were obtained for samples retrieved from routine surgeries, namely knee or hip joints replacements with implants, performed on individuals from Southern Poland. This allowed to collect representative sets of general public samples. The applied analytical radiochemical procedure for bone matrix is described in details. Due to low concentrations of {sup 238}Pu the ratio of Pu isotopes which might be used for Pu source identification is obtained only as upper limits other then global fallout (for example Chernobyl) origin of Pu. Calculated concentrations of radioisotopes are comparable to the existing data from post-mortem studies on human bones retrieved from autopsy or exhumations. Human bones removed during knee or hip joint surgery provide a simple and ethical way for obtaining samples for plutonium, americium and {sup 90}Sr in-body contamination studies in general public. - Highlights: > Surgery for joint replacement as novel sampling method for studying in-body radioactive contamination. > Proposed way of sampling is not causing ethic doubts. > It is a convenient way of collecting human bone samples from global population. > The applied analytical radiochemical procedure for bone matrix is described in details. > The opposite patient age correlations trends were found for 90Sr (negative) and Pu, Am (positive).

  9. Determination of environmental levels of 239240Pu, 241Am, 137Cs, and 90Sr in large volume sea water samples

    International Nuclear Information System (INIS)

    Sutton, D.C.; Calderon, G.; Rosa, W.

    1976-06-01

    A method is reported for the determination of environmental levels of 239 240 Pu and 241 Am in approximately 60-liter size samples of seawater. 137 Cs and 90 Sr were also separated and determined from the same samples. The samples were collected at the sea surface and at various depths in the oceans through the facilities of the Woods Hole Oceanographic Institution. Plutonium and americium were separated from the seawater by iron hydroxide scavenging then treated with a mixture of nitric, hydrochloric, and perchloric acids. A series of anion exchange separations were used to remove interferences and purify plutonium and americium; then each was electroplated on platinum disks and measured by solid state alpha particle spectrometry. The overall chemical yields averaged 62 +- 9 and 69 +- 14 percent for 236 Pu, and 243 Am tracers, respectively. Following the iron hydroxide scavenge of the transuranics, cesium was removed from the acidified seawater matrix by adsorption onto ammonium phosphomolybdate. Cesium carrier and 137 Cs isolation was effected by ion exchange and precipitations were made using chloroplatinic acid. The samples were weighed to determine overall chemical yield then beta counted. Cesium recoveries averaged 75 +- 5 percent. After cesium was removed from the seawater matrix, the samples were neutralized with sodium hydroxide and ammonium carbonate was added to precipitate 85 Sr tracer and the mixed alkaline earth carbonates. Strontium was separated as the nitrate and scavenged by chromate and hydroxide precipitations. Yttrium-90 was allowed to build up for two weeks, then milked and precipitated as the oxalate, weighed, and beta counted. The overall chemical yields of 85 Sr tracer averaged 84 +- 16 percent. The recovery of the yttrium oxalate precipitates averaged 96 +- 3 percent

  10. Results of 90Sr and 239+240Pu, 238Pu, 241Am measurements in some samples of mushrooms and forest soil from Poland

    International Nuclear Information System (INIS)

    Mietelski, J.W.; Larosa, J.; Ghods, A.

    1992-01-01

    Strontium-90, plutonium and americium activity concentrations in a few samples of forest soils, some species of mushrooms and fern leaves were determined. These results are compared with caesium activity concentrations in the same materials obtained in a previous work. Radiochemical procedures are described. The origin of the contamination (Chernobyl accident or nuclear test explosion release) is discussed. The 90 Sr activity concentration ranges from 0.6 Bq/kg (mushroom samples) to 48.4 Bq/kg (fern leaves). For 239+240 Pu, it ranges from not detected above background (mushrooms, fern) to 10.8 Bq/kg (humus layer of forest soil). The maximum concentration of 241 Am is found to be 2.4 Bq/kg (humus sample) and for 238 Pu it is 0.85 Bq/kg (also in the humus sample). (author). 12 refs, 9 figs, 7 tabs

  11. Sample preparation of tank 241-C-106 grab samples and testing For compatibility with tank 241-AY-102 supernate

    International Nuclear Information System (INIS)

    Crawford, B.A.

    1996-01-01

    This test plan describes a sample separation method which will be used to obtain physical measurements and separated 241-C-106 solids and supernate fractions. In addition compatibility of tank 241-C-106 sludge with tank 241-AY-102 supernate will be determined

  12. Characterization of strong (241)Am sources.

    Science.gov (United States)

    Vesterlund, Anna; Chernikova, Dina; Cartemo, Petty; Axell, Kåre; Nordlund, Anders; Skarnemark, Gunnar; Ekberg, Christian; Ramebäck, Henrik

    2015-05-01

    Gamma ray spectra of strong (241)Am sources may reveal information about the source composition as there may be other radioactive nuclides such as progeny and radioactive impurities present. In this work the possibility to use gamma spectrometry to identify inherent signatures in (241)Am sources in order to differentiate sources from each other, is investigated. The studied signatures are age, i.e. time passed since last chemical separation, and presence of impurities. The spectra of some sources show a number of Doppler broadened peaks in the spectrum which indicate the presence of nuclear reactions on light elements within the sources. The results show that the investigated sources can be differentiated between by age and/or presence of impurities. These spectral features would be useful information in a national nuclear forensics library (NNFL) in cases when the visual information on the source, e.g. the source number, is unavailable. Copyright © 2015 Elsevier Ltd. All rights reserved.

  13. Local Structure in Americium and Californium Hexa-cyanoferrates - Comparison with Their Lanthanide Analogues

    International Nuclear Information System (INIS)

    Dupouy, G.; Bonhoure, I.; Dumas, Th.; Moisy, Ph.; Petit, S.; Den Auwer, Ch.; Conradson, St.D.; Hennig, Ch.; Scheinost, A.C.; Le Naour, C.; Simoni, E.

    2011-01-01

    Metal hexa-cyanoferrates are well known molecular solids for a large variety of cations, although very little has been described for actinide adducts. Two new members of actinide(III) hexa-cyanoferrates were synthesized with the cations americium and californium. They were structurally characterized by infrared and X-ray absorption spectroscopy. Combined EXAFS data at the iron K edge and actinide L 3 edge provide evidence for a three-dimensional model for these two new compounds. Structural data in terms of bond lengths were compared to those reported for the parent lanthanide(III) compounds, neodymium and gadolinium hexa-cyanoferrates, respectively: the americium compound with (KNd(III)Fe(II)-Fe-III(CN) 6 .4H 2 O and the californium compound with (KGd(III)Fe(II)(CN) . 3.5H 2 O and (KGd(III)Fe(II)(CN) 6 .3H 2 O. This comparison between actinide and lanthanide homologues has been carried out on the basis of ionic radii considerations. The americium and neodymium environments appear to be very similar and are arranged in a tri-capped trigonal prism polyhedron of coordination number 9 (CN: 9), in which the americium atom is bonded to six nitrogen atoms and to three water molecules. For the californium adduct, a similar comparison and bond length and angle values derived from EXAFS studies suggest that the californium cation sits in a bi-capped trigonal prism (CN: 8) as in (KGd(III)Fe(II)(CN) 6 . 3H 2 O. This arrangement differs from that in the structure of (KGd(III)Fe(II)(CN) 6 .3.5H 2 O, in which the gadolinium atom is surrounded by 9 atoms. This is one of the rare pieces of information revealed by EXAFS spectroscopy for americium and californium in comparison to lanthanide atoms in molecular solid compounds. A discussion on the decrease in bond length and coordination number from americium to californium is also provided, on the basis of crystallographic results reported in the literature for actinide(III) and lanthanide(III) hydrate series. (authors)

  14. Depth profiling of Pu, 241Am and 137Cs in soils from southern Belarus measured by ICP-MS and alpha and gamma spectrometry.

    Science.gov (United States)

    Boulyga, Sergei F; Zoriy, Myroslav; Ketterer, Michael E; Becker, J Sabine

    2003-08-01

    The depth distribution of plutonium, americium, and 137Cs originating from the 1986 accident at the Chernobyl Nuclear Power Plant (NPP) was investigated in several soil profiles in the vicinity from Belarus. The vertical migration of transuranic elements in soils typical of the 30 km relocation area around Chernobyl NPP was studied using inductively coupled plasma mass spectrometry (ICP-MS), alpha spectrometry, and gamma spectrometry. Transuranic concentrations in upper soil layers ranged from 6 x 10(-12) g g(-1) to 6 x 10(-10) g g(-1) for plutonium and from 1.8 x 10(-13) g g(-1) to 1.6 x 10(-11) g g(-1) for americium. These concentrations correspond to specific activities of (239+240)Pu of 24-2400 Bq kg(-1) and specific activity of 241Am of 23-2000 Bq kg(-1), respectively. Transuranics in turf-podzol soil migrate slowly to the deeper soil layers, thus, 80-95%, of radionuclide inventories were present in the 0-3 cm intervals of turf-podzol soils collected in 1994. In peat-marsh soil migration processes occur more rapidly than in turf-podzol and the maximum concentrations are found beneath the soil surface (down to 3-6 cm). The depth distributions of Pu and Am are essentially identical for a given soil profile. (239+240)Pu/137Cs and 241Am/137Cs activity ratios vary by up to a factor of 5 at some sites while smaller variations in these ratios were observed at a site close to Chernobyl, suggesting that 137Cs is dominantly particle associated close to Chernobyl but volatile species of 137Cs are of relatively greater importance at the distant sites.

  15. Reference: 241 [Arabidopsis Phenome Database[Archive

    Lifescience Database Archive (English)

    Full Text Available 241 http://metadb.riken.jp/db/SciNetS_ria224i/cria224u4ria224u16024589i Calderon-V...development of Arabidopsis thaliana. 9 2473-85 16024589 2005 Sep The Plant cell Bevan Mike|Calderon-Villalobos Luz I A|Dohmann Esther M N|Kuhnle Carola|Li Hanbing|Schwechheimer Claus

  16. Tank 241-U-203: Tank Characterization Plan

    International Nuclear Information System (INIS)

    Sathyanarayana, P.

    1995-01-01

    The revised Federal Facility Agreement and Consent Order states that a tank characterization plan will be developed for each double-shell tank and single-shell tank using the data quality objective process. The plans are intended to allow users and regulators to ensure their needs will be met and resources are devoted to gaining only necessary information. This document satisfies that requirement for Tank 241-U-203 sampling activities

  17. Status of 241Am recovery and purification at Los Alamos Scientific Laboratory

    International Nuclear Information System (INIS)

    Ramsey, H.D.; Clifton, D.G.; Hayter, S.W.; Penneman, R.A.; Christensen, E.L.

    1980-01-01

    Americium recovery was initiated at Los Alamos Scientific Laboratory (LASL) in the late 1940's. The early procedures separated gram quantities of americium from large amounts of impurities including plutonium and the rare earths. Ion exchange procedures were developed for further purification. Until recently, no routine processing of americium has been done at LASL for several years. The increasing demand for americium in oil-well logging instruments and other uses led LASL to develop and install a process to recover larger quantities of americium. The LASL process was developed around the chemistry of americium that had been elucidated both at LASL and at other facilities. Presently, the americium feed is obtained as a by-product from a plutonium purification process at the new plutonium facility at LASL. This feed filtrate from a peroxide precipitation process is precipitated as a slurry of hydroxides, filtered, dissolved in nitric acid, and passed through an anion exchange column to remove any residual plutonium. The americium, contained in the effluent, is precipitated as the oxalate and calcined to the oxide. Americium is also available in other highly salted acidic process streams. These should lend themselves to solvent extraction. Developmental work has been promising, and a dibutyl butyl phosphate-kerosene extraction process is being brought on-line

  18. Thermal and Radiolytic Gas Generation Tests on Material from Tanks 241-U-103, 241-AW-101, 241-S-106, and 241-S-102: Status Report

    International Nuclear Information System (INIS)

    King, C.M.; Bryan, S.A.

    1999-01-01

    This report summarizes progress in evaluating thermal and radiolytic flammable gas generation in actual Hanford single-shell tank wastes. The work described was conducted at Pacific Northwest National Laboratory (PNNL) for the Flammable Gas Safety Project, whose purpose is to develop information to support DE and S Hanford (DESH) and Project Management Hanford Contract (PHMC) subcontractors in their efforts to ensure the safe interim storage of wastes at the Hanford Site. This work is related to gas generation studies performed by Numatec Hanford Corporation (formerly Westinghouse Hanford Company). This report describes the results of laboratory tests of gas generation from actual convective layer wastes from Tank 241-U-103 under thermal and radiolytic conditions. Accurate measurements of gas generation rates from highly radioactive tank wastes are needed to assess the potential for producing and storing flammable gases within the tanks. The gas generation capacity of the waste in Tank 241-U-103 is a high priority for the Flammable Gas Safety Program due to its potential for accumulating gases above the flammability limit (Johnson et al, 1997). The objective of this work was to establish the composition of gaseous degradation products formed in actual tank wastes by thermal and radiolytic processes as a function of temperature. The gas generation tests on Tank 241-U-103 samples focused first on the effect of temperature on the composition and rate of gas generation Generation rates of nitrogen, nitrous oxide, methane, and hydrogen increased with temperature, and the composition of the product gas mixture varied with temperature

  19. Structural characterisations and mechanistic investigations of the selective dissolution of americium by the ferricyanide ions in alkaline media. Application for the partitioning americium curium

    International Nuclear Information System (INIS)

    Fouchard, Sebastien

    2000-01-01

    Americium exhibits a high solubility form in basic media under oxidant conditions, unlike the other Transplutonium elements (TPE). This property can be used in the frame of High Level Liquid Waste (HLLW) treatment in order to extract preferentially the americium element, the main responsible of the long term radiotoxicity of the nuclear waste. This soluble compound can be obtained by addition of a concentrated basic solution of Fe(CN) 6 3- ions on Am(OH) 3 precipitates. This technique enables a rapid extraction of Am by the synthesis of this soluble form in alkaline solutions. Under these conditions, the other TPE remain in the solid state as trivalent hydroxide solids, strongly insoluble. In the case of dissolutions involving large amounts of Am(OH) 3 , the formation of the soluble complex is concomitant with the appearance of a reddish precipitate in the basic solution. Dissolution experiments which were carried out on this solid in NaOH/Fe(CN) 6 3- have demonstrated the dependency of the solubility equilibria with the media. Spectroscopic studies (UV Visible, XAS) on the precipitate have enabled the determination of the chemical structure and the oxidation state of the americium in the solid: Na 2 Am(V)O 2 (OH) 3 ,nH 2 O. Electrochemical studies on the americium solution have confirmed that the oxidation of Am(OH) 3 by the Fe(CN) 6 3- ions in basic media could only lead to the pentavalent form. A stoichiometric study carries out between a AmO 2 + ion and one Fe(CN) 6 3- ion and the spectroscopic characterisation of this reaction have demonstrated that the Fe(CN) 6 3- ion didn't remain as an un-complexed form in solution after the alkaline mixing. These results tend to prove that this dissolution of Am(OH) 3 is much more complex than a simple oxidation by the Fe(CN) 6 3- ions. The existence of molecular interactions between AmO 2 + and Fe(CN) 6 3- has been postulated and a mechanistic scheme has been proposed in order to explain the appearance of the soluble

  20. Influence of biofilms on migration of uranium, americium and europium in the environment; Einfluss von Biofilmen auf das Migrationsverhalten von Uran, Americium und Europium in der Umwelt

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-07-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  1. Determination of 241Am and 244Cm in environmental samples

    International Nuclear Information System (INIS)

    Bonino, N.O.; Grinman, A.D.R.; Serdeiro, N.H.

    1998-01-01

    The present technique describes a method to separate, purify and measure low levels of americium and curium in different environmental samples such as sediments, soils, water, vegetables, and air filters. The determination of radionuclides in theses environmental matrices have analytical problems, since a simple method doesn't exist for the purification, which is indispensable for its later measuring alpha spectrometry. The developed technique consist on taking an aliquot of the sample to analyze, to add tracer as americium 243 and curium 242, and to dissolve the matrix in a such way to have a clear solution. For the isolation of the americium and curium of the other actinides ar used as separation techniques: precipitation with Fe 3+ , anionic and cationic exchange, and extraction with a appropriate organic solvent. The purification of the americium and curium is followed by the electrodeposition habitually used. The measurement is carried out by alpha spectrometry with a detector of implanted ion. The detection limit for this techniques is of 0,002 Bq/l or 0,2 mBq in the case of filters. (author)

  2. Biological Monitoring for Plutonium-241; Detection du Plutonium-241 par Controles Biologiques; Dozimetriya Plutoniya-241 v biologicheskikh materialakh; Determinacion del Plutonio-241 en Sustancias Biologicas

    Energy Technology Data Exchange (ETDEWEB)

    Dalton, J. C.; McDonald, B. J.; Barnes, V. [United Kingdom Atomic Energy Authority, Windscale Works, Sellafield (United Kingdom)

    1965-10-15

    The origin and characteristics of {sup 241}Pu are described, special emphasis being given to its consideration as a health hazard, and to the problem of its determination. A counting system is described which is at present under development at Windscale for the low-level quantitative assay of {sup 241}Pu in samples from a biological monitoring programme. The technique at its present stage of development is at least as sensitive as procedures previously reported, and represents an improvement in terms of simplicity, rapidity and economy. The procedure is intended primarily for use in urinanalysis to supplement information already obtained from autoradiographic analysis of {alpha}-active plutonium isotopes. The same source disc is used for {sup 241}Pu assay thereby economizing in preparative effort. The isotopes of plutonium are first separated from the sample of urine, or other biological material, in a state of high radiochemical purity using an anion exchange procedure. They are then electrodeposited on to a stainless-steel disc. A direct count of the {sup 241}Pu soft beta-ray spectrum (maximum energy 20 keV, half-life 13.3 years) is obtained in an anti-coincidence system consisting of a small-volume gas-flow proportional counter with a plastic phosphor scintillation anti-coincidence guard. The dimensions are such that all the plutonium {beta}-particles are absorbed within the proportional counter while the {alpha}-particles dissipate about half their energy within the plastic phosphor. The geometry for both radiations is almost 2{pi}. At its present stage of development the equipment will detect 3 pCi of {sup 241}Pu in a counting time of one hour. This represents the 24 h urinary excretion rate 3 months after the intake of about 5% of a maximum permissible body-burden (0.9 {mu}Ci). The discs are subsequently assayed for a'-active plutonium isotopes by exposure for one week to a nuclear track plate which is then examined visually using a microscope. (author

  3. Transmutation of americium and curium incorporated in zirconia-based host materials

    International Nuclear Information System (INIS)

    Raison, P.E.

    2001-01-01

    Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO 2 -ZrO 2 -Y 2 O 3 . It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO 2 content. The Cm 2 O 3 -ZrO 2 system was also investigated. It was found that at 25 mol% of CmO 1.5 , the Cm(III) stabilized zirconia in its cubic form (a = 5.21 ±0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO 1.5 , a pyrochlore oxide - Cm 2 Zr 2 O 7 - is formed (a = 10.63 ±0.02 Angstrom). (author)

  4. High-purity germanium detection system for the in vivo measurement of americium and plutonium

    International Nuclear Information System (INIS)

    Tyree, W.H.; Falk, R.B.; Wood, C.B.; Liskey, R.W.

    1976-01-01

    A high-purity germanium (HPGe) array, photon-counting system has been developed for the Rocky Flats Plant Body-Counter Medical Facility. The newly improved system provides exceptional resolutions of low-energy X-ray and gamma-ray spectra associated with the in vivo deposition of plutonium and americium. Described are the operational parameters of the system and some qualitative results illustrating detector performance for the photon emissions produced from the decay of plutonium and americium between energy ranges from 10 to 100 kiloelectron volts. Since large amounts of data are easily generated with the system, data storage, analysis, and computer software developments continue to be an essential ingredient for processing spectral data obtained from the detectors. Absence of quantitative data is intentional. The primary concern of the study was to evaluate the effects of the various physical and electronic operational parameters before adding those related entirely to a human subject

  5. Electrodeposition of americium on a liquid cadmium cathode from a molten salt bath

    International Nuclear Information System (INIS)

    Laplace, A.; Lacquement, J.; Maillard, C.; Donner, L.

    2004-01-01

    A high-activity experiment involving the electrode position of americium on a liquid cadmium cathode from a LiCl-KCl eutectic with about 3 g of AmO 2 was conducted in a shielded cell in the ATALANTE complex. After describing the electrolyzer and the experimental conditions, the authors discuss the preparation of the LiCl-KCl-AmCl 3 solution and briefly review its electrochemical properties. It was clearly confirmed that Am(III) reduction on an inert solid cathode occurs in two steps forming Am(II) before Am(0), whereas only one reduction step was observed on liquid cadmium. The main results of this study concern americium electrode position on the liquid cadmium cathode (recovery yields, current densities, problems encountered). The solvent properties of cadmium for actinide/lanthanide separation are discussed. (authors)

  6. Quantitative determination of americium and curium in solutions using potassium tungstophosphate

    International Nuclear Information System (INIS)

    Chistyakov, V.M.; Baranov, A.A.; Erin, E.A.; Timoaeev, G.A.

    1990-01-01

    Two methods of americium (4) and curium (4) titration-replacement and redox ones - have been considered. According to the replacement method thorium nitrate solution was used as a titrant and the final point of titration was determined spectophotometrically. Using the method developed, on the basis of experimental data, the composition of thorium (4) complex with potassium tungstophosphate was determined. In case of the redox titration sodium nitrite was used, and the final titration point was indicated either spectrophotometrically or potentiometrically

  7. Determination of americium and plutonium in autopsy tissue: methods and problems

    International Nuclear Information System (INIS)

    Boyd, H.A.; Eutsler, B.C.; McInroy, J.F.

    1979-01-01

    The current methods used by the tissue analysis program at LASL for the determination of americium and plutonium in autopsy tissue are described. Problems affecting radiochemical yield are discussed. Included are problems associated with sample preparation, separation of plutonium from large amounts of bone ash, and reagent contamination. The average 242 Pu tracer yield for 1800 Pu determinations is 78 +- 12%. The average 242 Am tracer yield is 85 +- 7% for 40 determinations

  8. Experimental studies to validate model calculations and maximum solubility limits for Plutonium and Americium

    International Nuclear Information System (INIS)

    2017-01-01

    This report focuses on studies of KIT-INE to derive a significantly improved description of the chemical behaviour of Americium and Plutonium in saline NaCl, MgCl 2 and CaCl 2 brine systems. The studies are based on new experimental data and aim at deriving reliable Am and Pu solubility limits for the investigated systems as well as deriving comprehensive thermodynamic model descriptions. Both aspects are of high relevance in the context of potential source term estimations for Americium and Plutonium in aqueous brine systems and related scenarios. Americium and Plutonium are long-lived alpha emitting radionuclides which due to their high radiotoxicity need to be accounted for in a reliable and traceable way. The hydrolysis of trivalent actinides and the effect of highly alkaline pH conditions on the solubility of trivalent actinides in calcium chloride rich brine solutions were investigated and a thermodynamic model derived. The solubility of Plutonium in saline brine systems was studied under reducing and non-reducing conditions and is described within a new thermodynamic model. The influence of dissolved carbonate on Americium and Plutonium solubility in MgCl 2 solutions was investigated and quantitative information on Am and Pu solubility limits in these systems derived. Thermodynamic constants and model parameter derived in this work are implemented in the Thermodynamic Reference Database THEREDA owned by BfS. According to the quality assurance approach in THEREDA, is was necessary to publish parts of this work in peer-reviewed scientific journals. The publications are focused on solubility experiments, spectroscopy of aquatic and solid species and thermodynamic data. (Neck et al., Pure Appl. Chem., Vol. 81, (2009), pp. 1555-1568., Altmaier et al., Radiochimica Acta, 97, (2009), pp. 187-192., Altmaier et al., Actinide Research Quarterly, No 2., (2011), pp. 29-32.).

  9. Development of analytical methods for the separation of plutonium, americium, curium and neptunium from environmental samples

    Energy Technology Data Exchange (ETDEWEB)

    Salminen, S.

    2009-07-01

    In this work, separation methods have been developed for the analysis of anthropogenic transuranium elements plutonium, americium, curium and neptunium from environmental samples contaminated by global nuclear weapons testing and the Chernobyl accident. The analytical methods utilized in this study are based on extraction chromatography. Highly varying atmospheric plutonium isotope concentrations and activity ratios were found at both Kurchatov (Kazakhstan), near the former Semipalatinsk test site, and Sodankylae (Finland). The origin of plutonium is almost impossible to identify at Kurchatov, since hundreds of nuclear tests were performed at the Semipalatinsk test site. In Sodankylae, plutonium in the surface air originated from nuclear weapons testing, conducted mostly by USSR and USA before the sampling year 1963. The variation in americium, curium and neptunium concentrations was great as well in peat samples collected in southern and central Finland in 1986 immediately after the Chernobyl accident. The main source of transuranium contamination in peats was from global nuclear test fallout, although there are wide regional differences in the fraction of Chernobyl-originated activity (of the total activity) for americium, curium and neptunium. The separation methods developed in this study yielded good chemical recovery for the elements investigated and adequately pure fractions for radiometric activity determination. The extraction chromatographic methods were faster compared to older methods based on ion exchange chromatography. In addition, extraction chromatography is a more environmentally friendly separation method than ion exchange, because less acidic waste solutions are produced during the analytical procedures. (orig.)

  10. Influence of dissolved organic substances in groundwater on sorption behavior of americium and neptunium

    International Nuclear Information System (INIS)

    Boggs, S. Jr.; Seitz, M.G.

    1984-01-01

    Groundwaters typically contain dissolved organic carbon consisting largely of high molecular weight compounds of humic and fulvic acids. To evaluate whether these dissolved organic substances can enhance the tranport of radionuclides through the groundwater system, experiments were conducted to examine the sorption of americium and neptunium onto crushed basalt in the presence of dissolved humic- and fulvic-acid organic carbon introduced into synthetic groundwater. The partitioning experiments with synthetic groundwater show that increasing the concentration of either humic or fulvic acid in the water has a significant inhibiting effect on sorption of both americium and neptunium. At 22 0 C, adsorption of these radionuclides, as measured by distribution ratios (the ratio of nuclide sorbed onto the solid to nuclide in solution at the end of the experiment), decreased by 25% to 50% by addition of as little as 1 mg/L dissolved organic carbon and by one to two orders of magnitude by addition of 100 to 200 mg/L dissolved organic carbon. Distribution ratios measured in solutions reacted at 90 0 C similarly decreased with the addition of dissolved organic carbon but generally ranged from one to two orders of magnitude higher than those determined in the 22 0 C experiment. These results suggest that organic carbon dissolved in deep groundwaters may significantly enhance the mobility of radionuclides of americium and neptunium. 23 references, 5 figures, 11 tables

  11. A radiochemical procedure for a low-level measurement of ''241Am in environmental samples using a supported functional organo phosphorus extractant; Metodo analitico para la determinacion de ''241Am en muestras biologicas y sedimentos marinos mediante uso de una columna con extractante organico

    Energy Technology Data Exchange (ETDEWEB)

    Gasco, C.; Anton, M. P.; Alvarez, A.; Navarro, N.; Salvador, S.

    1994-07-01

    The transuranides analysis in environmental samples is carried out by CIEMAT using standardized methods based on sequential separation with ionic-exchange resins. The americium fraction is purified through a two-layer ion exchange column and lately in an anion-exchange column in nitric acid methanol medium. The technique is time consuming and the results are not completely satisfactory (low recovery and loss of a-resolution) for some samples. The chemical compound CMPO (octyl(phenyl)-N,N-diisobutyl carbomoylmethyiphosphine oxide) dissolved in TPB (tributyl phosphate) and supported on an inert substrate has been tested directly for ''241Am analysis by a large number of laboratories. A new method that combines both procedures has been developed. The details of the improved procedure are described in this paper. The advantages of its application to environmental samples (urine, faeces and sediments) are discussed. The utilization of standard samples, with americium certified concentrations confirms the reliability of our measurements. (Author) 8 refs.

  12. Hanford Tanks 241-AY-102 and 241-BX-101: Sludge Composition and Contaminant Release Data

    International Nuclear Information System (INIS)

    Krupka, Kenneth M.; Deutsch, William J.; Lindberg, Michael J.; Cantrell, Kirk J.; Hess, Nancy J.; Schaef, Herbert T.; Arey, Bruce W.

    2004-01-01

    This report describes the results of testing sludge samples from Hanford tanks 241-AY-102 (AY-102) and 241-BX-101 (BX-101). These tests were conducted to characterize the sludge and assess the water leachability of contaminants from the solids. This work is being conducted to support the tank closure risk assessments being performed by CH2M HILL Hanford Group, Inc. for the U.S. Department of Energy. This is the first report of testing of BX-101 sludge and the second report of testing of AY-102. Lindberg and Deutsch (2003) described the first phase of testing on AY-102 material

  13. Tank characterization report for single-shell tanks 241-T-201, 241-T-202, 241-T-203, and 241-T-204

    International Nuclear Information System (INIS)

    Simpson, B.C.

    1998-01-01

    A major function of the Tank Waste Remediation System (TWRS) is to characterize waste in support of waste management and disposal activities at the Hanford Site. Analytical data from sampling and analysis, in addition to other available information about a tank are compiled and maintained in a tank characterization report (TCR). This report and its appendices serve as the TCR for the single-shell tank series consisting of 241-T-201, -T-202, -T-203, and -T-204. The objectives of this report are: (1) to use characterization data in response to technical issues associated with T-200 series tank waste and (2) to provide a standard characterization of this waste in terms of a best-basis inventory estimate. Section 2.0 summarizes the response to technical issues, Section 3.0 shows the best-basis inventory estimate, Section 4.0 makes recommendations about the safety status of the tank and additional sampling needs. The appendices contain supporting data and information. Appendix A contains historical information for 241-T-201 to T-204, including surveillance information, records pertaining to waste transfers and tank operations, and expected tank contents derived from a process knowledge-based computer program. Appendix B summarizes sampling events, sample data obtained before 1989, and the most current sampling results. Appendix C reports the statistical analysis and numerical manipulation of data used in issue resolution. Appendix D contains the evaluation to establish the best-basis for the inventory estimate and the statistical analysis performed for this evaluation. Appendix E is a bibliography that resulted from an in-depth literature search of all known information sources applicable to tanks 241-T-201, -T-202, -T-203, and -T-204. The reports listed in Appendix E are available in the Tank Characterization and Safety Resource Center

  14. Measurement of contamination by 241Am

    International Nuclear Information System (INIS)

    Hemmingsen, L.B.S.

    1991-08-01

    In relation to the fact that four employees at the Danish Isotope Center who had regularly cleaned the smoke detectors used for control measurements were found to be contaminated with 241 Am, the aim was to investigate the suitability of the Phoswich detector system for measurement of contamination of humans by 241 Am. It was also wished to compare this measuring method with other selected ones. The measurement results are presented in detail. It was found that measurements taken on the cranium with the Phoswich detectors were more suitable for measurement of contamination by 241 Am than the use of a Ge detector on the liver, - because of the first-named method's greater degree of measuring efficiency, (0.013 cps/Bq compared with 0.0001 cps/Bq in the case of Ge detector measurement) and lower minimum detectable activity in relation to that activity that was measured on A1 (one of the employees). It was found that Phoswich-detector measurement and measuring of urine samples supplemented each other in a satisfactory way. The Phoswich detector enables a quick measurement of the degree of seriousness of the contamination of a person and a relatively accurate determination of the calculated intake of contamination which has a size of at least twice the annual limit of intake size. Measurements of urine samples enable smaller amounts of contamination to be revealed, but this takes ca. 32 weeks and is less accurate than Phoswich measurement especially if a long time has elapsed after the intake. (AB) (34 refs.)

  15. Tank 241-A-104 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1994-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of auger samples from tank 241-A-104. This Tank Characterization Plan will identify characterization objectives pertaining to sample collection, hot cell sample isolation, and laboratory analytical evaluation and reporting requirements in addition to reporting the current contents and status of the tank as projected from historical information

  16. Investigation of Tank 241-AN-101 Floating Solids

    Energy Technology Data Exchange (ETDEWEB)

    Kraft, Douglas P. [Washington River Protection Solutions, LLC, Richland, VA (United States); Meznarich, H. K. [Washington River Protection Solutions, LLC, Richland, VA (United States)

    2017-10-30

    Tank 241-AN-101 is the receiver tank for retrieval of several C-Farms waste tanks, including Tanks 241-C-102 and 241-C-111. Tank 241 C 111 received first-cycle decontamination waste from the bismuth phosphate process and Plutonium and Uranium Extraction cladding waste, as well as hydraulic fluid. Three grab samples, 1AN-16-01, 1AN-16-01A, and 1AN-16-01B, were collected at the surface of Tank 241-AN-101 on April 25, 2016, after Tank 241-C-111 retrieval was completed. Floating solids were observed in the three grab samples in the 11A hot cell after the samples were received at the 222-S Laboratory. Routine chemical analyses, solid phase characterization on the floating and settled solids, semivolatile organic analysis mainly on the aqueous phase for identification of degradation products of hydraulic fluids were performed. Investigation of the floating solids is reported.

  17. Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102

    International Nuclear Information System (INIS)

    Shultz, M.V.

    1999-01-01

    Tank 241-SY-101 waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from Tank 241-SY-101 to Tank 241-SY-102. The results of the hazards evaluation were compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. Revision 1 of this document deletes hazardous conditions no longer applicable to the current waste transfer design and incorporates hazardous conditions related to the use of an above ground pump pit and overground transfer line. This document is not part of the AB and is not a vehicle for requesting authorization of the activity; it is only intended to provide information about the hazardous conditions associated with this activity. The AB Control Decision process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis

  18. Nuclear and Physical Methods of Control For soil and Near-ground Air Contamination With Plutonium and Americium-241 in Belarus

    International Nuclear Information System (INIS)

    Yaroshevich, O.I.; Boulyga, S.F.; Zhuk, I.V.; Kievets, M.K.; Lomonosova, E.M.; Kudrayashov, V.P.; Mironov, V.P.

    1998-01-01

    As a result of the Chernobyl NPP accident considerable territories of Belarus have been contaminated with Pu and 2 41A m. The absence of instrumental techniques for a direct analysis of transuranium elements (TUE) in the objects of the environment has made the using of laborious radiochemical methods inevitable what, in its turn, has limited a necessary scale of investigations on TUE problem. The paper presents the more cheap and express instrumental nuclear and physical techniques for Pu and 2 41A m analysis in soils and near-ground layer of air having been developed at the Institute of Power Engineering Problems / National Academy of Sciences of Belarus (IPEP NASB), as well as some results having been obtained using these techniques

  19. New radiochemical methods for determination of 237Np a 241Pu using extraction chromatography (Presentation)

    International Nuclear Information System (INIS)

    Strisovska, J.

    2013-01-01

    Thesis was focused on the development of a new methodology for the separation of anthropogenic transuranium radionuclides 237 Np a 241 Pu from different kinds of matrices. The analytical methods used in this study were based on extraction chromatography and were optimized according to the sample type. The proposed radiochemical procedure is a combination of two algorithms, which represent the separation of radionuclides by using extraction chromatographic sorbents TEVA resin and TRU resin supplied by Eichrom Technologies LLC. 239 Np a 237 Np were selectively captured on sorbent TEVA resin in oxidation state 4+. TRU resin was used for purification of plutonium fraction from interfering americium radionuclide. 242 Pu and 239 Np radionuclides as tracers have been used to monitor the radiochemical yields of separation. Before every radiochemical separation tracer radionuclide 239 Np was obtained by separation from the parent radionuclide 2 43 Am, which is in radioactive equilibrium to 239 Np. The average yield of chemical separation was 69,3% for 239 Np at 277 keV energy line and 65,9% at 228 keV energy line. The NPL AH-B08069 (2008) samples which consist of the mixture of alpha-radionuclides were used for the modification and optimization of separation method used for separation of Np and Pu in model samples. This method provided high radiochemical yields of 239,240 Pu (95,0 ± 3,5)% and 237 Np (87,9 ± 3,0)%.. Reliability of the method was verified by applying our modified separation procedures on reference materials IAEA-375 and IAEA-414 supplied by International Atomic Energy Agency. A good agreement between the results is obtained by this procedure and the certified values were found. Samples of contaminated soils from the area of Nuclear power plant A-1 Jaslovske Bohunice which is stored temporarily before disposal were analyzed using developed separation procedure. Specific activity of investigated radionuclides was determined in these samples. (author)

  20. Evaluation of the contamination risk by 241AM from lightning rods disposed at uncontrolled garbage dump

    International Nuclear Information System (INIS)

    Marumo, Julio Takehiro

    2006-01-01

    Radioactive lightning rods were manufactured in Brazil until 1989, when the licenses for using radioactive sources in these products were lifted by the national nuclear authority. Since then, radioactive devices have been replaced by Franklin type one and collected as radioactive waste. However, only 23 percent of the estimated total number of installed rods was delivered to Brazilian Nuclear Commission (Comissao Nacional de Energia Nuclear - CNEN). This situation is of concern as there is a possibility of the rods being discarded as domestic waste, considering that in Brazil, 63.6 percent of the municipal solid waste is disposed at uncontrolled garbage dump, according to Instituto Brasileiro de Geografia e Estatistica (IBGE) in 2000. In addition, americium, the most common employed radionuclide, is classified as a high toxicity element, when ingested or inhaled. In the present study, it was performed migration experiments of Am-241 by lysimeter system in order to evaluate the risk of contamination caused by radioactive lightning rods disposed as a common solid waste. Sources removed from lightning rods were placed inside lysimeters filled with organic waste, collected at the restaurant of Instituto de Pesquisas Energeticas e Nucleares, IPEN-CNEN/SP, and the generated leachate was periodically analyzed to determine its characteristics such as pH, redox potential, solid content and concentration of the radioactive material. Microbial growth was also evaluated by counting the number of colony forming units. The equivalent dose to members of the public has been calculated considering the ingestion of drinking water, the most probable mode of exposure. The final result was about 145 times below the effective dose limit of 1 mSv.year-1 for members of the public, established by the International Commission on Radiological Protection (ICRP), demonstrating that the risk caused by lightning rods disposed at uncontrolled garbage dump is low. (author)

  1. Waste Analysis Plan for 241-Z

    International Nuclear Information System (INIS)

    HIRZEL, D.R.

    2000-01-01

    The 241-2 waste tanks are used to store, treat, and transfer waste to Tank Farms. The sampling requirements are established to identify the composition of the tank waste. The primary goal is to meet the Tank Farms acceptance criteria. Tank Farms will not accept waste without extensive characterization sample data. Process and lab wastes are sampled for suitability prior to routing to Tk-D8. The samples are helpful in tracking the amount of chemical constituents to determine treatment and are required to maintain Pu inventory and criticality prevention limitations. Likewise, the waste is sampled prior to inter-tank transfers. The revised Waste Analysis Plan for 241-2 (WAP) contains current facility, process and waste descriptions. The WAP lists the Double Shell Tank (DST) system acceptance criteria, sampling parameters and required analyses. The characterization data on historical process wastes was deleted. A section on the Tank Farms waste approval procedural process was added to describe the steps necessary and documentation required to transfer waste to the DST system. Failure to collect proper samples will result in Tank Farms' refusal to accept PFP waste until proper sampling conditions are met. This will use up unnecessary time and resources but not place the plant in a hazardous position

  2. The distribution of plutonium-241 in rodents

    International Nuclear Information System (INIS)

    Priest, N.D.

    1977-01-01

    Plutonium-241 citrate solution at pH 6.5 was injected intravenously or intraperitoneally into hamsters and rats at a dose of 50 MBq kg -1 (1.35 mCi kg -1 ). The animals were killed 1 day or 1 week later, and tissues were removed for autoradiography and radiochemical analysis. Plutonium-241 was distributed in rats in the same way as plutonium-239, and is a suitable isotope for high-resolution tissue-section autoradiography. Plutonium deposits in cells consisted of a nuclear and a cytoplasmic component. In the hamster kidney cells, the amount associated with the nucleus was about 55 per cent of the total cellular plutonium at 24 hours after injection. Six days later, it was only about 30 per cent. Plutonium deposits were also characterized in hepatocytes, in the interstitial cells of the testes, in the cells of ovarian follicles, in chondrocytes and in bone cells, including osteoblasts and osteocytes. In bone there appeared to be both an extracellular and intracellular deposit. No evidence was found of substantial incorporation of plutonium into the mineral phase of bone. (author)

  3. Disturbance from Am-241 Photons of the Cellular Dose by Am-241 Alpha Emissions: Am-241 as an alternative source of alpha particles to radon daughters

    International Nuclear Information System (INIS)

    Lee, Ki-Man; Kim, Eun-Hee

    2015-01-01

    The Radiation Bioengineering Laboratory (RadBio Lab) at Seoul National University (SNU) has built an Am-241 alpha particle irradiator for study of cellular responses to radiation from radon daughters. The radon daughters of concern that cause internal exposure from inhalation of radon-contaminated air are Po-218, Po-214 and Po-210. In their alpha decay schemes, the yields of photon emissions are negligible. Unfortunately, Am-241, the source of alpha irradiator in RadBio Lab, emits photons at every alpha decay while transforming to Np-237 of long half-life. Employing Am-241 as the source simulating radon daughters, therefore, requires that photon emissions from Am-241 be specified in term of dose contribution. In this study, Monte Carlo calculations have been made to characterize dose contributions of Am-241 photon emissions. This study confirms that disturbance from Am-241 photon emissions of the cellular dose by Am-241 alpha emissions is negligible. Dose contamination fraction from photon emissions was 8.02 .. 10 -6 at 25 mm SSD at maximum. Also, note that LET in tissue-equivalent medium varies within about 20% for alpha particles at energies over 5 MeV

  4. Tank 241-AZ-101 and tank 241-AZ-102, airlift circulator operation vapor sampling and analysis plan

    International Nuclear Information System (INIS)

    TEMPLETON, A.M.

    1999-01-01

    This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for vapor samples obtained during the operation of the tank 241-AZ-101 and 241-AZ-102 airlift circulators (ALCs). The purpose of the ALC operation is to support portions of the operational test procedure (OTP) for Project W-030 (OTP-W030-001) and to perform functional test in support of Project W-151. Project W-030 is the 241-A-702 ventilation upgrade project (241-AZ-702) and Project W-151 is the 241-AZ-101 Mixer Pump Test. The functional tests will check the operability of the tank 241-AZ-101 ALCs. Process Memo's No.2E98-082 and No.2E99-001 (LMHC 1999a, LMHC 1999b) direct the operation of the ALCs and the Industrial Hygiene monitoring respectively. A series of tests will be conducted in which the ALCs in tanks 241-AZ-101 and 241-AZ-102 will be operated at different air flow rates. Vapor samples will be obtained to determine constituents that may be present in the tank headspace during ALC operation at tanks 241-AZ-101 and 241-AZ-102 as the waste is disturbed. During the testing, vapor samples will be obtained from the headspace of tanks 241-AZ-101 and 241-AZ-102 via the unused port on the standard hydrogen monitoring system (SHMS). Results will be used to provide the waste feed delivery program with environmental air permitting data for tank waste disturbing activities. Because of radiological concerns, the samples will be filtered for particulates. It is recognized that this may remove some organic compounds

  5. Estimation of americium in cemented waste block using gamma ray spectrometry

    International Nuclear Information System (INIS)

    Singh, Sarbjit; Mhatre, Amol; Sagar, Veena

    2012-05-01

    A method was developed for the estimation of 241 Am present in the cemented waste block which was cylindrical in shape. In such large sample, the attenuation of gamma rays increases with size of the sample and density of the material present. Attenuation correction was incorporated using linear attenuation coefficients of 59.54 keV gamma ray of 241 Am. Also in such large samples, error due to the distribution of activity is more. Estimation of 241 Am in the cemented sample was carried out by applying corrections for attenuation and for the sample geometry. (author)

  6. A Procedure for the Sequential Determination of Radionuclides in Environmental Samples. Liquid Scintillation Counting and Alpha Spectrometry for 90Sr, 241Am and Pu Radioisotopes

    International Nuclear Information System (INIS)

    2014-01-01

    Since 2004, IAEA activities related to the terrestrial environment have aimed at the development of a set of procedures to determine radionuclides in environmental samples. Reliable, comparable and ‘fit for purpose’ results are an essential requirement for any decision based on analytical measurements. For the analyst, tested and validated analytical procedures are extremely important tools for the production of analytical data. For maximum utility, such procedures should be comprehensive, clearly formulated and readily available for reference to both the analyst and the customer. This publication describes a combined procedure for the sequential determination of 90 Sr, 241 Am and Pu radioisotopes in environmental samples. The method is based on the chemical separation of strontium, americium and plutonium using ion exchange chromatography, extraction chromatography and precipitation followed by alpha spectrometric and liquid scintillation counting detection. The method was tested and validated in terms of repeatability and trueness in accordance with International Organization for Standardization (ISO) guidelines using reference materials and proficiency test samples. Reproducibility tests were performed later at the IAEA Terrestrial Environment Laboratory. The calculations of the massic activity, uncertainty budget, decision threshold and detection limit are also described in this publication. The procedure is introduced for the determination of 90 Sr, 241 Am and Pu radioisotopes in environmental samples such as soil, sediment, air filter and vegetation samples. It is expected to be of general use to a wide range of laboratories, including the Analytical Laboratories for the Measurement of Environmental Radioactivity (ALMERA) network for routine environmental monitoring purposes

  7. The use of Am-241 as Equivalence Thickness Measurement for Irradiation Room at National institute for Cancer and Malacca Hospital: A Review

    International Nuclear Information System (INIS)

    Mohd Khalid Matori; Azuhar Ripin; Husaini Salleh

    2013-01-01

    Lead equivalent thickness measurement of a shielding material in diagnostic radiology is very important to ensure that requirements for the purpose of radiation protection of patients, employees and the public are met. The Malaysian Ministry of Health (MOH) has established that the irradiation room must have sufficient shielding thickness, for example for general radiography it must be at least equal to 2.0 mm of Pb, for panoramic dental radiography at least equal to 1.5 mm of Pb and for mammography should be a minimum of 1.0 mm of Pb. This paper presents a technique using americium-241 source to test and verify the integrity of the shielding thickness in term of lead equivalent for irradiation room at National Institute for Cancer (IKN) and General Malacca Hospital. Results of measurement of 10 irradiation rooms conducted in 2012 were analyzed for this presentation. Technical comparison of the attenuation of gamma rays from Am-241 source through the walls of the irradiation room and pieces of lead were used to assess the lead equivalent thickness of the walls. Results showed that almost all the irradiation rooms tested meet the requirements of the Ministry of Health and is suitable for the installation of the intended diagnostic X-ray apparatus. Some specific positions such as door knobs and locks, electrical plug sockets were identified with potential to not met the required lead equivalent thickness hence may contribute to higher radiation exposure to workers and the public. (author)

  8. Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm

    International Nuclear Information System (INIS)

    Girardot, Crystal L.; Harlow, Donald G.

    2014-01-01

    This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F

  9. Hanford Single-Shell Tank Leak Causes and Locations - 241-SX Farm

    Energy Technology Data Exchange (ETDEWEB)

    Girardot, Crystal L. [Washington River Protection Solutions (United States); Harlow, Donald G. [Washington River Protection Solutions (United States)

    2014-01-08

    This document identifies 241-SX Tank Farm (SX Farm) leak causes and locations for the 100 series leaking tanks (241-SX-107, 241-SX-108, 241-SX-109, 241-SX-111, 241-SX-112, 241-SX-113, 241-SX-114, and 241-SX-115) identified in RPP-ENV-39658, Rev. 0, Hanford SX-Farm Leak Assessments Report. This document satisfies the SX Farm portion of the target (T04) in the Hanford Federal Facility Agreement and Consent Order milestone M-045-91F.

  10. The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium

    Energy Technology Data Exchange (ETDEWEB)

    Ketelaer, Jens

    2010-06-14

    The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium: Nuclear masses are an important quantity to study nuclear structure since they reflect the sum of all nucleonic interactions. Many experimental possibilities exist to precisely measure masses, out of which the Penning trap is the tool to reach the highest precision. Moreover, absolute mass measurements can be performed using carbon, the atomic-mass standard, as a reference. The new double-Penning trap mass spectrometer TRIGA-TRAP has been installed and commissioned within this thesis work, which is the very first experimental setup of this kind located at a nuclear reactor. New technical developments have been carried out such as a reliable non-resonant laser ablation ion source for the production of carbon cluster ions and are still continued, like a non-destructive ion detection technique for single-ion measurements. Neutron-rich fission products will be available by the reactor that are important for nuclear astrophysics, especially the r-process. Prior to the on-line coupling to the reactor, TRIGA-TRAP already performed off-line mass measurements on stable and long-lived isotopes and will continue this program. The main focus within this thesis was on certain rare-earth nuclides in the well-established region of deformation around N {proportional_to} 90. Another field of interest are mass measurements on actinoids to test mass models and to provide direct links to the mass standard. Within this thesis, the mass of {sup 241}Am could be measured directly for the first time. (orig.)

  11. The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium

    International Nuclear Information System (INIS)

    Ketelaer, Jens

    2010-01-01

    The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium: Nuclear masses are an important quantity to study nuclear structure since they reflect the sum of all nucleonic interactions. Many experimental possibilities exist to precisely measure masses, out of which the Penning trap is the tool to reach the highest precision. Moreover, absolute mass measurements can be performed using carbon, the atomic-mass standard, as a reference. The new double-Penning trap mass spectrometer TRIGA-TRAP has been installed and commissioned within this thesis work, which is the very first experimental setup of this kind located at a nuclear reactor. New technical developments have been carried out such as a reliable non-resonant laser ablation ion source for the production of carbon cluster ions and are still continued, like a non-destructive ion detection technique for single-ion measurements. Neutron-rich fission products will be available by the reactor that are important for nuclear astrophysics, especially the r-process. Prior to the on-line coupling to the reactor, TRIGA-TRAP already performed off-line mass measurements on stable and long-lived isotopes and will continue this program. The main focus within this thesis was on certain rare-earth nuclides in the well-established region of deformation around N ∝ 90. Another field of interest are mass measurements on actinoids to test mass models and to provide direct links to the mass standard. Within this thesis, the mass of 241 Am could be measured directly for the first time. (orig.)

  12. Vapor characterization of Tank 241-C-103

    International Nuclear Information System (INIS)

    Huckaby, J.L.; Story, M.S.

    1994-06-01

    The Westinghouse Hanford Company Tank Vapor Issue Resolution Program has developed, in cooperation with Northwest Instrument Systems, Inc., Oak Ridge National Laboratory, Oregon Graduate Institute of Science and Technology, Pacific Northwest Laboratory, and Sandia National Laboratory, the equipment and expertise to characterize gases and vapors in the high-level radioactive waste storage tanks at the Hanford Site in south central Washington State. This capability has been demonstrated by the characterization of the tank 241-C-103 headspace. This tank headspace is the first, and for many reasons is expected to be the most problematic, that will be characterized (Osborne 1992). Results from the most recent and comprehensive sampling event, sample job 7B, are presented for the purpose of providing scientific bases for resolution of vapor issues associated with tank 241-C-103. This report is based on the work of Clauss et al. 1994, Jenkins et al. 1994, Ligotke et al. 1994, Mahon et al. 1994, and Rasmussen and Einfeld 1994. No attempt has been made in this report to evaluate the implications of the data presented, such as the potential impact of headspace gases and vapors to tank farm workers health. That and other issues will be addressed elsewhere. Key to the resolution of worker health issues is the quantitation of compounds of toxicological concern. The Toxicology Review Panel, a panel of Pacific Northwest Laboratory experts in various areas, of toxicology, has chosen 19 previously identified compounds as being of potential toxicological concern. During sample job 7B, the sampling and analytical methodology was validated for this preliminary list of compounds of toxicological concern. Validation was performed according to guidance provided by the Tank Vapor Conference Committee, a group of analytical chemists from academic institutions and national laboratories assembled and commissioned by the Tank Vapor Issue Resolution Program

  13. Vapor characterization of Tank 241-C-103

    Energy Technology Data Exchange (ETDEWEB)

    Huckaby, J.L. [Westinghouse Hanford Co., Richland, WA (United States); Story, M.S. [Northwest Instrument Systems, Inc. Richland, WA (United States)

    1994-06-01

    The Westinghouse Hanford Company Tank Vapor Issue Resolution Program has developed, in cooperation with Northwest Instrument Systems, Inc., Oak Ridge National Laboratory, Oregon Graduate Institute of Science and Technology, Pacific Northwest Laboratory, and Sandia National Laboratory, the equipment and expertise to characterize gases and vapors in the high-level radioactive waste storage tanks at the Hanford Site in south central Washington State. This capability has been demonstrated by the characterization of the tank 241-C-103 headspace. This tank headspace is the first, and for many reasons is expected to be the most problematic, that will be characterized (Osborne 1992). Results from the most recent and comprehensive sampling event, sample job 7B, are presented for the purpose of providing scientific bases for resolution of vapor issues associated with tank 241-C-103. This report is based on the work of Clauss et al. 1994, Jenkins et al. 1994, Ligotke et al. 1994, Mahon et al. 1994, and Rasmussen and Einfeld 1994. No attempt has been made in this report to evaluate the implications of the data presented, such as the potential impact of headspace gases and vapors to tank farm workers health. That and other issues will be addressed elsewhere. Key to the resolution of worker health issues is the quantitation of compounds of toxicological concern. The Toxicology Review Panel, a panel of Pacific Northwest Laboratory experts in various areas, of toxicology, has chosen 19 previously identified compounds as being of potential toxicological concern. During sample job 7B, the sampling and analytical methodology was validated for this preliminary list of compounds of toxicological concern. Validation was performed according to guidance provided by the Tank Vapor Conference Committee, a group of analytical chemists from academic institutions and national laboratories assembled and commissioned by the Tank Vapor Issue Resolution Program.

  14. Physics of plutonium and americium recycling in PWR using advanced fuel concepts

    International Nuclear Information System (INIS)

    Hourcade, E.

    2004-01-01

    PWR waste inventory management is considered in many countries including Frances as one of the main current issues. Pu and Am are the 2 main contents both in term of volume and long term radio-toxicity. Waiting for the Generation IV systems implementation (2035-2050), one of the mid-term solutions for their transmutation involves the use of advanced fuels in Pressurized Water Reactors (PWR). These have to require as little modification as possible of the core internals, the cooling system and fuel cycle facilities (fabrication and reprocessing). The first part of this paper deals with some neutronic characteristics of Pu and/or Am recycling. In a second part, 2 technical solutions MOX-HMR and APA-DUPLEX-84 are presented and the third part is devoted to the study of a few global strategies. The main neutronic parameters to be considered for Pu and Am recycling in PWR are void coefficient, Doppler coefficient, fraction of delayed neutrons and power distribution (especially for heterogeneous configurations). The modification of the moderation ratio, the opportunity to use inert matrices (targets), the optimisation of Uranium, Plutonium and Americium contents are the key parameters to play with. One of the solutions (APA-DUPLEX-84) presented here is a heterogeneous assembly with regular moderation ratio composed with both target fuel rods (Pu and Am embedded in an inert matrix) and standard UO 2 fuel rods. An EPR (European Pressurised Reactor) type reactor, loaded only with assemblies containing 84 peripheral targets, can reach an Americium consumption rate of (4.4; 23 kg/TWh) depending on the assembly concept. For Pu and Am inventories stabilisation, the theoretical fraction of reactors loaded with Pu + Am or Pu assemblies is about 60%. For Americium inventory stabilisation, the fraction decreases down to 16%, but Pu is produced at a rate of 18.5 Kg/TWh (-25% compared to one through UOX cycle)

  15. Sorption of 241Am by Aspergillus niger spore and hyphae

    International Nuclear Information System (INIS)

    Yuanyou Yang; Ning Liu; Jiali Liao; Jiannan Jin; Shunzhong Luo; Taiming Zhang; Pengji Zhao

    2004-01-01

    Biosorption of 241 Am by a fungus A. niger, including the spore and hyphae, was investigated. The preliminary results showed that the adsorption of 241 Am by the microorganism was efficient. More than 96% of the total 241 Am could be removed from 241 Am solutions of 5.6-111 MBq/l (C 0 ) by spore and hyphae of A. niger, with adsorbed 241 Am metal (Q) of 7.2-142.4 MBq/g biomass, and 5.2-106.5 MBq/g, respectively. The biosorption equilibrium was achieved within 1 hour and the optimum pH range was pH 1-3. No obvious effects on 241 Am adsorption by the fungus were observed at 10-45 deg C, or in solutions containing Au 3+ or Ag + , even 2000 times above the 241 Am concentration. The 241 Am biosorption by the fungus obeys the Freundlich adsorption equation. There was no significant difference between the adsorption behavior of A. niger spore and hyphae. (author)

  16. 24 CFR 241.840 - Date of default.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Date of default. 241.840 Section... § 241.840 Date of default. In computing loan insurance benefits, the date of default shall be considered... of the lender's acceleration of the debt because of the borrower's default under the first...

  17. 24 CFR 241.850 - Notice of default.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Notice of default. 241.850 Section... § 241.850 Notice of default. (a) If the default is not cured within the 30 day grace period, as defined... such default. (b) The lender shall give notice in writing to the Commissioner of the failure of the...

  18. 24 CFR 241.1070 - Agreed interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.1070...-Eligibility Requirements § 241.1070 Agreed interest rate. The equity or acquisition loan shall bear interest at the rate agreed upon by the borrower and the lender. ...

  19. 24 CFR 241.560 - Agreed interest rate.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Agreed interest rate. 241.560... § 241.560 Agreed interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the lender and the borrower. (b) Interest shall be payable in monthly installments on the principal amount of...

  20. 24 CFR 241.830 - Definition of default.

    Science.gov (United States)

    2010-04-01

    ... SUPPLEMENTARY FINANCING FOR INSURED PROJECT MORTGAGES Contract Rights and Obligations-Multifamily Projects... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definition of default. 241.830... § 241.830 Definition of default. (a) If the borrower fails to make any payments due under or provided to...

  1. 5 CFR 838.241 - Cost-of-living adjustments.

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Cost-of-living adjustments. 838.241... Affecting Employee Annuities Procedures for Computing the Amount Payable § 838.241 Cost-of-living... provide for cost-of-living adjustments on the former spouse's payment from employee annuity, the cost-of...

  2. 24 CFR 241.890 - Characteristics of debentures.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Characteristics of debentures. 241... Insurance § 241.890 Characteristics of debentures. Debentures issued in settlement of insurance claims under this subpart shall have the same characteristics and the same requirements for registration and...

  3. 24 CFR 241.1030 - Mortgage insurance premiums.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Mortgage insurance premiums. 241... Loans-Eligibility Requirements § 241.1030 Mortgage insurance premiums. The lender, upon endorsement of the note, shall pay the Commissioner a first mortgage insurance premium equal to 0.5 percent of the...

  4. Type B Investigation Report for 241-SY-101 Pump Start and 241-C-106 Pit Cleanout

    Energy Technology Data Exchange (ETDEWEB)

    Ewalt, J.R.

    1993-09-01

    In accordance with the direction of the Department of Energy (DOE) Manager, Richland Operations Office, a Type ``B`` investigation in accordance with the DOE Order 5484.1, Environmental Protection, Safety and Health Protection Information Reporting Requirements, has been conducted. The scope of the investigation included two events: The ``Inadvertent Mixer Pump Operation at 241-SY-101`` (RL-WHC-TANK FARM-1993-069); ``Inadequate Work Control Results in Personnel Skin Contamination at 241-C-106, Pit B`` (RL-WHC-TANK FARM-1993-071) events. Additionally, at the request of the President of the WHC, a broader investigation into Waste Tank Farm ``safety practices`` and ``Conduct of Operations`` was also conducted. The review was focused on (1) WHC organizations performing operations, maintenance, and radiological safety tasks; and (2) KEH organizations performing major maintenance tasks.

  5. Separation of americium and plutonium from nuclear wastes by the TRUEX process

    International Nuclear Information System (INIS)

    Leonard, R.A.; Vandegrift, G.F.; Manry, C.W.

    1986-01-01

    Americium and plutonium can be removed from a transuranic (TRU) waste stream to <10 nCi/g by the TRUEX process. The resulting waste is nontransuranic, greatly reducing disposal costs. An overview is given of the TRUEX process and of centrifugal contactors used to implement this process. Then, a plan for the deployment of TRUEX at the Hanford Site is discussed. Finally, details are given on the proposed use of TRUEX to treat the liquid wastes from the Plutonium Finishing Plant at the Hanford Site

  6. Comparison of acid leachate and fusion methods to determine plutonium and americium in environmental samples

    International Nuclear Information System (INIS)

    Smith, L.L.; Markun, F.; TenKate, T.

    1992-06-01

    The Analytical Chemistry Laboratory at Argonne National Laboratory performs radiochemical analyses for a wide variety of sites within the Department of Energy complex. Since the chemical history of the samples may vary drastically from site to site, the effectiveness of any analytical technique may also vary. This study compares a potassium fluoride-pyrosulfate fusion technique with an acid leachate method. Both normal and high-fired soils and vegetation samples were analyzed for both americium and plutonium. Results show both methods work well, except for plutonium in high-fired soils. Here the fusion method provides higher accuracy

  7. Standardization of a method to study the distribution of Americium in purex process

    International Nuclear Information System (INIS)

    Dapolikar, T.T.; Pant, D.K.; Kapur, H.N.; Kumar, Rajendra; Dubey, K.

    2017-01-01

    In the present work the distribution of Americium in PUREX process is investigated in various process streams. For this purpose a method has been standardized for the determination of Am in process samples. The method involves extraction of Am with associated actinides using 30% TRPO-NPH at 0.3M HNO 3 followed by selective stripping of Am from the organic phase into aqueous phase at 6M HNO 3 . The assay of aqueous phase for Am content is carried out by alpha radiometry. The investigation has revealed that 100% Am follows the HLLW route. (author)

  8. Microstructure and elemental distribution of americium containing MOX fuel under the short term irradiation tests

    International Nuclear Information System (INIS)

    Tanaka, Kosuke; Hirosawa, Takashi; Obayashi, Hiroshi; Koyama, Shin Ichi; Yoshimochi, Hiroshi; Tanaka, Kenya

    2008-01-01

    In order to investigate the effect of americium addition to MOX fuels on the irradiation behavior, the 'Am-1' program is being conducted in JAEA. The Am-1 program consists of two short term irradiation tests of 10-minute and 24 hour irradiations and a steady-state irradiation test. The short-term irradiation tests were successfully completed and the post irradiation examinations (PIEs) are in progress. The PIEs for Am-containing MOX fuels focused on the microstructural evolution and redistribution behavior of Am at the initial stage of irradiation and the results to date are reported

  9. Influence of biofilms on migration of uranium, americium and europium in the environment

    International Nuclear Information System (INIS)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-01-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  10. Software configuration management plan, 241-AY and 241-AZ tank farm MICON automation system

    International Nuclear Information System (INIS)

    Hill, L.F.

    1997-01-01

    This document establishes a Computer Software Configuration Management Plan (CSCM) for controlling software for the MICON Distributed Control System (DCS) located at the 241-AY and 241-AZ Aging Waste Tank Farm facilities in the 200 East Area. The MICON DCS software controls and monitors the instrumentation and equipment associated with plant systems and processes. A CSCM identifies and defines the configuration items in a system (section 3.1), controls the release and change of these items throughout the system life cycle (section 3.2), records and reports the status of configuration items and change requests (section 3.3), and verifies the completeness and correctness of the items (section 3.4). All software development before initial release, or before software is baselined, is considered developmental. This plan does not apply to developmental software. This plan applies to software that has been baselined and released. The MICON software will monitor and control the related instrumentation and equipment of the 241-AY and 241-AZ Tank Farm ventilation systems. Eventually, this software may also assume the monitoring and control of the tank sludge washing equipment and other systems as they are brought on line. This plan applies to the System Cognizant Manager and MICON Cognizant Engineer (who is also referred to herein as the system administrator) responsible for the software/hardware and administration of the MICON system. This document also applies to any other organizations within Tank Farms which are currently active on the system including system cognizant engineers, nuclear operators, technicians, and control room supervisors

  11. Study of the extraction and the purification of americium and trivalent actinides contained in effluents with supported liquid membranes

    International Nuclear Information System (INIS)

    Guillou, P.

    1990-12-01

    The supported liquid membrane technique is studied and developed for americium recovery from uranium or plutonium matrices and decontamination of liquid radioactive wastes. First tests on uranium-nickel solutions with a flat membrane showed the easiness of the operation and the efficiency of the process. Acid-resistant (10 N), interchangeable elements with hollow fibers, are developed and also a computerized automatic device. The different tests on americium solutions demonstrate the feasibility and the reliability of the system. Influence of various parameters on transfer kinetics is investigated

  12. Hazard evaluation for transfer of waste from tank 241-SY-101 to tank 241-SY-102

    International Nuclear Information System (INIS)

    SHULTZ, M.V.

    1999-01-01

    Tank 241-SY-101 (SY-101) waste level growth is an emergent, high priority issue. The purpose of this document is to record the hazards evaluation process and document potential hazardous conditions that could lead to the release of radiological and toxicological material from the proposed transfer of a limited quantity (approximately 100,000 gallons) of waste from SY-101 to 241-SY-102 (SY-102). The results of the hazards evaluation will be compared to the current Tank Waste Remediation System (TWRS) Basis for Interim Operation (HNF-SD-WM-BIO-001, 1998, Revision 1) to identify any hazardous conditions where Authorization Basis (AB) controls may not be sufficient or may not exist. Comparison to LA-UR-92-3196, A Safety Assessment for Proposed Pump Mixing Operations to Mitigate Episodic Gas Releases in Tank 241-SY-101, was also made in the case of transfer pump removal activities. This document is not intended to authorize the activity or determine the adequacy of controls; it is only intended to provide information about the hazardous conditions associated with this activity. The Unreviewed Safety Question (USQ) process will be used to determine the adequacy of controls and whether the proposed activity is within the AB. This hazard evaluation does not constitute an accident analysis

  13. 241-CX-70, 241-CX-71, and 241-CX-72 underground storage tanks at the strontium semiworks facility supplemental information to the Hanford Facility Contingency Plan

    International Nuclear Information System (INIS)

    Ingle, S.J.

    1996-03-01

    This document is a unit-specific contingency plan for the underground storage tanks at the Strontium Semiworks Facility and is intended to be used as a supplement to the Hanford Facility Contingency Plan. This unit-specific plan is to be used to demonstrate compliance with the contingency plan requirements of WAC 173-303 for certain Resource Conservation and Recovery Act of 1976 (RCRA) waste management units. Radioactive material is contained in three underground storage tanks: 241-CX-70, 241-CX-71, and 241-CX-72. Tank 241-CX-70 has been emptied, except for residual quantities of waste, and has been classified as an elementary neutralization tank under the RCRA. Tanks 241-CX-71 and 241-CX-72 contain radioactive and Washington State-only dangerous waste material, but do not present a significant hazard to adjacent facilities, personnel, or the environment. Currently, dangerous waste management activities are not being applied at the tanks. It is unlikely that any incidents presenting hazards to public health or the environment would occur at the Strontium Semiworks Facility

  14. Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems

    International Nuclear Information System (INIS)

    Himes, D.A.

    1998-01-01

    The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated

  15. Radiological and toxicological analyses of tank 241-AY-102 and tank 241-C-106 ventilation systems

    Energy Technology Data Exchange (ETDEWEB)

    Himes, D.A.

    1998-08-11

    The high heat content solids contained in Tank 241-C-106 are to be removed and transferred to Tank 241-AY-102 by sluicing operations, to be authorized under project W320. While sluicing operations are underway, the state of these tanks will be transformed from unagitated to agitated. This means that the partition fraction which describes the aerosol content of the head space will increase from IE-10 to IE-8 (see WHC-SD-WM-CN062, Rev. 2 for discussion of partition fractions). The head spare will become much more loaded with suspended material. Furthermore, the nature of this suspended material can change significantly: sluicing could bring up radioactive solids which normally would lay under many meters of liquid supernate. It is assumed that the headspace and filter aerosols in Tank 241-AY-102 are a 90/10 liquid/solid split. It is further assumed that the sluicing line, the headspace in Tank 241-C-106, and the filters on Tank 241-C-106 contain aerosols which are a 67/33 liquid/solid split. The bases of these assumptions are discussed in Section 3.0. These waste compositions (referred to as mitigated compositions) were used in Attachments 1 through 4 to calculate survey meter exposure rates per liter of inventory in the various system components. Three accident scenarios are evaluated: a high temperature event which melts or burns the HEPA filters and causes releases from other system components; an overpressure event which crushes and blows out the HEPA filters and causes releases from other system components; and an unfiltered release of tank headspace air. The initiating event for the high temperature release is a fire caused by a heater malfunction inside the exhaust dust or a fire outside the duct. The initiating event for the overpressure event could be a steam bump which over pressurizes the tank and leads to a blowout of the HEPA filters in the ventilation system. The catastrophic destruction of the HEPA filters would release a fraction of the accumulated

  16. Separation and activity determination of 239+240Pu, 241Am and Curium (242and244Cm) in evaporator concentrate by Alpha Spectrometry

    International Nuclear Information System (INIS)

    Reis Junior, Aluisio S.; Temba, Eliane S.C.; Kastner, Geraldo F.; Monteiro, Roberto P.G.

    2013-01-01

    Alpha spectrometry analysis was used for activity determinations of Pu, Am and Cm isotopes in evaporator concentrate samples from nuclear power plants. Using a sequential procedure the first step was Pu isolation by an anion exchange column followed by an Am and Cm separation of U and Fe by a co-precipitation with oxalic acid. The precipitate was used for americium and curium separation of strontium by using a TRU resin extraction chromatography column. Due to their chemical similarities and energy difference it was seen that the simultaneous determination of 241 Am, 242 Cm and 24 3 ,244 Cm isotopes is possible using the 243 Am as tracer, once they have peaks in different region of interest (ROI) in the alpha spectrum. In this work it was used tracers, 238 Pu, 243 Am, 244 Cm and 232 U, for determination and quantification of theirs isotopes, respectively. The standard deviations for replicate analysis were calculated and for 241 Am it was (1,040 ± 160 mBqKg -1 ), relative standard deviation 15.38%, and for 239+240 Pu it was (551 +- 44 mBqKg -1 ), relative standard deviation 7.98%. In addition, for the 242 Cm isotope the standard deviation for determinations was(75 ± 23 mBqKg -1 ), with the relative standard deviation 30.67% higher than for 241 Am and 239+240 Pu. The radiometric yields ranged from 90% to 105% and the lower limit of detection was estimated as being 2.05 mBqKg -1 . (author)

  17. Production of a square geometry Americium standard source for use with photodiodes

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Priscila; Geraldo, Bianca; Raele, Marcus P.; Marumo, Júlio T.; Vicente, Roberto; Zahn, Guilherme S.; Genezini, Frederico A., E-mail: priscila3.costa@usp.br, E-mail: fredzini@ipen.br [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)

    2017-07-01

    In the development of a thermal neutron detector using a square photodiode and a thin boron film, a radioactive calibration source with the same geometry was needed. An americium-243 standard source was produced by electrodeposition aiming at the calibration of a PIN-type silicon photodiode with a detection area of 10 x 10 mm{sup 2}. To produce the samples two tests were performed. In the first test, a square stainless steel plate (10 x 10 mm{sup 2}) was fixed on the surface of the conventional plate, which was removed after deposition. To reduce the loss of activity of the source, in the second test nail polish was applied on the silver plate leaving only an area of 10 x 10 mm{sup 2} without varnish coating. Once the electrodeposition process was completed, the activity concentration measurement was performed by alpha particle spectrometry. The first method presented a lower activity when compared to the total activity of Am-243 added initially. For the second method, the total activity was concentrate in the exposed square region (without nail polish). The results showed that it is possible to obtain a square geometry source; furthermore, the surrounding nail polish was not contaminated by {sup 243}Am. The comparison of these two approaches indicated that the second method was more efficient as it was possible to concentrate all the americium activity in the delimited square area. (author)

  18. Fuel cycle covariance of plutonium and americium separations to repository capacity using information theoretic measures

    International Nuclear Information System (INIS)

    Scopatz, Anthony; Schneider, Erich; Li, Jun; Yim, Man-Sung

    2011-01-01

    A light water reactor, fast reactor symbiotic fuel cycle scenario was modeled and parameterized based on thirty independent inputs. Simultaneously and stochastically choosing different values for each of these inputs and performing the associated fuel cycle mass-balance calculation, the fuel cycle itself underwent Monte Carlo simulation. A novel information theoretic metric is postulated as a measure of system-wide covariance. This metric is the coefficient of variation of the set of uncertainty coefficients generated from 2D slices of a 3D contingency table. It is then applied to the fuel cycle, taking fast reactor used fuel plutonium and americium separations as independent variables and the capacity of a fully-loaded tuff repository as the response. This set of parameters is known from prior studies to have a strong covariance. When measured with all 435 other input parameters possible, the fast reactor plutonium and americium separations pair was found to be ranked the second most covariant. This verifies that the coefficient of variation metric captures the desired sensitivity of sensitivity effects in the nuclear fuel cycle. (author)

  19. Contribution to the prediction of americium, plutonium and neptunium behaviour in the geosphere: chemical data

    International Nuclear Information System (INIS)

    Robouch, P.

    1989-01-01

    An exhaustive bibliographic review on hydrolysis of americium gives the stability constants, at zero ionic strength. No evidence of Am(OH) 4 - formation was found by solubility studies up to pH 2 (CO 3 ) 3 characterised by its X-ray diffraction pattern is studied at a high ionic strength. All the published results on Am in carbonate media are reinterpreted using these stability constants (Am-OH-CO 3 complexes are not needed). No evidence of Am(CO 3 ) 4 5- formation was found by spectrophotometry up to 3M. Literature results are used to determine the formal redox potentials at pH = 9.4 and to calculate the formation constants, at zero ionic strength. The formation of complexes between americium and humic materials (purified fulvic and humic acids) has been studied by a spectrophotometric technique. The results are interpreted by the formation of a 1:1 complexe. Solubility of the solid PuO 2 (CO 3 ) is measured in bicarbonate media at high ionic strength, to obtain the solubility product and formation constants of the PuO 2 (CO 3 ) i 2-2i complexes [fr

  20. Vitrification of F-area americium/curium: feasibility study and preliminary process recommendation

    International Nuclear Information System (INIS)

    Ramsey, W.G.; Miller, D.; Minichan, R.; Coleman, L.; Schumacher, R.; Hardy, B.; Jones, R.

    1994-01-01

    Work was performed to identify a process to vitrify the contents of F- canyon Tank 17.1. Tank 17.1 contains the majority of americium (Am) and curium (Cm) contained in the DOE Complex. Oak Ridge National Laboratory (ORNL) has made a formal request for this material as fuel for production of Cf252 and other transplutonium actinides. The Am and Cm (and associated lanthanide fission products) are currently in nitric acid solution. Transportation of the intensely radioactive Am/Cm in liquid form is not considered possible. As a result, the material will either be solidified and shipped to ORNL or discarded to the Tank Farm. Nuclear Materials Processing Technology (NMPT), therefore, requested Defense Waste Processing Technology (DWPT) to determine if the Tank 17.1 material could be vitrified, and if it was vitrified could the americium and curium be successfully recovered. Research was performed to determine if the Tank 17.1 contents could indeed be mixed with glass formers and vitrified. Additional studies identified critical process parameters such as heat loading, melter requirements, off-gas evolution, etc. Discussions with NMPT personnel were initiated to determine existing facilities where this work could be accomplished safely. A process has been identified which will convert the Am/Cm material into approximately 300kg of glass

  1. A simple approach to determine the diffusivity of americium in granite

    International Nuclear Information System (INIS)

    Song, L.; Feng, X.; Liang, J.; Zhang, Y.; Wang, J.

    2009-01-01

    The diffusivities of the key radionuclides in host rock are important for the performance assessment of repositories. One of the conventional methods for determining the diffusivities of radionuclides is to grind the rock tablet layer by layer and then to measure the radioactivity remaining on the rock tablet before each grinding cycle. Since grinding hard rock samples, especially those with radioactivity, is very difficult, we developed a new approach to determine the diffusivity of americium in granite. The new approach mainly includes two parts: one is to measure the radioactivities from both sides of a rock disk sample by autoradiography with phosphor imaging technique; the other is to study the relationship between the radioactivities and the apparent diffusivity of americium in granite by computer modelling. Because the high contamination risk of grinding radioactive rock samples has been avoided, the new approach is much simpler than the conventional method. It may be a better choice of measuring the diffusivities of radionuclides in rock, especially for those laboratories in which grinding radioactive rock samples is inconvenient. (orig.)

  2. Transmutation of americium and curium incorporated in zirconia-based host materials

    Energy Technology Data Exchange (ETDEWEB)

    Raison, P.E. [CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. d' Etudes des Combustibles; Haire, R.G. [Oak Ridge National Lab., TN (United States)

    2001-07-01

    Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO{sub 2}-ZrO{sub 2}-Y{sub 2}O{sub 3}. It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO{sub 2} content. The Cm{sub 2}O{sub 3}-ZrO{sub 2} system was also investigated. It was found that at 25 mol% of CmO{sub 1.5}, the Cm(III) stabilized zirconia in its cubic form (a = 5.21 {+-}0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO{sub 1.5}, a pyrochlore oxide - Cm{sub 2}Zr{sub 2}O{sub 7} - is formed (a = 10.63 {+-}0.02 Angstrom). (author)

  3. Comparison of Americium-Beryllium neutron spectrum obtained using activation foil detectors and NE-213 spectrometer

    International Nuclear Information System (INIS)

    Sunny, Sunil; Subbaiah, K.V.; Selvakumaran, T.S.

    1999-01-01

    Neutron spectrum of Americium - Beryllium (α,n) source is measured with two different spectrometers vis-a-vis activation foils (foil detectors) and NE-213 organic scintillator. Activity induced in the foils is measured with 4π-β-γ sodium iodide detector by integrating counts under photo peak and the saturation activity is found by correcting to elapsed time before counting. The data on calculated activity is fed into the unfolding code, SAND-II to obtain neutron spectrum. In the case of organic scintillator, the pulse height spectrum is obtained using MCA and this is processed with unfolding code DUST in order to get neutron spectrum. The Americium - Beryllium (α,n) neutron spectrum thus obtained by two different methods is compared. It is inferred that the NE-213 scintillator spectrum is in excellent agreement with the values beyond 1MeV. Neutron spectrum obtained by activation foils depends on initial guess spectrum and is found to be in reasonable agreement with NE-213 spectrum. (author)

  4. Tank 241-B-103 tank characterization plan

    International Nuclear Information System (INIS)

    Carpenter, B.C.

    1995-01-01

    The Defense Nuclear Facilities Safety Board (DNFSB) has advised the US Department of Energy (DOE) to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The data quality objective (DQO) process was chosen as a tool to be used to identify sampling and analytical needs for the resolution of safety issues. As a result, a revision in the Federal Facility Agreement and Consent Order (Tri-Party Agreement or TPA) milestone M-44-00 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process... Development of TCPs by the DQO process is intended to allow users (e.g., Hanford Facility user groups, regulators) to ensure their needs will be met and that resources are devoted to gaining only necessary information.'' This document satisfies that requirement for Tank 241-B-103 (B-103) sampling activities. Tank B-103 was placed on the Organic Watch List in January 1991 due to review of TRAC data that predicts a TOC content of 3.3 dry weight percent. The tank was classified as an assumed leaker of approximately 30,280 liters (8,000 gallons) in 1978 and declared inactive. Tank B-103 is passively ventilated with interim stabilization and intrusion prevention measures completed in 1985

  5. Tank 241-AW-101 tank characterization plan

    International Nuclear Information System (INIS)

    Sathyanarayana, P.

    1994-01-01

    The first section gives a summary of the available information for Tank AW-101. Included in the discussion are the process history and recent sampling events for the tank, as well as general information about the tank such as its age and the risers to be used for sampling. Tank 241-AW-101 is one of the 25 tanks on the Flammable Gas Watch List. To resolve the Flammable Gas safety issue, characterization of the tanks, including intrusive tank sampling, must be performed. Prior to sampling, however, the potential for the following scenarios must be evaluated: the potential for ignition of flammable gases such as hydrogen-air and/or hydrogen-nitrous oxide; and the potential for secondary ignition of organic-nitrate/nitrate mixtures in crust layer initiated by the burning of flammable gases or by a mechanical in-tank energy source. The characterization effort applicable to this Tank Characterization Plan is focused on the resolution of the crust burn flammable gas safety issue of Tank AW-101. To evaluate the potential for a crust burn of the waste material, calorimetry tests will be performed on the waste. Differential Scanning Calorimetry (DSC) will be used to determine whether an exothermic reaction exists

  6. 241-AZ-101 pump removal trough analysis

    International Nuclear Information System (INIS)

    Coverdell, B.L.

    1995-01-01

    As part of the current Hanford mission of environmental cleanup, various long length equipment must be removed from highly radioactive waste tanks. The removal of equipment will utilize portions of the Equipment Removal System for Project W320 (ERS-W320), specifically the 50 ton hydraulic trailer system. Because the ERS-W320 system was designed to accommodate much heavier equipment it is adequate to support the dead weight of the trough, carriage and related equipment for 241AZ101 pump removal project. However, the ERS-W320 components when combined with the trough and its' related components must also be analyzed for overturning due to wind loads. Two troughs were designed, one for the 20 in. diameter carriage and one for the 36 in. diameter carriage. A proposed 52 in. trough was not designed and, therefore is not included in this document. In order to fit in the ERS-W320 strongback the troughs were design with the same widths. Structurally, the only difference between the two troughs is that more material was removed from the stiffener plates on the 36 in trough. The reduction in stiffener plate material reduces the allowable load. Therefore, only the 36 in. trough was analyzed

  7. 241-Z-361 Sludge Characterization Sampling and Analysis Plan

    Energy Technology Data Exchange (ETDEWEB)

    BANNING, D.L.

    1999-08-05

    This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.

  8. 241-Z-361 Sludge Characterization Sampling and Analysis Plan

    Energy Technology Data Exchange (ETDEWEB)

    BANNING, D.L.

    1999-07-29

    This sampling and analysis plan (SAP) identifies the type, quantity, and quality of data needed to support characterization of the sludge that remains in Tank 241-2-361. The procedures described in this SAP are based on the results of the 241-2-361 Sludge Characterization Data Quality Objectives (DQO) (BWHC 1999) process for the tank. The primary objectives of this project are to evaluate the contents of Tank 241-2-361 in order to resolve safety and safeguards issues and to assess alternatives for sludge removal and disposal.

  9. EURADOS intercomparison on measurements and Monte Carlo modelling for the assessment of Americium in a USTUR leg phantom

    International Nuclear Information System (INIS)

    Lopez, M. A.; Broggio, D.; Capello, K.; Cardenas-Mendez, E.; El-Faramawy, N.; Franck, D.; James, A. C.; Kramer, G. H.; Lacerenza, G.; Lynch, T. P.; Navarro, J. F.; Navarro, T.; Perez, B.; Ruehm, W.; Tolmachev, S. Y.; Weitzenegger, E.

    2011-01-01

    A collaboration of the EURADOS working group on 'Internal Dosimetry' and the United States Transuranium and Uranium Registries (USTUR) has taken place to carry out an intercomparison on measurements and Monte Carlo modelling determining americium deposited in the bone of a USTUR leg phantom. Preliminary results and conclusions of this intercomparison exercise are presented here. (authors)

  10. The weak acid resin process: a dustless conversion route for the synthesis of americium bearing-blanket precursors

    International Nuclear Information System (INIS)

    Picart, S.; Gauthe, A.; Parant, P.; Remy, E.; Jobelin, I.; Pomared, J.M.; Grangaud, P.; Dauby, J.; Delahaye, T.; Caisso, M.; Bataille, M.; Bayle, J.P.; Frost, C.; Delage, C.; Martin, C.L.; Ayral, E.

    2016-01-01

    Mixed uranium-americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Conversion and fabrication processes are currently developed to make those materials in the form of dense and homogeneous oxide ceramic pellets or dense granulates incorporating uranium and americium. Their development points out the need of a simplified and optimized process which could lower hazards linked to dust generation of highly contaminating and irradiating compounds and facilitate material transfer in remote handling operations. This reason motivated the development of innovative 'dustless' route such as the Weak Acid Resin route (WAR) which provides the oxide precursors in the form of sub-millimeter-sized microspheres with optimal flowability and limits dust generation during conversion and fabrication steps. This study is thus devoted to the synthesis of mixed uranium-americium oxide microspheres by the WAR process and to the characterization of such precursors. This work also deals with their application to the fabrication of dense or porous pellets and with their potential use as dense spherules to make Sphere-Pac fuel. (authors)

  11. The weak acid resin process: a dustless conversion route for the synthesis of americium bearing-blanket precursors

    Energy Technology Data Exchange (ETDEWEB)

    Picart, S.; Gauthe, A.; Parant, P.; Remy, E.; Jobelin, I.; Pomared, J.M.; Grangaud, P.; Dauby, J.; Delahaye, T. [CEA, Centre de Marcoule, DEN/MAR/DRCP, F-30207 Bagnols-sur-Ceze (France); Caisso, M.; Bataille, M.; Bayle, J.P. [CEA, Centre de Marcoule, DEN/MAR/DTEC, F-30207 Bagnols-sur-Ceze (France); Frost, C. [CEA, Centre de Marcoule, DEN/MAR/DRCP, F-30207 Bagnols-sur-Ceze (France); Institut Europeen des Membranes, CNRS-ENSCM-UM, CC47, University of Montpellier, F-34095 Montpellier (France); Delage, C. [CEA, Centre de Cadarache, DEN/CAD/DEC, Saint-Paul-lez-Durance (France); Martin, C.L. [Univ. Grenoble Alpes, CNRS, SIMAP, F-38000 Grenoble (France); Ayral, E. [Institut Europeen des Membranes, CNRS-ENSCM-UM, CC47, University of Montpellier, F-34095 Montpellier (France)

    2016-07-01

    Mixed uranium-americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Conversion and fabrication processes are currently developed to make those materials in the form of dense and homogeneous oxide ceramic pellets or dense granulates incorporating uranium and americium. Their development points out the need of a simplified and optimized process which could lower hazards linked to dust generation of highly contaminating and irradiating compounds and facilitate material transfer in remote handling operations. This reason motivated the development of innovative 'dustless' route such as the Weak Acid Resin route (WAR) which provides the oxide precursors in the form of sub-millimeter-sized microspheres with optimal flowability and limits dust generation during conversion and fabrication steps. This study is thus devoted to the synthesis of mixed uranium-americium oxide microspheres by the WAR process and to the characterization of such precursors. This work also deals with their application to the fabrication of dense or porous pellets and with their potential use as dense spherules to make Sphere-Pac fuel. (authors)

  12. 24 CFR 241.865 - Election by the lender.

    Science.gov (United States)

    2010-04-01

    ... Without a HUD-Insured or HUD-Held Mortgage Rights and Duties of Lender Under the Contract of Insurance § 241.865 Election by the lender. Where a real estate mortgage, or other security instrument has been...

  13. Tank 241-BY-110 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-BY-110

  14. Acceptance Test Report for 241-U compressed air system

    International Nuclear Information System (INIS)

    Freeman, R.D.

    1994-01-01

    This Acceptance Test Report (ATR) documents the results of acceptance testing of a newly upgraded compressed air system at 241-U Farm. The system was installed and the test successfully performed under work package 2W-92-01027

  15. Tank characterization report for single shell tank 241-SX-108

    Energy Technology Data Exchange (ETDEWEB)

    Eggers, R.F., Westinghouse Hanford

    1996-07-11

    This document summarizes the information on the historical uses, present status, and the sampling and analysis results of waste stored in tank 241-SX-108. This report supports the requirements of Tri-Party Agreement Milestone M-44-09.

  16. Tank 241-S-107 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-S-107

  17. Tank 241-AN-102 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-AN-102

  18. Tank 241-BY-105 rotary core sampling and analysis plan

    International Nuclear Information System (INIS)

    Sasaki, L.M.

    1995-01-01

    This Sampling and Analysis Plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for two rotary-mode core samples from tank 241-BY-105 (BY-105)

  19. Tank 241-U-111 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-U-111

  20. Tank 241-B-106 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-B-106

  1. Tank 241-SY-103 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Homi, C.S.

    1995-01-01

    This document is a plan that identifies the information needed to address relevant issues concerning short-term and long-term safe storage and long-term management of Single-Shell Tank (SST) 241-SY-103

  2. Compressed air piping, 241-SY-101 hydraulic pump retrieval trailer

    International Nuclear Information System (INIS)

    Wilson, T.R.

    1994-01-01

    The following Design Analysis was prepared by the Westinghouse Hanford Company to determine pressure losses in the compressed air piping installed on the hydraulic trailer for the 241-SY-101 pump retrieval mission

  3. Photon interaction studies using 241Am γ-rays

    Indian Academy of Sciences (India)

    rays from a 241Am source. These include attenuation studies as well as photoelectric absorption studies in various samples. The attenuation studies have been made using leaf and wood samples, samples like sand, sugar etc., which ...

  4. Dicty_cDB: CHR241 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR241 (Link to dictyBase) - - - Contig-U10843-1 | Contig-U131... library) Clone ID CHR241 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U108...43-1 | Contig-U13148-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/C...ilyhtht**KTMATQQQQQQQQQQQQQIKARKDIQIQQ AQSASDILGPPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICT...PPEISETEITTESILGDGSFGTVYKGRCRLKDVAVKVMLKQVDQKTLTDFR KEVAIMSKIFHPNIVLFLGACTSTPGKLMICTELMKGNLVSLLLDPMVKLPLITRM

  5. Test report - 241-AN-274 Caustic Pump Control Building

    International Nuclear Information System (INIS)

    Paintner, G.P.

    1995-05-01

    This Acceptance Test Report documents the test results of test procedure WHC-SD-WM-ATP-135 'Acceptance Test Procedure for the 241-AN- 274 Caustic Pump Control Building.' The objective of the test was to verify that the 241-AN-274 Caustic Pump Control Building functions properly based on design specifications per applicable H-2-85573 drawings and associated ECN's. The objective of the test was met

  6. Analysis and characterization of double shell tank 241-AP-108

    International Nuclear Information System (INIS)

    Miller, G.L.

    1994-01-01

    This document is the first part of a three-part report describing the analysis and characterization of double shell tank 241-AP-108 which is located at the Hanford Reservation.This document is the analytical laboratory data package entitled 'Analysis and Characterization of Double Shell Tank 241-AP-108' which contains a case sampling history, the sampling protocols, the analytical procedures, sampling and analysis quality assurance and quality control measures, and chemical analysis results for samples obtained from the tank

  7. Tank 241-Z-361 process and characterization history

    International Nuclear Information System (INIS)

    Jones, S.A.

    1997-01-01

    This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of 20 plus years ago. Records of transfers into the tank, past characterization efforts, and speculation will be used to estimate the current condition of Tank 241-Z-361 and its contents

  8. Tank 241-AZ-101 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, A revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process. Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information''. This document satisfies that requirement for Tank 241-AZ-101 (AZ-101) sampling activities. Tank AZ-101 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The contents of Tank AZ-101, as of October 31, 1994, consisted of 3,630 kL (960 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-101 is expected to have two primary layers. The bottom layer is composed of 132 kL of sludge, and the top layer is composed of 3,500 kL of supernatant, with a total tank waste depth of approximately 8.87 meters

  9. Tank 241-AZ-102 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    The Defense Nuclear Facilities Safety Board has advised the DOE to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The Data Quality Objective (DQO) process was chosen as a tool to be used in the resolution of safety issues. As a result, a revision in the Federal Facilities Agreement and Consent Order (Tri-Party Agreement) milestone M-44 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process ... Development of TCPs by the DQO process is intended to allow users to ensure their needs will be met and that resources are devoted to gaining only necessary information''. This document satisfies that requirement for tank 241-AZ-102 (AZ-102) sampling activities. Tank AZ-102 is currently a non-Watch List tank, so the only DQOs applicable to this tank are the safety screening DQO and the compatibility DQO, as described below. The current contents of Tank AZ-102, as of October 31, 1994, consisted of 3,600 kL (950 kgal) of dilute non-complexed waste and aging waste from PUREX (NCAW, neutralized current acid waste). Tank AZ-102 is expected to have two primary layers. The bottom layer is composed of 360 kL of sludge, and the top layer is composed of 3,240 kL of supernatant, with a total tank waste depth of approximately 8.9 meters

  10. Tank 241-C-107 tank characterization plan

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    The Defense Nuclear Facilities Safety Board (DNFSB) has advised the US Department of Energy (DOE) to concentrate the near-term sampling and analysis activities on identification and resolution of safety issues. The data quality objective (DQO) process was chosen as a tool to be used to identify sampling and analytical needs for the resolution of safety issues. As a result, a revision in the Federal Facility Agreement and Consent Order (Tri-Party Agreement or TPA) milestone M-44-00 has been made, which states that ''A Tank Characterization Plan (TCP) will also be developed for each double-shell tank (DST) and single-shell tank (SST) using the DQO process... Development of TCPs by the DQO process is intended to allow users (e.g., Hanford Facility user groups, regulators) to ensure their needs will be met and that resources are devoted to gaining only necessary information.'' This document satisfies that requirement for the Tank 241-C-107 (C-107) sampling activities. Currently tank C-107 is categorized as a sound, low-heat load tank with partial isolation completed in December 1982. The tank is awaiting stabilization. Tank C-107 is expected to contain three primary layers of waste. The bottom layer should contain a mixture of the following wastes: ion exchange, concentrated phosphate waste from N-Reactor, Hanford Lab Operations, strontium semi-works, Battelle Northwest, 1C, TBP waste, cladding waste, and the hot semi-works. The middle layer should contain strontium recovery supernate. The upper layer should consist of non-complexed waste

  11. Worldwide bioassay data resources for plutonium/americium internal dosimetry studies

    International Nuclear Information System (INIS)

    Miller, G.; Bertelli, L.; Little, T.; Guilmette, R.; Riddell, T.; Filipy, R.

    2005-01-01

    Full text: Biokinetic models are the scientific underpinning of internal dosimetry. These models describe how materials of interest taken into the body by various routes (for example inhalation) are transported through the body, allowing the modelling of bioassay measurements and the estimation of radiation dose. The International Commission on Radiation Protection (ICRP) publishes biokinetic models for use in internal dosimetry. These models represent the consensus judgement of a committee of experts, based on human and animal data. Nonetheless, it is important to validate biokinetic models using directly applicable data, in a scientifically transparent manner, especially for internal dosimetry research purposes (as opposed to radiation protection), as in epidemiology studies. Two major goals would be to determine individual variations of model parameters for the purpose of assessing this source of uncertainty in internal dose calculations, and to determine values of workplace specific parameters (such as particle solubility in lung fluids) for different representative workplaces. Furthermore, data on the observed frequency of intakes under various conditions can be used in the interpretation of bioassay data. All of the above may be couched in the terminology of Bayesian statistical analysis and amount to the determination of the Bayesian prior probability distributions needed in a Bayesian interpretation of bioassay data. The authors have direct knowledge of several significant databases of plutonium/americium bioassay data (including autopsy data). The purpose of this paper is to acquaint the worldwide community with these resources and to invite others who may know of other such databases to participate with us in a publication that would document the content, form, and the procedures for seeking access to these databases. These databases represent a tremendous scientific resource in this field. Examples of databases known to the authors include: the

  12. Placental transfer and distribution of 241Am in the rat

    International Nuclear Information System (INIS)

    Hisamatsu, S.; Takizawa, Y.

    1983-01-01

    The placental transfer and distribution of 241 Am in the feto-placental system were studied in pregnant rats. Rats were injected intravenously with 241 Am citrate at 15 or 18 days of gestation. Groups injected at 15 days of gestation were sacrificed 2, 24, 48, or 120 hr after injection, and the group injected at 18 days was sacrificed 24 hr after. The radioactivities of 241 Am in fetus, fetal membrane, and placenta were determined, and its distribution in the feto-placental system was investigated by high-speed autoradiography using a silver-activated zinc sulfide-coated membrane as an intensifying screen. The deposition of 241 Am in feto-placenta units increased with the number of days of gestation. Results of autoradiography revealed that major deposition sites of 241 Am in the fetus are the skeleton and liver. Heavy deposition of 241 Am in the yolksac splanchnopleure and its existence in the exocoelom strongly suggest that the yolk sac placenta plays an important role in the placental transfer of this nuclide

  13. Effect of gavaged chemical form of 241Am on its retention in mice

    International Nuclear Information System (INIS)

    Hisamatsu, S.; Takizawa, Y.

    1987-01-01

    The retention of 241 Am in mice 48 h after administration by gavage is reported here. The 241 Am was given to mice in the form of either 241 Am nitrate or 241 Am citrate. The 241 Am was also injected into rats in the same form. The homogenized livers of those rats were subsequently administered by gavage to another group of mice. The retention of 241 Am citrate was 1.5 X 10(-2)% of the original dose and was the highest among the compounds examined. The retention of biologically incorporated 241 Am into the liver as 241 Am nitrate and as 241 Am citrate was 2.4 X 10(-3) and 2.6 X 10(-3)%, respectively, and was similar to the retention of 241 Am nitrate, which was 2.8 X 10(-3)%. The ratio of the retention in the carcass to that in the liver for the 241 Am citrate was lower than that of the 241 Am nitrate and the biologically incorporated 241 Am. This difference indicates that the distribution of 241 Am in the animal body depends on the chemical form administered. The retention of liver-incorporated 241 Am as citrate after autolysis of the liver is similar to that of fresh liver-incorporated 241 Am citrate

  14. EURADOS action for determination of americium in skull measures in vivo and Monte Carlo simulation

    International Nuclear Information System (INIS)

    Lopez Ponte, M. A.; Navarro Amaro, J. F.; Perez Lopez, B.; Navarro Bravo, T.; Nogueira, P.; Vrba, T.

    2013-01-01

    From the Group of WG7 internal dosimetry of the EURADOS Organization (European Radiation Dosimetry group, e.V.) which It coordinates CIEMAT, international action for the vivo measurement of americium has been conducted in three mannequins type skull with detectors of Germanium by gamma spectrometry and simulation by Monte Carlo methods. Such action has been raised as two separate exercises, with the participation of institutions in Europe, America and Asia. Other actions similar precede this vivo intercomparison of measurement and modeling Monte Carlo1. The preliminary results and associated findings are presented in this work. The laboratory of the body radioactivity (CRC) of service counter of dosimetry staff internal (DPI) of the CIEMAT, it has been one of the participants in vivo measures exercise. On the other hand part, the Group of numerical dosimetry of CIEMAT is participant of the Monte Carlo2 simulation exercise. (Author)

  15. Complex formation of trivalent americium with salicylic acid at very low concentrations

    International Nuclear Information System (INIS)

    Melanie Mueller; Margret Acker; Steffen Taut; Gert Bernhard; Forschungszentrum Dresden-Rossendorf, Dresden

    2010-01-01

    For the first time, the complexation of americium(III) with salicylic acid was studied at trace metal concentrations using a 2.0 m Long Path Flow Cell for UV-vis spectroscopy. The detection limit of Am(III) in aqueous solution at pH 3.0 was found to be 5 x 10 -9 M. Two Am(III)-salicylate complexes were formed at pH 5.0 in 0.1 M NaClO 4 , indicated by a clear red shift of the absorption maximum. The absorption spectra obtained from spectrophotometric titration were analyzed by means of factor analysis and complex stabilities were calculated to be log β 110 = 2.56 ± 0.08 and log β 120 = 3.93 ± 0.19. (author)

  16. Recovery of plutonium and americium from chloride salt wastes by solvent extraction

    International Nuclear Information System (INIS)

    Reichley-Yinger, L.; Vandegrift, G.F.

    1987-01-01

    Plutonium and americium can be recovered from aqueous waste solutions containing a mixture of HCl and chloride salt wastes by the coupling of two solvent extraction systems: tributyl phosphate (TBP) in tetrachloroethylene (TCE) and octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) in TCE. In the flowsheet developed, the salt wastes are dissolved in HCl, the Pu(III) is oxidized to the IV state with NaClO 2 and recovered in the TBP-TCE cycle, and the Am is then removed from the resultant raffinate by the CMPO-TCE cycle. The consequences of the feed solution composition and extraction behavior of these species on the process flowsheet design, the Pu-product purity, and the decontamination of the aqueous raffinate from transuranic elements are discussed. 16 refs., 6 figs

  17. Separation and measurement of thorium, plutonium, americium, uranium and strontium in environmental matrices

    International Nuclear Information System (INIS)

    Harrison, Jennifer J.; Zawadzki, Atun; Chisari, Robert; Wong, Henri K.Y.

    2011-01-01

    A technique for the isolation of thorium (Th), plutonium (Pu), americium (Am), uranium (U) and strontium (Sr) isotopes from various environmental matrices has been adapted from a previously published method specific to water samples (). Separation and isolation of the various elemental fractions from a single sub-sample is possible, thereby eliminating the need for multiple analyses. The technique involves sample dissolution, concentration via calcium phosphate co-precipitation, rapid column extraction using TEVA TM , TRU TM and Sr-Spec TM resin cartridges, alpha spectrometry for Th, Pu, U and Am and Cerenkov counting for Sr. Various standard reference materials were analysed and chemical yields are in the range of 70-80% for Th, Am, U and Sr and 50-60% for Pu. Sample sizes of up to 10 L for water, 5 g for dry soil and sediment and 10 g for dry vegetation and seaweed can be processed using this technique.

  18. Separation and measurement of thorium, plutonium, americium, uranium and strontium in environmental matrices

    Energy Technology Data Exchange (ETDEWEB)

    Harrison, Jennifer J., E-mail: jennifer.harrison@ansto.gov.au [Australian Nuclear Science and Technology Organisation, PMB 1, Menai NSW 2234 (Australia); Zawadzki, Atun; Chisari, Robert; Wong, Henri K.Y. [Australian Nuclear Science and Technology Organisation, PMB 1, Menai NSW 2234 (Australia)

    2011-10-15

    A technique for the isolation of thorium (Th), plutonium (Pu), americium (Am), uranium (U) and strontium (Sr) isotopes from various environmental matrices has been adapted from a previously published method specific to water samples (). Separation and isolation of the various elemental fractions from a single sub-sample is possible, thereby eliminating the need for multiple analyses. The technique involves sample dissolution, concentration via calcium phosphate co-precipitation, rapid column extraction using TEVA{sup TM}, TRU{sup TM} and Sr-Spec{sup TM} resin cartridges, alpha spectrometry for Th, Pu, U and Am and Cerenkov counting for Sr. Various standard reference materials were analysed and chemical yields are in the range of 70-80% for Th, Am, U and Sr and 50-60% for Pu. Sample sizes of up to 10 L for water, 5 g for dry soil and sediment and 10 g for dry vegetation and seaweed can be processed using this technique.

  19. Liquid-liquid extraction of plutonium and americium by cekanoic acid from alkaline medium

    International Nuclear Information System (INIS)

    Venugopal Chetty, K.; Sagar, V.; Swarup, R.

    2001-01-01

    Liquid-liquid extraction studies of plutonium and americium from aqueous carbonate medium using a high molecular weight carboxylic acid namely cekanoic acid in different diluents has been carried out. The distribution ratio (D) values for Pu(IV) and Am(III) under various parameters such as concentration of extractant, Na 2 CO 3 and initial pH were obtained. Results indicated that Pu(IV) and Am(III) could be satisfactorily extracted together or individually from aqueous carbonate medium using cekanoic acid in different diluents like carbon tetrachloride, cyclohexane, toluene, n-dodecane or solvesso-100. The D values for Pu(IV) and Am(III) also indicated the possibility of their mutual separation. The back extraction of Pu and Am with different reagents was also studied. (orig.)

  20. Magnesium ionophore II as an extraction agent for trivalent europium and americium

    Energy Technology Data Exchange (ETDEWEB)

    Makrlik, Emanuel [Czech Univ. of Life Sciences, Prague (Czech Republic). Faculty of Environmental Sciences; Vanura, Petr [Univ. of Chemistry and Technology, Prague (Czech Republic). Dept. of Analytical Chemistry

    2016-11-01

    Solvent extraction of microamounts of trivalent europium and americium into nitrobenzene by using a mixture of hydrogen dicarbollylcobaltate (H{sup +}B{sup -}) and magnesium ionophore II (L) was studied. The equilibrium data were explained assuming that the species HL{sup +}, HL{sup +}{sub 2}, ML{sup 3+}{sub 2}, and ML{sup 3+}{sub 3} (M{sup 3+} = Eu{sup 3+}, Am{sup 3+}; L=magnesium, ionophore II) are extracted into the nitrobenzene phase. Extraction and stability constants of the cationic complex species in nitrobenzene saturated with water were determined and discussed. From the experimental results it is evident that this effective magnesium ionophore II receptor for the Eu{sup 3+} and Am{sup 3+} cations could be considered as a potential extraction agent for nuclear waste treatment.

  1. 241-SY Tank Farm Construction Extent of Condition Review for Tank Integrity

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, Travis J.; Boomer, Kayle D.; Gunter, Jason R.; Venetz, Theodore J.

    2013-07-25

    This report provides the results of an extent of condition construction history review for tanks 241-SY-101, 241-SY-102, and 241-SY-103. The construction history of the 241-SY tank farm has been reviewed to identify issues similar to those experienced during tank 241-AY-102 construction. Those issues and others impacting integrity are discussed based on information found in available construction records, using tank 241-AY-102 as the comparison benchmark. In the 241-SY tank farm, the third DST farm constructed, refractory quality and stress relief were improved, while similar tank and liner fabrication issues remained.

  2. Riser configuration, Tank 241-A-105, light duty utility arm

    International Nuclear Information System (INIS)

    Boucher, T.D.

    1994-01-01

    The light-duty utility arm (LDUA) is a seven-joint stainless steel robotic arm with a payload capacity of 75 lb. The robotic arm is deployed vertically with a maximum vertical reach of 63 ft. and a maximum horizontal reach of 13.5 ft. The functional requirements of the LDUA system are mapping and characterization of waste in Hanford single-shell tanks (SST) before and during waste retrieval. The LDUA system consists of a mobile deployment system (MDS), a vertical positioning mast (VPM), a tank riser interface confinement (TRIC), the LDUA, and a controller subsystem or support trailer. Currently, the system is in design and is subject to change; however, the LDUA or robotic arm will be deployed through a 12-in. riser above the tank dome. Field trips were performed to gather specifics for future deployment of the LDUA in Tank 241-A-105. The purpose of this report is to support two previous reports for the investigation of SSTs for deployment of the LDUA system. The first report identified the availability of risers while the second report identified the availability of Tanks 241-A-105, 241-A-S-109, 241-A-T-101, and 241-A-T-109 for deployment of the LDUA system. The second report also identified those 4- and 12-in. risers that could be used for deployment of the LDUA and camera system. This report addresses accessibility to the 241-A Tank Farm and the usability of the Tank 241-A-105 risers. The following information for assisting in the design and deployment of the LDUA will be discussed in this report: radiation survey; flange identification; high resolution video; computer simulated model; and field survey

  3. Evaluation of the contamination risk by {sup 241}AM from lightning rods disposed at uncontrolled garbage dump; Avaliacao da contaminacao provocada por para-raios radioativos de americio-241 descartados em lixoes

    Energy Technology Data Exchange (ETDEWEB)

    Marumo, Julio Takehiro

    2006-07-01

    Radioactive lightning rods were manufactured in Brazil until 1989, when the licenses for using radioactive sources in these products were lifted by the national nuclear authority. Since then, radioactive devices have been replaced by Franklin type one and collected as radioactive waste. However, only 23 percent of the estimated total number of installed rods was delivered to Brazilian Nuclear Commission (Comissao Nacional de Energia Nuclear - CNEN). This situation is of concern as there is a possibility of the rods being discarded as domestic waste, considering that in Brazil, 63.6 percent of the municipal solid waste is disposed at uncontrolled garbage dump, according to Instituto Brasileiro de Geografia e Estatistica (IBGE) in 2000. In addition, americium, the most common employed radionuclide, is classified as a high toxicity element, when ingested or inhaled. In the present study, it was performed migration experiments of Am-241 by lysimeter system in order to evaluate the risk of contamination caused by radioactive lightning rods disposed as a common solid waste. Sources removed from lightning rods were placed inside lysimeters filled with organic waste, collected at the restaurant of Instituto de Pesquisas Energeticas e Nucleares, IPEN-CNEN/SP, and the generated leachate was periodically analyzed to determine its characteristics such as pH, redox potential, solid content and concentration of the radioactive material. Microbial growth was also evaluated by counting the number of colony forming units. The equivalent dose to members of the public has been calculated considering the ingestion of drinking water, the most probable mode of exposure. The final result was about 145 times below the effective dose limit of 1 mSv.year-1 for members of the public, established by the International Commission on Radiological Protection (ICRP), demonstrating that the risk caused by lightning rods disposed at uncontrolled garbage dump is low. (author)

  4. Role of natural dissolved organic compounds in determining the concentrations of americium in natural waters

    International Nuclear Information System (INIS)

    Nelson, D.M.; Orlandini, K.A.

    1985-01-01

    Concentrations of 241 Am, both in solution and bound to suspended particulate matter, have been measured in several North American lakes. Dissolved concentrations vary from 0.4 μBq/L to 85 μBq/L. The 241 Am in these lakes originated solely from global fallout and hence entered all lakes in the same physiocochemical form. The observed differences in solubility behavior must, therefore, be attributable to chemical and/or hydrological differences among the lakes. Concentrations of dissolved 241 Am are highly correlated with the corresponding concentrations of /sup 239, 240/Pu(III,IV), suggesting that a common factor is responsible for maintaining both in solution. The K/sub D/ values for 241 Am and /sup 239, 240/Pu(III,IV) are highly correlated with the concentrations of dissolved organic carbon (DOC) in the waters, suggesting that the common factor is the formation of soluble complexes with natural DOC for both elements. This hypothesis was tested in a series of laboratory experiments in which the DOC from several of the lakes was isolated by ultrafiltration. Plots of K/sub D/, as a function of DOC concentration, show K/sub D/ to be very high (approx.10 6 ) at low DOC concentrations. Above critical concentrations (a few mg/L DOC) the K/sub D/ values begin a progressive decrease with increasing DOC. We conclude that in most surface waters, the dissolved 241 Am concentration is regulated by an adsorption/desorption equilibrium with the sediments (and suspended solids) and the value of K/sub D/ that characterizes this equilibrium is largely determined by the concentration of natural DOC in the water. 11 refs., 3 figs., 2 tabs

  5. Tank 241-Z-361 process and characterization history

    International Nuclear Information System (INIS)

    Jones, S.A.

    1998-01-01

    An Unreviewed Safety Question (Wagoner, 1997) was declared based on lack of adequate authorization basis for Tank 241-Z-361 in the 200W Area at Hanford. This document is a summary of the history of Tank 241-Z-361 through December 1997. Documents reviewed include engineering files, laboratory notebooks from characterization efforts, waste facility process procedures, supporting documents and interviews of people's recollections of over twenty years ago. Records of transfers into the tank, past characterization efforts, and speculation were used to estimate the current condition of Tank 241-Z-361 and its contents. Information about the overall waste system as related to the settling tank was included to help in understanding the numbering system and process relationships. The Plutonium Finishing Plant was built in 1948 and began processing plutonium in mid-1949. The Incinerator (232-Z) operated from December 1961 until May 1973. The Plutonium Reclamation Facility (PRF, 236-Z) began operation in May 1964. The Waste Treatment Facility (242-Z) operated from August 1964 until August 1976. Waste from some processes went through transfer lines to 241-Z sump tanks. High salt and organic waste under normal operation were sent to Z-9 or Z-18 cribs. Water from the retention basin may have also passed through this tank. The transfer lines to 241-Z were numbered D-4 to D-6. The 241-Z sump tanks were numbered D-4 through D-8. The D-4, 5, and 8 drains went to the D-6 sump tank. When D-6 tank was full it was transferred to D-7 tank. Prior to transfer to cribs, the D-7 tank contents was sampled. If the plutonium content was analyzed to be more than 10 g per batch, the material was (generally) reprocessed. Below the discard limit, caustic was added and the material was sent to the cribs via the 241-Z-361 settling tank where solids settled out and the liquid overflowed by gravity to the cribs. Waste liquids that passed through the 241-Z-361 settling tank flowed from PFP to ground in

  6. Tank characterization data report: Tank 241-C-112

    International Nuclear Information System (INIS)

    Simpson, B.C.; Borsheim, G.L.; Jensen, L.

    1993-09-01

    Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable

  7. Tank characterization data report: Tank 241-C-112

    Energy Technology Data Exchange (ETDEWEB)

    Simpson, B.C.; Borsheim, G.L.; Jensen, L.

    1993-09-01

    Tank 241-C-112 is a Hanford Site Ferrocyanide Watch List tank that was most recently sampled in March 1992. Analyses of materials obtained from tank 241-C-112 were conducted to support the resolution of the Ferrocyanide Unreviewed Safety Question (USQ) and to support Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) Milestone M-10-00. Analysis of core samples obtained from tank 241-C-112 strongly indicates that the fuel concentration in the tank waste will not support a propagating exothermic reaction. Analysis of the process history of the tank as well as studies of simulants provided valuable information about the physical and chemical condition of the waste. This information, in combination with the analysis of the tank waste, sup ports the conclusion that an exothermic reaction in tank 241-C-112 is not plausible. Therefore, the contents of tank 241-C-112 present no imminent threat to the workers at the Hanford Site, the public, or the environment from its forrocyanide inventory. Because an exothermic reaction is not credible, the consequences of this accident scenario, as promulgated by the General Accounting Office, are not applicable.

  8. Association behaviour of 241Am(III) on SiO2(amorphous) and SiO2(quartz) colloids

    International Nuclear Information System (INIS)

    Degueldre, C.; Wernli, B.

    1993-01-01

    SiO 2 colloids have been identified as a potential vector for enhancing radionuclide transport in granitic groundwater and in concrete pore water. The sorption behaviour of 241 Am(III) on SiO 2 colloids was studied as a function of americium concentration pH (5-12), colloid concentration, ionic strength, temperature and SiO 2 allotropic species. The Am(III) sorption mechanism on amorphous silica is different from that on quartz. For SiO 2(amorphous) solution, the variation of log K p (ml g -1 ) with pH is linear (pH=5-9) with a slope of +1 indicating a one proton exchange mechanism. The colloid concentration (ppm) affects the sorption and log K p 3.7-0.67 log [SiO 2 ] (pH = 6). K p increases insignificantly when the ionic strength decreases. It shows no significant variation, however, with the Am concentration. On amorphous silica, the Am(III) sorption is driven by proton exchange from the silanol groups. For SiO 2 (quartz), log K p is constant over a large range of quartz concentration in suspension and the variation of log K p with pH is about linear (pH = 5-12), with a slope of 0.28, indicating a more complex exchange mechanism. Reactions taking into account the interaction of positive Am(OH) w (3-w)+ species on to the negatively charged quartz surface are suggested. (author)

  9. Separation by sequential chromatography of americium, plutonium and neptunium elements: application to the study of trans-uranian elements migration in a European lacustrine system

    International Nuclear Information System (INIS)

    Michel, H.

    1999-01-01

    The nuclear tests carried out in the atmosphere in the Sixties, the accidents and in particular that to the power station of Chernobyl in 1986, were at the origin of the dispersion of a significant quantity of transuranic elements and fission products. The study of a lake system, such that of the Blelham Tarn in Great Britain, presented in this memory, can bring interesting answers to the problems of management of the environment. The determination of the radionuclides in sediment cores made it possible not only to establish the history of the depositions and consequently the origin of the radionuclides, but also to evaluate the various transfers which took place according to the parameters of the site and the properties of the elements. The studied transuranic elements are plutonium 238, 239-240, americium 241 and neptunium 237. Alpha emitting radionuclides, their determination requires complex radiochemical separations. A method was worked out to successively separate the three radioelements by using a same chromatographic column. Cesium 137 is the studied fission product, its determination is done by direct Gamma spectrometry. Lead 210, natural radionuclide, whose atmospheric flow can be supposed constant. makes it possible to obtain a chronology of the various events. The detailed vertical study of sediment cores showed that the accumulation mode of the studied elements is the same one and that the methods of dating converge. The cesium, more mobile than transuranic elements in the atmosphere, was detected in the 1963 and 1986 fallout whereas an activity out of transuranic elements appears only for the 1963 fallout. The activity of the 1963 cesium fallout is of the same order of magnitude as that of 1986. The calculation of the diffusion coefficients of the elements in the sediments shows an increased migration of cesium compared to transuranic elements. An inventory on the whole of the lake made it possible to note that the atmospheric fallout constitute the

  10. Fabrication of targets for transmutation of americium : synthesis of inertial matrix by sol-gel method. Procedure study on the infiltration of a radioactive solutions

    International Nuclear Information System (INIS)

    Fernandez Carretero, A.

    2002-01-01

    Transmutation and incineration are innovative options in the management and disposal of fission products and actinides. nevertheless, the fabrication of targets for transmutation and incineration of actinides and fission products require a reconsideration of conventional processes (mechanical blending) and the development of new procedures compatible with the high activity of these materials. This work presents th R and D of a new fabrication method called INRAM (Infiltration of Radioactive Materials) based on the infiltration of an actinide solution in a porous non radiotoxic material in the form of a pellet (up to 12% An), or beads (up to 40% An) produced by sol-gel. The first method have been used for the fabrication of spinel (MgAl 2 O 4 ) targets containing 11% Am, which have been irradiated in HFR-Petten (358.4 full power days). Post-test burn-up calculations showed that at the end of the irradiation the initial Am-241 concentration was reduced to 4%. The fraction of the initial americum atoms that have been fissioned is 28%. The main advantage of the INRAM method is that matrices with low or zero activity can be fabricated and formed into the required shape in an unshielded facility. This method offers other advantages over conventional ones, such as the active wastes are reduced, is easy to automate, adoptable to telemanipulation and dust free, which facilitate operator intervention and minimise radiation exposure to the personal. In addition, the infiltrant needs only be present in liquid form, i. e. it could be transferred directly from the reprocessing plant for fabrication into targets without conversion into-solid form. In order to optimise the infiltration process in depth investigations of all important process parameters, e. g. infiltration kinetics and metal (pu, Am) concentration in the feed solution, and also on extensive study or powder metallurgy parameters for the preparation of high quality fuel pellets with a high density, have been made. In

  11. Experimental and in situ investigations on americium, curium and plutonium behaviour in marine benthic species: transfer from water or sediments

    International Nuclear Information System (INIS)

    Miramand, P.

    1984-06-01

    The tranfer of transuranic elements -americium, curium and plutonium- from the sediments containing them to some marine benthic species (endofauna and epifauna) was studied with a twofold approach - laboratory and in-situ investigation. The experimental investigations, divided into three parts, made it possible to specify concentration factors (F.C.), transfer factors (F.T.) and to understand the process involved for 5 benthic species. The result were refined by an in-situ study that brought new data on the marine distribution of the transuranic elements released by the La Hague plant. Finally, the localization of americium and plutonium in the tissues and cells of these species was determined by autoradiography [fr

  12. Annual report for FY 1976 on project AN0115A: the migration of plutonium and americium in the lithosphere

    International Nuclear Information System (INIS)

    Fried, S.; Friedman, A.M.; Hines, J.J.; Atcher, R.W.; Quarterman, L.A.; Volesky, A.

    1976-12-01

    Studies have been carried out on the migration of plutonium and americium in solutions flowing through porous and crushed rock and through fissures. The migration process can be described in terms of the surface absorption of these elements. In addition, chemical effects on the absorption have been observed. One of these effects is possibly due to the presence of a plutonium polymer that migrates at a more rapid rate than normal plutonium

  13. Upper limits to americium concentration in large sized sodium-cooled fast reactors loaded with metallic fuel

    International Nuclear Information System (INIS)

    Zhang, Youpeng; Wallenius, Janne

    2014-01-01

    Highlights: • The americium transmutation capability of Integral Fast Reactor was investigated. • The impact from americium introduction was parameterized by applying SERPENT Monte Carlo calculations. • Higher americium content in metallic fuel leads to a power penalty, preserving consistent safety margins. - Abstract: Transient analysis of a large sized sodium-cooled reactor loaded with metallic fuel modified by different fractions of americium have been performed. Unprotected loss-of-offsite power, unprotected loss-of-flow and unprotected transient-over-power accidents were simulated with the SAS4A/SASSYS code based on the geometrical model of an IFR with power rating of 2500 MW th , using safety parameters obtained with the SERPENT Monte Carlo code. The Ti-modified austenitic D9 steel, having higher creep rupture strength, was considered as the cladding and structural material apart from the ferritic/martensitic HT9 steel. For the reference case of U–12Pu–1Am–10Zr fuel at EOEC, the margin to fuel melt during a design basis condition UTOP is about 50 K for a maximum linear rating of 30 kW/m. In order to maintain a margin of 50 K to fuel failure, the linear power rating has to be reduced by ∼3% and 6% for 2 wt.% and 3 wt.% Am introduction into the fuel respectively. Hence, an Am concentration of 2–3 wt.% in the fuel would lead to a power penalty of 3–6%, permitting a consumption rate of 3.0–5.1 kg Am/TW h th . This consumption rate is significantly higher than the one previously obtained for oxide fuelled SFRs

  14. Test plan for Tank 241-AW-101 solubility screening tests

    International Nuclear Information System (INIS)

    Person, J.C.

    1998-01-01

    Tank 241-AW-101 (101-AW) has been identified as one of the early tanks to be for retrieved for low level waste pretreatment and immobilization and retrieval of the tank waste may require dilution. This test is to determine the effects of dilution on the mass of solids and their composition. This test plan gives test instructions, example data sheets, a waste compatibility review, and a waste stream fact sheet. This test Plan is similar to tests on tanks 241-AN-102 (Person 1998a) and 241-AN-107 (Person 1998 b). The 101-AW tests will be done with composites of liquid and solids from grab samples that were taken in 1998 (Benar 1998). Future revisions of the Tank Sampling and Analysis Plan (Benar 1998) may change the details of the work performed under this test plan

  15. Determination of plutonium 241 in solutions of nuclear wastes

    International Nuclear Information System (INIS)

    Raymond, A.; Bilcot, J.B.; Poletiko, C.

    1990-09-01

    Determination of plutonium 241 in nuclear wastes is important because of long period and high energy of some daughter products. In this report are presented two quantitative analysis methods using both scintillation techniques: A complete method, in any case, by selective extraction of plutonium on an anionic resin allowing simultaneous determination of Pu 241 and the sum of other plutonium isotopes; a simplified method when alpha activity is higher than beta/gamma activity by liquid extraction with TTA. These methods are applied for analysis of 4 waste types: cement encapsulated wastes, bitumen encapsulated wastes, incineration ashes, leaching of encapsulated incineration ashes. In these 4 examples, Pu 241 activity is equal or higher than the sum of alpha plutonium isotope activity. Separation efficiency, measured from Pu 239 or with Pu 236 as tracer, is between 90 and 99% [fr

  16. Operational test procedure for Bldg 241-A-701 air compressor

    International Nuclear Information System (INIS)

    Desantis, G.N.

    1995-01-01

    This document is an Operability Test Procedure (OTP) which will verify and record that the 241-A-701 air compressor and associated equipment operates within their intended design parameters. The activities defined in this OTP will be performed to ensure the daily operation of the new compressed air system can be reliable and efficient. The Compressed Air System (CAS) for 241-A-701 supplies process and instrument air to the A, AX, AY, and AZ tank farms. The primary use of the CAS is for tank farms instrumentation, air operated valves, and air lift circulators

  17. Waste behavior analysis for tank 241-SY-103

    International Nuclear Information System (INIS)

    Wilkins, N.E.

    1994-01-01

    Tank 241-SY-103 is on the Flammable Gas Watch List. The waste in this tank behaves similarly to that in tank 241-Sy-101. Both show slurry growth and periodic surface level drops. However, the surface level drops are much smaller than those in tank 101-SY. A standard hydrogen monitoring system (SHMS) was recently installed in tank 103-SY, and waste auger samples were recently taken. This document covers the characterization results to date for the auger samples, and the behavior of the tank waste during both steady state periods and gas release events

  18. Test plan for tank 241-AN-104 dilution studies

    International Nuclear Information System (INIS)

    Herting, D.L.

    1998-01-01

    Tank 241-AN-104 (104-AN) has been identified as the one of the first tanks to be retrieved for low level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount and type of dilution required for safe retrieval and transfer of feed and to re-dissolve major soluble sodium salts while not precipitating out other salts. The proposed laboratory tests are described in this document. Tank 241-AN-104 is on the Hydrogen Watch List

  19. Pu241 cross-sections below 1 keV

    International Nuclear Information System (INIS)

    Doherty, G.

    1966-12-01

    Early in 1965 a new data file (DFN 40) for Pu241 covering the energy range 10 - 4 eV to 15 MeV was prepared for the UKAEA Nuclear Data Library. The data above 1 keV are described by Douglas (AWRE 0-101/64) and the data below 1 keV are set out in this report. During the past year a number of additional measurements have been reported for Pu241 and a brief summary of these measurements and their implications for the data on the file are given. (author)

  20. Total and spontaneous fission half-lives of the americium and curium nuclides

    International Nuclear Information System (INIS)

    Holden, N.E.

    1984-01-01

    The total half-life and the half-life for spontaneous fission are evaluated for the various long-lived nuclides of interest. Recommended values are presented for 241 Am, /sup 242m/Am, 243 Am, 242 Cm, 243 Cm, 244 Cm, 245 Cm, 246 Cm, 247 Cm, 248 Cm, and 250 Cm. The uncertainties are provided at the 95% confidence limit for each of the recommended values

  1. Interim safety equipment list for 241-C-106 waste retrieval, project W-320

    International Nuclear Information System (INIS)

    Conner, J.C.

    1996-01-01

    The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices

  2. Interim safety equipment list for 241-C-106 waste retrieval, project W-320

    Energy Technology Data Exchange (ETDEWEB)

    Conner, J.C.

    1996-01-25

    The purpose of this supporting document is to provide safety classifications for systems, structures, and components of the Tank 241-C-106 Waste Retrieval Sluicing System (WRSS) and to document the methodology used to develop these safety classifications. The WRSS requires two transfer lines, one to carry sluiced waste slurry to tank 241-AY-102 and the other to return supernatant to tank 241-C-106; pumps in each tank; sluicers to direct the supernatant stream inside tank 241-C-106; a slurry distributor in tank 241-AY-102; heating, ventilation, and air conditioning for tank 241-C-106; and instrumentation and control devices.

  3. Comparative uptake and distribution of plutonium, americium, curium and neptunium in four plant species

    Energy Technology Data Exchange (ETDEWEB)

    Schreckhise, R E; Cline, J F [Battelle Pacific Northwest Labs., Richland, WA (USA)

    1980-05-01

    Uptake of the nitrate forms of /sup 238/Pu, /sup 239/Pu, /sup 241/Am, /sup 244/Cm and /sup 237/Np from soil into selected parts of four different plant species grown under field conditions was compared Alfalfa, barley, peas and cheatgrass were grown outdoors in small weighing lysimeters filled with soil containing these radionuclides. The plants were harvested at maturity, divided into selected components and radiochemically analyzed by alpha-energy analysis. Soil concentration did not appear to affect the plant uptake of /sup 238/Pu, /sup 239/Pu, /sup 241/Am or /sup 244/Cm for the two levels utilized. The relative plant uptake of the five different transuranics was /sup 237/Np>/sup 244/Cm approximately equal /sup 241/Am>/sup 239/Pu approximately equal/sup 238/Pu. Relative uptake values of Np for various plant parts ranged from 2200 to 45,000 times as great as for Pu, while Am and Cm values were 10-20 times as great. The values for seeds were significantly lower than those for the other aboveground plant parts for all four transuranic elements. The legumes accumulated approx. 10 times more than the grasses. A comparison of the postulated radionuclide content of plants grown in soil contaminated with material from spent liquid metal fast breeder reactor fuels indicated that concentrations of isotopes of Am, Cm and Np would exceed /sup 239/Pu values.

  4. Analysis of the 241SY101 pump removal trailer and the 241SY101 strongback

    International Nuclear Information System (INIS)

    Coverdell, B.L.

    1995-09-01

    The purpose of the calculations contained in the attached appendix is to determine the vibrational stability of the following combination (The Combination); shipping container, strongback and trailer. The vibrational stability of The Combination will be determined with the shipping container and strongback in the upright position. If the natural frequency of The Combination coincides with the input frequency and no damping is present, resonance will occur. The result of this is that the natural frequency of the Combination must be calculated as well as the input frequency. The input frequency in this case is caused by wind. Due to their geometrical complexity the upper and lower hydraulic clevises were analyzed for structural adequacy by using finite-element analysis (FEA). The FEA software COSMOS/M version 1.70 was used to model the upper and lower hydraulic clevis. All designs are in accordance with Standard Architectural-Civil Design Criteria, Design Loads for Facilities (DOE-RL 1989) and are safety class 3. The design and fabrication of each component is in accordance with American Institute of Steel Construction, Manual of Steel Construction, (AISC, 1989). The analyses contained in this document reflects the as-built condition of the 241SY101 hydraulic trailer

  5. Test plan for tank 241-C-104 retrieval testing

    International Nuclear Information System (INIS)

    HERTING, D.L.

    1999-01-01

    Tank 241-C-104 has been identified as one of the first tanks to be retrieved for high-level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount of dilution required for safe retrieval and transfer of feed. The proposed laboratory tests are described in this document

  6. Tank 241-AP-104 Grab Sampling and Analysis Plan

    International Nuclear Information System (INIS)

    TEMPLETON, A.M.

    2000-01-01

    This sampling and analysis plan (SAP) identifies characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for samples obtained from tank 241-AP-104. The purpose of this sampling event is to obtain information about the characteristics of the contents of 241-AP-104 required to provide sample material to the Waste Treatment Contractor. Grab samples will be obtained from riser 001 to provide sufficient material for the chemical analyses and tests required to satisfy these data quality objectives and ICD-23. The 222-S Laboratory will receive samples; composite the samples; perform chemical analyses on composite samples; and provide samples to the Waste Treatment Contractor and the Process Chemistry Laboratory. The Process Chemistry Laboratory at the 222-S Laboratory Complex will perform process tests to evaluate the behavior of the 241-AP-104 waste undergoing the retrieval and treatment scenarios defined in the applicable DQOs. The Waste Treatment Contractor will perform process verification and waste form qualification tests. Requirements for analyses of samples originating in the L and H DQO process tests will be documented in the corresponding test plan (Person 2000) and are not within the scope of this SAP. This report provides the general methodology and procedures to be used in the preparation, retrieval, transport, analysis, and reporting of results from grab samples retrieved from tank 241-AP-104

  7. 49 CFR 192.241 - Inspection and test of welds.

    Science.gov (United States)

    2010-10-01

    ... NATURAL AND OTHER GAS BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.241 Inspection and test of welds. (a) Visual inspection of welding must be conducted by an individual qualified by appropriate training and experience to ensure that: (1) The welding is performed in accordance...

  8. Sentinel node biopsy for melanoma: a study of 241 patients

    DEFF Research Database (Denmark)

    Chakera, Annette Hougaard; Drzewiecki, Krzysztof Tadeusz; Jakobsen, Annika Loft

    2004-01-01

    The aim of this study was to evaluate the sentinel node biopsy (SNB) technique for melanoma using both radiocolloid and blue dye in 241 clinically N0 patients with melanomas >1.0 mm, or thinner lesions exhibiting regression/ulceration. We showed that an increase in injected radioactivity increased...

  9. Justification for Continued Operation for Tank 241-Z-361

    International Nuclear Information System (INIS)

    BOGEN, D.M.

    1999-01-01

    This justification for continued operations (JCO) summarizes analyses performed to better understand and control the potential hazards associated with Tank 241-2-361. This revision to the JCO has been prepared to identify and control the hazards associated with sampling the tank using techniques developed and approved for use in the Tank Waste Remediation System (TWRS) at Hanford

  10. Solid Phase Characterization of Tank 241-C-105 Grab Samples

    International Nuclear Information System (INIS)

    Ely, T. M.; LaMothe, M. E.; Lachut, J. S.

    2016-01-01

    The solid phase characterization (SPC) of three grab samples from single-shell Tank 241-C-105 (C-105) that were received at the laboratory the week of October 26, 2015, has been completed. The three samples were received and broken down in the 11A hot cells.

  11. Justification for Continued Operation for Tank 241-Z-361

    Energy Technology Data Exchange (ETDEWEB)

    BOGEN, D.M.

    1999-09-01

    This justification for continued operations (JCO) summarizes analyses performed to better understand and control the potential hazards associated with Tank 241-2-361. This revision to the JCO has been prepared to identify and control the hazards associated with sampling the tank using techniques developed and approved for use in the Tank Waste Remediation System (TWRS) at Hanford.

  12. Methods of assessment of whole body 241Am content

    International Nuclear Information System (INIS)

    Foltanova, S.; Malatova, I.; Klisak, J.

    1998-01-01

    This paper discuss an influence of different skull phantoms on efficiency of the measurement. Description of some methods of an assessment of the 241 Am content in the human skeleton from measurements performed over long bones of the human body is also offered. (authors)

  13. On a low intensity 241 Am Compton spectrometer for measurement ...

    Indian Academy of Sciences (India)

    In this paper, a new design and construction of a low intensity (100 mCi) 241Am -ray Compton spectrometer is presented. The planar spectrometer is based on a small disc source with the shortest geometry. Measurement of the momentum density of polycrystalline Al is used to evaluate the performance of the new design.

  14. 39 CFR 241.3 - Discontinuance of post offices.

    Science.gov (United States)

    2010-07-01

    ... CLASSIFICATION, AND DISCONTINUANCE § 241.3 Discontinuance of post offices. (a) Introduction—(1) Coverage. This... justify in sufficient detail to Postal Service management and affected customers the proposed service... inspection during normal business hours at each post office where the Final Determination is posted for 30...

  15. Tank 241-BY-103 Tank Characterization Plan. Revision 1

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations and WHC 222-S Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples for tank 241-BY-103

  16. 36 CFR 241.2 - Cooperation in wildlife management.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation in wildlife... FISH AND WILDLIFE General Provisions § 241.2 Cooperation in wildlife management. The Chief of the... which national forests or portions thereof may be devoted to wildlife protection in combination with...

  17. 36 CFR 241.1 - Cooperation in wildlife protection.

    Science.gov (United States)

    2010-07-01

    ... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Cooperation in wildlife... FISH AND WILDLIFE General Provisions § 241.1 Cooperation in wildlife protection. (a) Officials of the... and regulations for the protection of wildlife. (b) Officials of the Forest Service who have been, or...

  18. ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN

    Energy Technology Data Exchange (ETDEWEB)

    DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ

    2006-12-13

    This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts.

  19. Inhalation toxicology of 241Am(NO3)3

    International Nuclear Information System (INIS)

    Ballou, J.E.; Gies, R.A.; Beasley, A.H.

    1980-01-01

    Inhaled 241 Am(NO 3 ) 3 was rapidly cleared from the lung (90% in 30 days) and translocated principally to skeleton. Although the estimated radiation dose to lung was twofold greater than the bone dose, the principal treatment-related lesion appeared to be osteosarcoma of the skeleton

  20. Test Plan for Tank 241-C-104 Retrieval Testing

    International Nuclear Information System (INIS)

    HERTING, D.L.

    1999-01-01

    Tank 241-C-104 has been identified as one of the first tanks to be retrieved for high-level waste pretreatment and immobilization. Retrieval of the tank waste will require dilution. Laboratory tests are needed to determine the amount of dilution required for safe retrieval and transfer of feed. The proposed laboratory tests are described in this document

  1. Granulometric data 241-TY Tank Farm monitoring well sediments

    International Nuclear Information System (INIS)

    Fecht, K.R.; Price, W.H.

    1977-12-01

    Approximately 200 sediment samples collected during the drilling of wells in the 241-TY Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 200 sediment samples are documented in this paper

  2. Granulometric data 241-S Tank Farm monitoring well sediments

    International Nuclear Information System (INIS)

    Fecht, K.R.; Price, W.H.

    1977-12-01

    Approximately 580 sediment samples collected during the drilling of wells in the 241-S Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment glass of each of the 580 sediment samples are documented in this report

  3. Granulometric data 241-C Tank Farm monitoring well sediments

    International Nuclear Information System (INIS)

    Fecht, K.R.; Price, W.H.

    1977-12-01

    Approximately 500 sediment samples collected during the drilling of wells in the 241-C Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 500 sediment samples are documented in this report

  4. Granulometric data 241-T Tank Farm monitoring well sediments

    International Nuclear Information System (INIS)

    Fecht, K.R.; Price, W.H.

    1977-12-01

    Approximately 850 sediment samples collected during the drilling of wells in the 241-T Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 850 sediment samples are documented in this report

  5. Granulometric data 241-B Tank Farm monitoring well sediments

    International Nuclear Information System (INIS)

    Fecht, K.R.; Price, W.H.

    1977-12-01

    Approximately 400 sediment samples collected during the drilling of wells in the 241-B Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 400 sediment samples are documented in this report

  6. Granulometric data 241-T Tank Farm monitoring well sediments

    International Nuclear Information System (INIS)

    Fecht, K.R.; Price, W.H.

    1977-12-01

    Approximately 650 sediment samples collected during the drilling of wells in the 241-BY Tank Farm have been analyzed for grain size and calcium carbonate content. The grain size data were used to categorize the sediment samples into sediment classes. The granulometric data, the calcium carbonate data, and the sediment class of each of the 650 sediment samples are documented in this report

  7. Project W-320, 241-C-106 sluicing supporting documentation bibliography

    International Nuclear Information System (INIS)

    Bailey, J.W.

    1998-01-01

    This supporting document has been prepared to make the listing of documentation used to develop, or in support of Project W-320, readily retrievable. All documents are sorted by document number and list the document type. Tank 241-C-106 has been included on the High Heat Load Watch List

  8. 48 CFR 52.241-5 - Contractor's Facilities.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Contractor's Facilities....241-5 Contractor's Facilities. As prescribed in 41.501(c)(4), insert a clause substantially the same as the following: Contractor's Facilities (FEB 1995) (a) The Contractor, at its expense, unless...

  9. Tank 241-C-103 tank characterization plan. Revision 1

    International Nuclear Information System (INIS)

    Schreiber, R.D.

    1995-01-01

    This document is a plan which serves as the contractual agreement between the Characterization Program, Sampling Operations, WHC 222-S Laboratory, and PNL 325 Analytical Chemistry Laboratory. The scope of this plan is to provide guidance for the sampling and analysis of samples from tank 241-C-103

  10. ANALYSIS RESULTS FOR BUILDING 241 702-AZ A TRAIN

    International Nuclear Information System (INIS)

    DUNCAN JB; FRYE JM; COOKE CA; LI SW; BROCKMAN FJ

    2006-01-01

    This report presents the analyses results for three samples obtained under RPP-PLAN-28509, Sampling and Analysis Plan for Building 241 702-AZ A Train. The sampling and analysis was done in response to problem evaluation request number PER-2004-6139, 702-AZ Filter Rooms Need Radiological Cleanup Efforts

  11. 24 CFR 241.555 - Security instrument and lien.

    Science.gov (United States)

    2010-04-01

    ... that a default under the first mortgage is a default under the supplementary loan security instrument... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Security instrument and lien. 241... HOUSING AND URBAN DEVELOPMENT MORTGAGE AND LOAN INSURANCE PROGRAMS UNDER NATIONAL HOUSING ACT AND OTHER...

  12. Project W-320, 241-C-106 sluicing, master calculation list

    International Nuclear Information System (INIS)

    Bailey, J.W.

    1998-01-01

    This supporting document has been prepared to make the Master Calculation List readily retrievable. The list gives the status of the calculation (as-built, not used, applied, etc.), the calculation title, its originator, comments, and report number under which it was issued. Tank 241-C-106 has been included on the High Heat Load Watch List

  13. 27 CFR 24.241 - Decolorizing juice or wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Decolorizing juice or wine..., DEPARTMENT OF THE TREASURY LIQUORS WINE Storage, Treatment and Finishing of Wine § 24.241 Decolorizing juice or wine. (a) Conditions and limitations. If the proprietor wishes to use activated carbon or other...

  14. Solution speciation of plutonium and Americium at an Australian legacy radioactive waste disposal site.

    Science.gov (United States)

    Ikeda-Ohno, Atsushi; Harrison, Jennifer J; Thiruvoth, Sangeeth; Wilsher, Kerry; Wong, Henri K Y; Johansen, Mathew P; Waite, T David; Payne, Timothy E

    2014-09-02

    During the 1960s, radioactive waste containing small amounts of plutonium (Pu) and americium (Am) was disposed in shallow trenches at the Little Forest Burial Ground (LFBG), located near the southern suburbs of Sydney, Australia. Because of periodic saturation and overflowing of the former disposal trenches, Pu and Am have been transferred from the buried wastes into the surrounding surface soils. The presence of readily detected amounts of Pu and Am in the trench waters provides a unique opportunity to study their aqueous speciation under environmentally relevant conditions. This study aims to comprehensively investigate the chemical speciation of Pu and Am in the trench water by combining fluoride coprecipitation, solvent extraction, particle size fractionation, and thermochemical modeling. The predominant oxidation states of dissolved Pu and Am species were found to be Pu(IV) and Am(III), and large proportions of both actinides (Pu, 97.7%; Am, 86.8%) were associated with mobile colloids in the submicron size range. On the basis of this information, possible management options are assessed.

  15. Cleanex process: a versatile solvent extraction process for recovery and purification of lanthanides, americium, and curium

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Collins, E.D.; King, L.J.

    1979-01-01

    At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter

  16. Contrasts between the marine and freshwater biological interactions of plutonium and americium

    International Nuclear Information System (INIS)

    Livingston, H.D.; Bowen, V.T.

    1975-01-01

    Whether in lakes or the oceans the transuranic elements plutonium and americium are taken up by marine organisms, with concentration factors that would class them as nice, typical heavy metals. There is no evidence for strong, widespread discrimination against the transuranics by either plant or animal absorptive surfaces. In both freshwater and marine situations the major reservoir of Pu and Am soon becomes the sediments, and organisms are more exposed to uptake of these nuclides the closer is their ecological involvement with the sediments. Although there is little evidence that this can be an ionic strength effect, it does appear that Pu may be somewhat more available, biologically, in marine environments, and Am, conversely, in fresh water. We incline to the belief that details of these behaviors are usually controlled by local availability of organic complexers. No compelling evidence exists of increase in Pu concentration at higher levels of food chains; in marine situations this appears true of Am as well, but a few data suggest that in fresh water fish there is a progressive increase, in higher trophic levels, in the ratio Am to Pu. Although marine and fresh water biogeochemistries of transuranics are much more similar than we had expected, it will generally be dangerous to extrapolate from one to the other. In both systems there appears to us no question that we are observing real element biogeochemistry, not the redistribution of inert, labelled, fallout fragments

  17. Plutonium and americium recovery from spent molten-salt-extraction salts with aluminum-magnesium alloys

    International Nuclear Information System (INIS)

    Cusick, M.J.; Sherwood, W.G.; Fitzpatrick, R.F.

    1984-01-01

    Development work was performed to determine the feasibility of removing plutonium and americium from spent molten-salt-extraction (MSE) salts using Al-Mg alloys. If the product buttons from this process are compatible with subsequent aqueous processing, the complex chloride-to-nitrate aqueous conversion step which is presently required for these salts may be eliminated. The optimum alloy composition used to treat spent 8 wt % MSE salts in the past yielded poor phase-disengagement characteristics when applied to 30 mol % salts. After a limited investigation of other alloy compositions in the Al-Mg-Pu-Am system, it was determined that the Al-Pu-Am system could yield a compatible alloy. In this system, experiments were performed to investigate the effects of plutonium loading in the alloy, excess magnesium, age of the spent salt on actinide recovery, phase disengagement, and button homogeneity. Experimental results indicate that 95 percent plutonium recoveries can be attained for fresh salts. Further development is required for backlog salts generated prior to 1981. A homogeneous product alloy, as required for aqueous processing, could not be produced

  18. Development and Testing of an Americium/Lanthanide Separation Flowsheet Using Sodium Bismuthate

    Energy Technology Data Exchange (ETDEWEB)

    Jack Law; Bruce Mincher; Troy Garn; Mitchell Greenhalgh; Nicholas Schmitt; Veronica Rutledge

    2014-04-01

    The separation of Am from the lanthanides and curium is a key step in proposed advanced fuel cycle scenarios. The partitioning and transmutation of Am is desirable to minimize the long-term heat load of material interred in a future high-level waste repository. A separation process amenable to process scale-up remains elusive. Given only subtle chemistry differences within and between the ions of the trivalent actinide and lanthanide series this separation is challenging ; however, higher oxidation states of americium can be prepared using sodium bismuthate and separated via solvent extraction using diamylamylphosphonate (DAAP) extraction. Among the other trivalent metals only Ce is also oxidized and extracted. Due to the long-term instability of Am(VI) , the loaded organic phase is readily selectively stripped to partition the actinide to a new acidic aqueous phase. Batch extraction distribution ratio measurements were used to design a flowsheet to accomplish this separation. Additionally, crossflow filtration was investigated as a method to filter the bismuthate solids from the feed solution prior to extraction. Results of the filtration studies, flowsheet development work and flowsheet performance testing using a centrifugal contactor are detailed.

  19. Preparation of curium-americium oxide microspheres by resin-bead loading

    International Nuclear Information System (INIS)

    Chattin, F.R.; Benker, D.E.; Lloyd, M.H.; Orr, P.B.; Ross, R.G.; Wiggins, J.T.

    1980-01-01

    Resin-bead loading and calcination techniques have been used to produce all curium and americium oxide feed material (about 2.2 kg) for HFIR targets since 1971. The process based on Dowex 50W resin has progressed from a series of test runs, through special production runs, into routine production in permanent equipment beginning in 1975. Key attributes of this process are its reliability, high yields, and ease of operation. The process is suited for remote operation in hot cells. Yields approaching 95% are routinely obtained and only one unacceptable product has been generated during routine production operations. There have been no problems in fabricating targets from this oxide or in the subsequent irradiation of these targets. The present scale of production of 150 to 250 g/y supplies the present need and is comparable with the level of other chemical process operations at TRU. Since the annual production is accomplished in two 8 to 12 day periods, there has been no reason to consider further scale-up. However, the rate of production could easily be doubled by simply adding a second set of calcination equipment

  20. Multicompartment kinetic models for the metabolism of americium, plutonium and uranium in rats

    International Nuclear Information System (INIS)

    Sontag, W.

    1986-01-01

    To examine the kinetic behaviour of americium, plutonium and uranium in male and female rats, an extended mammillary model has been developed, composed of 10 compartments connected with 17 linear transfer coefficients. The 10 compartments describe the behaviour of the three nuclides in the blood, skeleton, liver and kidney; the remaining activity is assigned to one residual organ. Each organ is divided into two compartments, short- and long-term. In the skeleton the short-term compartment has been assumed to be the bone surface and marrow, and the long-term compartment the deep bone; in the liver, evidence suggests that the short-term compartment is physiologically associated with lysosomes and the long-term compartment identical with telolysosomes. Influence of age, sex and different nuclides on the transfer coefficients and the absorbed radiation dose are discussed. By using the transfer coefficients calculated for intravenous injection, the behaviour of the nuclides in skeleton and liver during continuous intake has been calculated. The behaviour of the three nuclides in skeleton and liver after intravenous injection has also been calculated with the additional assumption that from the fifth day the animals were treated continuously with a chelating agent. (UK)