
Sample records for americium 235

  1. Preparation of americium amalgam

    International Nuclear Information System (INIS)

    The authors describe a method for the electrochemical preparation of an americium amalgam from americium dioxide and americium 241 and 243 for use in determining the physicochemical properties of the alloy. Moessbauer spectra were made using neptunium dioxide, in the neptunium 237 form, as an absorber. Results show that electrolysis produces a homogeneous amalgam that gives an unoxidized product on vacuum distillation at 200 degrees C

  2. Americium recovery from reduction residues (United States)

    Conner, W.V.; Proctor, S.G.


    A process for separation and recovery of americium values from container or bomb'' reduction residues comprising dissolving the residues in a suitable acid, adjusting the hydrogen ion concentration to a desired level by adding a base, precipitating the americium as americium oxalate by adding oxalic acid, digesting the solution, separating the precipitate, and thereafter calcining the americium oxalate precipitate to form americium oxide. (Official Gazette)

  3. Preparation of americium amalgam

    International Nuclear Information System (INIS)

    Using the method of NGR-spectroscopy with the aid of 241Am isotope chemical state of transuranium elements in the volume and on the surface of amalgams is studied. Amalgam preparation was realized in a simplified electrolytic cell. It is shown that in the process of amalgam preparation the first order of reaction as to actinide is observed; americium is distributed gradually over the volume and it is partially sorbed by the surface of glass capillary. NGR spectrum of dry residue after mercury distillation at 200 deg C points to the presence of americium-mercury intermetal compounds

  4. Chemistry of americium

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.


    Essential features of the descriptive chemistry of americium are reviewed. Chapter titles are: discovery, atomic and nuclear properties, collateral reading, production and uses, chemistry in aqueous solution, metal, alloys, and compounds, and, recovery, separation, purification. Author and subject indexes are included. (JCB)

  5. ADJ 235 Tutorials / adj235dotcom




    ADJ 235 Entire Course (UOP)   For more course tutorials visit   ADJ 235 Week 1 Checkpoint Legalizing Morality ADJ 235 Week 1 DQ 1 and DQ 2 ADJ 235 Week 2 Checkpoint Interpretation of Ethical Systems ADJ 235 Week 2 Assignment Deontological Versus Teleological Ethical Systems ADJ 235 Week 3 Checkpoint Undercover Operations ADJ 235 Week 3 DQ 1 and DQ 2 ADJ 235 Week 4 Checkpoint Law Enforcement Code of Ethics ADJ 235 Week 4 ...

  6. Americium-241 - ED 4308

    International Nuclear Information System (INIS)

    This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)

  7. The Biokinetic Model of Americium

    Institute of Scientific and Technical Information of China (English)


    To improve in vivo measurements for detecting internal exposure from transuranium radio nuclides, such as neptunium, plutonium, americium, the bioknetic model was studied. According to ICRP report (1993, 1995, 1997) and other research, the

  8. Americium product solidification and disposal

    International Nuclear Information System (INIS)

    The americium product from the TRUEX processing plant needs to be converted into a form suitable for ultimate disposal. An evaluation of the disposal based on safety, number of process steps, demonstrated operability of the processes, production of low-level alpha waste streams, and simplicity of maintenance with low radiation exposures to personnel during maintenance, has been made. The best process is to load the americium on a cation exchange resin followed by calcination or oxidation of the resin after loading

  9. Science and Technology for Americium Transmutation

    International Nuclear Information System (INIS)

    Americium could be seen as the most troublesome element that is present in nuclear fuel. This thesis offers different points of view on the possibility of americium transmutation. The first point of view elaborates simulations of americium-bearing facilities, namely nuclear data, a popular computational code and modeling techniques. The second point of view is focused on practical usage of the simulations to examine upper limit of americium in a specific reactor

  10. Transmutation of Americium in Fast Neutron Facilities


    Zhang, Youpeng


    In this thesis, the feasibility to use a medium sized sodium cooled fast reactor fully loaded with MOX fuel for efficient transmutation of americium is investigated by simulating the safety performance of a BN600-type fast reactor loaded with different fractions of americium in the fuel, using the safety parameters obtained with the SERPENT Monte Carlo code. The focus is on americium mainly due to its long-term contribution to the radiotoxicity of spent nuclear fuel and its deterioration on c...

  11. ADJ 235 UOP Course Tutorial / adj235dotcom




    ADJ 235 Entire Course (UOP) For more course tutorials visit ADJ 235 Week 1 Checkpoint Legalizing Morality ADJ 235 Week 1 DQ 1 and DQ 2 ADJ 235 Week 2 Checkpoint Interpretation of Ethical Systems ADJ 235 Week 2 Assignment Deontological Versus Teleological Ethical Systems ADJ 235 Week 3 Checkpoint Undercover Operations ADJ 235 Week 3 DQ 1 and DQ 2 ADJ 235 Week 4 Checkpoint Law Enforcement Code of Ethics ADJ 235 Week 4 Assignment Law Enforce...

  12. Monte Carlo modeling of spallation targets containing uranium and americium

    International Nuclear Information System (INIS)

    Neutron production and transport in spallation targets made of uranium and americium are studied with a Geant4-based code MCADS (Monte Carlo model for Accelerator Driven Systems). A good agreement of MCADS results with experimental data on neutron- and proton-induced reactions on 241Am and 243Am nuclei allows to use this model for simulations with extended Am targets. It was demonstrated that MCADS model can be used for calculating the values of critical mass for 233,235U, 237Np, 239Pu and 241Am. Several geometry options and material compositions (U, U + Am, Am, Am2O3) are considered for spallation targets to be used in Accelerator Driven Systems. All considered options operate as deep subcritical targets having neutron multiplication factor of k∼0.5. It is found that more than 4 kg of Am can be burned in one spallation target during the first year of operation

  13. Production of americium isotopes in France

    International Nuclear Information System (INIS)

    The program of productions of americium 241 and 243 isotopes is based respectively on the retreatment of aged plutonium alloys or plutonium dioxide and on the treatment of plutonium targets irradiated either in CELESTIN reactors for Pu-Al alloys or OSIRIS reactor for plutonium 242 dioxide. All the operations, including americium final purifications, are carried out in hot cells equipped with remote manipulators. The chemical processes are based on the use of extraction chromatography with hydrophobic SiO2 impregnated with extracting agents. Plutonium targets and aged plutonium alloys are dissolved in nitric acid using conventional techniques while plutonium dioxide dissolutions are performed routine at 300 grams scale with electrogenerated silver II in 4M HNO3 at room temperature. The separation between plutonium and americium is performed by extraction of Pu(IV) either on TBP/SiO2 or TOAHNO3/SiO2 column. Americium recovery from waste streams rid of plutonium is realized by chromatographic extraction of Am(III) using mainly TBP and episodically DHDECMP as extractant. The final purification of both americium isotopes uses the selective extraction of Am(VI) on HDDiBMP/SiO2 column at 60 grams scale. Using the overall process a total amount of 1000 grams of americium 241 and 100 grams of americium 243 has been produced nowadays and the AmO2 final product indicates a purity better than 98.5%

  14. ADJ 235 Courses Tutorial / indigohelp




    ADJ 235 Week 1 Checkpoint Legalizing Morality ADJ 235 Week 1 DQ 1 and DQ 2 ADJ 235 Week 2 Checkpoint Interpretation of Ethical Systems ADJ 235 Week 2 Assignment Deontological Versus Teleological Ethical Systems ADJ 235 Week 3 Checkpoint Undercover Operations ADJ 235 Week 3 DQ 1 and DQ 2 ADJ 235 Week 4 Checkpoint Law Enforcement Code of Ethics ADJ 235 Week 4 Assignment Law Enforcement Deviance ADJ 235 Week 5 Checkpoint Attorneys Ethical Responsibilities ADJ ...

  15. 31 CFR 540.315 - Uranium-235 (U235). (United States)


    ... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Uranium-235 (U235). 540.315 Section... FOREIGN ASSETS CONTROL, DEPARTMENT OF THE TREASURY HIGHLY ENRICHED URANIUM (HEU) AGREEMENT ASSETS CONTROL REGULATIONS General Definitions § 540.315 Uranium-235 (U235). The term uranium-235 or U235 means the...

  16. Study of americium sorption by humic acids

    International Nuclear Information System (INIS)

    The results of investigation of influence of the cation content and acidity of soil solution on americium sorption by the humic acids have been shown. The most influence on the interphase distribution coefficient in the system 'humic acid - model soil solution' is caused by the presence of the iron (III), calcium ions and acidity of the solution. The increase of the sodium ions concentration in the solution makes an insignificant impact on the americium sorption. (Authors)

  17. BUS 235 Course tutorial/ indigohelp




    For more classes visit   BUS 235 Week 1 DQ 1 Marketing Trends BUS 235 Week 1 DQ 2 Customer Needs and Wants BUS 235 Week 2 DQ 1 Market Research BUS 235 Week 2 DQ 2 Customer Loyalty BUS 235 Week 3 DQ 1 Branding Debate BUS 235 Week 3 DQ 2 New Product Development BUS 235 Week 3 Assignment Retail Store (Walmart) BUS 235 Week 4 DQ 1 Price and Ethics BUS 235 Week 4 DQ 2 Service Marketing BUS 235 Week 5 DQ 1 Super Bowl Advertisin...

  18. ADJ 235 Courses/snaptutorial




    ­For more classes visits                 ADJ 235 Week 1 Checkpoint Legalizing Morality ADJ 235 Week 1 DQ 1 and DQ 2 ADJ 235 Week 2 Checkpoint Interpretation of Ethical Systems ADJ 235 Week 2 Assignment Deontological Versus Teleological Ethical Systems ADJ 235 Week 3 Checkpoint Undercover Operations ADJ 235 Week 3 DQ 1 and DQ 2 ADJ 235 Week 4 Checkpoint Law Enforcement...

  19. Spectrochemical analysis of curium and americium samples

    International Nuclear Information System (INIS)

    Spectrochemical procedures have been developed to determine impurities in americium and curium samples. The simultaneous separation of many impurity elements from the base material (americium and curium) is carried out with extraction and extraction-chromatographic methods using di-2-ethylhexylphosphoric acid. It is shown that part of the elements are separated with extraction or sorption of americium and curium; the other part with the Talspeak process. Two fractions in the extraction chromatography and three fractions in the extraction separation of americium and curium, containing impurities, are analyzed separately by a.c. or d.c. arc spectrography. To increase the sensitivity of the spectrographic analysis and accelerate the burn-up of impurities from the crater of the carbon electrode bismuth fluoride and sodium chloride were used as chemically active substances. The extraction of impurities from weighed quantities of americium and curium samples of 5 to 10 mg permits the lower limit of determined impurity concentrations to be extended to 1 x 10-4 to 5 x 10-3% m/m. (author)

  20. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    Acqueous Chloride mission is to recover plutonium and americium from pyrochemical residues (undesirable form for utilization and storage) and generate plutonium oxide and americium oxide. Plutonium oxide is recycled into Pu metal production flowsheet. It is suitable for storage. Americium oxide is a valuable product, sold through the DOE-OS isotope sales program.

  1. Pyrochemical technology of plutonium and americium preparation and purification

    International Nuclear Information System (INIS)

    Pyrochemical tecnology of metallic plutonium and americium preparation and purification is considered. Investigations into plutonium dioxide reduction up to metal; plutonium electrolytic refining in molten salts; plutonium extraction from the molten salts and preparation of americium dioxide and metallic americium from its tetrafluoride are described

  2. Formation of americium and europium humate complexes

    International Nuclear Information System (INIS)

    Binding constants of americium and europium with a humic acid were determined to study if complex formation of trivalent actinide-humates affects dissolved species of the actinides in hydrosphere. The purified humic acid was characterized by means of UV-vis, IR, and pH titration, indicating high carboxylate capacity and low aromaticity. Binding constants of americium and europium humates were determined at pH 4.6 and 6.0 by solvent extraction using 241Am or 152Eu as a tracer. The binding constants for americium-humate obtained preliminarily suggest that complexes with humic acid are not negligible in speciation of trivalent actinides in hydrosphere. The obtained binding constants were nearly identical with those determined previously by the same procedures, but with humic acids of different origin and compositions. (author)

  3. Preparation of americium source for smoke detector

    International Nuclear Information System (INIS)

    This report describes the method developed for the preparation of 241Am source for smoke detector. Americium was electrodeposited from iso-propyl alcohol medium on silver backing. Thin layer of gold (few hundred micro gram thick) was plated on the americium source to make it safe for handling. The thickness of plated gold was such that the alpha radiations from the 241Am source could escape out of the gold layer and cause ionisation in the surrounding air. The performance of the prepared sources were checked in a smoke detector and was found to be satisfactory and comparable to the imported sources. (author). 1 refs., 2 figs., 1 tab

  4. Recovery of americium-241 from raffinates of plutonium purification columns

    International Nuclear Information System (INIS)

    Recovery and purification of americium from ion exchange raffinates generated during purification of aged plutonium is described. The method consists of the following stages: (i) co-precipitation of americium with kilogramme quantities of rare earth oxalates, (ii) destruction of oxalate and removal of residual plutonium from nitric acid medium using anion exchange process, (iii) preliminary separation of americium making use of its preferential uptake on an anion exchange column from thiocyanate medium and (iv) extraction of americium and remaining rare earths into di-(2-ethyl hexyl) phosphoric acid followed by preferential back washing of americium by lactic acid medium containing DTPA. (author)

  5. 1976 Hanford americium exposure incident: psychological aspects

    International Nuclear Information System (INIS)

    Accidents involving exposure to radiation or radioactive materials may involve an unusual degree of emotional trauma. Methods that may be employed in dealing with such trauma are discussed in relation to a specific accident in which a radiation worker was injured and seriously contaminated with americium-241

  6. Americium separations from high salt solutions

    International Nuclear Information System (INIS)

    Americium (III) exhibits an unexpectedly high affinity for anion-exchange material from the high-salt evaporator bottoms solutions--an effect which has not been duplicated using simple salt solutions. Similar behavior is observed for its lanthanide homologue, Nd(III), in complex evaporator bottoms surrogate solutions. There appears to be no single controlling factor--acid concentration, total nitrate concentration or solution ionic strength--which accounts for the approximately 2-fold increase in retention of the trivalent ions from complex solutions relative to simple solutions. Calculation of species activities (i.e., water, proton and nitrate) in such concentrated mixed salt solutions is difficult and of questionable accuracy, but it is likely that the answer to forcing formation of anionic nitrate complexes of americium lies in the relative activities of water and nitrate. From a practical viewpoint, the modest americium removal needs (ca. 50--75%) from nitric acid evaporator bottoms allow sufficient latitude for the use of non-optimized conditions such as running existing columns filled with older, well-used Reillex HPQ. Newer materials, such as HPQ-100 and the experimental bifunctional resins, which exhibit higher distribution coefficients, would allow for either increased Am removal or the use of smaller columns. It is also of interest that one of the experimental neutral-donor solid-support extractants, DHDECMP, exhibits a similarly high level of americium (total alpha) removal from EV bottoms and is much less sensitive to total acid content than commercially-available material

  7. Decontaminaion of metals containing plutonium and americium

    International Nuclear Information System (INIS)

    Melt-slagging (melt-refining) techniques were evaluated as a decontamination and consolidation step for metals contaminated with oxides of plutonium and americium. Experiments were performed in which mild steel, stainless steel, and nickel contaminated with oxides of plutonium and americium were melted in the presence of silicate slags of various compositions. The metal products were low in contamination, with the plutonium and americium strongly fractionated to the slags. Partition coefficients (plutonium in slag/plutonium in steel) of 7 x 106 were measured with boro-silicate slag and of 3 x 106 with calcium, magnesium silicate slag. Decontamination of metals containing as much as 14,000 ppM plutonium appears to be as efficient as for metals with plutonium levels of 400 ppM. Staged extraction, that is, a remelting of processed metal with clean slag, results in further decontamination of the metal. The second extraction is effective with either resistance-furnace melting or electric-arc melting. Slag adhering to the metal ingots and in defects within the ingots is in the important contributors to plutonium retained in processed metals. If these sources of plutonium are controlled, the melt-refining process can be used on a large scale to convert highly contaminated metals to homogeneous and compact forms with very low concentrations of plutonium and americium. A conceptual design of a melt-refining process to decontaminate plutonium- and americium-contaminated metals is described. The process includes single-stage refining of contaminated metals to produce a metal product which would have less than 10 nCi/g of TRU-element contamination. Two plant sizes were considered. The smaller conceptual plant processes 77 kg of metal per 8-h period and may be portable.The larger one processes 140 kg of metal per 8-h period, is stationary, and may be near te maximum size that is practical for a metal decontamination process

  8. Status of Americium-241 recovery at Rocky Flats Plant

    International Nuclear Information System (INIS)

    This paper is presented in two parts: Part I, Molten Salt Extraction of Americium from Molten Plutonium Metal, and Part II, Aqueous Recovery of Americium from Extraction Salts. The Rocky Flats recovery process used for waste salts includes (1) dilute hydrochloric acid dissolution of residues; (2) cation exchange to convert from the chloride to the nitrate system and to remove gross amounts of monovalent impurities; (3) anion exchange separation of plutonium; (4) oxalate precipitation of americium; and (5) calcination of the oxalate at 6000C to yield americium oxide. The aqueous process portion describes attempts to improve the recovery of americium. The first part deals with modifications to the cation exchange step; the second describes development of a solvent extractions process that will recovery americium from residues containing aluminium as well as other common impurities. Results of laboratory work are described. 3 figures, 6 tables. (DP)

  9. Plutonium and americium in soil organic matter

    International Nuclear Information System (INIS)

    A gley soil from west Cumbria, with specific activities in its surface horizon of 5-10 kBq kg-1239,240Pu and comparable 241Am levels, has been used as a source of actinide-enriched organic fractions. Humic and fulvic acids were isolated by conventional alkali extraction and investigated by gel filtration, treatment with organic solvents and differential flocculation procedures. All these techniques are capable of resolving the organics into two or more fractions, with specific activities up to 80 kBq kg-239,240Pu. There is evidence for differentiation of plutonium and americium, with americium being concentrated, to some extent, in the lower molecular weight fractions from gel filtration. (author)

  10. Comment: 235 [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available koji mold Aspergillus oryzae Aspergillus_oryzae_L.png 235.png Osamu Mizutani (Tohoku University ... ing)) licensed under CC Attribution2.1 Japan 撮影: 水 谷治(東北大学(現 酒類総研)) Photo: Osamu Mizutani ...

  11. ADJ 235 UOP COURSE Tutorial/UOPHELP




    ADJ 235 Week 1 Checkpoint Legalizing Morality ADJ 235 Week 1 DQ 1 and DQ 2 ADJ 235 Week 2 Checkpoint Interpretation of Ethical Systems ADJ 235 Week 2 Assignment Deontological Versus Teleological Ethical Systems ADJ 235 Week 3 Checkpoint Undercover Operations ADJ 235 Week 3 DQ 1 and DQ 2 ADJ 235 Week 4 Checkpoint Law Enforcement Code of Ethics ADJ 235 Week 4 Assignment Law Enforcement Deviance ADJ 235 Week 5 Checkpoint Attorneys Ethical Responsibilities ADJ ...

  12. Incentives for transmutation of americium in thermal reactors

    International Nuclear Information System (INIS)

    This report describes possible benefits when americium is irradiated in a thermal reactor. If all plutonium is partitioned from spent fuel, americium is the main contributor to the radiotoxicity of spent fuel upto several thousands of years of storage. It is shown that americium can be transmuted to other nuclides upon irradiation in a thermal reactor, leading to a 50% reduction of the radiotoxicity of neptunium, which can be an important contributor to the dose due to leakage of nuclides after one million years of storage. The radiotoxicity of americium can be reduced considerably after irradiation for 3 to 6 years in a thermal reactor with thermal neutron flux of 1014 cm-2s-1. The strongly α and neutron emitting transmutation products can most probably not be recycled again, so a transmutation process is suggested in which americium is irradiated for 3 to 6 years and then put to final storage. It is shown that the radiotoxicity of the transmuation products after a storage time of about one hundred years can be considerably reduced compared to the radiotoxicity of the initial americium. The same holds for the α activity and heat emission of the transmutation products. Because plutonium in spent fuel contributes for about 80% to the radiotoxicity upto 105 years of storage, recycling and transmutation of plutonium has first priority. Transmutation of americium is only meaningful when the radiotoxicity of plutonium is reduced far below the radiotoxicity of americium. (orig.)

  13. Americium transfer studies using hollow fiber/extractant membranes

    International Nuclear Information System (INIS)

    Americium can be removed from low acid/high nitrate feeds using hollow fiber membrane modules. Americium can be concentrated in the stripping solution. (Maximum observed concentration was a factor of 3.1). Accurel hollow fibers are less prone to leakage problems

  14. Electronic structure of compressed americium metal

    Czech Academy of Sciences Publication Activity Database

    Kolorenč, Jindřich; Shick, Alexander; Caciuffo, R.

    Cambridge: Cambridge University Press,, 2012 - (Anderson, D.; Boot, C.; Burns, P.), s. 177-182. (Materials Research Society Symposium Proceedings. 1444). ISBN 978-1-60511-421-7. ISSN 0272-9172. [2012 MRS Spring Meeting. Sacramento (CA), 09.04.2012-13.04.2012] R&D Projects: GA ČR(CZ) GAP204/10/0330; GA AV ČR IAA100100912 Institutional research plan: CEZ:AV0Z10100520 Keywords : americium * X-ray spectroscopy * LDA+DMFT Subject RIV: BM - Solid Matter Physics ; Magnetism

  15. Electrochemical oxidation of americium in nitric medium: study of reaction mechanisms; Oxydation de l'americium par voie electrochimique: etude des mecanismes

    Energy Technology Data Exchange (ETDEWEB)

    Picart, S.; Chartier, D.; Donnet, L.; Adnet, J.M. [CEA Valrho, (DCC/DRRV/SPHA), 30 - Marcoule (France)


    One alternative selected by the CEA for partitioning minor actinides from aqueous solutions containing fission products is the selective extraction of oxidized americium. This is the SESAME process (Selective Extraction and Separation of Americium by Means of Electrolysis) aimed to convert americium to oxidation state (VI) and then extract it with a specific extractant of high valences. This paper presents the study of the electrochemical oxidation of americium in nitric medium which represents an important stage of the process. The reaction can be divided into two main steps: oxidation of americium (III) to americium (IV), and then of americium (IV) to americium (VI). For the first oxidation step, a ligand L is needed to stabilize the intermediate species americium (IV) which disproportionates in its free form into americium (III) and (V). Phospho-tungstate or silico-tungstate are appropriate ligands because they are stable in concentrated nitric acid and show a great affinity for metallic cations at oxidation state (IV) (Table 1 lists the stability constants of americium (IV) complexes). The presence of the lacunary poly-anion lowers the potential of the americium (IV) / americium (Ill) redox pair (see Figure 5 for the diagram of the apparent formal potential of americium versus ligand concentration). This makes it thermodynamically possible to oxidize americium (III) into americium (IV) at the anode of an electrolyzer in nitric acid. For the second oxidation step, a strong oxidant redox mediator, like silver (II), is needed to convert complexed americium at oxidation state (IV) to oxidation state (V). The AmVL complex is then hydrolyzed to yield americyle (V) aqua ion. A spectroscopic Raman study with {sup 18}O labeled species showed that the oxygen atoms of the americyle moiety came from water. This indicates that water hydrolyzes the americium (V) complex to produce americyle (V) aqua ion, AmO{sub 2}{sup +}. This cation reacts with silver (Il) to give

  16. Modelling of americium stripping in the EXAm process

    International Nuclear Information System (INIS)

    The EXAm process aims at recovering americium alone contained in the PUREX raffinate. The americium stripping model has been revised to take into account a change of stripping aqueous phase and up-to-date experimental results conducted within DRCP to improve knowledge about complexes. This work represents a first approximation at modelling americium stripping. The modelling work has led to synthesize the knowledge on chemical phenomenology and adopt assumptions that best reflect experimental results. The modelling has been implemented in PAREX code in order to simulate this step to prepare and understand tests to be carried out in mixer settlers. (authors)

  17. Higher Americium Oxidation State Research Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    Mincher, Bruce J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Law, Jack D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Goff, George S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Moyer, Bruce A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Lumetta, Gregg J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shehee, Thomas C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hobbs, David T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)


    The partitioning of hexavalent Am from dissolved nuclear fuel requires the ability to efficiently oxidize Am(III) to Am(VI) and to maintain that oxidation state for a length of time sufficient to perform the separation. Several oxidants have been, or are being developed. Chemical oxidants include Ag-catalyzed ozone, Ag-catalyzed peroxydisulfate, Cu(III) periodate, and sodium bismuthate. Hexavalent americium has also now successfully been prepared by electrolysis, using functionalized electrodes. So-called auto-reduction rates of Am(VI) are sufficiently slow to allow for separations. However, for separations based on solvent extraction or ion exchange using organic resins, the high valence state must be maintained under the reducing conditions of the organic phase contact, and a holding oxidant is probably necessary. Until now, only Cu(III) periodate and sodium bismuthate oxidation have been successfully combined with solvent extraction separations. Bismuthate oxidation provided the higher DAm, since it acts as its own holding oxidant, and a successful hot test using centrifugal contactors was performed. For the other oxidants, Ag-catalyzed peroxydisulfate will not oxidize americium in nitric acid concentrations above 0.3 M, and it is not being further investigated. Peroxydisulfate in the absence of Ag catalysis is being used to prepare Am(V) in ion exchange work, discussed below. Preliminary work with Ag-catalyzed ozone has been unsuccessful for extractions of Am(VI) from 6.5 M HNO3, and only one attempt at extraction, also from 6.5 M HNO3, using the electrolytic oxidation has been attempted. However, this high acid concentration was based on the highest Am extraction efficiency using the bismuthate oxidant; which is only sparingly soluble, and thus the oxidation yield is based on bismuthate solubility. Lower acid concentrations may be sufficient with alternative oxidants and work with Ag-ozone, Cu(III) and electrolysis is on-going. Two non

  18. Mixed chelation therapy for removal of plutonium and americium

    International Nuclear Information System (INIS)

    Iron-binding compounds, 2,3-dihydroxybenzoic acid (DHBA), 2-hydroxybenzoic acid (HBA), and 2-(acetyloxy)benzoic acid (ABA), were tested for their ability to remove americium and plutonium from rats following intraperitioneal injection of the radionuclides as citrates (pH 5). Treatments, 2 mmol/kg, were given on days 3, 6, 10, 12 and 14 following the actinide injection. DHBA and HBA caused about a 20% decrease in liver retention of americium compared to the control value, and DHB caused a similar effect for plutonium. The above agents, co-administered with 0.5 mmol polyaminopolycarboxylic acid (PAPCA)-type chelons, did not change tissue retention of americium and plutonium from that due to the PAPCAs alone. Administration of americium and plutonium to the same rats is useful for studying removal agents since the two actinides behave independently in their biological disposition and response to removal

  19. Plutonium and Americium Geochemistry at Hanford: A Site Wide Review

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Felmy, Andrew R.


    This report was produced to provide a systematic review of the state-of-knowledge of plutonium and americium geochemistry at the Hanford Site. The report integrates existing knowledge of the subsurface migration behavior of plutonium and americium at the Hanford Site with available information in the scientific literature regarding the geochemistry of plutonium and americium in systems that are environmentally relevant to the Hanford Site. As a part of the report, key research needs are identified and prioritized, with the ultimate goal of developing a science-based capability to quantitatively assess risk at sites contaminated with plutonium and americium at the Hanford Site and the impact of remediation technologies and closure strategies.

  20. Americium/Curium Disposition Life Cycle Planning Study

    International Nuclear Information System (INIS)

    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS)

  1. Gamma-sources on the basis of metallic americium-241

    International Nuclear Information System (INIS)

    A batch of gamma-radiation sources has been manufactured from metallic americium-241 of isotopic purity, its activity varying from 0.08 to 0.93 GBq. The cores of the sources are high-purity americium metal condensate on a tantalum or stainless steel substrate prepared by thermal decomposition of 241Pu-241Am alloy in a high vacuum. 7 refs., 1 tab

  2. Pyrochemical investigations into recovering plutonium from americium extraction salt residues

    International Nuclear Information System (INIS)

    Progress into developing a pyrochemical technique for separating and recovering plutonium from spent americium extraction waste salts has concentrated on selective chemical reduction with lanthanum metal and calcium metal and on the solvent extraction of americium with calcium metal. Both techniques are effective for recovering plutonium from the waste salt, although neither appears suitable as a separation technique for recycling a plutonium stream back to mainline purification processes. 17 refs., 13 figs., 2 tabs

  3. 1976 Hanford americium-exposure incident: external decontamination procedures

    International Nuclear Information System (INIS)

    An accident resulted in the deposition on an injured workman's skin surfaces, in acid-burned areas and in lacerations, of something in excess of 6 mCi americium-241. The external decontamination procedures used, the change in americium content of the skin during the course of treatment, and some of the unusual problems encountered from the extrusion of foreign material and flaking of skin and scar tissue are described

  4. Electrochemical oxidation of americium in nitric medium: study of reaction mechanisms

    International Nuclear Information System (INIS)

    One alternative selected by the CEA for partitioning minor actinides from aqueous solutions containing fission products is the selective extraction of oxidized americium. This is the SESAME process (Selective Extraction and Separation of Americium by Means of Electrolysis) aimed to convert americium to oxidation state (VI) and then extract it with a specific extractant of high valences. This paper presents the study of the electrochemical oxidation of americium in nitric medium which represents an important stage of the process. The reaction can be divided into two main steps: oxidation of americium (III) to americium (IV), and then of americium (IV) to americium (VI). For the first oxidation step, a ligand L is needed to stabilize the intermediate species americium (IV) which disproportionates in its free form into americium (III) and (V). Phospho-tungstate or silico-tungstate are appropriate ligands because they are stable in concentrated nitric acid and show a great affinity for metallic cations at oxidation state (IV) (Table 1 lists the stability constants of americium (IV) complexes). The presence of the lacunary poly-anion lowers the potential of the americium (IV) / americium (Ill) redox pair (see Figure 5 for the diagram of the apparent formal potential of americium versus ligand concentration). This makes it thermodynamically possible to oxidize americium (III) into americium (IV) at the anode of an electrolyzer in nitric acid. For the second oxidation step, a strong oxidant redox mediator, like silver (II), is needed to convert complexed americium at oxidation state (IV) to oxidation state (V). The AmVL complex is then hydrolyzed to yield americyle (V) aqua ion. A spectroscopic Raman study with 18O labeled species showed that the oxygen atoms of the americyle moiety came from water. This indicates that water hydrolyzes the americium (V) complex to produce americyle (V) aqua ion, AmO2+. This cation reacts with silver (Il) to give americyle (VI) ion. Figure

  5. Complexation of americium with humic acid

    International Nuclear Information System (INIS)

    As a part of the interlaboratory comparison exercise for the complexation of humic acid and colloid generation (COCO-Club activities) in the CEC project MIRAGE-II, the complexation of americium with humic acid has been studied in our laboratory. Two humic acids were used for the study: Aldrich-HA(H+) which is a reference humic acid of the COCO-Club and Bradford-HA(H+) from Lake Bradford, Florida. A wide concentration range of humic acid and different ratios of Am to humic acid have been investigated between pH 5 and 6 with the ionic strength of 0.1 M and 1.0 M. The complexation has been studied by UV-spectroscopy, Laser-induced Photoacoustic Spectroscopy (LPAS) and ultrafiltration. LPAS is used for the submicromolar concentration range where the sensitivity of UV spectroscopy is not accessible. Ultrafiltration is used for low Am to humic acid ratios where both spectroscopic methods are not applicable. Varying the humic acid concentration over three orders of magnitude, only a 1:1 type of binding is observed. No significant variation of the stability constant is found in the investigated range of pH and ionic strength. However, the precipitation tendency and the loading capacity of humic acid are found to depend sensitively on pH and ionic strength. The complexation study provides a deep insight into the influence of humic acid on the migration behaviour of fission products and actinides in the geosphere. (orig.)

  6. Analysis of BWR lattices to recycle americium

    International Nuclear Information System (INIS)

    This study was carried out to assess the ability to eliminate meaningful quantities of americium in a primarily thermal neutron flux by 'spiking' modern BWR fuel with this minor actinide (MA). The studies carried out so far include the simulation of modern 10 x 10 BWR lattices employing the Westinghouse lattice physics code PHOENIX-4 alongside validation studies using MCNP5 models of the same lattices that were spatially depleted via the MONTEBURNS code coupling to ORIGEN. When considering the total inventory of minor actinides in Am-spiked pins, excluding isotopes of uranium and plutonium, the results indicate that a reduction of approximately 50% or more in the total mass inventory of these minor actinides is viable within the selected pins. Therefore, these preliminary results have encouraged the extension of this work to the development of improved lattice designs to help optimize the transmutation rates as well as absolute MA inventory reductions. The ultimate goal being to design batches of these advanced BWR bundles alongside multi-cycle core reload strategies. (authors)

  7. Applicability of insoluble tannin to treatment of waste containing americium

    International Nuclear Information System (INIS)

    The applicability of insoluble tannin adsorbent to the treatment of aqueous waste contaminated with americium has been investigated. Insoluble tannin is considered highly applicable because it consists of only carbon, hydrogen and oxygen and so its volume can be easily reduced by incineration. This report describes measurements of the americium distribution coefficient in low concentration nitric acid. The americium distribution coefficients were found to decrease with increasing concentration of nitric acid and sodium nitrate, and with increasing temperature. At 25 C in 2.0 x 10-3 M HNO3, the distribution coefficient was found to be 2000 ml g-1. The adsorption capacity was determined by column experiments using europium as a simulant of americium, and found to be 7 x 10-3 mmol g-1-dried tannin in 0.01 M HNO3 at 25 C, which corresponds to approximately 1.7 mg-241Am/g-adsorbent(dried). The prospect of applying the adsorbent to the treatment of aqueous waste contaminated with americium appears promising. (orig.)

  8. A TRUEX-based separation of americium from the lanthanides

    Energy Technology Data Exchange (ETDEWEB)

    Bruce J. Mincher; Nicholas C. Schmitt; Mary E. Case


    Abstract: The inextractability of the actinide AnO2+ ions in the TRUEX process suggests the possibility of a separation of americium from the lanthanides using oxidation to Am(V). The only current method for the direct oxidation of americium to Am(V) in strongly acidic media is with sodium bismuthate. We prepared Am(V) over a wide range of nitric acid concentrations and investigated its solvent extraction behavior for comparison to europium. While a separation is achievable in principal, the presence of macro amounts of cerium competes for the sparingly soluble oxidant and the oxidant itself competes for CMPO complexation. These factors conspire to reduce the Eu/Am separation factor from ~40 using tracer solutions to ~5 for extractions from first cycle raffinate simulant solution. To separate pentavalent americium directly from the lanthanides using the TRUEX process, an alternative oxidizing agent will be necessary.

  9. Salvage of plutonium-and americium-contaminated metals

    International Nuclear Information System (INIS)

    Melt-slagging techniques were evaluated as a decontamination and consolidation step for metals contaminated with oxides of plutonium and americium. Experiments were performed in which mild steel, stainless steel, and nickel metals contaminated with oxides of plutonium and americium were melted in the presence of silicate slags of various compositions. The metal products were low in contamination, with the plutonium and americium strongly fractionated to the slags. Partition coefficients (plutonium in slag/plutonium in steel) of 7*10/sup 6/ with borosilicate slag and 3*10/sup 6/ for calcium, magnesium silicate slag were measured. Decontamination of metals containing as much as 14,000 p.p.m. plutonium appears to be as efficient as that of metals with plutonium levels of 400 p.p.m. Staged extraction, that is, a remelting of processed metal with clean slag, results in further decontamination of the metal. 10 refs

  10. 32 CFR 235.5 - Responsibilities. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Responsibilities. 235.5 Section 235.5 National... SALE OR RENTAL OF SEXUALLY EXPLICIT MATERIAL ON DOD PROPERTY § 235.5 Responsibilities. (a) The... its responsibilities as set forth in § 235.6. (b) The Secretaries of the Military Departments...

  11. Uptake of americium-241 by algae and bacteria

    International Nuclear Information System (INIS)

    The uptake of americium by three algae, scenedesmus obliquus, selenastrum capricomutum and chlorella pyrenosdosa and a bacterium aeromonas hydrophila was studied. Live and fixed cells of each algal species and live bacterial cells were used. it is shown that algae and bacteria concentrate americium 241 to a high degree which makes them important links in the biomagnification phenomenon which may ultimately lead to a human hazard and be potentially important in recycling Am 241 in the water column and mobilization from sediments. Chemical fixation of algal cells caused increased uptake which indicated that uptake is by passive diffusion and probably due to chemical alteration of surface binding sites. (U.K.)

  12. Americium incineration by recycling in target rods using coated particles

    International Nuclear Information System (INIS)

    This paper proposes a type of target rod based on the use of coated particles, for an efficient incineration of americium in nuclear reactors. The analysis takes advantage of the experience gained in the past from long duration irradiation without damage of coated particles with plutonium oxide kernels. A conservative theoretical evaluation of the gas pressure inside the coated particles at the end of irradiation allows comparing the well known conditions of the plutonium oxide particles which were successfully irradiated to high burn-up, with a preliminary design of americium oxide particles. (authors)

  13. 1976 Hanford americium exposure incident: overview and perspective

    International Nuclear Information System (INIS)

    Salient features of the 1976 Hanford americium exposure incident are discussed. Comparisons are made with previous human and animal exposure data, and conclusions drawn relative to the injured workman, to health physics practices, and to the adequacy of current exposure limits

  14. Americium retention by the smectite hectorite

    International Nuclear Information System (INIS)

    Document available in extended abstract form only. Clay minerals may play an important role in a high level nuclear waste disposal site. Smectites may be major components of backfill material used to enhance the retention properties of engineered barriers. Furthermore, they have also been detected in the alteration layer of nuclear waste glass corroded in laboratory experiments. For example, the smectite hectorite (Na0.33[Mg2.67Li0.33Si4O10(OH)2]) was identified as phase forming upon waste matrix dissolution and subsequent reprecipitation. Smectites are known to be highly reactive with respect to cations in aqueous systems. Several distinct molecular scale binding mechanisms may operate, but the most effective retention may occur by incorporation in the bulk structure, especially if a (meta)stable solid solution forms. Investigations showed the possibility to incorporate Lu(III) in a clay-like octahedral site in hectorite by coprecipitation. Furthermore, luminescence studies on hectorite synthesized in the presence of Cm(III) or Eu(III) were consistent with an incorporation in the bulk structure. However, structural data such as coordination numbers and bond lengths are still missing for the actinides. In the present study, Am(III) was coprecipitated with and adsorbed on hectorite to decipher the actual retention mechanism(s). Hectorite was synthesized in the presence of Am(III) (sample AmCopHec) from an Am-containing brucite precursor phase. Briefly, brucite was freshly precipitated in the presence of Am(III) (Am:Mg molar ratio of 1:1175) and washed. The resulting sol was aged in a tightly closed vessel in the presence of LiF and silica sol for several days at 90 C. Separately, an Am-containing brucite phase (sample AmCopBru) was prepared under identical conditions as described above, and the americium aqua ions were adsorbed on hectorite (m/V = 2 g/L, [Am(III)]tot = 105 μmol/L, 0.5 mol/L NaClO4, pH = 6.4(1), sample AmSorbHec) and used as reference samples. X

  15. Synthesis and characterization of uranium-americium mixed oxides

    International Nuclear Information System (INIS)

    Americium isotopes represent a significant part of high-level and long-lived nuclear waste in spent fuels. Among the envisaged reprocessing scenarios, their transmutation in fast neutron reactors using uranium-americium mixed-oxide pellets (U1-xAmxO2±δ) is a promising option which would help decrease the ecological footprint of ultimate waste repository sites. In this context, this thesis is dedicated to the study of such compounds over a wide range of americium contents (7.5 at.% ≤ Am/(U+Am) ≤ 70 at.%), with an emphasis on their fabrication from single-oxide precursors and the assessment of their structural and thermodynamic stabilities, also taking self-irradiation effects into account. Results highlight the main influence of americium reduction to Am(+III), not only on the mechanisms of solid-state formation of the U1-xAmxO2±δ solid solution, but also on the stabilization of oxidized uranium cations and the formation of defects in the oxygen sublattice such as vacancies and cub-octahedral clusters. In addition, the data acquired concerning the stability of U1-xAmxO2±δ compounds (existence of a miscibility gap, vaporization behavior) were compared to calculations based on new thermodynamic modelling of the U-Am-O ternary system. Finally, α-self-irradiation-induced structural effects on U1-xAmxO2±δ compounds were analyzed using XRD, XAS and TEM, allowing the influence of americium content on the structural swelling to be studied as well as the description of the evolution of radiation-induced structural defects. (author)

  16. Reduction Rates for Higher Americium Oxidation States in Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Grimes, Travis Shane [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mincher, Bruce Jay [Idaho National Lab. (INL), Idaho Falls, ID (United States); Schmitt, Nicholas C [Idaho National Lab. (INL), Idaho Falls, ID (United States)


    The stability of hexavalent americium was measured using multiple americium concentrations and nitric acid concentrations after contact with the strong oxidant sodium bismuthate. Contrary to our hypotheses Am(VI) was not reduced faster at higher americium concentrations, and the reduction was only zero-order at short time scales. Attempts to model the reduction kinetics using zero order kinetic models showed Am(VI) reduction in nitric acid is more complex than the autoreduction processes reported by others in perchloric acid. The classical zero-order reduction of Am(VI) was found here only for short times on the order of a few hours. We did show that the rate of Am(V) production was less than the rate of Am(VI) reduction, indicating that some Am(VI) undergoes two electron-reduction to Am(IV). We also monitored the Am(VI) reduction in contact with the organic diluent dodecane. A direct comparison of these results with those in the absence of the organic diluent showed the reduction rates for Am(VI) were not statistically different for both systems. Additional americium oxidations conducted in the presence of Ce(IV)/Ce(III) ions showed that Am(VI) is reduced without the typical growth of Am(V) observed in the systems sans Ce ion. This was an interesting result which suggests a potential new reduction/oxidation pathway for Am in the presence of Ce; however, these results were very preliminary, and will require additional experiments to understand the mechanism by which this occurs. Overall, these studies have shown that hexavalent americium is fundamentally stable enough in nitric acid to run a separations process. However, the complicated nature of the reduction pathways based on the system components is far from being rigorously understood.

  17. 7 CFR 235.3 - Administration. (United States)


    ... programs in accordance with the applicable requirements of this part, 7 CFR parts 210, 215, 220, 225, 226... 7 Agriculture 4 2010-01-01 2010-01-01 false Administration. 235.3 Section 235.3 Agriculture... CHILD NUTRITION PROGRAMS STATE ADMINISTRATIVE EXPENSE FUNDS § 235.3 Administration. (a) Within...

  18. 32 CFR 235.7 - Information requirements. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Information requirements. 235.7 Section 235.7 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS SALE OR RENTAL OF SEXUALLY EXPLICIT MATERIAL ON DOD PROPERTY § 235.7 Information requirements....

  19. 45 CFR 235.110 - Fraud. (United States)


    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Fraud. 235.110 Section 235.110 Public Welfare... PROGRAMS § 235.110 Fraud. State plan requirements: A State plan under title I, IV-A, X, XIV, or XVI of the... criteria for identifying situations in which a question of fraud in the program may exist, and...

  20. 7 CFR 905.235 - Assessment rate. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 905.235 Section 905.235 Agriculture... TANGELOS GROWN IN FLORIDA Assessment Rates § 905.235 Assessment rate. On and after August 1, 2007, an assessment rate of $0.0072 per 4/5 bushel carton or equivalent is established for Florida citrus...

  1. 7 CFR 915.235 - Assessment rate. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 915.235 Section 915.235 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing Agreements... Assessment Rates § 915.235 Assessment rate. On and after April 1, 2005, an assessment rate of $0.27 per...

  2. 7 CFR 906.235 - Assessment rate. (United States)


    ... 7 Agriculture 8 2010-01-01 2010-01-01 false Assessment rate. 906.235 Section 906.235 Agriculture... RIO GRANDE VALLEY IN TEXAS Rules and Regulations § 906.235 Assessment rate. On and after August 1, 2004, an assessment rate of $0.12 per 7/10-bushel carton or equivalent is established for oranges...

  3. 49 CFR 235.9 - Civil penalty. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Civil penalty. 235.9 Section 235.9 Transportation... SIGNAL SYSTEM OR RELIEF FROM THE REQUIREMENTS OF PART 236 § 235.9 Civil penalty. Any person (an entity of... violates any requirement of this part or causes the violation of any such requirement is subject to a...

  4. 49 CFR 235.20 - Protests. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Protests. 235.20 Section 235.20 Transportation... SIGNAL SYSTEM OR RELIEF FROM THE REQUIREMENTS OF PART 236 § 235.20 Protests. (a) A protest against the... concise statement of the interest of protestant in the proceeding. (b) Protests shall be filed with...

  5. Liquid-liquid extraction separation and determination of plutonium and americium

    International Nuclear Information System (INIS)

    A procedure is described for the determination of plutonium and americium after their initial separation on barium sulfate. The barium sulfate is dissolved in perchloric acid and the antinides and lanthanides are extracted into bis(2-ethylhexyl)phosphoric acid (HDEHP). Americium along with other tervalent actinides and lanthanides is stripped from HDEHP with nitric acid. The lanthanides are removed on a column of HDEHP supported on Teflon powder, and the americium and other tervalent actinides are electrodeposited for their determination by α spectrometry. The plutonium is stripped with nitric acid after reduction to the tervalent state with 2,5-di-tert-butylhydroquinone and electrodeposited for α spectrometry. Decontamination factors for plutonium and americium from each other and from other α emitters are 104 to 105. Two hours are required for the liquid-liquid extraction separations of plutonium and americium from eight samples. Recoveries of americium and plutonium through the HDEHP separatons are 99% and 95%, respectively

  6. Calculational study on irradiation of americium fuel samples in the Petten High Flux Reactor

    International Nuclear Information System (INIS)

    A calculational study on the irradiation of americium samples in the Petten High Flux Reactor (HFR) has been performed. This has been done in the framework of the international EFTTRA cooperation. For several reasons the americium in the samples is supposed to be diluted with a neutron inert matrix, but the main reason is to limit the power density in the sample. The low americium nuclide density in the sample (10 weight % americium oxide) leads to a low radial dependence of the burnup. Three different calculational methods have been used to calculate the burnup in the americium sample: Two-dimensional calculations with WIMS-6, one-dimensional calculations with WIMS-6, and one-dimensional calculations with SCALE. The results of the different methods agree fairly well. It is concluded that the radiotoxicity of the americium sample can be reduced upon irradiation in our scenario. This is especially the case for the radiotoxicity between 100 and 1000 years after storage. (orig.)

  7. Neptunium and americium control for international non-proliferation regime

    International Nuclear Information System (INIS)

    It was decided in the IAEA Board of Governors Meeting held in Sept. 1999 that Neptunium and Americium could be diverted for manufacturing nuclear weapon or explosives, so that appropriate measures should be taken for the prevention of proliferation of these materials. It is expected to take relatively long time for settling down the aligned system dealing with the above materials because the present regulatory statement was prepared on the basis of voluntary offers from the States concerned. The necessity of preventive measures is being convinced among Member States, but it would not be easy to take voluntary participation in detail because of their respective interests. It is expected that this paper could contribute to the effective response as to the international commitments as well as for protecting the domestic nuclear industry and R and D area through analysis on the IAEA's approach on Neptunium and Americium

  8. Thermophysical properties of americium-containing barium plutonate

    International Nuclear Information System (INIS)

    Polycrystalline specimens of americium-containing barium plutonate have been prepared by mixing the appropriate amounts of (Pu0.91Am0.09)O2 and BaCO3 powders followed by reacting and sintering at 1600 K under the flowing gas atmosphere of dry-air. The sintered specimens had a single phase of orthorhombic perovskite structure and were crack-free. Elastic moduli were determined from longitudinal and shear sound velocities. Debye temperature was also determined from sound velocities and lattice parameter measurements. Thermal conductivity was calculated from measured density at room temperature, literature values of heat capacity and thermal diffusivity measured by laser flash method in vacuum. Thermal conductivity of americium-containing barium plutonate was roughly independent of temperature and registered almost the same magnitude as that of BaPuO3 and BaUO3. (author)

  9. 1976 Hanford americium-exposure incident: decontamination and treatment facility

    International Nuclear Information System (INIS)

    An injured worker, contaminated with over 6 mCi of americium-241, required special treatment and housing for 4 months. This paper is a description of the design and management of the facility in which most of the treatment and housing occurred. The problems associated with contamination control, waste handling, supplies, and radiological concerns during the two-stage transfer of the patient from a controlled situation to his normal living environment are discussed in detail

  10. Recycling heterogeneous americium targets in a boiling water reactor

    International Nuclear Information System (INIS)

    One of the limiting contributors to the heat load constraint for a long term spent fuel repository is the decay of americium-241. A possible option to reduce the heat load produced by Am-241 is to eliminate it via transmutation in a light water reactor thermal neutron environment, in particular, by taking advantage of the large thermal fission cross section of Am-242 and Am-242m. In this study we employ lattice loading optimization techniques to define the loadings and arrangements of fuel pins with blended americium and uranium oxide in boiling water reactor bundles, specifically, by defining the incineration of pre-loaded americium as an objective function to maximize americium transmutation. Subsequently, the viability of these optimized lattices is tested by assembling them into bundles with Am-spiked fuel pins and by loading these bundles into realistic three-dimensional BWR core-wide simulations that model multiple reload cycles and observe standard operational constraints. These simulations are possible via our collaboration with the Westinghouse Electric Co. which facilitates the use of industrial-caliber design tools such as the PHOENIX-4/POLCA-7 sequence and the Core Master 2 GUI work environment for fuel management. The resulting analysis confirms the ability to axially uniformly eliminating roughly 90% of the pre-loaded inventory of recycled Am-241 in BWR bundles with heterogeneous target pins. This high level of incineration was achieved within three to four 18-month operational cycles, which is equivalent to a typical in-core residence time of a BWR bundle.

  11. Ingestion Pathway Transfer Factors for Plutonium and Americium

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.


    Overall transfer factors for major ingestion pathways are derived for plutonium and americium. These transfer factors relate the radionuclide concentration in a given foodstuff to deposition on the soil. Equations describing basic relationships consistent with Regulatory Guide 1.109 are followed. Updated values and coefficients from IAEA Technical Reports Series No. 364 are used when a available. Preference is given to using factors specific to the Savannah River Site.

  12. Gut uptake factors for plutonium, americium and curium

    International Nuclear Information System (INIS)

    Data on estimates of the absorption of plutonium, americium and curium from the human gut based on measurements of uptake in other mammalian species are reviewed. It is proposed that for all adult members of the public ingesting low concentrations of plutonium in food and water, 0.05% would be an appropriate value of absorption except when the conditions of exposure are known and a lower value can be justified. For dietary intakes of americium and curium, the available data do not warrant a change from the ICRP value of 0.05%. For newborn children ingesting americium, curium and soluble forms of plutonium, a value of 1% absorption is proposed for the first 3 months of life during which the infant is maintained on a milk diet. It is proposed that a value of 0.5% should be used for the first year of life to take account of the gradual maturation of the gut. In considering the ingestion of insoluble oxides of plutonium by infants, it is proposed that absorption is taken as 0.1% for the first 3 months and 0.05% for the first year. (author)

  13. ADJ 235 uop course tutorial/uop help




     For more course tutorials visit     ADJ 235 Week 1 Checkpoint Legalizing Morality ADJ 235 Week 1 DQ 1 and DQ 2 ADJ 235 Week 2 Checkpoint Interpretation of Ethical Systems ADJ 235 Week 2 Assignment Deontological Versus Teleological Ethical Systems ADJ 235 Week 3 Checkpoint Undercover Operations ADJ 235 Week 3 DQ 1 and DQ 2 ADJ 235 Week 4 Checkpoint Law Enforcement Code of Ethics ADJ 235 Week 4 Assignment Law Enforcemen...

  14. Dicty_cDB: SLA235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLA235 (Link to dictyBase) - - - Contig-U16325-1 SLA235E (Link... to Original site) - - - - - - SLA235E 470 Show SLA235 Library SL (Link to library) Clone ID SLA235 (Link Representative seq. ID SLA23...5E (Link to Original site) Representative DNA sequence >SLA235 (SLA235Q) /CSM/SL/SLA2-B/SLA235Q.Seq.d/ CCAAA...GTTTTTAAAAAAAAAA AAAAAAATAATTATTAAATTTTTAAAATTATAAATAATAATCTTCTTATG sequence update 1997. 5. 7 Transla

  15. Recommended decay data for 235-neptunium

    International Nuclear Information System (INIS)

    An evaluation has been made of the decay of 235Np, a nuclide that has become popular for monitoring neptunium chemistry in the environment. Compared with other radioactive nuclides, 235Np produces few emissions that are suitable for quantitative analysis. A semi-theoretical study was undertaken, and it is recommended that four K-shell X rays are used to monitor 235Np. (U.K.)

  16. Airborne plutonium-239 and americium-241 concentrations measured from the 125-meter Hanford Meteorological Tower

    International Nuclear Information System (INIS)

    Airborne plutonium-239 and americium-241 concentrations and fluxes were measured at six heights from 1.9 to 122 m on the Hanford meteorological tower. The data show that plutonium-239 was transported on nonrespirable and small particles at all heights. Airborne americium-241 concentrations on small particles were maximum at the 91 m height

  17. Characterization of uranium, plutonium, neptunium, and americium in HLW supernate for LLW certification

    International Nuclear Information System (INIS)

    The 1S Manual requires that High Level Waste (HLW) implement a waste certification program prior to sending waste packages to the E-Area vaults. To support the waste certification plan, the HLW supernate inventory of uranium, plutonium, neptunium and americium have been characterized. This characterization is based on the chemical, isotopic and radiological properties of these elements in HLW supernate. This report uses process knowledge, solubility data, isotopic inventory data and sample data to determine if any isotopes of the aforementioned elements will exceed the minimum reportable quantity (MRQ) for waste packages contaminated with HLW supernate. If the MRQ can be exceeded for a particular nuclide, then a method for estimating the waste package content is provided. Waste packages contaminated from HLW supernate do not contain sufficient U-233, U-234, U-235, U-236, U-238, Pu-239, Pu-240, Pu-241, Pu-242 or Am-241 to warrant separate reporting on the shipping manifest. Calculations show that, on average, more than 100 gallons of supernate is required to exceed the PAC (package acceptance criteria) for each of these nuclides. Thus it is highly unlikely that the PAC would be exceeded for these nuclides and unlikely that the MRQ would be exceeded. These nuclides should be manifested as zero for waste packages contaminated with HLW supernate. The only actinide isotopes that may exceed the MRQ are Np-237 and Pu-238. The recommended method to calculate the amount of these two isotopes in waste packages contaminated with HLW supernate is to ratio them to the measured Cs-137 activity

  18. Effect of 241-americium on bone marrow stroma

    International Nuclear Information System (INIS)

    The regulation of haemopoiesis occurs via complex interactions between the stroma and the haemopoietic cells. An attempt to further clarifying the mechanisms and the exact role of the stroma in the regulation was made in a study. Results revealed that the murine bone marrow stromal cells are highly radiosensitive after injection with 241-americium and can thus be considered as a target population after internal contamination. In addition, observations are made which may be important for risk estimation for the developing animal and during pregnancy. Contamination in utero and by lactation shows persistent damage up to 1 year after contamination at an average annual dose of 5 cGy. (author)

  19. Recovery of americium-241 from aged plutonium metal

    International Nuclear Information System (INIS)

    After separation and purification, both actinides were precipitated as oxalates and calcined. A large-scale process was developed using dissolution, separation, purification, precipitation, and calcination. Efforts were made to control corrosion, to avoid product contamination, to keep the volume of process and waste solutions manageable, and to denitrate solutions with formic acid. The Multipurpose Processing Facility (MPPF), designed for recovery of transplutonium isotopes, was used for the first time for the precipitation and calcination of americium. Also, for the first time,, large-scale formic acid denitration was performed in a canyon vessel at SRP

  20. Preferential decorporation of americium by pulmonary administration of DTPA dry powder after inhalation of aged PuO2 containing americium in rats

    International Nuclear Information System (INIS)

    After inhalation of plutonium oxides containing various percentages of americium in rats, we identified an acellular transient pulmonary compartment, the epithelial lining fluid (ELF), in which a fraction of actinide oxides dissolve prior to absorption and subsequent extrapulmonary deposit. Chelation therapy is usually considered to be poorly efficient after inhalation of actinide oxides. However, in the present study, prompt pulmonary administration of diethylenetriaminepentaacetic acid (DTPA) as a dry powder led to a decrease in actinide content in ELF together with a limitation of bone and liver deposits. Because americium is more soluble than plutonium, higher amounts of americium were found in ELF, extrapulmonary tissues and urine. Our results also demonstrated that the higher efficacy of DTPA on americium compared to plutonium in ELF induced a preferential inhibition of extrapulmonary deposit and a greater urinary excretion of americium compared to plutonium. All together, our data justify the use of an early and local DTPA treatment after inhalation of plutonium oxide aerosols in which americium can be in high proportion such as in aged compounds. (authors)

  1. Investigation of neutronic behavior in a CANDU reactor with different (Am, Th, 235U)O2 fuel matrixes

    International Nuclear Information System (INIS)

    Recently thorium-based fuel matrixes are taken into consideration for nuclear waste incineration because of thorium proliferation resistance feature moreover its breeding or convertor ability in both thermal and fast reactors. In this work, neutronic influences of adding Am to (Th-235U)O2 on effective delayed neutron fraction, reactivity coefficients and burn up of a fed CANDU core has been studied using MCNPX 2.6.0 computational code. Different atom fractions of Am have been introduced in the fuel matrix to evaluate its effects on neutronic parameters of the modeled core. The computational data show that adding 2% atom fraction of Am to thorium-based fuel matrix won't noticeably change reactivity coefficients in comparison with the fuel matrix containing 1% atom fraction of Am. The use of 2% atom fraction of Am resulted in a higher delayed neutron fraction. According to the obtained data, 32.85 GWd burn up of the higher Americium-containing fuel matrix resulted in 55.2%, 26.5%, 41.9% and 2.14% depletion of 241Am, 243Am, 235U and 232Th respectively. 132.8 kg of 233U fissile element is produced after the burn up time and the nuclear core multiplication factor increases in rate of 2390 pcm. The less americium-containing fuel matrix resulted in higher depletion of 241/243Am, 235U and 232Th while the nuclear core effective multiplication factor increases in rate of 5630 pcm after the burn up time with 9.8 kg additional 233U production.

  2. 50 CFR 600.235 - Financial disclosure. (United States)


    ... ADMINISTRATION, DEPARTMENT OF COMMERCE MAGNUSON-STEVENS ACT PROVISIONS Council Membership § 600.235 Financial... 50 Wildlife and Fisheries 8 2010-10-01 2010-10-01 false Financial disclosure. 600.235 Section 600.... Financial interest in harvesting, processing, or marketing (1) includes: (i) Stock, equity, or...

  3. 14 CFR 21.235 - Application. (United States)


    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Application. 21.235 Section 21.235 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION AIRCRAFT CERTIFICATION... Administrator, to the Aircraft Certification Office for the area in which the manufacturer is located. (b)...

  4. 44 CFR 19.235 - Statutory amendments. (United States)


    ... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Statutory amendments. 19.235 Section 19.235 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... of factors related to the individual's personal appearance, poise, and talent. The pageant,...

  5. 24 CFR 235.206 - Substitute mortgagors. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Substitute mortgagors. 235.206... MORTGAGE INSURANCE AND ASSISTANCE PAYMENTS FOR HOME OWNERSHIP AND PROJECT REHABILITATION Contract Rights and Obligations-Homes for Lower Income Families § 235.206 Substitute mortgagors. (a) Selling...

  6. 33 CFR 105.235 - Communications. (United States)


    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Communications. 105.235 Section... MARITIME SECURITY: FACILITIES Facility Security Requirements § 105.235 Communications. (a) The Facility... conditions at the facility. (b) Communication systems and procedures must allow effective and...

  7. Analytical performance of radiochemical method for americium determination in urine

    International Nuclear Information System (INIS)

    This paper presents an analytical method developed and adapted for separation and analysis of Plutonium (Pu) isotopes and Americium (Am) in urine samples. The proposed method will attend the demand of internal exposure monitoring program for workers involved mainly with dismantling rods and radioactive smoke detectors. In this experimental procedure four steps are involved as preparation of samples, sequential radiochemical separation, preparation of the source for electroplating and quantification by alpha spectrometry. In the first stage of radiochemical separation, plutonium is conventionally isolated employing the anion exchange technique. Americium isolation is achieved sequentially by chromatographic extraction (Tru.spec column) from the load and rinse solutions coming from the anion exchange column. The 243Am tracer is added into the sample as chemical yield monitors and to correct the results improving the precision and accuracy. The mean recovery obtained is 60%, and the detection limit for 24h urine sample is 1.0 mBq L-1 in accordance with the literature. Based in the preliminary results, the method is appropriate to be used in monitoring programme of workers with a potential risk of internal contamination. (author)

  8. Placental transfer of americium and plutonium in mice

    International Nuclear Information System (INIS)

    Actinide element release to the environment and subsequent transfer through food chains to pregnant women may present a radiation hazard to fetuses in utero. To measure americium incorporation, four groups of pregnant mice were intravenously dosed with four concentrations of 243Am citrate in late pregnancy. Concentrations of 243Am in fetuses, placentas, and maternal femur, liver, carcass and pelt were determined 48 hr after injection. Doses were chosen so that the number of atoms of 243Am in each injected dose was equal to the number of atoms of 239Pu used in an earlier study of transplacental movement. Results indicate that, atom for atom, americium is incorporated into fetal tissue in lesser amounts (10-25 times) than is plutonium when intravenously administered to pregnant mice in equal atom amounts. Tissue analyses indicated that, at low dose levels, the average fraction of the dose incorporated into the fetuses decreased as the dose to the pregnant mouse was increased. A similar pattern was noted for placentas and maternal femurs. Data indicate that one must make extrapolations from low dose data only to make reasonable and realistic estimates of the transplacental movement and fetal incorporation of environmental levels of actinide elements in man and other species. (author)

  9. Development of separation techniques of americium from reprocessing solution

    International Nuclear Information System (INIS)

    Americium(Am) and neptunium(Np) finally transfer to the waste stream in the current PUREX reprocessing process. As an option, some methods have been developed to recover Am and Np from the waste stream to decrease long-term toxicity of the high level waste. The most stable valence state of Am is III, but TBP (tri-n-butyl phosphate) which is an extractant used in the PUREX reprocessing does not extract Am(III). Therefore, some special extractants have been developed to recover Am(III). However, they also extract rare-earth elements(REs), which necessitates the separation process for Am from REs. We have been developing a separation process which consists of valence control of Am to the VI state and its extraction with TBP. This process allows Am recovery from reprocessing solution and Am separation from REs simultaneously. Americium(III) is oxidized to Am(VI) by electrochemical oxidation and chemical oxidation using peroxodisulfate ammonium and silver nitrate. The latter was adopted here because the chemical oxidation reaction proceeds faster than the electrochemical method. Reaction mechanisms of oxidation and extraction were investigated. Based on the mechanisms, we found that extraction efficiency could be improved and waste generation could be minimized. (author)

  10. Solubility of Plutonium (IV) Oxalate During Americium/Curium Pretreatment

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.S.


    Approximately 15,000 L of solution containing isotopes of americium and curium (Am/Cm) will undergo stabilization by vitrification at the Savannah River Site (SRS). Prior to vitrification, an in-tank pretreatment will be used to remove metal impurities from the solution using an oxalate precipitation process. Material balance calculations for this process, based on solubility data in pure nitric acid, predict approximately 80 percent of the plutonium in the solution will be lost to waste. Due to the uncertainty associated with the plutonium losses during processing, solubility experiments were performed to measure the recovery of plutonium during pretreatment and a subsequent precipitation process to prepare a slurry feed for a batch melter. A good estimate of the plutonium content of the glass is required for planning the shipment of the vitrified Am/Cm product to Oak Ridge National Laboratory (ORNL).The plutonium solubility in the oxalate precipitation supernate during pretreatment was 10 mg/mL at 35 degrees C. In two subsequent washes with a 0.25M oxalic acid/0.5M nitric acid solution, the solubility dropped to less than 5 mg/mL. During the precipitation and washing steps, lanthanide fission products in the solution were mostly insoluble. Uranium, and alkali, alkaline earth, and transition metal impurities were soluble as expected. An elemental material balance for plutonium showed that greater than 94 percent of the plutonium was recovered in the dissolved precipitate. The recovery of the lanthanide elements was generally 94 percent or higher except for the more soluble lanthanum. The recovery of soluble metal impurities from the precipitate slurry ranged from 15 to 22 percent. Theoretically, 16 percent of the soluble oxalates should have been present in the dissolved slurry based on the dilution effects and volumes of supernate and wash solutions removed. A trace level material balance showed greater than 97 percent recovery of americium-241 (from the beta dec

  11. Solubility of Plutonium (IV) Oxalate During Americium/Curium Pretreatment

    International Nuclear Information System (INIS)

    Approximately 15,000 L of solution containing isotopes of americium and curium (Am/Cm) will undergo stabilization by vitrification at the Savannah River Site (SRS). Prior to vitrification, an in-tank pretreatment will be used to remove metal impurities from the solution using an oxalate precipitation process. Material balance calculations for this process, based on solubility data in pure nitric acid, predict approximately 80 percent of the plutonium in the solution will be lost to waste. Due to the uncertainty associated with the plutonium losses during processing, solubility experiments were performed to measure the recovery of plutonium during pretreatment and a subsequent precipitation process to prepare a slurry feed for a batch melter. A good estimate of the plutonium content of the glass is required for planning the shipment of the vitrified Am/Cm product to Oak Ridge National Laboratory (ORNL).The plutonium solubility in the oxalate precipitation supernate during pretreatment was 10 mg/mL at 35 degrees C. In two subsequent washes with a 0.25M oxalic acid/0.5M nitric acid solution, the solubility dropped to less than 5 mg/mL. During the precipitation and washing steps, lanthanide fission products in the solution were mostly insoluble. Uranium, and alkali, alkaline earth, and transition metal impurities were soluble as expected. An elemental material balance for plutonium showed that greater than 94 percent of the plutonium was recovered in the dissolved precipitate. The recovery of the lanthanide elements was generally 94 percent or higher except for the more soluble lanthanum. The recovery of soluble metal impurities from the precipitate slurry ranged from 15 to 22 percent. Theoretically, 16 percent of the soluble oxalates should have been present in the dissolved slurry based on the dilution effects and volumes of supernate and wash solutions removed. A trace level material balance showed greater than 97 percent recovery of americium-241 (from the beta dec

  12. Americium Transmutation Feasibility When Used as Burnable Absorbers - 12392

    International Nuclear Information System (INIS)

    The use of plutonium in Mixed Oxide (MOX) fuel in traditional Pressurized Water Reactor (PWR) assemblies leads to greater americium production which is not addressed in MOX recycling. The transuranic nuclides (TRU) contribute the most to the radiotoxicity of nuclear waste and a reduction of the TRU stockpile would greatly reduce the overall radiotoxicity of what must be managed. Am-241 is a TRU of particular concern because it is the dominant contributor of total radiotoxicity for the first 1000 years in a repository. This research explored the feasibility of transmuting Am-241 by using varying amounts in MOX rods being used in place of burnable absorbers and evaluated with respect to the impact on incineration and transmutation of transuranics in MOX fuel as well as the impact on safety. This research concludes that the addition of americium to a non-uniform fuel assembly is a viable method of transmuting Am-241, holding down excess reactivity in the core while serving as a burnable poison, as well as reducing the radiotoxicity of high level waste that must be managed. The use of Am/MOX hybrid fuel assemblies to transmute americium was researched using multiple computer codes. Am-241 was shown in this study to be able to hold down excess reactivity at the beginning of cycle and shape the power distribution in the core with assemblies of varying americium content loaded in a pattern similar to the traditional use of assemblies with varying amounts of burnable absorbers. The feasibility, safety, and utility of using americium to create an Am/MOX hybrid non-uniform core were also evaluated. The core remained critical to a burnup of 22,000 MWD/MTM. The power coefficient of reactivity as well as the temperature and power defects were sufficiently negative to provide a prompt feedback mechanism in case of a transient and prevent a power excursion, thus ensuring inherent safety and protection of the core. As shown here as well as many other studies, this non

  13. Removal of americium from effluent generated during the purification of plutonium by anion exchange

    Energy Technology Data Exchange (ETDEWEB)

    Noronha, Donald M.; Pius, Illipparambil C.; Chaudhury, Satyajeet [Bhabha Atomic Research Centre, Mumbai (India). Fuel Chemistry Div.


    Studies have been carried out on removal of americium from the effluent generated during anion exchange purification of plutonium. Americium 241, generated by the beta decay of Plutonium-241, is the major source of a activity in this highly acidic effluent and its removal would render the waste easily disposable. A simple and effective co-precipitation method, using thorium oxalate has been investigated for the treatment of this alpha active aqueous waste. Experiments have been carried out to identify optimum conditions to obtain high percentage co-precipitation with minimum amount of co-precipitant. Efforts were carried out to correlate the optimum conditions of co-precipitation of americium obtained in these experiments with solubility of thorium oxalate and americium oxalate calculated from solubility products of these compounds, stability constants of thorium and americium oxalate complexes taken from literature. The saturation capacity of thorium oxalate for Am(III) was also calculated by analyzing the K{sub d} value data using Langmuir adsorption equation. The strong tendency of americium to get co-precipitated and the high capacity exhibited by thorium oxalate for the uptake of americium indicate feasibility of using this method for the treatment of anion exchange effluent.

  14. Removal of americium from effluent generated during the purification of plutonium by anion exchange

    International Nuclear Information System (INIS)

    Studies have been carried out on removal of americium from the effluent generated during anion exchange purification of plutonium. Americium 241, generated by the beta decay of Plutonium-241, is the major source of a activity in this highly acidic effluent and its removal would render the waste easily disposable. A simple and effective co-precipitation method, using thorium oxalate has been investigated for the treatment of this alpha active aqueous waste. Experiments have been carried out to identify optimum conditions to obtain high percentage co-precipitation with minimum amount of co-precipitant. Efforts were carried out to correlate the optimum conditions of co-precipitation of americium obtained in these experiments with solubility of thorium oxalate and americium oxalate calculated from solubility products of these compounds, stability constants of thorium and americium oxalate complexes taken from literature. The saturation capacity of thorium oxalate for Am(III) was also calculated by analyzing the Kd value data using Langmuir adsorption equation. The strong tendency of americium to get co-precipitated and the high capacity exhibited by thorium oxalate for the uptake of americium indicate feasibility of using this method for the treatment of anion exchange effluent.

  15. Selective leaching studies of deep-sea sediments loaded with americium, neptunium and plutonium

    International Nuclear Information System (INIS)

    A series of selective leaching experiments were undertaken to investigate the solid phase speciation and distribution of americium, neptunium and plutonium which had been experimentally loaded onto different marine sediment types. The chemical leaches employed showed rather poor selectivity but certain trends were evident. Adsorption was not by ion exchange. Americium showed a preferential affinity for carbonate and plutonium for organic matter. Neptunium appeared to have no preferential affinities. Americium was sorbed by acetic acid residues (CaCO3 removed) and by unleached carbonate-rich sediments with equal efficiency. This indicates that it is able to diversify its solid phase affinity/distribution depending upon which solid phases are available. (author)

  16. Solubility of americium collected on an aerosol filter

    International Nuclear Information System (INIS)

    Kinetics of dissolution of undefined americium aerosol in simulated serum ultrafiltrate was studied. 241Am was present in aerosol collected at a workplace, where an intake of 241Am had occurred formerly. Dissolution experiments in four parts of an aerosol filter were carried out either in ambient air or under CO2 and pH was kept within physiological range. Two?phase kinetics was found in both cases with dissolution half?times for rapid and slow phases ranging from 0.16 to 0.23 d and from 150 to 500 d, respectively. Regardless data dispersion, found half?times justify use of class M model in intake assessment. (author)

  17. The 1976 Hanford Americium Accident: Then and Now

    Energy Technology Data Exchange (ETDEWEB)

    Carbaugh, Eugene H.


    The 1976 chemical explosion of an 241Am ion exchange column at a Hanford Site waste management facility resulted in the extreme contamination of a worker with 241Am, nitric acid and debris. The worker underwent medical treatment for acid burns, as well as wound debridement, extensive personal skin decontamination and long-term DTPA chelation therapy for decorporation of americium-241. Because of the contamination levels and prolonged decontamination efforts, care was provided for the first three months at the unique Emergency Decontamination Facility with gradual transition to the patient’s home occurring over another two months. The medical treatment, management, and dosimetry of the patient have been well documented in numerous reports and journal articles. The lessons learned with regard to patient treatment and effectiveness of therapy still form the underlying philosophy of treatment for contaminated injuries. Changes in infrastructure and facilities as well as societal expectations make for interesting speculation as to how responses might differ today.

  18. Separation of americium from curium by oxidation and ion exchange. (United States)

    Burns, Jonathan D; Shehee, Thomas C; Clearfield, Abraham; Hobbs, David T


    Nuclear energy has the potential to be a clean alternative to fossil fuels, but in order for it to play a major role in the US, many questions about the back end of the fuel cycle must be addressed. One of these questions is the difficult separation of americium from curium. Here, we report the oxidation of Am in two systems, perchloric acid and nitric acid and the affect of changing the acid has on the oxidation. K(d) values were observed and a direct separation factor was calculated and was seen to be as high as 20 for four metal(IV) pillared phosphate phosphonate inorganic organic hybrid ion exchange materials. These ion exchangers are characterized by very low selectivity for cations with low charge but extremely high uptake of ions of high charge. PMID:22827724

  19. Pretreatment of americium/curium solutions for vitrification

    International Nuclear Information System (INIS)

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment

  20. 32 CFR 235.1 - Purpose. (United States)


    ... OF SEXUALLY EXPLICIT MATERIAL ON DOD PROPERTY § 235.1 Purpose. This part implements 10 U.S.C. 2489a... sexually explicit materials on property under the jurisdiction of the Department of Defense or by...

  1. 49 CFR 235.3 - Application. (United States)


    ... SIGNAL SYSTEM OR RELIEF FROM THE REQUIREMENTS OF PART 236 § 235.3 Application. (a) Except as provided in... part of the general railroad system of transportation. (b) This part does not apply to rail...

  2. Plutonium and americium in sediments of Lithuanian lakes

    International Nuclear Information System (INIS)

    The assessment of contribution of the global and the Chernobyl NPP (Nuclear Power Plant) accident plutonium and americium to plutonium pollution in sediments of Lithuanian lakes is presented. Theoretical evaluation of activity ratios of 238Pu/239+240Pu and 241Pu/239+240Pu in the reactor of unit 4 of the Chernobyl NPP before the accident was performed by means of the ORIGEN-ARP code from the SCALE 4.4A program package. Non-uniform distribution of radionuclides in depositions on the Lithuanian territory after nuclear weapon tests and the Chernobyl NPP accident is experimentally observed by measuring the lake sediment pollution with actinides. The activity concentration of sediments polluted with plutonium ranges from 2.0 ± 0.5 Bq/kg d.w. (dry weight) in Lake Asavelis to 14 ± 2 Bq/kg d.w. in Lake Juodis. The ratio of activity concentrations of plutonium isotopes 238Pu/239+240Pu measured by α-spectrometry in the 10-cm-thick upper layer of bottom sediment varies from 0.03 in Lake Juodis to 0.3 in Lake Zuvintas. The analysis of the ratio values shows that the deposition of the Chernobyl origin plutonium is prevailing in southern and south-western regions of Lithuania. Plutonium of nuclear weapon tests origin in sediments of lakes is observed on the whole territory of Lithuania, and it is especially distinct in central Lithuania. The americium activity due to 241Pu decay after the Chernobyl NPP accident and global depositions in bottom sediments of Lithuanian lakes has been evaluated to be from 0.9 to 5.7 Bq/kg. (author)

  3. Kinetic parameters of transformation of americium and plutonium physicochemical forms in podsol soils

    International Nuclear Information System (INIS)

    Kinetic parameters of transformation of americium and plutonium physicochemical forms have been estimated and the prognosis of fixing and remobilization of these nuclides in podsol soils have been made on that basis in the work. (authors)

  4. Calibration procedures for in vivo sodium iodide spectrometry of plutonium and americium in the human lung

    International Nuclear Information System (INIS)

    This paper describes the calibration techniques and associated error analysis for the in vivo measurement by NaI spectrometry of heavy elements in the lung, specifically plutonium and americium. A very brief description of the instrumentation system is included

  5. Relativistic density functional theory modeling of plutonium and americium higher oxide molecules (United States)

    Zaitsevskii, Andréi; Mosyagin, Nikolai S.; Titov, Anatoly V.; Kiselev, Yuri M.


    The results of electronic structure modeling of plutonium and americium higher oxide molecules (actinide oxidation states VI through VIII) by two-component relativistic density functional theory are presented. Ground-state equilibrium molecular structures, main features of charge distributions, and energetics of AnO3, AnO4, An2On (An=Pu, Am), and PuAmOn, n = 6-8, are determined. In all cases, molecular geometries of americium and mixed plutonium-americium oxides are similar to those of the corresponding plutonium compounds, though chemical bonding in americium oxides is markedly weaker. Relatively high stability of the mixed heptoxide PuAmO7 is noticed; the Pu(VIII) and especially Am(VIII) oxides are expected to be unstable.

  6. Distribution of uranium, americium and plutonium in the biomass of freshwater macrophytes

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.YA. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)


    Accumulation of uranium ({sup 238}U), americium ({sup 241}Am) and plutonium ({sup 242}Pu) and their distribution in cell compartments and biochemical components of the biomass of aquatic plants Elodea canadensis, Ceratophyllum demersum, Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory batch experiments. Isotopes of uranium, americium and plutonium taken up from the water by Elodea canadensis apical shoots were mainly absorbed by cell walls, plasmalemma and organelles. A small portion of isotopes (about 6-13 %) could be dissolved in cytoplasm. The major portion (76-92 %) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-23 % of americium activity was registered in the fraction of proteins and carbohydrates, and just a small portion (< 1%) in lipid fraction. The distribution of plutonium in the biomass fraction of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides in Elodea biomass. Distribution of uranium in the biomass of Elodea differed essentially from that of transuranium elements: a considerable portion of uranium was recorded in the fraction of protein and carbohydrates (51 %). From our data we can assume that uranium has higher affinity to carbohydrates than proteins. (authors)

  7. Separation of curium and americium microquantities by chromatographic method with introduction of separating ions. 2. Effect of cadmium ion quantity and method of it introduction in the system on efficiency of curium and americium separation

    International Nuclear Information System (INIS)

    Effect of fractionating cadmium ion and a method of it introduction in the system on efficiency of separation of curium and americium with the use of NTA solutions as an eluent is investigated. It is established that in contrast to mutual sorption of curium, americium and cadmium their selective sorption contributes more complete separation of curium and americium. It is shown that growth of quantity of introduced cadmium increased efficiency of separation. Elution rate not products effect on separation process

  8. Dicty_cDB: SSC235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SS (Link to library) SSC235 (Link to dictyBase) - - - Contig-U16581-1 SSC235F (Link to Original site) SS...C235F 463 - - - - - - Show SSC235 Library SS (Link to library) Clone ID SSC235 (Link Representative seq. ID SSC23...5F (Link to Original site) Representative DNA sequence >SSC235 (SSC235Q) /CSM/SS/SSC2-B/SSC235Q.Seq.d/ ANTAA...pdate 1998. 8. 5 Translated Amino Acid sequence xk*kkkkkk*kki**vlkwysfnkkkkkttiisskkkiknkkkknkkk***aipwdleki

  9. Americium(3) solvent extraction by oxides of dialkyl(diaryl)[dialkylcarbamoylmethyl]phosphines (CMPO) from perchloric acid solutions

    International Nuclear Information System (INIS)

    Extraction of americium(3) from perchloric acid solutions by CMPO was investigated. It is shown that americium(3) is much more effectively extracted from perchloric acid solutions, than from nitric acid ones, and increase in americium distribution coefficient depends considerably on reagent nature. As a consequence, anomalous aryl effect increases significantly in perchloric acid solutions. The value of anomalous aryl effect depends directly on stoichiometry of extracted complexes in nitric acid and perchloric acid media. Conditions for extractional concentration of americium up to the 100-fold one with small reagent consumption were suggested

  10. 24 CFR 235.1234 - Term of assistance payment contract in connection with mortgages insured under section 235(r) of... (United States)


    ... certified by the mortgagee and shall continue until the contract is terminated pursuant to 24 CFR 235.375... pursuant to 24 CFR 235.375. The mortgagor will acknowledge receipt of a notice containing the expiration... in connection with mortgages insured under section 235(r) of the Act. 235.1234 Section...

  11. Decay scheme of the U235

    International Nuclear Information System (INIS)

    A study of the Th231 excited levels from the alpha decay of the U235, is carried out. The alpha particle spectrum was measured by means of a semiconductor counter spectrometer with an effective resolution of 18 keV. Nineteen new lines were identified. The gamma-ray spectrum was measured with thin samples of U235, free from decay products, and in such geometrical conditions, that most of the interference effects were eliminated. The gamma-gamma coincidence spectra have made easier a better knowledge of the transition between the several levels. (Author) 110 refs

  12. Extraction of Americium(III) by diglycolamides in ionic liquids

    International Nuclear Information System (INIS)

    In the present work, the extraction behavior of Am(lII) in the three isomeric DGAs, TODGA, DEHDODGA and TEHDGA in two ionic liquids, 1-butyl-3-methylimidazolium bis(triflouromethane sulphonyl)imide (C4mimNTf2) and 1-butyl-1-methylpyrrolidinium bis(triflouromethanesulphonyl)imide (C4mpyNTf2) is compared. The distribution ratio of americium was determined at various acidities ranging from 1M to 8M. The distribution values were found to decrease with increase in aqueous phase acidity upto 3M. The DAm values then marginally increased with increase of acidity from 3 to 4M followed by a decrease in distribution values. The distribution ratio obtained for various DGAs followed the order TEHDGA < TODGA < DEHDODGA at aqueous phase acidities ranging from 1-4 M. When the aqueous nitric acid concentration was higher than 4M, the distribution values followed the order DEHDODGA < TEHDGA < TODGA. The anomalous behaviour of unsymmetrical diglycolamide in ionic liquid medium was investigated by IR spectroscopy. The study revealed that the unprotonated fraction of DGA (i.e. the free DGA) increased in the order TEHDGA < TODGA < DEHDODGA, which seems to be responsible for the observed anomalous extraction trend in DEHDODGA in ionic liquid medium

  13. Extraction of americium and europium by CMPO-substituted adamantylcalixarenes

    International Nuclear Information System (INIS)

    Eight p-adamantylcalix[4]arene derivatives, bearing four CMPO-like functions [-(CH2)n-NH-C(O)-CH2-P(O)Ph2] at the wide (4a,b, n = 0, 1) or narrow (5a-c and 6a-c, n = 2-4) rims were synthesized for the first time. Studies of the extraction of americium(III) and europium(III) from 3 M HNO3 solutions to organic phases (dichloromethane, m-nitro-trifluoromethylbenzene) showed: (i) The extraction ability for all the adamantylcalixarene ligands is much better than for their monomeric analogues -N-(1-adamantyl)-, N-(1-adamantylmethyl)- and N,N-(dibutyl)carbamoylmethyldiphenylphosphine oxides 7a, 7b, 8; (ii) The extraction percentage increases strongly with increasing length of the spacer for all types of ligands 4-6, and best extraction results were found for 4b (n = 1) and 5c (n = 4); (iii) The separation coefficient DAm/DEu for the investigated compounds did not exceed 2, which is close to the narrow rim CMPO calixarenes, studied earlier; (iv) Variation of the spacer length between CMPO groups attached to the 1,3- and 2,4-positions of the calixarene platform in 6 did not lead to appreciably improved extractants, neither with respect to the extraction abilities (D) nor to the selectivities (DAm/DEu). (orig.)

  14. Effect of americium-241 on luminous bacteria. Role of peroxides

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)


    The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.

  15. 46 CFR 108.235 - Construction. (United States)


    ... limit drop test in 14 CFR 29.725, or a load of not less than 75 percent of the helicopter maximum weight... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.235 Construction. (a) Each helicopter deck must...

  16. 32 CFR 235.6 - Procedures. (United States)


    ... OF SEXUALLY EXPLICIT MATERIAL ON DOD PROPERTY § 235.6 Procedures. (a) The Board shall periodically... determine whether any such material is sexually explicit in accordance with this part. (b) If the Board... jurisdiction may be sexually explicit as defined herein, and such material is not addressed by the...

  17. 32 CFR 235.4 - Policy. (United States)


    ... OF SEXUALLY EXPLICIT MATERIAL ON DOD PROPERTY § 235.4 Policy. It is DoD policy that: (a) No sexually explicit material may be offered for sale or rental on property under the DoD jurisdiction, and no member..., shall offer for sale or rental any sexually explicit material. (b) Material shall not be deemed...

  18. 32 CFR 235.3 - Definitions. (United States)


    ... SALE OR RENTAL OF SEXUALLY EXPLICIT MATERIAL ON DOD PROPERTY § 235.3 Definitions. For the purpose of this part, the following definitions apply: Dominant theme. A theme of any material that is superior in... Exchanges, and ship stores. Sexually explicit material. Material, the dominant theme of which is...

  19. 21 CFR 514.235 - Judicial review. (United States)


    ... Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUG APPLICATIONS Judicial Review § 514.235 Judicial review. (a... manufacturer or distributor of an identical, related, or similar drug product, as defined in § 310.6 of...

  20. The Coriolis attenuation problem in 235U

    International Nuclear Information System (INIS)

    A new version of the particle-rotor model, featuring diagonalization of a state-dependent pairing force and the full recoil term, has been applied to 235U. A significant improvement is obtained in the description of the Coriolis coupled K=5/2, 7/2 and 9/2 rotational bands. No ad hoc Coriolis attenuation factors are used. (orig.)

  1. Separation and determination of americium in low-level alkaline waste of NPP origin (United States)

    Todorov, B.; Djingova, R.; Nikiforova, A.


    The aim of this work is to develop a short and cost-saving procedure for the determination of 241Am in sludge sample of the alkaline low-level radioactive waste (LL LRAW) collected from Nuclear Power Plant “Kozloduy”. The determination of americium was a part of a complex analytical approach, where group actinide separation was achieved. An anion exchange was used for separation of americium from uranium, plutonium and iron. For the separation of americium extraction with diethylhexyl phosphoric acid (DEHPA) was studied. The final radioactive samples were prepared by micro co-precipitation with NdF3, counted by alpha and gamma spectrometry. The procedure takes 2 hours. The recovery yield of the procedure amounts to (95 ± 1.5)% and the detection limit is 53 mBq/kg 241Am (t=150 000 s). The analytical procedure was applied for actual liquid wastes and results were compared to standard procedure.

  2. Americium 241 in vegetation of natural biocenoses and agrocenoses on Belarus territories contaminated with Chernobyl fall-out

    International Nuclear Information System (INIS)

    As a result of beta-decay of plutonium 241 the content of americium 241 increases progressively in soils, contaminated with Chernobyl trans uranium elements. Americium 241 displayed higher (0,5 - 1,5-fold) biological mobility than isotopes of plutonium 239, 240. Activity of americium 241 in surface phyto mass of wild and cultural plants varies from 0,04 to 5,9 Bq/kg of dry weight. Americium 241 contribution to the total trans uranium elements contamination of plants made up 60 - 80% in 1996 - 1998. Investigation of trials from the areas adjacent to the 30-km zone showed that mobility of americium 241 and plutonium was 5 - 15 times as high as in the zone

  3. Isotopic and elemental composition of plutonium/americium oxides influence pulmonary and extra-pulmonary distribution after inhalation in rats

    International Nuclear Information System (INIS)

    The biodistribution of plutonium and americium has been studied in a rat model after inhalation of two PuO2 powders in lungs and extra-pulmonary organs from 3 d to 3 mo. The main difference between the two powders was the content of americium (approximately 46% and 4.5% of total alpha activity). The PuO2 with a higher proportion of americium shows an accelerated transfer of activity from lungs to blood as compared to PuO2 with the lower americium content, illustrated by increased urinary excretion and higher bone and liver actinide retention. The total alpha activity measured reflects mostly the americium biological behavior. The activity contained in epithelial lining fluid, recovered in the acellular phase of broncho-alveolar lavages, mainly contains americium, whereas plutonium remains trapped in macrophages. Epithelial lining fluid could represent a transitional pulmonary compartment prior to translocation of actinides to the blood and subsequent deposition in extra-pulmonary retention organs. In addition, differential behaviors of plutonium and americium are also observed between the PuO2 powders with a higher dissolution rate for both plutonium and americium being obtained for the PuO2 with the highest americium content. Our results indicate that the biological behavior of plutonium and americium after translocation into blood differ two-fold: (1) for the two actinides for the same PuO2 aerosol, and (2) for the same actinide from the two different aerosols. These results highlight the importance of considering the specific behavior of each contaminant after accidental pulmonary intake when assessing extra-pulmonary deposits from the level of activity excreted in urine or for therapeutic strategy decisions. (authors)

  4. Determination of trace concentration of uranium in americium oxide samples by ICP-AES

    International Nuclear Information System (INIS)

    A solvent extraction method has been developed for the determination of uranium (200-2000 ppm) in americium oxide samples. The method involves the quantitative separation of uranium from americium matrix using mixed solvent comprising 1.1M tri-n-butyl phosphate (TBP) +1% trialkyl phosphine oxide (TRPO) + 0.3 M tertiary butyl hydroquinone (TBHQ) in n-dodecane. Uranium from the organic is stripped into the aqueous phase with 0.8 M oxalic acid and determined by ICP-AES. The reliability of the method was ascertained by analytical recovery, which is found to be nearly 100%. (author)

  5. Indirect NMR detection of 235U in gaseous uranium hexafluoride


    Ursu, I.; Demco, D.E.; Bogdan, M.; Fitori, P.; Darabont, A.


    The possibility to use nuclear magnetic resonance in indirect detection of the 235U nucleus in gaseous UF6 is discussed. The 19F absorption spectra linewidths in gaseous UF6 was investigated as a function of 235U enrichment, revealing a dependence on the isotope concentration. The 19F-235U indirect scalar coupling modulated by 235U quadrupole relaxation is the relaxation mechanism responsible for this enrichment effect.

  6. Photonuclear data evaluation of U235

    International Nuclear Information System (INIS)

    This report presents cross-sections calculation up to 130 MeV for U235. The photoabsorption process is described by the giant dipole resonance and quasi deuteron mechanisms. Neutron emission is treated within the preequilibrium and statistical models while fission is also calculated within this statistical approach using a double-humped fission barrier. The U235(γ,n), (γ,2n) and (γ,f) cross-sections are calculated with the TALYS-0.64 code using a coupled channels optical potential. Charges in level densities did not affect results significantly. Fission barrier heights and widths were modified to reproduce experimental data. Neither fission level densities nor other default fission parameters were changed. More calculations are needed in order to check cross-sections sensitivity to other level densities and fission models. (A.C.)

  7. 32 CFR 235.2 - Applicability and scope. (United States)


    ... 32 National Defense 2 2010-07-01 2010-07-01 false Applicability and scope. 235.2 Section 235.2 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS SALE OR RENTAL OF SEXUALLY EXPLICIT MATERIAL ON DOD PROPERTY § 235.2 Applicability and scope....

  8. 8 CFR 235.6 - Referral to immigration judge. (United States)


    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Referral to immigration judge. 235.6 Section 235.6 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS INSPECTION OF PERSONS APPLYING FOR ADMISSION § 235.6 Referral to immigration judge. (a) Notice—(1) Referral by Form...

  9. 49 CFR 234.235 - Insulated rail joints. (United States)


    ... 49 Transportation 4 2010-10-01 2010-10-01 false Insulated rail joints. 234.235 Section 234.235..., DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.235 Insulated rail joints. Each insulated rail joint...

  10. 49 CFR 192.235 - Preparation for welding. (United States)


    ... 49 Transportation 3 2010-10-01 2010-10-01 false Preparation for welding. 192.235 Section 192.235... BY PIPELINE: MINIMUM FEDERAL SAFETY STANDARDS Welding of Steel in Pipelines § 192.235 Preparation for welding. Before beginning any welding, the welding surfaces must be clean and free of any material...

  11. Physical conditions in star forming regions around S235

    CERN Document Server

    Kirsanova, Maria S; Sobolev, Andrej M; Henkel, Christian; Tsivilev, Alexander P


    Gas density and temperature in star forming regions around Sh2-235 are derived from ammonia line observations. This information is used to evaluate formation scenarios and to determine evolutionary stages of the young embedded clusters S235 East1, S235 East2, and S235 Central. We also estimate the gas mass in the embedded clusters and its ratio to the stellar mass. S235 East1 appears to be less evolved than S235 East2 and S235 Central. In S235 East1 the molecular gas mass exceeds that in the other clusters. Also, this cluster is more embedded in the parent gas cloud than the other two. Comparison with a theoretical model shows that the formation of these three clusters could have been stimulated by the expansion of the Sh2-235 HII region (hereafter S235) via a collect-and-collapse process, provided the density in the surrounding gas exceeds $3\\cdot10^3$ cm$^{-3}$, or via collapse of pre-existing clumps. The expansion of S235 cannot be responsible for star formation in the southern S235 A-B region. However, fo...

  12. Centrifuge for separation of enriched 235U

    International Nuclear Information System (INIS)

    The invention claim is for a centrifuge for enrichment of 235U characterized by: (1) a rotor provided with hollow upper and lower rotating shafts which serve, respectively, as a feed conduit for a light inert-gas/UF6-gas mixture and as a discharge conduit for the light inert gas, and provided with top and bottom end-plates having vents for discharging the 235U-enriched gas and 235U-depleted gas in equal amounts; (2) a fixed outer jacket which accomodates the freely rotating rotor in such a manner as to form annular slits between the shoulders of the rotor and the inner wall of the jacket, and is equipped at the mid-section with gas-inlet conduits for injecting the inert light gas into the annular space between the rotor and the jacket through the openings provided at the tips of the conduits in the direction of the rotor's rotation and also tangentially to the rotor, and is further equipped near the top and bottom with gas-outlet conduits fitted with control valves; and (3) heating and cooling units installed at the top and bottom of the annualr space between the rotor and the jacket. (U.S.)

  13. International 235U fission foil mass intercomparison

    International Nuclear Information System (INIS)

    In the measurement of neutron fission cross sections, one of the larger uncertainties is associated with the mass determination of the fissionable deposit. Inconsistencies in determinations of the fission cross sections may be a result of systematic errors associated with the measurement of the deposit mass. As part of a study to check the consistency of mass scales at a number of laboratories throughout the world, two 235U deposits from the Khlopin Radium Institute (KRI) in Leningrad, USSR, were made available through the assistance of the International Atomic Energy Agency for measurements at the National Bureau of Standards (NBS) and Argonne National Laboratory (ANL). These deposits are directly traceable to foils used in very precise measurements of the 235U(n,f) cross section made in a collaborative effort by KRI and the Technical University of Dresden (TUD), GDR. The study undertaken at the NBS consisted of two parts. One part was the measurement of the alpha-decay rates of the two 235U samples (KRI VI and KRI-XV) with a low-geometry-counting spectrometry facility. The other was the measurement of the total alpha disintegration rate of the samples employing a 2II alpha counter

  14. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  15. Practical Gamma Counting of Unirradiated Uranium-235

    International Nuclear Information System (INIS)

    During the fabrication of reactor fuel elements it is necessary to have assurance regarding the accuracy of the fabricator's uranium assignment within the specified tolerances. Destructive analysis of random samples is both expensive and time-consuming. Where the uranium-bearing components are suitable for gamma counting, a non-destructive method of assay can be used with greater efficiency and equal accuracy. The particular method described was used for checking fuel cores of nominal 30 wt.% enriched uranium in aluminium measuring about two inches square by 0.080 in. and 0.160 in. thick. The equipment was a basic Nal scintillation counter equipped with a single-channel analyser. The analyser, however, was operated with a very wide window covering both the 90-keV and 184-keV peaks characteristic of uranium-235. In practice, the threshold level acid the window opening, were adjusted to give the optimum maximum count rate as indicated by a ratemeter. The counting of a fuel core was then performed with the Nal crystal essentially unshielded and located several inches above the fuel core. The counting time was adjusted to yield a total count in the range of 105 to 106 in order to minimize the counting error. Effects due to variations in the counting geometry and to non-uniform uranium distribution were minimized by the relatively large separation of the crystal from the fuel core. Effects due to shifting of analyser window were minimized by use of a wide opening. To compensate for possible non-uniform uranium distribution through the thickness of a fuel core, each core was counted on both sides. The total count obtained in this manner was directly proportioned to the uranium-235 content of the fuel core. In application, the counting equipment was set up in the fabricator's plant and a number of production fuel cores were counted. The plotting of the total counts against the fabricator's uranium-235 assignment revealed an unexpected error in the fabricator's system

  16. Preparation of americium targets for nuclear chemistry experiments at DANCE

    International Nuclear Information System (INIS)

    Using 1 gram of 241Am from LANL stocks, the purification steps required to obtain a solution of 241Am from the original material are described. Part of the purified solution was submitted for purity analysis by mass spectrometry, radiochemistry and trace metals analysis. The impurities were expected to be 239Pu and 237Np. A second fraction of this material was used for electroplating three samples onto titanium disks that were suitable for insertion into an instrument package to be placed into the DANCE detector. The purification methods used, the electroplating setup and the solutions to various problems that were encountered in making these targets are discussed. The analytical results are discussed as well as the yields from the electrodeposition process. Comparison of these yields with those from similar experiments utilizing 235U and 243Am are also discussed. (author)

  17. Impact of ionic liquids on europium and americium extraction by an upper rim phosphorylated calixarene

    International Nuclear Information System (INIS)

    The solvent extraction of europium and americium using the calixarene 5,11,17,23-tetrakis[dipropylphosphinylmethyl] 25,26,27,28-tetrapropoxycalix[4]arene (conical conformation) in the presence of ionic liquids with different natures was studied. It was shown that upper rim phosphorylated calixarene is able to extract europium and americium from nitric acid to dichloroethane by forming a 1:1 complex without the addition of ionic liquids. The distribution coefficients of americium are higher than those of europium in this case, but the isolation degrees of both elements are insufficient for this system to be useful in extraction technologies. The addition of the ionic liquid trihexyl(tetradecyl)phosphonium hexafluorophosphate increases the europium distribution coefficient by values ranging from twofold to more than two orders of magnitude at ionic liquid concentrations of 1 and 50 %, respectively. The values of the distribution coefficients for americium are increased by approximately 25-fold after a 50 % addition of the ionic liquid. (author)

  18. Understanding the Chemistry of Uncommon Americium Oxidation States for Application to Actinide/Lanthanide Separations

    Energy Technology Data Exchange (ETDEWEB)

    Leigh Martin; Bruce J. Mincher; Nicholas C. Schmitt


    A spectroscopic study of the stability of Am(V) and Am(VI) produced by oxidizing Am(III) with sodium bismuthate is presented, varying the initial americium concentration, temperature and length of the oxidation was seen to have profound effects on the resultant solutions.

  19. Speciation and bioavailability of plutonium and americium in the Irish Sea and other marine ecosystems

    International Nuclear Information System (INIS)

    Since the late 1960s, the Irish Sea has become a repository for a variety of radio-elements originating mainly in discharges from the British Nuclear Fuels (BNF) plc. Sellafield reprocessing complex located on the Cumbrian coast. In particular, transuranium nuclides such as plutonium, americium and curium (the main constituents of the α-emitting discharges) have become incorporated into every marine compartment by a variety of mechanisms, many of which are not well understood. Although extensive studies have been carried out in the near-field (eastern Irish Sea, especially in the vicinity of the discharge point and collateral muddy sediments), comparatively little had been done to assess the long-term behaviour and bioavailability of plutonium and americium in the far-field, e.g., the western Irish Sea, prior to the present study. In this dissertation, the results of an extensive research programme, undertaken in order to improve and refine our understanding of the behaviour of plutonium and americium in the marine environment, are presented. Specifically, the thesis details the results of (and conclusions deduced from) a series of experiments in which the physical and chemical speciation, colloidal association, mobility and bioavailability of plutonium and americium were examined in diverse environments including the Irish Sea and the Mediterranean. (author)

  20. Evaluation of the readsorption of plutonium and americium in dynamic fractionations of environmental solid samples

    DEFF Research Database (Denmark)

    Petersen, Roongrat; Hou, Xiaolin; Hansen, Elo Harald


    extractions. The degree of readsorption in dynamic and conventional batch extraction systems are compared and evaluated by using a double-spiking technique. A high degree of readsorption of plutonium and americium (>75%) was observed in both systems, and they also exhibited similar distribution patterns...

  1. Extraction chromatographic recovery of americium from acidic raffinate solutions using CMPO adsorbed on Chromosorb-102

    International Nuclear Information System (INIS)

    Microgram amounts of americium have been separated and purified from large amounts of uranium present in effluent solutions resulting from the anion-exchange columns during the purification and recovery of plutonium by using TBP extraction followed by extraction chromatography using CMPO adsorbed on Chromosorb-102. (author). 4 refs., 1 tab

  2. Cesium-137 and americium-241 distribution by granulometric fractions of soil at Azgir test site grounds

    International Nuclear Information System (INIS)

    In measurements of radionuclide specific content in surface soil layer of contaminated territories it is important to determine in what agglomerations of soil particles there is the highest radionuclide concentration. For this purpose granulometric composition of soil at Azgir test site was studied and cesium-137 and americium-241 distribution by soil fractions was researched. (author)

  3. Development of analytical methods for the separation of plutonium, americium, curium and neptunium from environmental samples


    Salminen, Susanna


    In this work, separation methods have been developed for the analysis of anthropogenic transuranium elements plutonium, americium, curium and neptunium from environmental samples contaminated by global nuclear weapons testing and the Chernobyl accident. The analytical methods utilized in this study are based on extraction chromatography. Highly varying atmospheric plutonium isotope concentrations and activity ratios were found at both Kurchatov (Kazakhstan), near the former Semipalatinsk...

  4. Determination of specific activity of americium and plutonium in selected environmental samples

    International Nuclear Information System (INIS)

    The aim of this work was development of method for determination of americium and plutonium in environmental samples. Developed method was evaluated on soil samples and after they was applied on selected samples of fishes (smoked mackerel, herring and fillet from Alaska hake). The method for separation of americium is based on liquid separation with Aliquate-336, precipitation with oxalic acid and using of chromatographic material TRU-SpecTM.The intervals of radiochemical yields were from 13.0% to 80.9% for plutonium-236 and from 10.5% to 100% for americium-241. Determined specific activities of plutonium-239,240 were from (2.3 ± 1.4) mBq/kg to (82 ± 29) mBq/kg, the specific activities of plutonium-238 were from (14.2 ± 3.7) mBq/kg to (708 ± 86) mBq/kg. The specific activities of americium-241 were from (1.4 ± 0.9) mBq/kg to (3360 ± 210) mBq/kg. The fishes from Baltic Sea as well as from North Sea show highest specific activities then fresh-water fishes from Slovakia. Therefore the monitoring of alpha radionuclides in foods imported from territories with nuclear testing is recommended

  5. Application of hollow fiber supported liquid membrane for the separation of americium from the analytical waste

    International Nuclear Information System (INIS)

    Americium from analytical solid waste containing U and metallic impurities was separated using hollow fiber supported liquid membrane (HFSLM) technique impregnated with DHOA-TODGA from nitric acid medium. An aliquot of 5 g of the solid waste containing Am (19.95 mg) as minor actinide and of U (2,588 mg), Fe (1,360 mg), Ca (1,810 mg) and Na (3,130 mg) as major impurities was processed. The feed solution obtained after the dissolution of the residue in ∼4 M HNO3 was passed through HFSLM module. In the first stage using 1 M DHOA-dodecane was used for the separation of Am from other impurities. Though, majority of the elements were separated in this cycle, Ca was co extracted along with the americium. CMPO extraction chromatographic technique was used for further separation of americium from Ca. Significant decontamination factors were achieved in this three step separation process with respect to U, Fe, Na and Ca with ∼77 % recovery of americium. (author)

  6. Determination of α-emitters (plutonium, americium, curium ...) in feces and urine ashes

    International Nuclear Information System (INIS)

    A description is given of the methods used to determine a number of radionuclides to be found in feces and urine, and obtain samples thin enough for counting and α-spectrometry. These methods can be applied to plutonium, americium and curium especially

  7. Upper Limits to Americium Concentration in Medium Size Sodium Cooled Fast Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y.P.; Wallenius, J. [Royal Institute of Technology (KTH), AlbaNova University Centre, S-106 91, Stockholm (Sweden)


    The fastest way to realize transmutation of minor actinides would be using existing reactor types, adding some proper modifications to allow for insertion of MA in the fuel. According to calculations by Fazio and co-workers, the consumption rate of TRU in a low conversion ratio fast reactor may reach 70-75 % of that of an ADS with uranium free fuel [1]. However, americium introduction brings a negative influence on several safety parameters such as {beta}{sub eff}, Doppler coefficient, coolant temperature coefficient and void worth. Therefore the upper limit of americium that can be included into the fuel needs to be carefully evaluated. In this paper, fast reactor fuels with various minor actinide fractions are loaded into a SAS4A model of the semi-commercial BN600 reactor. Unprotected loss of flow (ULOF) and transient over power (UTOP) accidents are modelled using safety parameters obtained from Monte Carlo simulations as well as from the deterministic calculations published by Fazio et al. Applying the latter parameters (obtained with VARI3D), the upper limit to MA concentration in the fuel of a medium sized SFR of BN-600 type appears at 12%, corresponding to 8% of americium. We note however that the Doppler constants displayed by Fazio et al for MA concentrations above 10% have a considerably larger magnitude than those obtained with MCNP. Applying the safety parameters obtained with Monte Carlo simulations and updated nuclear data evaluations, we find that the upper limit to the americium concentration allowing to survive a ULOF is about half of that inferred by the use of parameters from VARI-3D. Since such a difference has a major impact on the predicted americium transmutation capability of SFR, it is of high priority to analyse the reasons for the apparent discrepancies. We note here that the major contribution to the Doppler feedback comes from capture resonance in U-238 and Pu-240 residing below the sodium scattering resonance located at 3 keV, and that

  8. Effect of bone-status on retention and distribution of americium-241 in bones of small rodents

    International Nuclear Information System (INIS)

    Forced physical exercise before and after application of americium-241 resulted in only small changes in bone-structure and behaviour of the radionuclide in bone. Feeding of a low phosphorus or low calcium diet resulted in an increased excretion of americium from bone, whereby Zn-DTPA as chelating agent removed an additional fraction of the radionuclide from bone. Low calcium diet and simultaneous continuous infusion of pharmacological doses of vitamin D-hormones didn't increase the excretion of americium more than the low calcium diet alone. (orig.)

  9. Decay scheme of the U{sup 2}35; Esquema de desintegracion del U-235

    Energy Technology Data Exchange (ETDEWEB)

    Gaeta, R.


    A study of the Th{sup 2}31 excited levels from the alpha decay of the U{sup 2}35, is carried out. The alpha particle spectrum was measured by means of a semiconductor counter spectrometer with an effective resolution of 18 keV. Nineteen new lines were identified. The gamma-ray spectrum was measured with thin samples of U{sup 2}35, free from decay products, and in such geometrical conditions, that most of the interference effects were eliminated. The gamma-gamma coincidence spectra have made easier a better knowledge of the transition between the several levels. (Author) 110 refs.

  10. Preparation of 235U target by electrodeposition

    International Nuclear Information System (INIS)

    A target for the production of fission 99Mo in a nuclear reactor is composed of an enclosed, cylindrical vessel. Preferable vessel is comprised of stainless steel, having a thin, continuous, uniform layer of 235U integrally bonded to its inner walls. Two processes are introduced for electrodepositing uranium on to the inner walls of the vessel. One processes is electrodepositing UO2 from UO2(NO3)2-(NH4)2CO4·H2O solution; the other is electrodepositing pure uranium metal from molten salt. Its plating efficiency and plating quantity from a molten bath is higher than UO2 from the aqueous system. (authors)

  11. Interaction and diffusion transport of americium in soils

    International Nuclear Information System (INIS)

    The final disposal of High Level Radioactive Wastes (HLRW) is based on its long-term storage in underground facilities located in geological stable sites with a multi-barrier system, the so called Deep Geological Repositories (DGR), that will keep HLRW confined for >10.000 years. After this period of time, leachates rich in long-live radioisotopes might escape from DGR and start to transport towards the biosphere. There is still a lack of information concerning the interaction and transport in soils of some radionuclides present in HLRW, especially for radionuclides that present a high sorption, such as americium (Am). Having reliable information about the mobility of radionuclides in soils is crucial in order to develop risk assessment models and to take proper decisions in case of soil contamination. The aim of the present work was, by means of laboratory scale experiments, to study the interaction and, for first time, to evaluate the diffusion transport of 241Am in soils. The 241Am interaction in soils was assessed by applying sorption batch assays to 20 soil samples with contrasted edaphic properties which allowed us to quantify the solid-liquid distribution coefficient (Kd) and desorption percentage. Kd (Am) values ranged from 103 to 105 L kg-1 and desorption percentages were always less than 2% which denoted a high capacity of the soil to incorporate the Am and a low reversibility of the sorption process. The influence of soil properties in 241Am interaction was studied by means of multiple linear and multivariate regressions. Although a single correlation between Kd (Am) values and a soil property was not found, the main properties affecting 241Am interaction in soils were soil pH, carbonate and organic matter contents in the soil. Finally, additional batch assays at different controlled pH were done to study Am sorption as a function of the contact solution pH. A variation of the Am sorption capacity was observed in all soils due to the dissolution of soil

  12. Interaction and diffusion transport of americium in soils

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)


    The final disposal of High Level Radioactive Wastes (HLRW) is based on its long-term storage in underground facilities located in geological stable sites with a multi-barrier system, the so called Deep Geological Repositories (DGR), that will keep HLRW confined for >10.000 years. After this period of time, leachates rich in long-live radioisotopes might escape from DGR and start to transport towards the biosphere. There is still a lack of information concerning the interaction and transport in soils of some radionuclides present in HLRW, especially for radionuclides that present a high sorption, such as americium (Am). Having reliable information about the mobility of radionuclides in soils is crucial in order to develop risk assessment models and to take proper decisions in case of soil contamination. The aim of the present work was, by means of laboratory scale experiments, to study the interaction and, for first time, to evaluate the diffusion transport of {sup 241}Am in soils. The {sup 241}Am interaction in soils was assessed by applying sorption batch assays to 20 soil samples with contrasted edaphic properties which allowed us to quantify the solid-liquid distribution coefficient (K{sub d}) and desorption percentage. K{sub d} (Am) values ranged from 10{sup 3} to 10{sup 5} L kg{sup -1} and desorption percentages were always less than 2% which denoted a high capacity of the soil to incorporate the Am and a low reversibility of the sorption process. The influence of soil properties in {sup 241}Am interaction was studied by means of multiple linear and multivariate regressions. Although a single correlation between K{sub d} (Am) values and a soil property was not found, the main properties affecting {sup 241}Am interaction in soils were soil pH, carbonate and organic matter contents in the soil. Finally, additional batch assays at different controlled pH were done to study Am sorption as a function of the contact solution pH. A variation of the Am sorption


    Directory of Open Access Journals (Sweden)

    E. B. Ershov


    Full Text Available The article considers, on the basis of experimental data, the issue of assessing dose burdens to the skin basal layer in conditions of its permanent contamination with solutions of plutonium-239 and americium-241 and subsequent decontamination.

  14. Metabolism of americium-241 in man: an unusual case of internal contamination of a child and his father

    International Nuclear Information System (INIS)

    The metabolism of americium-241 was studied during an 8-yr period of an adult male and his son who, at the ages of 50 and 4, respectively, were accidentally and unknowingly contaminated within their home by means of inhalation. Chelation therapy with Na3(Ca-DTPA) was more effective in enhancing the removal of americium-241 from the child than from his father

  15. Influence of biofilms on migration of uranium, americium and europium in the environment; Einfluss von Biofilmen auf das Migrationsverhalten von Uran, Americium und Europium in der Umwelt

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro


    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  16. Liquid-liquid extraction separation and sequential determination of plutonium and americium in environmental samples by alpha-spectrometry

    International Nuclear Information System (INIS)

    A procedure is described by which plutonium and americium can be determined in environmental samples. The sample is leached with nitric acid and hydrogen peroxide, and the two elements are co-precipitated with ferric hydroxide and calcium oxalate. The calcium oxalate is incinerated at 4500 and the ash is dissolved in nitric acid. Plutonium is extracted with tri-n-octylamine solution in xylene from 4M nitric acid and stripped with ammonium iodide/hydrochloric acid. Americium is extracted with thenoyltrifluoroacetone solution in xylene at pH 4 together with rare-earth elements and stripped with 1M nitric acid. Americium and the rare-earth elements thus separated are sorbed on Dowex 1 x 4 resin from 1M nitric acid in 93% methanol, the rare-earth elements are eluted with 0.1M hydrochloric acid/0.5M ammonium thiocyanate/80% methanol and the americium is finally eluted with 1.5M hydrochloric acid in 86% methanol. Plutonium and americium in each fraction are electro-deposited and determined by alpha-spectrometry. Overall average recoveries are 81% for plutonium and 59% for americium. (author)

  17. Dicty_cDB: CFJ235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TTGTGTTGATGCTT CAACATGGCAATCCTATTCTGGTGGTATTATTACAACTGGTTGTGGTAAAAACATTGATC ATTGTGTTCAAGTA Length of 3' end seq. 554 Connect...ed seq. ID CFJ235P Connected seq. >CFJ235P.Seq ATATCAGTTTTACATCTTTTTTAAATATATATCTACTATATCTAA...ATTACAACTGGTTGTGGTAAAAACATTGATC ATTGTGTTCAAGTA Length of connected seq. 664 Full length Seq ID - Full length Seq. - Length of full length seq. - ... ...D859313.1 F15.001A09F020226 F15 Pisum sativum cDNA clone F15001A09, mRNA sequence. 48 5e-08 2 U19267 |U19267.1 Zinn...CF (Link to library) CFJ235 (Link to dictyBase) - - - Contig-U07719-1 CFJ235P (Link

  18. Multipole components of 235U photofission

    International Nuclear Information System (INIS)

    The absolute electrofission cross section for 235U has been experimentally obtained in the energy range 5.8 - 18.0 MeV, using the electron beam of the Linear Accelerator of Institute of Physics of the University of Sao Paulo. From a combined analysis of this cross section and a previously measured photofission cross section, using virtual photon spectra calculated in the Distorted Wave Born Approximation (DWBA), the '' non electric dipole photofission'' cross section σNDEγ,f (ω) has been obtained, which contains all multipolarities allowed by the reaction Kinematics, except El. This cross section presents a resonant shape, probably associated with the Giant Quadrupole Resonance (GQR). Once the fission channel exhausts a great amount of the Energy Weighted Sum Rule (EWSR), it is therefore the major decay mode of the GQR. All these aspects agree with the ones verified for the other Uranium isotopes previously analysed in this Laboratory. (author)

  19. Electrodeposition of americium on a liquid cadmium cathode from a molten salt bath

    International Nuclear Information System (INIS)

    A high-activity experiment involving the electrode position of americium on a liquid cadmium cathode from a LiCl-KCl eutectic with about 3 g of AmO2 was conducted in a shielded cell in the ATALANTE complex. After describing the electrolyzer and the experimental conditions, the authors discuss the preparation of the LiCl-KCl-AmCl3 solution and briefly review its electrochemical properties. It was clearly confirmed that Am(III) reduction on an inert solid cathode occurs in two steps forming Am(II) before Am(0), whereas only one reduction step was observed on liquid cadmium. The main results of this study concern americium electrode position on the liquid cadmium cathode (recovery yields, current densities, problems encountered). The solvent properties of cadmium for actinide/lanthanide separation are discussed. (authors)

  20. Experimental Insight into the Radiation Resistance of Zirconia-Based Americium Ceramics

    International Nuclear Information System (INIS)

    Our works shows that the americium pyrochlore 241Am2Zr2O7 undergoes a phase transition to a defect-fluorite structure along with an unusual volume contraction when subjected to internal radiation from α-emitting actinides. Disorder relaxation proceeds through the simultaneous formation of cation anti sites and oxygen Frenkel pairs. X-ray absorption spectroscopy at the Am-LII and the Zr-K edges reveals that Am-O polyhedra show an increasing disorder with increasing exposure. In contrast, the Zr-O polyhedral units remain highly ordered, while rotating along edges and corners, thereby reducing the structural strain imposed by the growing disorder around americium. We believe it is this particular property of the compound that provides the remarkable resistance to radiation (≥9.4 * 1018) α-decay events g-1 or 0.80 dpa). (authors)

  1. Influence of some organic additives on the extractive separation of americium(III) by sulfoxides

    International Nuclear Information System (INIS)

    The solvent extraction behavior of americium(III) from aqueous nitrate media by two long-chain aliphatic sulfoxides has been examined systematically in the presence of several water-miscible organic solvents to study their possible synergistic effect on metal ion extraction. Methanol, ethanol, n- and isopropanol, n-butanol, dioxane, acetone, as well as acetonitrile, were employed as the organic component of the mixed (polar) phase. These additives affected the extraction to varying degrees. Extractability of Am increased 5 to 10-fold with increasing concentration of some of these additives, with the maximum enhancement being observed in the presence of acetone or acetonitrile. However, alcohols are generally very poor in this respect. Possible reasons for such behavior are briefly discussed. The distribution of several common contaminants was also investigated at the optimum condition for americium extraction

  2. Transmutation of americium and curium incorporated in zirconia-based host materials

    International Nuclear Information System (INIS)

    Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO2-ZrO2-Y2O3. It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO2 content. The Cm2O3-ZrO2 system was also investigated. It was found that at 25 mol% of CmO1.5, the Cm(III) stabilized zirconia in its cubic form (a = 5.21 ±0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO1.5, a pyrochlore oxide - Cm2Zr2O7 - is formed (a = 10.63 ±0.02 Angstrom). (author)

  3. Americium and samarium determination in aqueous solutions after separation by cation-exchange

    International Nuclear Information System (INIS)

    The concentration of trivalent americium and samarium in aqueous samples has been determined by means of alpha-radiometry and UV-Vis photometry, respectively, after chemical separation and pre-concentration of the elements by cation-exchange using Chelex-100 resin. Method calibration was performed using americium (241Am) and samarium standard solutions and resulted in a high chemical recovery for cation-exchange. Regarding, the effect of physicochemical parameters (e.g. pH, salinity, competitive cations and colloidal species) on the separation recovery of the trivalent elements from aqueous solutions by cation-exchange has also been investigated. The investigation was performed to evaluate the applicability of cation-exchange as separation and pre-concentration method prior to the quantitative analysis of trivalent f-elements in water samples, and has shown that the method could be successfully applied to waters with relatively low dissolved solid content. (author)

  4. Analysis of americium-beryllium neutron source composition using the FRAM code

    Energy Technology Data Exchange (ETDEWEB)

    Hypes, P. A. (Philip A.); Bracken, D. S. (David S.); Sampson, Thomas E.; Taylor, W. A. (Wayne A.)


    The FRAM code was originally developed to analyze high-resolution gamma spectra from plutonium items. Its capabilities have since been expanded to include analysis of uranium spectra. The flexibility of the software also enables a capable spectroscopist to use FRAM to analyze spectra in which neither plutonium nor uranium is present in significant amounts. This paper documents the use of FRAM to determine the {sup 239}Pu/{sup 241}Am, {sup 243}Am/{sup 241}Am, {sup 237}Np/{sup 241}Am, and {sup 239}Np/{sup 241}Am ratios in americium-beryllium neutron sources. The effective specific power of each neutron source was calculated from the ratios determined by FRAM in order to determine the americium mass of each of these neutron sources using calorimetric assay. We will also discuss the use of FRAM for the general case of isotopic analysis of nonplutonium, nonuranium items.

  5. Influence of environmental factors on the gastrointestinal absorption of plutonium and americium

    International Nuclear Information System (INIS)

    The absorption of plutonium and americium from the gastrointestinal tract was studied, using adult hamsters and rabbits. Both actinides were administered as inorganic compounds, as organic complexes with naturally occurring chelating agents, and in a biologically incorporated form in liver tissues. The absorption of the tetravalent and hexavalent forms of plutonium were compared and the effect of protracted administration at very low concentrations was investigated. In addition, plutonium uptake from contaminated sediments and grass, collected near a nuclear-fuel reprocessing plant, was measured. The results of these studies suggest that chronic exposure of man to plutonium and americium in food and water will not lead to any substantial increase in their gastrointestinal absorption above the values currently recommended by the International Commission on Radiological Protection to define the occupational exposure of workers

  6. Contemporary state of plutonium and americium in the soils of Palesse state radiation-ecological reserve

    International Nuclear Information System (INIS)

    Full text: At present, the most important alpha-emitting radionuclides of Chernobyl origin are Pu 238, Pu 239, Pu 240 and Am 241. They are classified as the most dangerous group of radionuclides in view of the long half-lives and high radiotoxicity. The main part of alpha-emitted radionuclides is located within the Palesse State Radiation-Ecological Reserve. One of the most important factors determining the radioecological situation in the contaminated ecosystems is the physicochemical forms of radionuclides in a soil medium. Radionuclide species determine the radionuclide entrance into the soil solutions, their redistribution in soil profiles and the 'soil - plant' and the 'soil - surface, ground or underground water' systems as well as spreading beyond the contaminated area. The present work is devoted to investigation of state and migration ability of plutonium and americium in soils of the Palesse state radiation-ecological reserve after more than 20 years from the Chernobyl accident. The objects of investigation were mineral and organic soils sampled in 2008 with the step of 5 cm to the depth of 25-30 cm. The forms of plutonium and americium distinguishing by association with the different components of soil and by potential for migration in the soil medium were studied using the method of sequential selective extraction according to the modified Tessier scheme. Activities of Pu 238, Pu 239, Pu 240 and Am 241 in the samples were determined by the method of radiochemical analysis with alpha-spectrometer radionuclide identification. The dominant part of plutonium and americium in the soils is in immobile forms. Nowadays, radionuclide portions in water soluble and reversibly bound forms do not exceed 9.4 % of radionuclide content in the soil. In mineral soil samples, the radionuclide portions in these fractions exceed the corresponding portions in organic ones. In both mineral and organic soils, the portions of mobile americium are higher than plutonium. The

  7. Standard test method for quantitative determination of americium 241 in plutonium by Gamma-Ray spectrometry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia


    1.1 This test method covers the quantitative determination of americium 241 by gamma-ray spectrometry in plutonium nitrate solution samples that do not contain significant amounts of radioactive fission products or other high specific activity gamma-ray emitters. 1.2 This test method can be used to determine the americium 241 in samples of plutonium metal, oxide and other solid forms, when the solid is appropriately sampled and dissolved. 1.3 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  8. Fabrication of neptunium, plutonium, americium and curium metals for fuel research

    International Nuclear Information System (INIS)

    The techniques for the fabrication of actinide metals; neptunium, americium and curium called as minor actinides, and plutonium, are surveied in a viewpoint of the preparation of starting materials for fuel property measurements. In this report, the processes of the conversion to metals, purification et al. are reviewed. The concept related to the apparatus design is also proposed and the considerable subjects are discussed. (author)

  9. Final Radiological Assessment of External Exposure for CLEAR-Line Americium Recovery Operations

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Adam C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Belooussova, Olga N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hetrick, Lucas Duane [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)


    Los Alamos National Laboratory is currently planning to implement an americium recovery program. The americium, ordinarily isotopically pure 241Am, would be extracted from existing Pu materials, converted to an oxide and shipped to support fabrication of americium oxide-beryllium neutron sources. These operations would occur in the currently proposed Chloride Extraction and Actinide Recovery (CLEAR) line of glove boxes. This glove box line would be collocated with the currently-operational Experimental Chloride Extraction Line (EXCEL). The focus of this document is to provide an in-depth assessment of the currently planned radiation protection measures and to determine whether or not further design work is required to satisfy design-goal and ALARA requirements. Further, this document presents a history of americium recovery operations in the Department of Energy and high-level descriptions of the CLEAR line operations to provide a basis of comparison. Under the working assumptions adopted by this study, it was found that the evaluated design appears to mitigate doses to a level that satisfies the ALARA-in-design requirements of 10 CFR 835 as implemented by the Los Alamos National Laboratory procedure P121. The analyses indicate that extremity doses would also meet design requirements. Dose-rate calculations were performed using the radiation transport code MCNP5 and doses were estimated using a time-motion study developed in consort with the subject matter expert. A copy of this report and all supporting documentation are located on the Radiological Engineering server at Y:\\Rad Engineering\\2013 PROJECTS\\TA-55 Clear Line.

  10. Americium, plutonium and uranium contamination and speciation in well waters, streams and atomic lakes in the Sarzhal region of the Semipalatinsk Nuclear Test Site, Kazakhstan

    International Nuclear Information System (INIS)

    New data are reported on the concentrations, isotopic composition and speciation of americium, plutonium and uranium in surface and ground waters in the Sarzhal region of the Semipalatinsk Test Site, and an adjacent area including the settlement of Sarzhal. The data relate to filtered water and suspended particulate from (a) streams originating in the Degelen Mountains, (b) the Tel'kem 1 and Tel'kem 2 atomic craters, and (c) wells on farms located within the study area and at Sarzhal. The measurements show that 241Am, 239,240Pu and 238U concentrations in well waters within the study area are in the range 0.04-87 mBq dm-3, 0.7-99 mBq dm-3, and 74-213 mBq dm-3, respectively, and for 241Am and 239,240Pu are elevated above the levels expected solely on the basis of global fallout. Concentrations in streams sourced in the Degelen Mountains are similar, while concentrations in the two water-filled atomic craters are somewhat higher. Suspended particulate concentrations in well waters vary considerably, though median values are very low, at 0.01 mBq dm-3, 0.08 mBq dm-3 and 0.32 mBq dm-3 for 241Am, 239,240Pu and 238U, respectively. The 235U/238U isotopic ratio in almost all well and stream waters is slightly elevated above the 'best estimate' value for natural uranium worldwide, suggesting that some of the uranium in these waters is of test-site provenance. Redox analysis shows that on average most of the plutonium present in the microfiltered fraction of these waters is in a chemically reduced form (mean 69%; 95% confidence interval 53-85%). In the case of the atomic craters, the proportion is even higher. As expected, all of the americium present appears to be in a reduced form. Calculations suggest that annual committed effective doses to individual adults arising from the daily ingestion of these well waters are in the range 11-42 μSv (mean 21 μSv). Presently, the ground water feeding these wells would not appear to be contaminated with radioactivity from past

  11. Fabrication of uranium–americium mixed oxide pellet from microsphere precursors: Application of CRMP process

    International Nuclear Information System (INIS)

    Highlights: • Dust free process for (U,Am)O2 transmutation target fabrication. • Synthesis of U0.9Am0.1O2 mixed oxide microspheres from ion exchange resin. • Fabrication of dense U0.9Am0.1O2 pellet with 95% TD from mixed oxide microspheres. - Abstract: Mixed uranium–americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Recently, several processes have been developed in order to validate fabrication flowchart in terms of material specifications such as density and homogeneity but also to suggest simplifications for lowering industrial costs and hazards linked to dust generation of highly contaminating and irradiating compounds. This study deals with the application of an innovative route using mixed oxide microspheres obtained from metal loaded resin bead calcination, called Calcined Resin Microsphere Pelletization (CRMP). The synthesis of mixed oxide microsphere precursor of U0.9Am0.1O2±δ is described as well as its characterisation. The use of this free-flowing precursor allows the pressing and sintering of one pellet of U0.9Am0.1O2±δ. The ceramic obtained was characterised and results showed that its microstructure is dense and homogeneous and its density attains 95% of the theoretical density. This study validates the scientific feasibility of the CRMP process applied to the fabrication of uranium and americium-containing materials

  12. Influence of dissolved organic substances in groundwater on sorption behavior of americium and neptunium

    International Nuclear Information System (INIS)

    Groundwaters typically contain dissolved organic carbon consisting largely of high molecular weight compounds of humic and fulvic acids. To evaluate whether these dissolved organic substances can enhance the tranport of radionuclides through the groundwater system, experiments were conducted to examine the sorption of americium and neptunium onto crushed basalt in the presence of dissolved humic- and fulvic-acid organic carbon introduced into synthetic groundwater. The partitioning experiments with synthetic groundwater show that increasing the concentration of either humic or fulvic acid in the water has a significant inhibiting effect on sorption of both americium and neptunium. At 220C, adsorption of these radionuclides, as measured by distribution ratios (the ratio of nuclide sorbed onto the solid to nuclide in solution at the end of the experiment), decreased by 25% to 50% by addition of as little as 1 mg/L dissolved organic carbon and by one to two orders of magnitude by addition of 100 to 200 mg/L dissolved organic carbon. Distribution ratios measured in solutions reacted at 900C similarly decreased with the addition of dissolved organic carbon but generally ranged from one to two orders of magnitude higher than those determined in the 220C experiment. These results suggest that organic carbon dissolved in deep groundwaters may significantly enhance the mobility of radionuclides of americium and neptunium. 23 references, 5 figures, 11 tables

  13. Bidentate organophosphorus extraction of americium and plutonium from Hanford Plutonium Reclamation Facility waste

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.


    Applicability of bidentate organiphosphorus reagents to recovery of americium and plutonium from Hanford's Plutonium Reclamation Facility acid (approx. 2M HNO/sub 3/) waste stream (CAW solution) was studied. A solvent extraction process which employs a 30% DHDECMP (dihexyl-N, N-diethylcarbamylmethylene phosphonate)-CCl/sub 4/ extractant was devised and successfully tested in mixer-settler runs with actual CAW solution. Substitution of DHDECMP for DBBP eliminates the need to perform careful neutralization of unbuffered CAW soluton and increases overall americium recovery from the present 60 to 80% level to greater than or equal to 90%. Disadvantages to such substitution include the high cost (approx. $50/liter) of DHDECMP and the need to purify it (by acid (6M HCl) hydrolysis and alkaline washing) from small amounts of an unidentified impurity which prevents stripping of americium with dilute HNO/sub 3/. Distribution data obtained in this study confirm Siddall's earlier contention that bidentate organophosphorus regents can be used to remove actinides from concentrated high-level Purex process acid waste; a conceptual flowsheet for such an extraction process is given.

  14. Selective recovery of americium alone from PUREX or COEXTM raffinate by the EXAm process

    International Nuclear Information System (INIS)

    Americium is the main contributor to the long-term radiotoxicity and to the heat generation of glasses used for the HLW conditioning. To decrease both impact on the ultimate waste and to avoid the difficult recycling of curium, the CEA has developed the EXAm process for the the separation and the recovery of the sole americium directly from PUREX or COEXTM raffinates. The principle of the EXAm process is to extract americium and light lanthanides from high nitric acid media, leaving curium and heavy lanthanides in the raffinate. A water-soluble amide molecule, TEDGA, is added in aqueous phase to increase Am/Cm and Am/heavy lanthanides selectivity, because of the preferential complexation of curium and heavy lanthanides by this diglycolamide. Many experimental data have been acquired mainly at the extraction-scrubbing step (Am/Cm separation) and were used for the development of a phenomenological model implemented in the PAREX process simulation code. The scientific feasibility demonstration of the EXAm process was then performed on a genuine PUREX raffinate in Atalante CBP hot cell in 2010. (author)

  15. Uptake and effects of americium-241 on a brackish-water amphipod

    International Nuclear Information System (INIS)

    The present paper reports the results of experimental work undertaken using the brackish-water amphipod Gammarus duebeni duebeni and the transuranium nuclide americium-241. Data on the accumulation of this actinide showed that the larger fraction of the total body burden is associated with the exoskeleton. It was found that the body burden remained constant in the range pH 8.0-6.5 even though the water concentration changed markedly. It would thus appear that the concept of a concentration factor should be re-examined and it is proposed that a factor should be defined in terms of environmental and chemical parameters which represent the bioavailable fraction of the actinide. The effect of americium on survival and moulting was studied at two activity concentrations; the dose rates and absorbed doses under the experimental conditions employed have been estimated. The differences in survival rates between the control and irradiated groups were statistically analyzed and the significant difference at the higher concentration is believed to be due to a synergism between physiological stress and radiotoxicity of americium rather than the chemical toxicity of the element. (orig.)

  16. 33 CFR 162.235 - Puget Sound Area, Wash. (United States)


    ...: The Corps of Engineers also has regulations dealing with this section in 33 CFR Part 207. ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Puget Sound Area, Wash. 162.235...) PORTS AND WATERWAYS SAFETY INLAND WATERWAYS NAVIGATION REGULATIONS § 162.235 Puget Sound Area, Wash....

  17. Dicty_cDB: CHG235 [Dicty_cDB

    Lifescience Database Archive (English)


  18. Dicty_cDB: SHE235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHE235 (Link to dictyBase) - - - Contig-U15792-1 SHE235P (Link to Original ... |DV426996.1 NADY185TR Aedes aegypti infected with Dengue ... virus Pool library Aedes aegypti cDNA clone NADY18 ...

  19. Dicty_cDB: CHQ235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHQ235 (Link to dictyBase) - - - Contig-U11840-1 | Contig-U13129-1 CHQ235P ... mplete sequence. 149 2e-93 11 AF288090 |AF288090.1 Rhodomonas ... salina mitochondrial DNA, complete genome. 88 8e-1 ...

  20. 31 CFR 235.4 - Check Forgery Insurance Fund. (United States)


    ... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Check Forgery Insurance Fund. 235.4... SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE ISSUANCE OF SETTLEMENT CHECKS FOR FORGED CHECKS DRAWN ON DESIGNATED DEPOSITARIES § 235.4 Check Forgery Insurance Fund. The Check Forgery...

  1. Observation of the uranium 235 nuclear magnetic resonance signal


    Le Bail, H.; Chachaty, C.; Rigny, P.; Bougon, R.


    The first observation of the nuclear magnetic resonance of the uranium 235 is reported. It has been performed on pure liquid uranium hexafluoride at 380 K. The measured magnetogyric ratio is | γ(235U) | = 492.6 ± 0.2 rad.s-1 G-1.

  2. About the reaction between uranium-americium mixed oxides and sodium

    International Nuclear Information System (INIS)

    The recycling and fission of the highly toxic minor actinides neptunium and americium is only possible in a liquid metal cooled fast breeder reactor, for nuclear physical reasons. The present work is part of a research program dealing with the fuel-coolant interaction. Fuel pellets with equal parts of americium and uranium and varying oxygen-metal ratio were investigated. A behaviour comparable to that of uranium-plutonium mixed oxides was suggested as a first approach. The reaction of sodium with (U0.5Am0.5)O2-x results in a complete desintegration of the sintered pellet whereas (U, Pu)O2-x pellets show a small increase in volume. A first explanation of the strong reaction of uranium-americium mixed oxides compared to (U, Pu)O2-x or (U, Np)O2-x could be provided by the less negative oxygen potential of the former. Ternary and polynary oxides which are possible products of the fuel-coolant reaction were prepared and characterised by X-ray diffraction. Their oxygen potentials were measured using a solid state e.m.f. cell. Neither Na2AmO3 nor Na3AmO4 can coexist with sodium metal. The measured ΔGO2 values of the Am(IV) and Am (V)-compounds are much higher than those of the sodium uranates(VI) or sodium neptunates(VI). Only Na2O seems to be likely as product of the fuel-coolant interactions. It could be determined in reacted samples by X-ray diffraction. The relatively high oxygen potentials of (U0.5Am0.5)O2-x that are responsible for the reaction could be explained by a binding model which is based on an americium valency state of + 3 and U5+. The existence of both valency states could be proved by XPS measurements. Due to the similar behaviour of neptunium and uranium the problems that are expected for the recycling of Np are much smaller than for americium

  3. Nuclear Excitation by Electronic Transition of U-235

    Energy Technology Data Exchange (ETDEWEB)

    Chodash, Perry Adam [Univ. of California, Berkeley, CA (United States)


    Nuclear excitation by electronic transition (NEET) is a rare nuclear excitation that is theorized to occur in numerous isotopes. One isotope in particular, 235U, has been studied several times over the past 40 years and NEET of 235U has never been conclusively observed. These past experiments generated con icting results with some experiments claiming to observe NEET of 235U and others setting limits for the NEET rate. This dissertation discusses the latest attempt to measure NEET of 235U. If NEET of 235U were to occur, 235mU would be created. 235mU decays by internal conversion with a decay energy of 76 eV and a half-life of 26 minutes. A pulsed Nd:YAG laser operating at 1064 nm with a pulse energy of 789 mJ and a pulse width of 9 ns was used to generate a uranium plasma. The plasma was captured on a catcher plate and electrons emitted from the catcher plate were accelerated and focused onto a microchannel plate detector. A decay of 26 minutes would suggest the creation of 235mU and the possibility that NEET occurred. However, measurements performed using a variety of uranium targets spanning depleted uranium up to 99.4% enriched uranium did not observe a 26 minute decay. Numerous other decays were observed with half-lives ranging from minutes up to hundreds of minutes. While NEET of 235U was not observed during this experiment, an upper limit for the NEET rate of 235U was determined. In addition, explanations for the con icting results from previous experiments are given. Based on the results of this experiment and the previous experiments looking for NEET of 235U, it is likely that NEET of 235U has never been observed.

  4. Americium(3) coordination chemistry: An unexplored diversity of structure and bonding

    Energy Technology Data Exchange (ETDEWEB)

    Fedosseev, A.M.; Grigoriev, M.S.; Budantseva, N.A. [A.N. Frumkin Institute of Physical Chemistry and Electrochemistry, Moscow (Russian Federation); Guillaumont, D.; Den Auwer, Ch.; Moisy, Ph. [CEA Marcoule, Nuclear Energy Division, RadioChemistry and Processes Department, 30 (France); Le Naour, C.; Simoni, E. [CNRS, University Paris-11 Orsay, IPN, 91 - Orsay (France)


    The comparison of the physicochemical behavior of the actinides with that of the lanthanides can be justified by the analogy of their electronic structure, as each of the series is made up of elements corresponding to the filling of a given (n)f atomic shell. However relatively few points of comparison are available, given the lack of available structure for trans-plutonium(III) elements and the additional difficulty of stabilizing coordination complexes of uranium(III) to plutonium(III). This contribution is a focal point of trans-plutonium(III) chemistry and, more specifically, of some americium compounds that have been recently synthesized, all related with hard acid oxygen donor ligands that may be involved in the reprocessing chain of nuclear fuel. After a brief review of the solid hydrates and aquo species for the lanthanide and actinide families, we discuss two types of ligands that have in common three carboxylic groups, namely the amino-tri-acetic acid and the citric acid anions. The additional roles of the nitrogen atom for the first one and of the hydroxy function for the second one are discussed. Accordingly, five new complexes with either americium or lanthanides elements are described: [Co(NH{sub 3}){sub 6}][M(NTA){sub 2}(H{sub 2}O)].8H{sub 2}O with M Nd, Yb and Am, and [Co(NH{sub 3}){sub 6}]{sub 2}K[M{sub 3}(Cit){sub 4}(H{sub 2}O){sub 3}].18H{sub 2}O with Nd and Am cations. In all cases the americium complexes are isostructural with their lanthanide equivalents. (authors)

  5. Americium(3) coordination chemistry: An unexplored diversity of structure and bonding

    International Nuclear Information System (INIS)

    The comparison of the physicochemical behavior of the actinides with that of the lanthanides can be justified by the analogy of their electronic structure, as each of the series is made up of elements corresponding to the filling of a given (n)f atomic shell. However relatively few points of comparison are available, given the lack of available structure for trans-plutonium(III) elements and the additional difficulty of stabilizing coordination complexes of uranium(III) to plutonium(III). This contribution is a focal point of trans-plutonium(III) chemistry and, more specifically, of some americium compounds that have been recently synthesized, all related with hard acid oxygen donor ligands that may be involved in the reprocessing chain of nuclear fuel. After a brief review of the solid hydrates and aquo species for the lanthanide and actinide families, we discuss two types of ligands that have in common three carboxylic groups, namely the amino-tri-acetic acid and the citric acid anions. The additional roles of the nitrogen atom for the first one and of the hydroxy function for the second one are discussed. Accordingly, five new complexes with either americium or lanthanides elements are described: [Co(NH3)6][M(NTA)2(H2O)].8H2O with M Nd, Yb and Am, and [Co(NH3)6]2K[M3(Cit)4(H2O)3].18H2O with Nd and Am cations. In all cases the americium complexes are isostructural with their lanthanide equivalents. (authors)

  6. Speciation of americium in seawater and accumulation in the marine sponge Aplysina cavernicola. (United States)

    Maloubier, Melody; Michel, Hervé; Solari, Pier Lorenzo; Moisy, Philippe; Tribalat, Marie-Aude; Oberhaensli, François R; Dechraoui Bottein, Marie Yasmine; Thomas, Olivier P; Monfort, Marguerite; Moulin, Christophe; Den Auwer, Christophe


    The fate of radionuclides in the environment is a cause of great concern for modern society, seen especially in 2011 after the Fukushima accident. Among the environmental compartments, seawater covers most of the earth's surface and may be directly or indirectly impacted. The interaction between radionuclides and the marine compartment is therefore essential for better understanding the transfer mechanisms from the hydrosphere to the biosphere. This information allows for the evaluation of the impact on humans via our interaction with the biotope that has been largely undocumented up to now. In this report, we attempt to make a link between the speciation of heavy elements in natural seawater and their uptake by a model marine organism. More specifically, because the interaction of actinides with marine invertebrates has been poorly studied, the accumulation in a representative member of the Mediterranean coralligenous habitat, the sponge Aplysina cavernicola, was investigated and its uptake curve exposed to a radiotracer (241)Am was estimated using a high-purity Ge gamma spectrometer. But in order to go beyond the phenomenological accumulation rate, the speciation of americium(III) in seawater must be assessed. The speciation of (241)Am (and natural europium as its chemically stable surrogate) in seawater was determined using a combination of different techniques: Time-Resolved Laser-Induced Fluorescence (TRLIF), Extended X-ray Absorption Fine Structure (EXAFS) at the LIII edge, Attenuated Total Reflectance Fourier Transform Infrared (ATR-FTIR) spectroscopy and Scanning Electron Microscopy (SEM) and the resulting data were compared with the speciation modeling. In seawater, the americium(III) complex (as well as the corresponding europium complex, although with conformational differences) was identified as a ternary sodium biscarbonato complex, whose formula can be tentatively written as NaAm(CO3)2·nH2O. It is therefore this chemical form of americium that is

  7. Fabrication of uranium–americium mixed oxide pellet from microsphere precursors: Application of CRMP process

    Energy Technology Data Exchange (ETDEWEB)

    Remy, E. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Picart, S., E-mail: [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Delahaye, T. [Fuel Cycle Technology Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Jobelin, I. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Lebreton, F.; Horlait, D. [Fuel Cycle Technology Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Bisel, I. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Blanchart, P. [Heterogeneous Materials Research Group, Centre Européen de la Céramique, F-87068 Limoges (France); Ayral, A. [Institut Européen des Membranes, CNRS-ENSCM-UM2, CC47, University Montpellier 2, F-34095 Montpellier cedex 5 (France)


    Highlights: • Dust free process for (U,Am)O{sub 2} transmutation target fabrication. • Synthesis of U{sub 0.9}Am{sub 0.1}O{sub 2} mixed oxide microspheres from ion exchange resin. • Fabrication of dense U{sub 0.9}Am{sub 0.1}O{sub 2} pellet with 95% TD from mixed oxide microspheres. - Abstract: Mixed uranium–americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Recently, several processes have been developed in order to validate fabrication flowchart in terms of material specifications such as density and homogeneity but also to suggest simplifications for lowering industrial costs and hazards linked to dust generation of highly contaminating and irradiating compounds. This study deals with the application of an innovative route using mixed oxide microspheres obtained from metal loaded resin bead calcination, called Calcined Resin Microsphere Pelletization (CRMP). The synthesis of mixed oxide microsphere precursor of U{sub 0.9}Am{sub 0.1}O{sub 2±δ} is described as well as its characterisation. The use of this free-flowing precursor allows the pressing and sintering of one pellet of U{sub 0.9}Am{sub 0.1}O{sub 2±δ}. The ceramic obtained was characterised and results showed that its microstructure is dense and homogeneous and its density attains 95% of the theoretical density. This study validates the scientific feasibility of the CRMP process applied to the fabrication of uranium and americium-containing materials.

  8. Americium characterization by X-ray fluorescence and absorption spectroscopy in plutonium uranium mixed oxide

    International Nuclear Information System (INIS)

    Plutonium uranium mixed oxide (MOX) fuels are currently used in nuclear reactors. The actinides in these fuels need to be analyzed after irradiation for assessing their behaviour with regard to their environment and the coolant. In this work the study of the atomic structure and next-neighbour environment of Am in the (Pu,U)O2 lattice in an irradiated (60 MW d kg−1) MOX sample was performed employing micro-X-ray fluorescence (µ-XRF) and micro-X-ray absorption fine structure (µ-XAFS) spectroscopy. The chemical bonds, valences and stoichiometry of Am (∼0.66 wt%) are determined from the experimental data gained for the irradiated fuel material examined in its peripheral zone (rim) of the fuel. In the irradiated sample Am builds up as Am3+ species within an [AmO8]13− coordination environment (e.g. >90%) and no (III XAFS spectra recorded for the irradiated MOX sub-sample in the rim zone for a 300 μm×300 μm beam size area investigated over six scans of 4 h. The records remain constant during multi-scan. The analysis of the XAFS signal shows that Am is found as trivalent in the UO2 matrix. This analytical work shall open the door of very challenging analysis (speciation of fission product and actinides) in irradiated nuclear fuels. - Highlights: • Americium was characterized by microX-ray absorption spectroscopy in irradiated MOX fuel. • The americium redox state as determined from XAS data of irradiated fuel material was Am(III). • In the sample, the Am3+ face an AmO813− coordination environment in the (Pu,U)O2 matrix. • The americium dioxide is reduced by the uranium dioxide matrix

  9. Monsanto Gives Washington U. $23.5 Million. (United States)

    Culliton, Barbara J.


    Reviews various provisions of a five-year, $23.5-million research agreement between Washington University and the Monsanto Company. The scientific focus of this venture will be on proteins and peptides which modify cellular behavior. (SK)

  10. Assay Method for 235U in Low-Density Waste

    Institute of Scientific and Technical Information of China (English)


    <正>235U assay method will provide a semi-quantitative assay for any uranium lumps that might exist in low-density, low-Z material waste boxes within a short count time. These materials will consist of

  11. Recovery of Americium-241 from lightning rod by the method of chemical treatment

    International Nuclear Information System (INIS)

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 (241Am), fewer and Radium 226 (226Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241Am technique was used electrodeposition. (author)

  12. Report of scouting study on precipitation of strontium, plutonium, and americium from Hanford complexant concentrate waste

    International Nuclear Information System (INIS)

    A laboratory scouting test was conducted of precipitation methods for reducing the solubility of radionuclides in complexant concentrate (CC) waste solution. The results show that addition of strontium nitrate solution is effective in reducing the liquid phase activity of 90Sr (Strontium) in CC waste from tank 107-AN by 94% when the total strontium concentration is adjusted to 0.1 M. Addition of ferric nitrate solution effective in reducing the 241Am (Americium) activity in CC waste by 96% under the conditions described in the report. Ferric nitrate was also marginally effective in reducing the solubility of 239/240Pu (Plutonium) in CC waste

  13. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning;


    Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were...... plutonium from the latter to Spitsbergen waters. Fallout plutonium in Arctic waters has a residence time of the order of several years, while for Pu from Sellafield we estimate mean residence times of 11–15 months in Scottish waters and, tentatively, 1·5-3 y during transport from the North Channel (north...

  14. Americium and curium heterogeneous transmutation in moderated S/ A in the framework of CNE scenarios studies

    International Nuclear Information System (INIS)

    This paper presents the transmutation of Americium and Curium in a heterogeneous mode in the framework of the 1991 French Law concerning waste management. Two scenarios with moderated targets are presented: a 100% frit reactor (EFR) scenario multi-recycling Pu+Np with targets of Am+Cm placed in core and a mixed PWR (UOX fuel) and fast reactor (50% of EFR) multi-recycling Pu+Np and containing targets in core and in the blanket region. The design of the target is based on classical fast fuel S/A technology (pins, spacer wires,...) and should reach the goal of 90% fission rate. (authors)

  15. Laboratory investigation of the role of desorption kinetics on americium transport associated with bentonite colloids. (United States)

    Dittrich, Timothy Mark; Boukhalfa, Hakim; Ware, Stuart Douglas; Reimus, Paul William


    Understanding the parameters that control colloid-mediated transport of radionuclides is important for the safe disposal of used nuclear fuel. We report an experimental and reactive transport modeling examination of americium transport in a groundwater-bentonite-fracture fill material system. A series of batch sorption and column transport experiments were conducted to determine the role of desorption kinetics from bentonite colloids in the transport of americium through fracture materials. We used fracture fill material from a shear zone in altered granodiorite collected from the Grimsel Test Site (GTS) in Switzerland and colloidal suspensions generated from FEBEX bentonite, a potential repository backfill material. The colloidal suspension (100 mg L(-1)) was prepared in synthetic groundwater that matched the natural water chemistry at GTS and was spiked with 5.5 × 10(-10) M (241)Am. Batch characterizations indicated that 97% of the americium in the stock suspension was adsorbed to the colloids. Breakthrough experiments conducted by injecting the americium colloidal suspension through three identical columns in series, each with mean residence times of 6 h, show that more than 95% of the bentonite colloids were transported through each of the columns, with modeled colloid filtration rates (k(f)) of 0.01-0.02 h(-1). Am recoveries in each column were 55-60%, and Am desorption rate constants from the colloids, determined from 1-D transport modeling, were 0.96, 0.98, and 0.91 h(-1) in the three columns, respectively. The consistency in Am recoveries and desorption rate constants in each column indicates that the Am was not associated with binding sites of widely-varying strengths on the colloids, as one binding site with fast kinetics represented the system accurately for all three sequential columns. Our data suggest that colloid-mediated transport of Am in a bentonite-fracture fill material system is unlikely to result in transport over long distance scales because

  16. Purification of used scintillation liquids containing the alpha emitters americium and plutonium

    International Nuclear Information System (INIS)

    In Sweden, alpha radioactive waste liquids with an activity over some kBq per waste container cannot be sent for final storage. Therefore, in this work, a method for a purification of alpha active scintillation cocktails was developed. Until today (March, 2013) more than 20 L of scintillation liquids have successfully been purified from americium and plutonium. The products of the process are a solid fraction that can be sent to final storage and a practically non-radioactive liquid fraction that can be sent to municipal incineration. (author)

  17. Comparison of acid leachate and fusion methods to determine plutonium and americium in environmental samples

    International Nuclear Information System (INIS)

    The Analytical Chemistry Laboratory at Argonne National Laboratory performs radiochemical analyses for a wide variety of sites within the Department of Energy complex. Since the chemical history of the samples may vary drastically from site to site, the effectiveness of any analytical technique may also vary. This study compares a potassium fluoride-pyrosulfate fusion technique with an acid leachate method. Both normal and high-fired soils and vegetation samples were analyzed for both americium and plutonium. Results show both methods work well, except for plutonium in high-fired soils. Here the fusion method provides higher accuracy

  18. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning; Holm, E.; Boelskifte, S.; Duniec, S.; Persson, B.


    Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were...... plutonium from the latter to Spitsbergen waters. Fallout plutonium in Arctic waters has a residence time of the order of several years, while for Pu from Sellafield we estimate mean residence times of 11–15 months in Scottish waters and, tentatively, 1·5-3 y during transport from the North Channel (north of...

  19. Influence of biofilms on migration of uranium, americium and europium in the environment

    International Nuclear Information System (INIS)

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  20. Direct measurement of uranium 235 concentration in uranium hexafluoride containers

    International Nuclear Information System (INIS)

    A simple, portable and autonomous apparatus is described. Isotopic ratio of uranium 235 can be determined in UF6 containers (type 30B or 48Y) without contact with the fissile material. A thermal neutron source induces, through the container wall, nuclear fissions. Fast neutrons produced by the nuclear reaction are detected and counted giving the concentration in uranium 235. Results obtained are presented and discussed

  1. Dicty_cDB: SHH235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SH (Link to library) SHH235 (Link to dictyBase) - G23190 DDB0230077 Contig-U16076-1 SHH235P (Lin ... 24 |AF454824.1 Enterococcus faecalis pathogenicity island , complete sequence. 42 2e-04 9 AC116984 |AC116984. ... 999.1 Enterococcus faecalis putative pathogenicity island , partial sequence. 42 7e-04 5 dna update 2006. 4. ...

  2. Numerical simulation for concentration profiles of americium and lanthanides in the CMPO-TBP solvent extraction system

    International Nuclear Information System (INIS)

    A numerical simulation code is developed to predict the extraction behavior of americium and lanthanides in the TRUEX (TRansUranium EXtraction)process. This code gives the concentration profiles of the components at steady state. The stage efficiency is included in this code as a parameter in order to simulate the extraction behavior of the components accurately. Concentration profiles of americium and typical lanthanides in some counter current experiments are calculated by means of the present code. The calculated concentration profiles are compared with the experimental results. The efficiency value for the mixer-settlers, which gives good agreement between the calculated and the experimental profiles, is evaluated. (author)

  3. Numerical simulation for concentration profiles of americium and lanthanides in the CMPO-TBP solvent extraction system

    International Nuclear Information System (INIS)

    A numerical simulation code for the TRUEX (TRansUranium EXtraction) process is developed to predict the extraction behavior of americium and lanthanides. This code gives the concentrations of the components at the steady state of the TRUEX process. The stage efficiency is applied to this code in order to simulate the extraction behavior of the components accurately. Concentration profiles of americium and typical lanthanides in some counter current experiments are calculated by means of the present code. The calculated profiles are compared with the experimental ones. The efficiency value for the mixer-settlers, which gives the best agreement between the two profiles, is investigated

  4. Study of the extraction and the purification of americium and trivalent actinides contained in effluents with supported liquid membranes

    International Nuclear Information System (INIS)

    The supported liquid membrane technique is studied and developed for americium recovery from uranium or plutonium matrices and decontamination of liquid radioactive wastes. First tests on uranium-nickel solutions with a flat membrane showed the easiness of the operation and the efficiency of the process. Acid-resistant (10 N), interchangeable elements with hollow fibers, are developed and also a computerized automatic device. The different tests on americium solutions demonstrate the feasibility and the reliability of the system. Influence of various parameters on transfer kinetics is investigated

  5. Experimental and in situ investigations on americium, curium and plutonium behaviour in marine benthic species: transfer from water or sediments

    International Nuclear Information System (INIS)

    The tranfer of transuranic elements -americium, curium and plutonium- from the sediments containing them to some marine benthic species (endofauna and epifauna) was studied with a twofold approach - laboratory and in-situ investigation. The experimental investigations, divided into three parts, made it possible to specify concentration factors (F.C.), transfer factors (F.T.) and to understand the process involved for 5 benthic species. The result were refined by an in-situ study that brought new data on the marine distribution of the transuranic elements released by the La Hague plant. Finally, the localization of americium and plutonium in the tissues and cells of these species was determined by autoradiography

  6. Nuclear excitation by electronic transition of 235U (United States)

    Chodash, P. A.; Burke, J. T.; Norman, E. B.; Wilks, S. C.; Casperson, R. J.; Fisher, S. E.; Holliday, K. S.; Jeffries, J. R.; Wakeling, M. A.


    Background: Nuclear excitation by electronic transition (NEET) is a rare nuclear excitation that can occur in isotopes containing a low-lying nuclear excited state. Over the past 40 yr, several experiments have attempted to measure NEET of 235U and those experiments have yielded conflicting results. Purpose: An experiment was performed to determine whether NEET of 235U occurs and to determine its excitation rate. Method: A pulsed Nd:YAG laser operating at 1064 nm with a pulse energy of 790 mJ and a pulse width of 9 ns was used to generate a uranium plasma. The plasma was collected on a catcher plate and electrons from the catcher plate were accelerated and focused onto a microchannel plate detector. An observation of a decay with a 26-min half-life would suggest the creation of Um235 and the possibility that NEET of 235U occurred. Results: A 26-min decay consistent with the decay of Um235 was not observed and there was no evidence that NEET occurred. An upper limit for the NEET rate of 235U was determined to be λNEETconfidence level of 68.3%. Conclusions: The upper limit determined from this experiment is consistent with most of the past measurements. Discrepancies between this experiment and past measurements can be explained by assuming that past experiments misinterpreted the data.

  7. Vitrification of F-area americium/curium: feasibility study and preliminary process recommendation

    International Nuclear Information System (INIS)

    Work was performed to identify a process to vitrify the contents of F- canyon Tank 17.1. Tank 17.1 contains the majority of americium (Am) and curium (Cm) contained in the DOE Complex. Oak Ridge National Laboratory (ORNL) has made a formal request for this material as fuel for production of Cf252 and other transplutonium actinides. The Am and Cm (and associated lanthanide fission products) are currently in nitric acid solution. Transportation of the intensely radioactive Am/Cm in liquid form is not considered possible. As a result, the material will either be solidified and shipped to ORNL or discarded to the Tank Farm. Nuclear Materials Processing Technology (NMPT), therefore, requested Defense Waste Processing Technology (DWPT) to determine if the Tank 17.1 material could be vitrified, and if it was vitrified could the americium and curium be successfully recovered. Research was performed to determine if the Tank 17.1 contents could indeed be mixed with glass formers and vitrified. Additional studies identified critical process parameters such as heat loading, melter requirements, off-gas evolution, etc. Discussions with NMPT personnel were initiated to determine existing facilities where this work could be accomplished safely. A process has been identified which will convert the Am/Cm material into approximately 300kg of glass

  8. Transfer of radiocaesium, plutonium and americium to sheep after ingestion of contaminated soil

    International Nuclear Information System (INIS)

    A dual isotope method has been used to study the transfer of 137Cs, 239/240Pu and 241Am to sheep following ingestion of contaminated soil. Two soils were used; an alluvial gley contaminated by Sellafield discharges, and an organic soil, artificially contaminated in a lysimeter. Values of the true absorption coefficient of radiocaesium of 0.19 +/- 0.03 and 0.03 +/- 0.01 respectively were obtained for these soils. This implies an availability factor for soil-associated radiocaesium of up to about 20 pc compared to radiocaesium ingested in soluble form. The absorption of plutonium and americium was not significantly different for the two soils tested. Absorption of both plutonium and americium was in the range 10-5 - 10-4, with mean values of 7 x 10-5 and 4 x 10-5 obtained respectively. These values imply availability factors of around 10 pc, compared to the value of 5 x 10-4 recommended by ICRP for plutonium ingested in a comparatively available form. These results are compared with estimates of availability made using an in-vitro approach

  9. Transfer of radiocaesium, plutonium and americium to sheep after ingestion of contaminated soil

    Energy Technology Data Exchange (ETDEWEB)

    Cooke, A.I.; Weekes, T.E.C. [Newcastle upon Tyne Univ. (United Kingdom). Dept. of Biological and Nutritional Sciences; Rimmer, D.L. [Newcastle upon Tyne Univ. (United Kingdom). Dept. of Agricultural and Environmental Science; Green, N.; Wilkins, B.T. [National Radiological Protection Board, Chilton (United Kingdom)


    A dual isotope method has been used to study the transfer of {sup 137}Cs, {sup 239/240}Pu and {sup 241}Am to sheep following ingestion of contaminated soil. Two soils were used; an alluvial gley contaminated by Sellafield discharges, and an organic soil, artificially contaminated in a lysimeter. Values of the true absorption coefficient of radiocaesium of 0.19 +/- 0.03 and 0.03 +/- 0.01 respectively were obtained for these soils. This implies an availability factor for soil-associated radiocaesium of up to about 20 pc compared to radiocaesium ingested in soluble form. The absorption of plutonium and americium was not significantly different for the two soils tested. Absorption of both plutonium and americium was in the range 10{sup -5} - 10{sup -4}, with mean values of 7 x 10{sup -5} and 4 x 10{sup -5} obtained respectively. These values imply availability factors of around 10 pc, compared to the value of 5 x 10{sup -4} recommended by ICRP for plutonium ingested in a comparatively available form. These results are compared with estimates of availability made using an in-vitro approach

  10. Americium and europium extraction from carbonate solutions by 1-phenyl-3-methyl-4-benzoylpyrazolone -5

    International Nuclear Information System (INIS)

    Trivalent TPEs and REEs are extractable from carbonate solutions by 1-pheny-3-methyl-4-benzoylpyrazolone-5 (PMBP). The effect of concentration of KHCO3 and K2CO3, extractant, metal, and other factors on the extent of extraction of the elements has been clarified. The kinetics of extraction of the elements from carbonate solutions has been studied. It has been shown that in the KHCO3 concentration range 0.2-2.0 M americium and europium are extracted by PMBP solutions in different diluents with distribution coefficients lying within n x 102-n x 103. From K2CO3 solutions the elements are extracted better by PMBP solutions in methyl isobutyl ketone (MIBK). It has been shown that metal concentration in the range 1x10-5. 5x10-3 g-ion x liter-1 does not affect extraction (log E = 3). Extracts based on PMBP with a metal content higher than 5x10-3g-ion x liter-1 were obtained by absolute concentrating method and were used for the study of 13C NMR spectra. The composition of thecompounds extracted by PMBP from carbonate solutions was determined by 13C NMR spectroscopy and extraction. The conditions of europium and americium reextraction from extracts based on PMBP by complexones, their mixtures with alkalis and other substances were studied. The scopes for using the system PMBP-carbonate solutions to separate and concentrate TPEs and REEs has been examined

  11. Evaluation of americium-241 toxicity influence on the microbial growth of organic wastes

    International Nuclear Information System (INIS)

    Available in abstract form only. Full text of publication follows: Since the licenses for using radioactive sources in radioactive lightning rods were lifted by the Brazilian national nuclear authority, in 1989, the radioactive devices have been replaced by Franklin type and collected as radioactive waste. However, only 20 percent of the estimated total number of installed rods was delivered to Brazilian Nuclear Commission. This situation causes concern, due to, first, the possibility of the rods being disposed as domestic waste, and second, the americium, the most commonly employed radionuclide, is classified as a high-toxicity element. In the present study, Am-241 migration experiments were performed by a lysimeter system, in order to evaluate the risk of contamination caused by radioactive lightning rods disposed as a common solid waste. Besides the risk evaluation, it is important to know the mechanism of the Am-241 release or retention in waste as well as its influence in the waste decomposition processes. Many factors are involved, but microorganisms present in the waste play an important role in its degradation, which control the physical and chemical processes. The objective of this work was to evaluate the Am-241 influence on the microbial population by counting number of cells in lysimeters leachate. Preliminary results suggest that americium may influence significantly the bacteria growth in organic waste, evidenced by culture under aerobiosis and an-aerobiosis and the antimicrobial resistance test. (authors)

  12. Contribution to the prediction of americium, plutonium and neptunium behaviour in the geosphere: chemical data

    International Nuclear Information System (INIS)

    An exhaustive bibliographic review on hydrolysis of americium gives the stability constants, at zero ionic strength. No evidence of Am(OH)4- formation was found by solubility studies up to pH 2 (CO3)3 characterised by its X-ray diffraction pattern is studied at a high ionic strength. All the published results on Am in carbonate media are reinterpreted using these stability constants (Am-OH-CO3 complexes are not needed). No evidence of Am(CO3)45- formation was found by spectrophotometry up to 3M. Literature results are used to determine the formal redox potentials at pH = 9.4 and to calculate the formation constants, at zero ionic strength. The formation of complexes between americium and humic materials (purified fulvic and humic acids) has been studied by a spectrophotometric technique. The results are interpreted by the formation of a 1:1 complexe. Solubility of the solid PuO2(CO3) is measured in bicarbonate media at high ionic strength, to obtain the solubility product and formation constants of the PuO2(CO3)i2-2i complexes

  13. EURADOS intercomparison on measurements and Monte Carlo modelling for the assessment of Americium in a USTUR leg phantom

    International Nuclear Information System (INIS)

    A collaboration of the EURADOS working group on 'Internal Dosimetry' and the United States Transuranium and Uranium Registries (USTUR) has taken place to carry out an intercomparison on measurements and Monte Carlo modelling determining americium deposited in the bone of a USTUR leg phantom. Preliminary results and conclusions of this intercomparison exercise are presented here. (authors)

  14. An economic analysis of a light and heavy water moderated reactor synergy: burning americium using recycled uranium

    International Nuclear Information System (INIS)

    An economic analysis is presented for a proposed synergistic system between 2 nuclear utilities, one operating light water reactors (LWR) and another running a fleet of heavy water moderated reactors (HWR). Americium is partitioned from LWR spent nuclear fuel (SNF) to be transmuted in HWRs, with a consequent averted disposal cost to the LWR operator. In return, reprocessed uranium (RU) is supplied to the HWRs in sufficient quantities to support their operation both as power generators and americium burners. Two simplifying assumptions have been made. First, the economic value of RU is a linear function of the cost of fresh natural uranium (NU), and secondly, plutonium recycling for a third utility running a mixed oxide (MOX) fuelled reactor fleet has been already taking place, so that the extra cost of americium recycling is manageable. We conclude that, in order for this scenario to be economically attractive to the LWR operator, the averted disposal cost due to partitioning americium from LWR spent fuel must exceed 214 dollars per kg, comparable to estimates of the permanent disposal cost of the high level waste (HLW) from reprocessing spent LWR fuel. (authors)

  15. Effects of Hanford high-level waste components on sorption of cobalt, strontium, neptunium, plutonium, and americium on Hanford sediments

    Energy Technology Data Exchange (ETDEWEB)

    Delegard, C H; Barney, G S


    To judge the feasibility of continued storage of high-level waste solutions in existing tanks, effects of chemical waste components on the sorption of hazardous radioelements were determined. Experiments identified the effects of 12 Hanford high-level waste-solution components on the sorption of cobalt, strontium, neptunium, plutonium, and americium on 3 Hanford 200 Area sediments. The degree of sorption of strontium, neptunium, plutonium, and americium on two Hanford sediments was then quantified in terms of the concentrations of the influential waste components. Preliminary information on the influence of the waste components on radioelement solubility was gathered. Of the 12 Hanford waste-solution components studied, the most influential on radioelement sorption were NaOH, NaAlO/sub 2/, HEDTA, and EDTA. The chelating complexants, HEDTA and EDTA, generally decreased sorption by complexation of the radioelement metal ions. The components NaOH and NaAlO/sub 2/ decreased neptunium and plutonium sorption and increased cobalt sorption. Americium sorption was increased by NaOH. The three Hanford sediments' radioelement sorption behaviors were similar, implying that their sorption reactions were also similar. Sorption prediction equations were generated for strontium, neptunium, plutonium, and americium sorption reactions on two Hanford sediments. The equations yielded values of the distribution coefficient, K/sub d/, as quadratic functions of waste-component concentrations and showed that postulated radioelement migration rates through Hanford sediment could change by factors of 13 to 40 by changes in Hanford waste composition.

  16. Effects of Hanford high-level waste components on sorption of cobalt, strontium, neptunium, plutonium, and americium on Hanford sediments

    International Nuclear Information System (INIS)

    To judge the feasibility of continued storage of high-level waste solutions in existing tanks, effects of chemical waste components on the sorption of hazardous radioelements were determined. Experiments identified the effects of 12 Hanford high-level waste-solution components on the sorption of cobalt, strontium, neptunium, plutonium, and americium on 3 Hanford 200 Area sediments. The degree of sorption of strontium, neptunium, plutonium, and americium on two Hanford sediments was then quantified in terms of the concentrations of the influential waste components. Preliminary information on the influence of the waste components on radioelement solubility was gathered. Of the 12 Hanford waste-solution components studied, the most influential on radioelement sorption were NaOH, NaAlO2, HEDTA, and EDTA. The chelating complexants, HEDTA and EDTA, generally decreased sorption by complexation of the radioelement metal ions. The components NaOH and NaAlO2 decreased neptunium and plutonium sorption and increased cobalt sorption. Americium sorption was increased by NaOH. The three Hanford sediments' radioelement sorption behaviors were similar, implying that their sorption reactions were also similar. Sorption prediction equations were generated for strontium, neptunium, plutonium, and americium sorption reactions on two Hanford sediments. The equations yielded values of the distribution coefficient, K/sub d/, as quadratic functions of waste-component concentrations and showed that postulated radioelement migration rates through Hanford sediment could change by factors of 13 to 40 by changes in Hanford waste composition

  17. Anomalous aryl strengthening of americium and europium complexes during extraction by alkylenediphosphine dioxides from perchloric acid media

    International Nuclear Information System (INIS)

    Extraction of americium and europium from perchlorate environments by solutions of three types of methylenediphosphine dioxides, namely (C6H5)P(O)(CH2)sub(n)(O)P(C6H5)2, (C6H5)2P(O)CH2(O)P(C8H17)2 and (C8H17)2P(O)(CH2)sub(n)(O)P(C8H17)2 has been studied (n is 1 or 2 ) The diluents used have been dichlorethane and chloroform. In perchlorate environments the distribuiton coefficients of americium and europium have proved to be by about 3 orders of magnitude higher than in nitric acid environments, i.e. in perchlorate media the complexes are far more stable. Separation coefficients of americium and REE in perchloric acid soutions are much higher than in nitrate environments. The average value of Am/Eu separation coeffecient at 1-5 M acidity was about 6 (with dichlorethane as diluent) or about 7 (with chloroform as diluent). The complexes essentially exist as trisolvated. Americium complexes display anomalous stability increase upon being diluted: by about 2 orders of magnitude with dichlorethane and by up to 3 orders of magnitude with chloroform used as diluent

  18. Investigations of neutron characteristics for salt blanket models; integral fission cross section measurements of neptunium, plutonium, americium and curium isotopes

    International Nuclear Information System (INIS)

    Neutron characteristics of salt blanket micromodels containing eutectic mixtures of sodium, zirconium, and uranium fluorides were measured on FKBN-2M, BIGR and MAKET facilities. The effective fission cross sections of neptunium, plutonium, americium, and curium isotopes were measured on the neutron spectra formed by micromodels. (author)

  19. The distribution of plutonium-239 and americium-241 in the Syrian hamster following its intravenous administration as citrate

    International Nuclear Information System (INIS)

    Actinide distribution in various tissues and the skeleton of hamsters by liquid scintillation counting or isotope dilution. For plutonium 57% of activity was concentrated in the skeleton and more than 90% in the liver and skeleton after seven days. For americium the liver retained more than 50% of total activity and 25% was excreted in urine within seven days. (U.K.)

  20. A U-235 confirmation method with a discriminating view

    International Nuclear Information System (INIS)

    Reprocessed spent nuclear fuel that has gone through various stages of chemical processing is currently stored at the INEEL. The material consists of three categories: clean U-235 with radiation readings in the mR/h range, U-235 and fission products up to 900 mR/h, and U-235 with U-232 from 100--200 mR/h. The material is contained in plastic bottles and stored in steel structures consisting of seven vertically arranged individual compartments. A total of forty stacks reside in individual concrete wells. This material is considered hard to measure due to excessive radiation exposure to personnel involved with handling the material during mass and NaI U-235 confirmation measurements for Safeguards inventory purposes. A U-235 confirmation method was developed to assay the individual items in place with the ability to discriminate one item from the other items in the stack. Equipment used with this method includes a portable high-resolution gamma-ray detection system, an appropriate tungsten shield and collimator, and a laser-positioning device. A discrimination control test was incorporated to compare the gamma-ray signal of an item in place to the background signal when the item is removed. Total discrimination of the 186-keV gamma ray signal was achieved

  1. Application of ion-exchange chromatography to eliminate the curium from americium by his determination by the method of liquid scintillation spectrometry

    International Nuclear Information System (INIS)

    The aim of this work is to eliminate curium in determining of americium by the method of liquid scintillation spectrometry. The paper introduces a method that has been done to eliminate curium from americium by determining of americium with liquid scintillation spectrometry method. In the research we used ion-exchange chromatography and ion-exchange sorbents DOWEX. We also observed the effect of geometry organization of column on the separation course. Resources for alpha spectrometry were prepared by micro-precipitation with neodymium chloride. High radiochemical yields were achieved, but separation did not take place according to a pre-separation scheme. (authors)

  2. 235Cf anti ν discrepancy and the sulfur discrepancy

    International Nuclear Information System (INIS)

    The cantankerous discrepancy among measured values of anti ν for 235Cf appears at last to be nearing a final resolution. A recent review has summarized the progress that has been achieved through revaluation upward by 0.5% of two manganese bath values anti ν and the performance of a new liquid scintillator measurement. A new manganese bath measurement at INEL is in reasonably good agreement with previous manganese bath values of 235Cf anti ν. It now appears that the manganese bath values could still be systematically low by as much as 0.4% because the BNL-325 thermal absorption cross section for sulfur may be as much as 10% low. There is a bona fide discrepancy between measurements of the sulfur cross section by pile oscillators and the values derived from transmission measurements. The resolution of this discrepancy is a prerequisite to the final resolution of the 235Cf anti ν discrepancy. 22 references

  3. Purification of scintillation cocktails containing the alpha emitters americium and plutonium

    International Nuclear Information System (INIS)

    One efficient way of measuring alpha emitters is by the usage of liquid scintillation counting (LSC). A liquid sample is placed in a vial containing a scintillation cocktail. The alpha particles excite electrons in the surrounding liquid, and when they are de-excited photons are emitted. The photons are detected and the activity can be quantified. LSC has a high efficiency for alpha radiation and is therefore a fast and easy way for measuring alpha emitting samples. One drawback is that it does not differentiate very well between alpha energies; measurements of for example curium and plutonium simultaneously are impossible and demand other techniques. Another drawback is the production of a liquid alpha active waste. In Sweden alpha radioactive waste liquids with an activity over some kBq per waste container cannot be sent for final storage. If, however, the activity of the liquids could be reduced by precipitation of the actinides, it would be possible to send away the liquid samples to municipal incineration. In this work a method for a purification of alpha active scintillation cocktails was developed. The method was first tried on a lab scale, and then scaled up. Until today (March, 2013) more than 20 liters of scintillation liquids have successfully been purified from americium and plutonium at Chalmers University of Technology in Sweden. The four scintillation cocktails used were Emulsifier Safe®, Hionic-Fluor®, Ultima Gold AB® and Ultima Gold XR®. The scintillation cocktails could all be purified from americium with higher yield than 95%. The yield was kept when the liquids were mixed. Also plutonium could be precipitated with a yield over 95% in all cocktails except in Hionic-Fluor® (>55%). However, that liquid in particular could be purified (>95%) by mixing it with the three other cocktails. Up-scaling was performed to a batch size of 6-8 L of scintillation cocktail. In neither the americium nor the plutonium system, adverse effects of increasing the

  4. Integral cross section measurement of the 235U(n ,n') Um235 reaction in a pulsed reactor (United States)

    Bélier, G.; Bond, E. M.; Vieira, D. J.; Authier, N.; Becker, J. A.; Hyneck, D.; Jacquet, X.; Jansen, Y.; Legendre, J.; Macri, R.; Méot, V.; Romain, P.


    The integral measurement of the neutron inelastic cross section leading to the 26-minute half-life Um235 isomer in a fission-like neutron spectrum is presented. The experiment has been performed at a pulsed reactor, where the internal conversion decay of the isomer was measured using a dedicated electron detector after activation. The sample preparation, efficiency measurement, irradiation, radiochemistry purification, and isomer decay measurement will be presented. We determined the integral cross section for the 235U(n ,n') Um235 reaction to be 1.00 ±0.13 b . This result supports an evaluation performed with talys-1.4 code with respect to the isomer excitation as well as the total neutron inelastic scattering cross section.

  5. Imitators of plutonium and americium in a mixed uranium- plutonium nitride fuel (United States)

    Nikitin, S. N.; Shornikov, D. P.; Tarasov, B. A.; Baranov, V. G.; Burlakova, M. A.


    Uranium nitride and mix uranium nitride (U-Pu)N is most popular nuclear fuel for Russian Fast Breeder Reactor. The works in hot cells associated with the radiation exposure of personnel and methodological difficulties. To know the main physical-chemical properties of uranium-plutonium nitride it necessary research to hot cells. In this paper, based on an assessment of physicochemical and thermodynamic properties of selected simulators Pu and Am. Analogues of Pu is are Ce and Y, and analogues Am - Dy. The technique of obtaining a model nitride fuel based on lanthanides nitrides and UN. Hydrogenation-dehydrogenation- nitration method of derived powders nitrides uranium, cerium, yttrium and dysprosium, held their mixing, pressing and sintering, the samples obtained model nitride fuel with plutonium and americium imitation. According to the results of structural studies have shown that all the samples are solid solution nitrides rare earth (REE) elements in UN.

  6. Recovery of plutonium and americium from chloride salt wastes by solvent extraction

    International Nuclear Information System (INIS)

    Plutonium and americium can be recovered from aqueous waste solutions containing a mixture of HCl and chloride salt wastes by the coupling of two solvent extraction systems: tributyl phosphate (TBP) in tetrachloroethylene (TCE) and octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) in TCE. In the flowsheet developed, the salt wastes are dissolved in HCl, the Pu(III) is oxidized to the IV state with NaClO2 and recovered in the TBP-TCE cycle, and the Am is then removed from the resultant raffinate by the CMPO-TCE cycle. The consequences of the feed solution composition and extraction behavior of these species on the process flowsheet design, the Pu-product purity, and the decontamination of the aqueous raffinate from transuranic elements are discussed. 16 refs., 6 figs

  7. Recovery of plutonium and americium from chloride salt wastes by solvent extraction

    International Nuclear Information System (INIS)

    Plutonium and americium can be recovered from aqueous waste solutions containing a mixture of HCl and chloride salt wastes by the coupling of two solvent extraction systems: tributyl phosphate (TBP) in tetrachloroethylene (TCE) and octyl(phenyl)-N,N-diisobutyl-carbamoylmethylphosphine oxide (CMPO) in TCE. In the flowsheet developed, the salt wastes are dissolved in HCl, the Pu(III) is oxidized to the IV state with NaClO2 and recovered in the TBP-TCE cycle, and the Am is then removed from the resultant raffinate by the CMPO-TCE cycle. The consequences of the feed solution composition and extraction behavior of these species on the process flowsheet design, the Pu-product purity, and the decontamination of the aqueous raffinate from transuranic elements are discussed

  8. The uptake of plutonium-239, 240, americium-241, strontium-90 into plants

    International Nuclear Information System (INIS)

    This report describes the results of measurements on the uptake of plutonium, americium, strontium-90 and caesium-137 into peas, beet, oats, sweet corn, tomatoes and vegetable marrow grown in tubs containing radioactively-contaminated silts. The silts had been taken from an area of West Cumbria commonly referred to as the Ravenglass estuary. The experiments are categorised as being carried out under non-standard conditions because of the manner in which the radioactivity came to be incorporated into the growth medium. The growth medium was representative of conditions which could arise when the estuarine silt moves inland under the influence of wind and tide and mixes with the adjacent farm land. The silt had been contaminated by radioactive effluents from the nuclear fuels reprocessing plant at Sellafield and this contamination had been brought about by natural means. (Auth.)

  9. Mutual separation of americium(III) and europium(III) using glycolamic acid and thioglycolamic acid

    International Nuclear Information System (INIS)

    The extractants, bis(2-ethylhexyl)diglycolamicacid (HDEHDGA) and bis(2-ethylhexy)thiodiglycolamic acid (HDEHSDGA) were synthesized and characterized by 1H and 13C NMR, mass and IR spectroscopy. The extraction behaviour of (152+154)Eu(III) and 241Am(III) from nitric acid medium by a solution of HDEHDGA (or HDEHSDGA) in n-dodecane (n-DD) was studied for the mutual separation of actinides and lanthanides. The effect of various parameters such as the pH, concentrations of HDEHDGA, HDEHSDGA, sodium nitrate, N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (TPEN) and diethylenetriaminepentaacetic acid (DTPA) on the separation factor (SF) of americium(III) over europium(III) and vice versa was studied, and the conditions needed for the preferential separation were optimised. The results show that HDEHDGA exhibits higher extraction for (152+154)Eu(III) and HDEHSDGA shows the superior selectivity for 241Am(III). (orig.)

  10. Laboratory investigation of the role of desorption kinetics on americium transport associated with bentonite colloids

    International Nuclear Information System (INIS)

    Understanding the parameters that control colloid-mediated transport of radionuclides is important for the safe disposal of used nuclear fuel. We report an experimental and reactive transport modeling examination of americium transport in a groundwater–bentonite–fracture fill material system. A series of batch sorption and column transport experiments were conducted to determine the role of desorption kinetics from bentonite colloids in the transport of americium through fracture materials. We used fracture fill material from a shear zone in altered granodiorite collected from the Grimsel Test Site (GTS) in Switzerland and colloidal suspensions generated from FEBEX bentonite, a potential repository backfill material. The colloidal suspension (100 mg L−1) was prepared in synthetic groundwater that matched the natural water chemistry at GTS and was spiked with 5.5 × 10−10 M 241Am. Batch characterizations indicated that 97% of the americium in the stock suspension was adsorbed to the colloids. Breakthrough experiments conducted by injecting the americium colloidal suspension through three identical columns in series, each with mean residence times of 6 h, show that more than 95% of the bentonite colloids were transported through each of the columns, with modeled colloid filtration rates (kf) of 0.01–0.02 h−1. Am recoveries in each column were 55–60%, and Am desorption rate constants from the colloids, determined from 1-D transport modeling, were 0.96, 0.98, and 0.91 h−1 in the three columns, respectively. The consistency in Am recoveries and desorption rate constants in each column indicates that the Am was not associated with binding sites of widely-varying strengths on the colloids, as one binding site with fast kinetics represented the system accurately for all three sequential columns. Our data suggest that colloid-mediated transport of Am in a bentonite-fracture fill material system is unlikely to result in transport over long distance

  11. Comparative study of plutonium and americium bioaccumulation from two marine sediments contaminated in the natural environment

    International Nuclear Information System (INIS)

    Plutonium and americium sediment-animal transfer was studied under controlled laboratory conditions by exposure of the benthic polychaete Nereis diversicolor (O. F. Mueller) to marine sediments contaminated by a nuclear bomb accident (near Thule, Greenland) and nuclear weapons testing (Enewetak Atoll). In both sediment regimes, the bioavailability of plutonium and 241Am was low, with specific activity in the tissues 241Am occurred and 241Am uptake from the Thule sediment was enhanced compared to that from lagoon sediments of Enewetak Atoll. Autoradiography studies indicated the presence of hot particles of plutonium in the sediments. The results highlight the importance of purging animals of their gut contents in order to obtain accurate estimates of transuranic transfer from ingested sediments into tissue. It is further suggested that enhanced transuranic uptake by some benthic species could arise from ingestion of highly activity particles and organic-rich detritus present in the sediments. (author)

  12. A thermodynamic study of actinide oxide targets/fuels for americium transmutation

    International Nuclear Information System (INIS)

    A thermodynamic study was performed on the systems Am-O, AmOx-MgO, AmOx-MgAl2O4, Pu-Mg-O and U-Mg-O. Both experimental work (X-ray analyses, oxygen potential measurements etc.) and calculations on the phase diagrams involved were made. The reaction between americium oxide and spinel is expected to form the compound AmAlO3. Isothermal sections have been calculated for AmOx-(MgO, Al2O3), Pu-Mg-O and U-Mg-O at 2000 K using the software package ''Thermo-Calc''. Thermodynamic equilibrium data were used to predict the behaviour of actinide oxides in a reactor. The implication of the results for the technological application is discussed, with emphasis on the effects of the high oxygen potential of AmO2 as compared to the conventional fuel, i.e. UO2. (author)

  13. EURADOS action for determination of americium in skull measures in vivo and Monte Carlo simulation

    International Nuclear Information System (INIS)

    From the Group of WG7 internal dosimetry of the EURADOS Organization (European Radiation Dosimetry group, e.V.) which It coordinates CIEMAT, international action for the vivo measurement of americium has been conducted in three mannequins type skull with detectors of Germanium by gamma spectrometry and simulation by Monte Carlo methods. Such action has been raised as two separate exercises, with the participation of institutions in Europe, America and Asia. Other actions similar precede this vivo intercomparison of measurement and modeling Monte Carlo1. The preliminary results and associated findings are presented in this work. The laboratory of the body radioactivity (CRC) of service counter of dosimetry staff internal (DPI) of the CIEMAT, it has been one of the participants in vivo measures exercise. On the other hand part, the Group of numerical dosimetry of CIEMAT is participant of the Monte Carlo2 simulation exercise. (Author)

  14. Ab initio modelling of the behaviour of helium in americium and plutonium oxides

    International Nuclear Information System (INIS)

    By means of an ab initio plane wave pseudo potential method, plutonium dioxide and americium dioxide are modelled, and the behaviour of helium in both these materials is studied. We first show that a pseudo potential approach in the Generalized Gradient Approximation (GGA) can satisfactorily describe the cohesive properties of PuO2 and AmO2. We then calculate the formation energies of point defects (vacancies and interstitials), as well as the incorporation and solution energies of helium in PuO2 and AmO2. The results are discussed according to the incorporation site of the gas atom in the lattice and to the stoichiometry of PuO2±x and AmO2±x. (authors)

  15. Removal of plutonium and americium from hydrochloric acid waste stream using extraction chromatography

    International Nuclear Information System (INIS)

    Extraction chromatography is under development as a method to lower actinide activity levels in hydrochloric acid (HCl) effluent streams. Successful application of this technique would allow recycle of the largest portion of HCl, while lowering the quantity and improving the form of solid waste generated. The extraction of plutonium and americium from HCl solutions was examined for several commercial and similar laboratory-produced resins coated with n-octyl(phenyl)-N,N-diisobutylcarbamoylmethyphosphine oxide (CMPO) and either tributyl phosphate (TBP), or diamyl amylphosphonate (DAAP). Distribution coefficients for Pu and Am were measured by contact studies in hydrochloric acid solutions over the range of 0.1 - 10.0 N HCl, whole varying REDOX conditions, actinide loading levels, and contact time intervals. Significant differences in the actinide distribution coefficients, and in the kinetics of actinide removal were observed as a function of resin formulation. The usefulness of these resins for actinide removal from HCl effluent streams is discussed

  16. Complex formation of trivalent americium with salicylic acid at very low concentrations

    International Nuclear Information System (INIS)

    For the first time, the complexation of americium(III) with salicylic acid was studied at trace metal concentrations using a 2.0 m Long Path Flow Cell for UV-vis spectroscopy. The detection limit of Am(III) in aqueous solution at pH 3.0 was found to be 5 x 10-9 M. Two Am(III)-salicylate complexes were formed at pH 5.0 in 0.1 M NaClO4, indicated by a clear red shift of the absorption maximum. The absorption spectra obtained from spectrophotometric titration were analyzed by means of factor analysis and complex stabilities were calculated to be log β110 = 2.56 ± 0.08 and log β120 = 3.93 ± 0.19. (author)

  17. Standard practice for The separation of americium from plutonium by ion exchange

    CERN Document Server

    American Society for Testing and Materials. Philadelphia


    1.1 This practice describes the use of an ion exchange technique to separate plutonium from solutions containing low concentrations of americium prior to measurement of the 241Am by gamma counting. 1.2 This practice covers the removal of plutonium, but not all the other radioactive isotopes that may interfere in the determination of 241Am. 1.3 This practice can be used when 241Am is to be determined in samples in which the plutonium is in the form of metal, oxide, or other solid provided that the solid is appropriately sampled and dissolved (See Test Methods C758, C759, and C1168). 1.4 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  18. Transportability Class of Americium in K Basin Sludge under Ambient and Hydrothermal Processing Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Delegard, Calvin H.; Schmitt, Bruce E.; Schmidt, Andrew J.


    This report establishes the technical bases for using a ''slow uptake'' instead of a ''moderate uptake'' transportability class for americium-241 (241Am) for the K Basin Sludge Treatment Project (STP) dose consequence analysis. Slow uptake classes are used for most uranium and plutonium oxides. A moderate uptake class has been used in prior STP analyses for 241Am based on the properties of separated 241Am and its associated oxide. However, when 241Am exists as an ingrown progeny (and as a small mass fraction) within plutonium mixtures, it is appropriate to assign transportability factors of the predominant plutonium mixtures (typically slow) to the Am241. It is argued that the transportability factor for 241Am in sludge likewise should be slow because it exists as a small mass fraction as the ingrown progeny within the uranium oxide in sludge. In this report, the transportability class assignment for 241Am is underpinned with radiochemical characterization data on K Basin sludge and with studies conducted with other irradiated fuel exposed to elevated temperatures and conditions similar to the STP. Key findings and conclusions from evaluation of the characterization data and published literature are summarized here. Plutonium and 241Am make up very small fractions of the uranium within the K Basin sludge matrix. Plutonium is present at about 1 atom per 500 atoms of uranium and 241Am at about 1 atom per 19000 of uranium. Plutonium and americium are found to remain with uranium in the solid phase in all of the {approx}60 samples taken and analyzed from various sources of K Basin sludge. The uranium-specific concentrations of plutonium and americium also remain approximately constant over a uranium concentration range (in the dry sludge solids) from 0.2 to 94 wt%, a factor of {approx}460. This invariability demonstrates that 241Am does not partition from the uranium or plutonium fraction for any characterized sludge matrix. Most

  19. Plutonium and americium concentrations and vertical profiles in some Italian mosses used as bioindicators

    International Nuclear Information System (INIS)

    We have examined the uptake of actinide elements Am and Pu by different species of lichen and moss collected in two locations (Urbino, Central Italy; Alps region, North-east Italy). Plutonium and americium were separated and determined by extraction chromatography, electrodeposition and alpha-spectrometry. This paper summarizes our results with a special emphasis on the vertical profiles of these actinides in two different species of mosses. Several 1-2 cm depth sections were obtained and dated by 210Pb method. A typical peak for 239,240Pu and 241Am was found in the very old moss species ('Sphagnum Compactum') at a depth corresponding to the period 1960-1970 which was the period characterized by the maximum nuclear weapon tests. In a younger moss species ('Neckeria Crispa') no peak was observed and the regression curves showed that Am is more mobile than 239,240Pu and 238Pu. (author)

  20. 77 FR 29986 - Savannah River Site Building 235-F Safety (United States)


    ... site workers who are normally in the facilities, construction sites, and trailers located adjacent to... Solidification Building construction sites to examine how these facilities would respond to a significant... facilities, construction sites, and trailers located adjacent to Building 235-F. Development of this...

  1. Dicty_cDB: SLI235 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLI235 (Link to dictyBase) - G24235 DDB0191526 Contig-U01384-1 | Contig-U12 ... ****lkklkkkktlii Frame B: yhskhsrtsw*igsrs*rlkesig*skw *nh*rcwyir*syr*yqskigscyqslccshk *fyhptklikcc*nr*** ...

  2. Some 235U reference fission product yield data evaluation

    International Nuclear Information System (INIS)

    To satisfy the requirement of application for reference fission product yield data, the data have been and will be continuously evaluated. Present work, in which the reference data for 20 product nuclides from 235U fission were evaluated, is a part of the whole work

  3. 48 CFR 2052.235-70 - Publication of research results. (United States)


    ... publication in refereed scientific and engineering journals or dissemination to the public of any information... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Publication of research....235-70 Publication of research results. As prescribed in 2035.70(a)(1), the contracting officer...

  4. 48 CFR 235.006-70 - Manufacturing Technology Program. (United States)


    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Manufacturing Technology... CONTRACTING 235.006-70 Manufacturing Technology Program. In accordance with 10 U.S.C. 2521(d), for acquisitions under the Manufacturing Technology Program— (a) Award all contracts using competitive...

  5. 46 CFR 172.235 - Extent of damage. (United States)


    ... BULK CARGOES Special Rules Pertaining to Great Lakes Dry Bulk Cargo Vessels § 172.235 Extent of damage... Damage Collision Penetration Longitudinal extent 0.495 L2/3 or 47.6 feet. (1/3 L2/3 or 14.5 m),...

  6. 29 CFR 99.235 - Program-specific audits. (United States)


    ... § 99.235 Program-specific audits. (a) Program-specific audit guide available. In many cases, a program-specific audit guide will be available to provide specific guidance to the auditor with respect to internal control, compliance requirements, suggested audit procedures, and audit reporting requirements....

  7. 24 CFR 235.230 - Condition of multifamily structure. (United States)


    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Condition of multifamily structure... Involving Condominium Units § 235.230 Condition of multifamily structure. (a) When a family unit is conveyed... principal rating organization doing business in the state. If the property is located in a state which...

  8. 4-Chloro-2,3,5-trifluorobenzoic Acid

    Directory of Open Access Journals (Sweden)

    Shuitao Yu


    Full Text Available A new tetrahalogenated benzoic acid 4-chloro-2,3,5-trifluorobenzoic acid was synthesized from methyl 2,3,4,5-tetrafluorobenzoate via three steps. The structure of the newly synthesized compound was established by FTIR, NMR, MS and elemental analysis.

  9. 24 CFR 8.29 - Homeownership programs (sections 235(i) and 235(j), Turnkey III and Indian housing mutual self... (United States)


    ... order to accommodate his or her specific handicap. The cost of making a facility accessible under this... the extent such costs exceed allowable mortgage limits, they may be passed on to the prospective homebuyer, subject to maximum sales price limitations (see 24 CFR 235.320.)...

  10. An electrochemical oxidation process of Am (III) into Am (VI) used to separate the americium of spent fuels reprocessing solutions

    International Nuclear Information System (INIS)

    The aim of this invention is to oxidize by an electrochemical process Am (III) to Am (VI). This process can be used to separate the americium of spent fuels reprocessing solutions. The method consists to add to the aqueous nitric solution containing Am (III) an heteropolyanion able to complex the americium (as for instance the potassium tungstophosphate) and the Ag (II) ion. The Ag (II) ion oxidizes the Am (III) and is reduced into an Ag (I) ion. It is then regenerated by the electrolysis of the solution. After the oxidation of Am (III) into Am (VI), this last ion can be extracted by an adapted organic solvent. With this electrochemical method a yield of 100% Am (VI) is obtained in half a hour. (O.M.). 5 refs., 5 figs., 2 tabs

  11. Separation of oxidized americium from lanthanides by use of pillared metal(IV) phosphate-phosphonate hybrid materials

    International Nuclear Information System (INIS)

    Closing the nuclear fuel cycle in the US poses many challenges, one of which is found in the waste streams, which contain both trivalent lanthanides and actinides. The separation of americium from the raffinate will dramatically reduce the long-term radiotoxicity of the waste. The sorption of americium in both the tri- and pentavalent oxidation states was observed for four M(IV) phosphate-phosphonate ion exchange materials in nitric acid at pH 2. High selectivity was observed for reduced Am(III) with Kd values ca. 6 x 105 mL/g, while the Kd values for Am(V) were much lower. A new method of synthesizing and stabilizing AmO2+ to yield a lifetime of at least 24 h in acidic media using a combination of sodium persulfate and calcium hypochlorite will be described.

  12. Effects of impurities on the size and form of crystals of thorium and americium oxalates and oxides

    International Nuclear Information System (INIS)

    The influence of impurity salts and certain surfactants on the shape and size of thorium and americium oxalate crystals, as well as crystals of their dioxides, prepared at thermolysis of oxalate precipitates, has been investigated. It is shown that during thorium oxalate deposition from solutions, containing 0.8 mol/l thorium and 2 mol/l nitric acid at 96 deg C in the presence of ammonium salts or surfactants larger and monodisperse crystals are grown than in the absence of the above-mentioned substances. Addition of ammonium nitrate in the amount of 0.6 mol/l to solution containing 7.6x10-3 mol/l of americium dioxide particles coincides with the shape of oxalate crystals but their size is reduced by (20-25)% as compared with the initial ones

  13. Combined radiochemical procedure for determination of plutonium, americium and strontium-90 in the soil samples from SNTS

    International Nuclear Information System (INIS)

    The results of combined radiochemical procedure for the determination of plutonium, americium and 90Sr (via measurement of 90Y) in the soil samples from SNTS (Semipalatinsk Nuclear Test Site) are presented. The processes of co-precipitation of these nuclides with calcium fluoride in the strong acid solutions have been investigated. The conditions for simultaneous separation of americium and yttrium using extraction chromatography have been studied. It follows from analyses of real soil samples that the procedure developed provides the chemical recovery of plutonium and yttrium in the range of 50-95 % and 60-95 %, respectively. The execution of the procedure requires 3.5 working days including a sample decomposition study. (author)

  14. Extraction of americium(III) from nitric acid medium by CMPO-TBP extractants in ionic liquid diluent

    International Nuclear Information System (INIS)

    Extraction of americium(III) from nitric acid medium by a solution of tri-n-butylphosphate (TBP) and n-octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) in room temperature ionic liquid, l-butyl-3-methyl-imidazolium bis(trifluoromethanesulfonyl)imide (bmimNTf2), was studied and the results were compared with that obtained with CMPO-TBP in n-doddecane (n-DD). The distribution ratio of 241Am(III) in TBP-CMPO/bmimNTf2 was measured as a function of various parameters such as concentrations of nitric acid, CMPO, bmimNO3, NaNO3 and TBP and temperature. Remarkably large distribution ratios were observed for the extraction of americium(III) when bmimNTf2 acted as diluent and the extraction was insignificant in the absence of CMPO. The stoichiometry of metal-solvate in organic phase was determined by the slope analysis of extraction data and it indicated the formation of 1:3 (Am: CMPO) complex in organic phase. Viscosity of TBP-CMPO/bmimNTf2 at various temperatures and enthalpy change accompanied by the extraction of americium(III) were determined and reported in this paper. (orig.)

  15. The behaviour under irradiation of molybdenum matrix for inert matrix fuel containing americium oxide (CerMet concept) (United States)

    D'Agata, E.; Knol, S.; Fedorov, A. V.; Fernandez, A.; Somers, J.; Klaassen, F.


    Americium is a strong contributor to the long term radiotoxicity of high activity nuclear waste. Transmutation by irradiation in nuclear reactors or Accelerator Driven System (ADS, subcritical reactors dedicated to transmutation) of long-lived nuclides like 241Am is therefore an option for the reduction of radiotoxicity of waste packages to be stored in a repository. In order to safely burn americium in a fast reactor or ADS, it must be incorporated in a matrix that could be metallic (CerMet target) or ceramic (CerCer target). One of the most promising matrix to incorporate Am is molybdenum. In order to address the issues (swelling, stability under irradiation, gas retention and release) of using Mo as matrix to transmute Am, two irradiation experiments have been conducted recently at the High Flux Reactor (HFR) in Petten (The Netherland) namely HELIOS and BODEX. The BODEX experiment is a separate effect test, where the molybdenum behaviour is studied without the presence of fission products using 10B to "produce" helium, the HELIOS experiment included a more representative fuel target with the presence of Am and fission product. This paper covers the results of Post Irradiation Examination (PIE) of the two irradiation experiments mentioned above where molybdenum behaviour has been deeply investigated as possible matrix to transmute americium (CerMet fuel target). The behaviour of molybdenum looks satisfying at operating temperature but at high temperature (above 1000 °C) more investigation should be performed.

  16. Consideration of the effect of lymph-node deposition upon the measurement of plutonium and americium in the lungs

    International Nuclear Information System (INIS)

    Measurement of an inhaled radionuclide by external photon counting includes quantities which may be contained in lymph nodes, as well as quantities in the lungs. An overestimate of the lung burden can result, if a portion of the radionuclide were present in the lymph nodes. This problem is analyzed with respect to the measurement of inhaled plutonium containing plutonium-241 and americium-241, when americium-241 has been used as a tracer for the plutonium. Equations are derived which yield the amounts of americium and of plutonium in the lungs and in the lymph nodes as a function of time after exposure and for various translocation and retention parameters. Count histories (count profiles) of actual exposure cases are compared with calculated count profiles in order to gain insight into possible values of the translocation and retention parameters. Comparison is also made with calculated count profiles using values of translocation and retention parameters recommended by the International Commission on Radiological Protection (ICRP) for use with the Task Group Lung Model. The magnitude of the possible overestimate (error factor) was calculated for combinations o

  17. HELIOS: the new design of the irradiation of U-free fuels for americium transmutation

    Energy Technology Data Exchange (ETDEWEB)

    D' Agata, E. [European Commission, Joint Research Centre, Institute for Energy, P.O. Box 2, 1755 ZG Petten (Netherlands); Klaassen, F.; Sciolla, C. [Nuclear Research and Consultancy Group, Dept. Life Cycle and Innovations, P.O. Box 25 1755 ZG Petten (Netherlands); Fernandez-Carretero, A. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Bonnerot, J.M. [Commissariat a l' Energie Atomique, DEC/SESC/LC2I CEA-Cadarache, 13108 St. Paul lez Durance Cedex (France)


    Americium is one of the radioactive elements that mostly contribute to the radiotoxicity of the nuclear spent fuel. Transmutation of long-lived nuclides like Americium is an option for the reduction of the mass, the radiotoxicity and the decay heat of nuclear waste. The HELIOS irradiation experiment is the last evolution in a series of experiments on americium transmutation. The previous experiments, EFTTRA-T4 and T4bis, have shown that the release or trapping of helium is the key issue for the design of such kind of target. In fact, the production of helium, which is characteristic of {sup 241}Am transmutation, is quite significant. The experiment is carried out in the framework of the 4-year project EUROTRANS of the EURATOM 6. Framework Programme (FP6). Therefore, the main objective of the HELIOS experiment is to study the in-pile behaviour of U-free fuels such as CerCer (Pu, Am, Zr)O{sub 2} and Am{sub 2}Zr{sub 2}O{sub 7}+MgO or CerMet (Pu, Am)O{sub 2}+Mo in order to gain knowledge on the role of the fuel microstructure and of the temperature on the gas release and on the fuel swelling. The experiment was planned to be conducted in the HFR (High Flux Reactor) in Petten (The Netherlands) starting the first quarter of 2007. Because of the innovative aspects of the fuel, the fabrication has had some delays as well as the final safety analyses of the original design showed some unexpected deviation. Besides, the HFR reactor has been unavailable since August 2008. Due to the reasons described above, the experiment has been postponed. HELIOS should start in the first quarter of 2009 and will last 300 full power days. The paper will cover the description of the new design of the irradiation experiment HELIOS. The experiment has been split in two parts (HELIOS1 and HELIOS2) which will be irradiated together. Moreover, due to the high temperature achieved in cladding and to the high amount of helium produced during transmutation the experiment previously designed for a

  18. Uptake of americium-241 by plants from contaminated Chernobyl exclusive zone test site soils

    International Nuclear Information System (INIS)

    Americium-241 was found to accumulate in soils and biological objects of the environment. Its concentration has increased many times after the Chernobyl disaster and can be expected to increase about 40 times in the future. This research concentrated on the contaminated exclusive Chernobyl zone polluted by trace radionuclides, their behavior and accumulation by various plant species. Special attention is devoted to the bioavailability of 241Am to the plants Galium rivale, G. tinctorium, G. aparine, G. intermedium, Berteroa incana, Artemisia absinthium, A. vulgaris, Centaurea borysthenica, C. arenaria, Cirsium arvense, Succissa pratensis, Solidago virgaurea, Linaria vulgaris, Lepidium ruderale, Stenactis annua, Veronica maxima, Verbascum lychnitis, Euphorbia cyparissias, Genista tinctoria, Erigeron canadensis, Oenothera biennis, Betula pendula and Quercus robur, which were collected from the Chernobyl, Kopachi, and Yanov districts. The plant samples of Oenothera biennis, Betula pendula and Quercus robur were collected from the Yanov district, where the soil contamination by 241Am and 137Cs was at the level of 660 and 27 MBq/m2, respectively. Gamma spectroscopy and radiochemical methods were used to estimate the activity concentration of 137Cs, 90Sr, 238Pu, 239+240Pu, 241Am. The radionuclides were measured in the dry green mass of the plant samples and in the dry soils. The contamination of the Oenothera biennis, Betula pendula and Quercus robur samples by 137Cs was (5.8±1,5)x106, (7.4±1.1)x105, and (2.6±0.2)x106 Bq/kg dry mass, respectively, and contamination by 241Am was 47±5, 45±3 and 3.2±0.2 Bq/kg, respectively. The soil-to-plant transfer ratio for 137Cs ranged lay within the interval of 0.2 to 0.03 Bq/kg : Bq/m2, the the transfer ratio for 241Am did not exceed 7x10-5 Bq/kg : Bq/m2. The coefficient of the relative contents of the 241Am/239+240Pu radionuclides in the various plant samples varied from 3.2 to 8.3, while for soil from the Yanov district this

  19. Anomalous aryl strengthening of complexes at americium and europium extraction with alkylenediphospine dioxide from perchloric media

    International Nuclear Information System (INIS)

    Studied was the extraction of americium(3) and europium(3) from perchlorate solutions(0.001 M) with dioxides of alkylenediphosphines of three types: aryl Ph2P(O)CH2(O)PPh2(briefly 4P), and Ph2P(O)(CH2)2(O)PPh2, mixed Ph2P(O)CH2(O)P(C8H17)2 (or 2Ph2Oct) and alkyl (C8H17)2P(O)CH2(O)P(C8H17)2 (or 4 Oct). Trisolvates of MeS3x(ClO4)3 are predominantly formed but americium disolvates are also present upon dilution with dichloroethane. For 4Ph,2Ph2Oct and 4 Oct the concentration is, respectively, 1015, 2x1014, and 1013; for disolvates by 4 orders of magnitude lower which is, nevertheless, by 2 orders of magnitude higher than for nitric acid solutions. The separation coefficient of β Am/Eu for 4Ph attains 6-8. As in the case of nitrate solutions, an anomalous aryl strengthening of the complexes is observed: an increase in the distribution coefficients and extraction constants in the series of 4 Oct - 2Ph 2 Oct - 4Ph, in spite of the introduction of electronegative aryl substituents into the dioxide molecule, which reduce electron density on oxygen atoms and basicity of dioxides. In contrast to nitric acid solutions, observed is a nonlinear effect of a change in basicity on extraction properties upon dilution with dichloroethane (dioxide of 2Ph2 Oct does not occupy an intermediate position but is close to 4Ph). Upon dilution with chloroform the dependence is linear and anomalous effect rises due to a different nature of interactions of dioxides with chloroform. When the bridge increases up to ethylene, an anomalous strengthening of the complexes disappears. However, the distribution coefficients upon extraction with alkyl dioxide are considerably lower, which can be explained by a stronger extraction of perchloric acid

  20. 48 CFR 235.015-70 - Special use allowances for research facilities acquired by educational institutions. (United States)


    ... research facilities acquired by educational institutions. 235.015-70 Section 235.015-70 Federal Acquisition... CONTRACTING RESEARCH AND DEVELOPMENT CONTRACTING 235.015-70 Special use allowances for research facilities acquired by educational institutions. (a) Definitions. As used in this subsection— (1) Research...

  1. 41 CFR 102-41.235 - May we sell forfeited drug paraphernalia? (United States)


    ... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false May we sell forfeited drug paraphernalia? 102-41.235 Section 102-41.235 Public Contracts and Property Management Federal... Requiring Special Handling Drug Paraphernalia § 102-41.235 May we sell forfeited drug paraphernalia? No,...

  2. Preliminary Study on the Determination of ~(235)U and ~(239)Pu Using Delayed Neutron Counting Method

    Institute of Scientific and Technical Information of China (English)


    The preliminary study on the fast measurements of 235U and 239Pu in samples containing 235U, 239Pu and 235U-239Pu mixture using delayed neutron counting method is introduced. All samples were irradiated for 30 s using the 30 kW Miniature Neutron

  3. 48 CFR 1852.235-74 - Additional Reports of Work-Research and Development. (United States)


    ...-Research and Development. 1852.235-74 Section 1852.235-74 Federal Acquisition Regulations System NATIONAL... Provisions and Clauses 1852.235-74 Additional Reports of Work—Research and Development. As prescribed in 1835.070(e), insert a clause substantially the same as the following: Additional Reports of...

  4. 22 CFR 23.5 - Claims for settlement by Department of State or General Accounting Office. (United States)


    ... General Accounting Office. 23.5 Section 23.5 Foreign Relations DEPARTMENT OF STATE FEES AND FUNDS FINANCE AND ACCOUNTING § 23.5 Claims for settlement by Department of State or General Accounting Office. Claims for settlement by the Department of State or by the General Accounting Office shall be...

  5. 16 CFR 23.5 - Misuse of the word “vermeil.” (United States)


    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Misuse of the word âvermeil.â 23.5 Section 23.5 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES FOR THE JEWELRY, PRECIOUS METALS, AND PEWTER INDUSTRIES § 23.5 Misuse of the word “vermeil.” (a) It is unfair...

  6. 24 CFR 235.331 - Increased maximum mortgage amount for physically handicapped persons. (United States)


    ... for physically handicapped persons. 235.331 Section 235.331 Housing and Urban Development Regulations... maximum mortgage amount for physically handicapped persons. If the mortgage relates to a dwelling unit to be occupied by a handicapped person as defined in § 235.5(c)(2), the otherwise applicable...

  7. 41 CFR 102-117.235 - How do I get a cost comparison? (United States)


    ... MANAGEMENT Shipping Household Goods § 102-117.235 How do I get a cost comparison? (a) You may calculate a cost comparison internally according to 41 CFR 302-8.3. (b) You may request GSA to perform the cost... comparison? 102-117.235 Section 102-117.235 Public Contracts and Property Management Federal...

  8. Composite delayed-neutron spectra from U-235

    International Nuclear Information System (INIS)

    Delayed-neutron spectra from thermal neutron-induced fission of U-235 have been measured over the neutron energy range, .01 - 2.0 MeV, for delay times following fission ranging from 0.17 - 85.5 s. A helium jet system was used for the rapid transport of fission products to a low-background area, where the spectra were determined from beta-neutron correlations using the neutron time-of-flight method

  9. Sistem Pakar Pada Perangkat Mobile Untuk Mendeteksi Kerusakan Docucenter 235


    Azhary, M. Fadli


    Development for mobile device is relieve to give efficient and faster information. Expert system is subdivision of artificial intelligence for solving in expert human problems. This study for implementation expert system working with backward chaining method that compatible for diagnose. In implementation, system giving user option “Yes” or “No” for answer some question. Those questions are pack based on technician experience and from guide book to solve troubleshooting for Docucenter 235. Th...

  10. Building 235-F Goldsim Fate And Transport Model

    International Nuclear Information System (INIS)

    Savannah River National Laboratory (SRNL) personnel, at the request of Area Completion Projects (ACP), evaluated In-Situ Disposal (ISD) alternatives that are under consideration for deactivation and decommissioning (D and D) of Building 235-F and the Building 294-2F Sand Filter. SRNL personnel developed and used a GoldSim fate and transport model, which is consistent with Musall 2012, to evaluate relative to groundwater protection, ISD alternatives that involve either source removal and/or the grouting of portions or all of 235-F. This evaluation was conducted through the development and use of a Building 235-F GoldSim fate and transport model. The model simulates contaminant release from four 235-F process areas and the 294-2F Sand Filter. In addition, it simulates the fate and transport through the vadose zone, the Upper Three Runs (UTR) aquifer, and the Upper Three Runs (UTR) creek. The model is designed as a stochastic model, and as such it can provide both deterministic and stochastic (probabilistic) results. The results show that the median radium activity concentrations exceed the 5 ρCi/L radium MCL at the edge of the building for all ISD alternatives after 10,000 years, except those with a sufficient amount of inventory removed. A very interesting result was that grouting was shown to basically have minimal effect on the radium activity concentration. During the first 1,000 years grouting may have some small positive benefit relative to radium, however after that it may have a slightly deleterious effect. The Pb-210 results, relative to its 0.06 ρCi/L PRG, are essentially identical to the radium results, but the Pb-210 results exhibit a lesser degree of exceedance. In summary, some level of inventory removal will be required to ensure that groundwater standards are met

  11. Building 235-F Goldsim Fate And Transport Model

    Energy Technology Data Exchange (ETDEWEB)

    Taylor, G. A.; Phifer, M. A.


    Savannah River National Laboratory (SRNL) personnel, at the request of Area Completion Projects (ACP), evaluated In-Situ Disposal (ISD) alternatives that are under consideration for deactivation and decommissioning (D&D) of Building 235-F and the Building 294-2F Sand Filter. SRNL personnel developed and used a GoldSim fate and transport model, which is consistent with Musall 2012, to evaluate relative to groundwater protection, ISD alternatives that involve either source removal and/or the grouting of portions or all of 235-F. This evaluation was conducted through the development and use of a Building 235-F GoldSim fate and transport model. The model simulates contaminant release from four 235-F process areas and the 294-2F Sand Filter. In addition, it simulates the fate and transport through the vadose zone, the Upper Three Runs (UTR) aquifer, and the Upper Three Runs (UTR) creek. The model is designed as a stochastic model, and as such it can provide both deterministic and stochastic (probabilistic) results. The results show that the median radium activity concentrations exceed the 5 ?Ci/L radium MCL at the edge of the building for all ISD alternatives after 10,000 years, except those with a sufficient amount of inventory removed. A very interesting result was that grouting was shown to basically have minimal effect on the radium activity concentration. During the first 1,000 years grouting may have some small positive benefit relative to radium, however after that it may have a slightly deleterious effect. The Pb-210 results, relative to its 0.06 ?Ci/L PRG, are essentially identical to the radium results, but the Pb-210 results exhibit a lesser degree of exceedance. In summary, some level of inventory removal will be required to ensure that groundwater standards are met.

  12. Overview of recent U235 neutron cross section evaluation work

    Energy Technology Data Exchange (ETDEWEB)

    Lubitz, C. [Lockheed Martin Corp., Schenectady, NY (United States)


    This report is an overview (through 1997) of the U235 neutron cross section evaluation work at Oak Ridge National Laboratory (ORNL), AEA Technology (Harwell) and Lockheed Martin Corp.-Schenectady (LMS), which has influenced, or appeared in, ENDF/B-VI through Release 5. The discussion is restricted to the thermal and resolved resonance regions, apart from some questions about the unresolved region which still need investigation. The important role which benchmark testing has played will be touched on.

  13. Activity of BKM120 and BEZ235 against Lymphoma Cells

    Directory of Open Access Journals (Sweden)

    Monica Civallero


    Full Text Available Non-Hodgkin lymphomas encompass a heterogeneous group of cancers, with 85–90% arising from B lymphocytes and the remainder deriving from T lymphocytes or NK lymphocytes. These tumors are molecularly and clinically heterogeneous, showing dramatically different responses and outcomes with standard therapies. Deregulated PI3K signaling is linked to oncogenesis and disease progression in hematologic malignancies and in a variety of solid tumors and apparently enhances resistance to antineoplastic therapy, resulting in a poor prognosis. Here, we have evaluated and compared the effects of the pan-PI3K inhibitor BKM120 and the dual PI3K/mTOR inhibitor BEZ235 on mantle, follicular, and T-cell lymphomas. Our results suggest that BKM120 and BEZ235 can effectively inhibit lymphoma cell proliferation by causing cell cycle arrest and can lead to cell death by inducing apoptosis and autophagy mediated by ROS accumulation. Despite great advances in lymphoma therapy after the introduction of monoclonal antibodies, many patients still die from disease progression. Therefore, novel treatment approaches are needed. BKM120 and BEZ235 alone and in combination are very effective against lymphoma cells in vitro. If further studies confirm their effectiveness in animal models, they may be promising candidates for development as new drugs.

  14. Calculation of resonance self-shielding in 235U

    International Nuclear Information System (INIS)

    The self-shielded fission rates for 235U measured by Czirr have been computed in the 0.464- to 464-eV range with the 235U resolved resonance parameters of the current version of ENDF/B-VI. The main purpose of describing the neutron cross sections of the fissile isotopes with resonance parameters is for the calculation of resonance self-shielding in reactors. Czirr has measured the relative self-shielded fission rate behind absorber thicknesses varying from 0.5 to 19 g/cm2 of uranium. These measurements have repeatedly been used to test the validity of sets of resonance parameters. However, previous calculations of these experiments were limited and inconclusive. An evaluation of the 235U resolved resonance region extending to 2.2 keV was recently completed and incorporated into ENDF/B-VI. The resonance parameters of this evaluation were used to compute the self-shielded fission rates for energy groups 0 to 8 (energies from 0.464 to 464 eV) of the Czirr measurement

  15. Ternary Fission of U235 by Resonance Neutrons

    International Nuclear Information System (INIS)

    Recently a number of papers have appeared indicating considerable variations in the ratio of the ternary-fission cross-section to the binary-fission cross-section of U235 on transition from one neutron resonance to another. However, such variations have not been discovered in U233 and Pu239. The paper reports investigations of the ternary fission of U235 by neutrons with an energy of 0.1 to 30 eV. Unlike other investigators of the ternary fission of U235 , we identified the ternary-fission event by the coincidence of one of the fission fragments with a light long-range particle. This made it passible to separate ternary fissions from the possible contribution of the (n, α)reaction. The measurements were performed at the fast pulsed reactor of the Joint Institute for Nuclear Research by the time-of-flight method. A flight length of 100 m was used, giving a resolution of 0.6 μs/m. Gas scintillation counters filled with xenon at a pressure of 2 atm were used to record the fission fragments and the light long-range particle. A layer of enriched U235 ∼2 mg/cm2 thick and ∼300 cm2 in area was applied to an aluminium foil 20-fim thick. The scintillations from the fission fragments were recorded in the gas volume on one side of the foil and those from the light long-range particles in that on the other. In order to assess the background (e.g . coincidences of the pulse from a fragment with that from a fission gamma quantum or a proton from the (n, p) reaction in the aluminium foil), a measurement was carried out in which the volume recording the long-range particle was shielded with a supplementary aluminium filter 1-mm thick. The results obtained indicate the absence of the considerable variations in the ratio between the ternary-and binary- fission cross-sections for U235 that have been noted by other authors. Measurements showed no irregularity in the ratio of the cross-sections in the energy range 0.1 to 0.2 eV. The paper discusses the possible effect of the (n,

  16. Different evolutionary stages in S235A-B (United States)

    Felli, Marcello; Massi, Fabrizio; Cesaroni, Riccardo

    The star forming region S235A-B has been studied at high resolution with radio (IRAM Interferometer and VLA) and infrared (JCMT and Spitzer) observations. The region was mapped in HCO^+, C^34S, H[2]CS, SO[2] and CH[3]CN as well as in the 1.2 and 3.3 continuum, in the cm continuum at 6, 3.6, 1.3 and 0.7 cm and in the 22 GHz water maser line, in the far infrared at 450 and 850 micron and in the mid infrared from 3.6 to 8 micron. Use was made of the Medicina water maser patrol, from 1987 to 2005, to study the maser variability. S235A is a classical HII region, well resolved and with a very good match between radio and infrared images. To the south of it, molecular and continuum mm observations as well as infrared observations reveal the presence of newly formed YSOs placed in between S235A and S235B: a molecular core and an unresolved mm source centred on one maser component, with indication of mass infall onto the core. Two bipolar outflows and a jet originate from the same position. No cm radio continuum emission is detected either from the compact molecular core or from the jet-like structure, suggesting emission from dust in both cases. Evidence is found for a molecular rotating disk perpendicular to the main bipolar outflow. The derived parameters indicate that the YSO is an intermediate luminosity object in a very early evolutionary phase. Its main source of energy could come from gravitational infall thus making this YSO a rare link between the earliest evolutionary phases of massive stars and low mass protostars of class 0-I. Two compact radio continuum sources (VLA-1 and VLA-2) and three separate maser spots were found. VLA-1 coincides with one of the maser spots and with an IR source (M1). VLA-2 lies towards S235B and represents the first radio detection from this peculiar nebula. The two other maser spots coincide with the rotating disk perpendicular to the bipolar molecular outflow. The Spitzer images reveal a red object towards the molecular core which is

  17. Americium and plutonium in water, biota, and sediment from the central Oregon coast

    International Nuclear Information System (INIS)

    Plutonium-239, 240 and americium-241 were measured in the mussel Mytilus californianus from the region of Coos Bay, OR. The flesh of this species has a plutonium concentration of about 90 fCi/kg, and an Am-241/Pu-239, 240 ratio that is high relative to mixed fallout, ranging between two and three. Transuranic concentrations in sediment, unfiltered water, and filterable particulates were also measured; none of these materials has an Am/Pu ratio as greatly elevated as the mussels, and there is no apparent difference in the Am/Pu ratio of terrestrial runoff and coastal water. Sediment core profiles do not allow accumulation rates or depositional histories to be identified, but it does not appear that material characterized by a high Am/Pu ratio has ever been introduced to this estuary. Other bivalves (Tresus capax and Macoma nasuta) and a polychaete (Abarenicola sp.) do not have an elevated Am/Pu ratio, although the absolute activity of plutonium in the infaunal bivalves is roughly four times that in the mussels

  18. Americium-based oxides: Dense pellet fabrication from co-converted oxalates

    Energy Technology Data Exchange (ETDEWEB)

    Horlait, Denis; Lebreton, Florent [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France); Gauthé, Aurélie [CEA, DEN, DRCP/SERA/LCAR, 30207 Bagnols-sur-Cèze (France); Caisso, Marie [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France); Arab-Chapelet, Bénédicte; Picart, Sébastien [CEA, DEN, DRCP/SERA/LCAR, 30207 Bagnols-sur-Cèze (France); Delahaye, Thibaud, E-mail: [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France)


    Mixed oxides are used as nuclear fuels and are notably envisaged for future fuel cycles including plutonium and minor actinide recycling. In this context, processes are being developed for the fabrication of uranium–americium mixed-oxide compounds for transmutation. The purpose of these processes is not only the compliance with fuel specifications in terms of density and homogeneity, but also the simplification of the process for its industrialization as well as lowering dust generation. In this paper, the use of a U{sub 0.85}Am{sub 0.15}O{sub 2±δ} powder synthesized by oxalate co-conversion as a precursor for dense fuel fabrications is assessed. This study notably focuses on sintering, which yielded pellets up to 96% of the theoretical density, taking advantage of the high reactivity and homogeneity of the powder. As-obtained pellets were further characterized to be compared to those obtained via processes based on the UMACS (Uranium Minor Actinide Conventional Sintering) process. This comparison highlights several advantages of co-converted powder as a precursor for simplified processes that generate little dust.

  19. Influence of organic additives on the colour reaction between trivalent americium and arsenazo III

    International Nuclear Information System (INIS)

    The colour reaction of Am(III) with arsenazo III in several hydroorganic media has been examined systematically on the addition of certain polar water-miscible organic solvents in the course of a search for improved and simple spectrophotometric methods for the estimation of americium. Addition of these substances resulted in the stabilization of colour and brought about a drastic enhancement in the absorbance values. The organic additives studied include acetone, acetonitrile, dimethylformamide, dioxane and ethanol. Among the many solvents tested, alcohol and dioxane proved to be the most effective, the highest sensitivity is obtained by using a 60% dioxane-ethanol (1:1) mixture. The apparent molar absorptivity based on Am content is 184616+-9931 mol-1 cm-1 at 655 nm which is about 3 times higher than that attained for the reaction in aqueous medium (65178+-1243). Moreover, this is the highest value reported as yet for its determination. Beer's law is obeyed both in mixed and aqueous media. The effects of some experimental variables on colour development have also been studied to optimize the conditions for the assay of Am. (author)

  20. Speciation and bioavailability of Americium-241 in the fresh water environment

    International Nuclear Information System (INIS)

    Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241Am in the freshwater environment aim to establish a relation between the behavior of 241Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241Am. Based on the registration of the 241Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241Am with some other metals (240Pu, 64Cu, 198Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241Am in organisms can be explained from its chemical characteristics

  1. Development and Testing of an Americium/Lanthanide Separation Flowsheet Using Sodium Bismuthate

    Energy Technology Data Exchange (ETDEWEB)

    Jack Law; Bruce Mincher; Troy Garn; Mitchell Greenhalgh; Nicholas Schmitt; Veronica Rutledge


    The separation of Am from the lanthanides and curium is a key step in proposed advanced fuel cycle scenarios. The partitioning and transmutation of Am is desirable to minimize the long-term heat load of material interred in a future high-level waste repository. A separation process amenable to process scale-up remains elusive. Given only subtle chemistry differences within and between the ions of the trivalent actinide and lanthanide series this separation is challenging ; however, higher oxidation states of americium can be prepared using sodium bismuthate and separated via solvent extraction using diamylamylphosphonate (DAAP) extraction. Among the other trivalent metals only Ce is also oxidized and extracted. Due to the long-term instability of Am(VI) , the loaded organic phase is readily selectively stripped to partition the actinide to a new acidic aqueous phase. Batch extraction distribution ratio measurements were used to design a flowsheet to accomplish this separation. Additionally, crossflow filtration was investigated as a method to filter the bismuthate solids from the feed solution prior to extraction. Results of the filtration studies, flowsheet development work and flowsheet performance testing using a centrifugal contactor are detailed.

  2. Determination of plutonium americium and curium in soil samples by solvent extraction with trioctylphosphine oxide

    International Nuclear Information System (INIS)

    A method of Pu, Am and Cm determination in soil samples, which was developed for analyzing samples from territories subjected to radioactive contamination as a result of the Chernobyl accident is described. After preliminary treatment the samples were leached by solution of 7 mol/l HNO23+0.3 mol/l KBrO3 during heating. Pu was isolated by extraction with 0.05 mol TOPO from 7 mol/l HNO3. 144Ce and partially remaining in water phase isotopes of Zr, U and Th were isolated in an extraction-chromatographic column with TOPO and PbO2. Then Am and Cm were extracted by 0.2 mol/l TOPO from solution 1 mol/l HLact+0.07 mol/l DTPA+1 mol/l Al(NO3)3. Alpha-activity of both extracted products was determined in liquid scintillation counter. Chemical yield of plutonium counted to 85±10%, that of americium and curium -75±10%. 17 refs

  3. Assessment of radiation doses from residential smoke detectors that contain americium-241

    International Nuclear Information System (INIS)

    External dose equivalents and internal dose commitments were estimated for individuals and populations from annual distribution, use, and disposal of 10 million ionization chamber smoke detectors that contain 110 kBq (3 μCi) americium-241 each. Under exposure scenarios developed for normal distribution, use, and disposal using the best available information, annual external dose equivalents to average individuals were estimated to range from 4 fSv (0.4 prem) to 20 nSv (2 μrem) for total body and from 7 fSv to 40 nSv for bone. Internal dose commitments to individuals under post disposal scenarios were estimated to range from 0.006 to 80 μSv (0.0006 to 8 mrem) to total body and from 0.06 to 800 μSv to bone. The total collective dose (the sum of external dose equivalents and 50-year internal dose commitments) for all individuals involved with distribution, use, or disposal of 10 million smoke detectors was estimated

  4. NMR Evidence for the 8.5 K Phase Transition in Americium Dioxide (United States)

    Tokunaga, Yo; Nishi, Tsuyoshi; Kambe, Shinsaku; Nakada, Masami; Itoh, Akinori; Homma, Yoshiya; Sakai, Hironori; Chudo, Hiroyuki


    We report here the first NMR study of americium dioxide (AmO2). More than 30 years ago, a phase transition was suggested to occur in this compound at 8.5 K based on magnetic susceptibility data, while no evidence had been obtained from microscopic measurements. We have prepared a powder sample of 243AmO2 containing 90 at. % 17O and have performed 17O NMR at temperatures ranging from 1.5 to 200 K. After a sudden drop of the 17O NMR signal intensity below 8.5 K, at 1.5 K we have observed an extremely broad spectrum covering a range of ˜14 kOe in applied field. These data provide the first microscopic evidence for a phase transition as a bulk property in this system. In addition, the 17O NMR spectrum has been found to split into two peaks in the paramagnetic state, an effect which has not been reported for actinide dioxides studied up to now. We suggest that the splitting is induced by self-radiation damage from the alpha decay of 243Am.

  5. Study of biosorbents application on the treatment of radioactive liquid wastes with americium-241

    International Nuclear Information System (INIS)

    The use of nuclear energy for many different purposes has been intensified and highlighted by the benefits that it provides. Medical diagnosis and therapy, agriculture, industry and electricity generation are examples of its application. However, nuclear energy generates radioactive wastes that require suitable treatment ensuring life and environmental safety. Biosorption and bioaccumulation represent an emergent alternative for the treatment of radioactive liquid wastes, providing volume reduction and physical state change. This work aimed to study biosorbents for the treatment of radioactive liquid wastes contaminated with americium-241 in order to reduce the volume and change the physical state from liquid to solid. The biosorbents evaluated were Saccharomyces cerevisiae immobilized in calcium alginate beads, inactivated and free cells of Saccharomyces cerevisiae, calcium alginate beads, Bacillus subtilis, Cupriavidus metallidurans and Ochrobactrum anthropi. The results were quite satisfactory, achieving 100% in some cases. The technique presented in this work may be useful and viable for implementing at the Waste Management Laboratory of IPEN - CNEN/SP in short term, since it is an easy and low cost method. (author)

  6. In Vitro Dissolution Tests of Plutonium and Americium Containing Contamination Originating From ZPPR Fuel Plates

    Energy Technology Data Exchange (ETDEWEB)

    William F. Bauer; Brian K. Schuetz; Gary M. Huestis; Thomas B. Lints; Brian K. Harris; R. Duane Ball; Gracy Elias


    Assessing the extent of internal dose is of concern whenever workers are exposed to airborne radionuclides or other contaminants. Internal dose determinations depend upon a reasonable estimate of the expected biological half-life of the contaminants in the respiratory tract. One issue with refractory elements is determining the dissolution rate of the element. Actinides such as plutonium (Pu) and Americium (Am) tend to be very refractory and can have biological half-lives of tens of years. In the event of an exposure, the dissolution rates of the radionuclides of interest needs to be assessed in order to assign the proper internal dose estimates. During the November 2011 incident at the Idaho National Laboratory (INL) involving a ZPPR fuel plate, air filters in a constant air monitor (CAM) and a giraffe filter apparatus captured airborne particulate matter. These filters were used in dissolution rate experiments to determine the apparent dissolution half-life of Pu and Am in simulated biological fluids. This report describes these experiments and the results. The dissolution rates were found to follow a three term exponential decay equation. Differences were noted depending upon the nature of the biological fluid simulant. Overall, greater than 95% of the Pu and 93% of the Am were in a very slow dissolving component with dissolution half-lives of over 10 years.

  7. Solution speciation of plutonium and Americium at an Australian legacy radioactive waste disposal site. (United States)

    Ikeda-Ohno, Atsushi; Harrison, Jennifer J; Thiruvoth, Sangeeth; Wilsher, Kerry; Wong, Henri K Y; Johansen, Mathew P; Waite, T David; Payne, Timothy E


    During the 1960s, radioactive waste containing small amounts of plutonium (Pu) and americium (Am) was disposed in shallow trenches at the Little Forest Burial Ground (LFBG), located near the southern suburbs of Sydney, Australia. Because of periodic saturation and overflowing of the former disposal trenches, Pu and Am have been transferred from the buried wastes into the surrounding surface soils. The presence of readily detected amounts of Pu and Am in the trench waters provides a unique opportunity to study their aqueous speciation under environmentally relevant conditions. This study aims to comprehensively investigate the chemical speciation of Pu and Am in the trench water by combining fluoride coprecipitation, solvent extraction, particle size fractionation, and thermochemical modeling. The predominant oxidation states of dissolved Pu and Am species were found to be Pu(IV) and Am(III), and large proportions of both actinides (Pu, 97.7%; Am, 86.8%) were associated with mobile colloids in the submicron size range. On the basis of this information, possible management options are assessed. PMID:25126837

  8. Comparative study of plutonium and americium bioaccumulation from two marine sediments contaminated in the natural environment

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, T.F.; Smith, J.D. (Melbourne Univ., Parkville (Australia). Dept. of Inorganic Chemistry); Fowler, S.W.; LaRosa, J.; Holm, E. (International Atomic Energy Agency, Monaco-Ville (Monaco). Lab. of Marine Radioactivity); Aarkrog, A.; Dahlgaard, H. (Risoe National Lab., Roskilde (Denmark))


    Plutonium and americium sediment-animal transfer was studied under controlled laboratory conditions by exposure of the benthic polychaete Nereis diversicolor (O. F. Mueller) to marine sediments contaminated by a nuclear bomb accident (near Thule, Greenland) and nuclear weapons testing (Enewetak Atoll). In both sediment regimes, the bioavailability of plutonium and {sup 241}Am was low, with specific activity in the tissues <1% (dry wt) than in the sediments. Over the first three months, a slight preference in transfer of plutonium over {sup 241}Am occurred and {sup 241}Am uptake from the Thule sediment was enhanced compared to that from lagoon sediments of Enewetak Atoll. Autoradiography studies indicated the presence of hot particles of plutonium in the sediments. The results highlight the importance of purging animals of their gut contents in order to obtain accurate estimates of transuranic transfer from ingested sediments into tissue. It is further suggested that enhanced transuranic uptake by some benthic species could arise from ingestion of highly activity particles and organic-rich detritus present in the sediments. (author).

  9. Evaluation of 235U(n,f) above 100 keV for ENDF/B-V and the implications of a unified 235U mass scale

    International Nuclear Information System (INIS)

    A previously reported evaluation of 235U(n,f) in the fast neutron energy range was updated to include data published up to the 1978 Harwell Conference on Neutron Physics. The shape of the cross section resulting from this evaluation and a normalization factor extracted from data provided within the framework of this evaluation were used by the Subcommittee on Standards and Normalizations of the Cross Section Evaluation Working Group to establish 235U(n,f) for ENDF/B-V above 100 keV. The 235U sample mass comparisons made between different laboratories were compiled in order to investigate the implications of different sample masses on recent 235U(n,f) data. A new intercomparison of several such samples was carried out using absolute and relative alpha-counting and relative fast neutron fission counting. The result of this work is a unified 235U mass scale with an uncertainty of 0.6%. 39 references

  10. Use of radioisotopes in the study of tetracycline analytical application. Extraction of compounds formed between tetracycline and neptunium and americium elements

    International Nuclear Information System (INIS)

    The behavior of tetracycline as complexing agent, in solvent extraction studies of neptunium and americium, using benzyl alcohol as the organic phase, is presented. By using radioactive tracers of 239Np and 241Am the extraction percent of these elements were determined as a function of pH in the absence and in the presence of several masking agents. The influence of shaking time and the use of different types of supporting eletrolytes upon the extraction behavior was also studied. The extraction curves obtained using EDTA as masking agent show that tetracycline can be used for neptunium and americium separation. In this condition neptunium is extracted into the organic phase and americium remains in the aqueous phase. (Author)

  11. Sorption of plutonium and americium on repository, backfill and geological materials relevant to the JNFL low-level radioactive waste repository at Rokkasho-Mura

    International Nuclear Information System (INIS)

    An integrated program of batch sorption experiments and mathematical modeling has been carried out to study the sorption of plutonium and americium on a series of repository, backfill and geological materials relevant to the JNFL low-level radioactive waste repository at Rokkasho-Mura. The sorption of plutonium and americium on samples of concrete, mortar, sand/bentonite, tuff, sandstone and cover soil has been investigated. In addition, specimens of bitumen, cation and anion exchange resins, and polyester were chemically degraded. The resulting degradation product solutions, alongside solutions of humic and isosaccharinic acids were used to study the effects on plutonium sorption onto concrete, sand/bentonite and sandstone. The sorption behavior of plutonium and americium has been modeled using the geochemical speciation program HARPHRQ in conjunction with the HATCHES database

  12. Biosorption of Americium-242 by saccharomyces cerevisiae: preliminary evaluation and mechanism

    International Nuclear Information System (INIS)

    As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high radiation toxicity and long half-life. In this experiment, the biosorption of 241Am from solution by a fungus, Saccharomyces cerevisiae (S. cerevisiae), and the effects of various experimental conditions on the biosorption and the mechanism were explored. The preliminary results showed that S. cerevisiae is a very efficient biosorbent. An average of more than 99% of the total 241Am could be removed by S. cerevisiae of 2.1g/L (dry weight) from 241Am solutions of 2.22MBq/L -555 MBq/L (Co). The adsorption equilibrium was achieved within 1 hour and the optimum pH ranged 1-3. The culture times of more than 16 hours were suitable and the efficient adsorption of 241Am by the S. cerevisiae could be noted. The biosorption of 241Am by the decomposed cell wall, protoplasm or cell membrane of S. cerevisiae was same efficient as by the intact fungus, but the some components of S. cerevisiae, such as protein and acylation group had obvious effect on adsorption. When the concentrations of coexistent Eu3+, Nd3+ were 100 times more than that of 241Am, the adsorption rates would drop to 65%. However, most of the investigated acidic ions have no significant influence on the 241Am adsorption but minute change of pH value, while the saturated EDTA can strong inhibit the biosorption of 241Am.. (authors)

  13. Some elements for a revision of the americium reference biokinetic model

    International Nuclear Information System (INIS)

    The interpretation of individual activity measurement after a contamination by 241Am or its parent nuclide 241Pu is based on the reference americium (Am) biokinetic model published by the International Commission on Radiological Protection in 1993 [International Commission on Radiological Protection. Age-dependent doses to members of the public from intake of radionuclides: Part 2 Ingestion dose coefficients. ICRP Publication 67. Ann. ICRP 23(3/4) (1993)]. The authors analysed the new data about Am biokinetics reported afterwards to propose an update of the current model. The most interesting results, from the United States Transuranium and Uranium Registries post-mortem measurement database [Filipy, R. E. and Russel, J. J. The United States Transuranium and Uranium Registries as sources for actinide dosimetry and bio-effects. Radiat. Prot. Dosim. 105(1-4), 185-187 (2003)] and the long-term follow-up of cases of inhalation intake [Malatova, I., Foltanova, S., Beckova, V., Filgas, R., Pospisilova, H. and Hoelgye, Z. Assessment of occupational doses from internal contamination with 241Am. Radiat. Prot. Dosim. 105(1-4), 325-328 (2003)], seemed to show that the current model underestimates the retention in the massive soft tissues and overestimates the retention in the skeleton and the late urinary excretion. However, a critical review of the data demonstrated that all were not equally reliable and suggested that only a slight revision of the model, possibly involving a change in the balance of activity between massive soft tissues, cortical and trabecular bone surfaces, may be required. (authors)

  14. The treatment of liquid radioactive waste containing Americium by using a cation exchange method

    International Nuclear Information System (INIS)

    A research in the treatment of a liquid radioactive waste containing americium has been done. The liquid radioactive waste used in this research was standard solution of U dan Ce with the initial activity of 100 ppm. The experimental investigation is aimed at a study of the effects of the waste pH, the column dimension of IR-120 cation exchanger which is expressed as L/D, the flow rate of a liquid waste and the influence of thiocyanate as a complex agent against the efficiency of a decontamination for uranium and cerium element. The experiment was done by passing downward the feed of uranium and cerium solution into an IR-120 type of cation exchanger with the L/D of 11.37. From the experimental parameters done in this research where the influence of waste pH was varied from 3 - 8, the geometric column (L/D) 11.37, the liquid flow rate was from 2.5 - 10 ml/m and the thiocyanate concentration was between 100 ppm-500 ppm can be concluded that the optimum operational condition for the ion exchange achieved were the waste pH for uranium = 4 and the waste pH for cerium = 6, the flow rate = 2.5 ml/men. From the given maximum value of DF for uranium = 24 (DE = 95.83%) and of DF for cerium = 40 (DE = 97.5%), it can also be concluded that this investigation is to be continued in order that the greater value of DF/DE can be achieved

  15. A study of plutonium and americium concentrations in seaspray on the southern Scottish coast

    International Nuclear Information System (INIS)

    Seaspray and seawater have been collected from the southern Scottish coast and, for comparison, Cumbria in northwest England during 1989 and 1991. The occurrence of sea-to-land transfer of the actinides plutonium and americium in seaspray was observed on these coasts using muslin screens (a semi-quantitative technique most efficient for collecting large spray droplets) and high volume conventional air samplers. The actinides and fine particulate in the spray were present in relatively higher concentrations than measured in the adjacent seawater, i.e. the spray was enriched in particulate actinides. The net efficiency of the muslim screens in collecting airborne plutonium isotopes and 241Am generally appeared to be about 20%. A review of earlier published concentrations of 239+240Pu and 241Am measured in aerosol and deposition for over a year several tens of metres inland was carried out. This suggested that airborne activities are up to a factor of 5 times higher in Cumbria than southern Scotland. However, neither the new data collected in 1989 and 1991 nor this older data suggests any enhancement of seaspray actinide enrichment in southern Scotland compared to Cumbria. This finding contrasts with earlier, more limited, comparisons that have been carried out which suggested such a difference. There is clear evidence of considerable localised spatial and temporal variability in aerosol actinide enrichment over the beaches in both areas. Enrichments varies between 20 and 500 relative to the adjacent surf zone waters. However, the average enrichment in spray based on the continuous measurements made further inland is likely to be at the lower end of this range. (author)

  16. Reduction of. systematic error of In-vivo measurement of americium 241 activity in the skull

    International Nuclear Information System (INIS)

    Excretion analysis and in vivo measuring methods are used for estimation of internal contamination by 241Am. In vivo measurements of the lung are suitable in short time after time of intake when the way of the intake is inhalation. In vivo measurements of the activity in the liver or in the skeleton could be performed at a later time. Detection of radionuclide activity in the liver is quite difficult because it is necessary to distinguish liver activity from the activity of surrounding tissues i.e. lung and skeleton. The skull or knees are the most suitable., for activity assessment in the skeleton. The skull is the most appropriate for measurements because it represents about 15% of total skeleton mass and contributions to measured activity of surrounding tissues are small. Americium activity in the skull could be measured with different instrumentation and in various geometries. Setting of two semiconductors detectors placed 3 cm over temporal region of the skull is used in NRPI. Calibration of the system was done by several head phantoms, in this process was observed that detection efficiencies depend on size of the phantoms. The aim of the paper is to express character of the efficiency as function of the size of skull in order to obtain more accurate value of the activity and decrees its uncertainty. Simulations of head by simplified geometric shapes, i.e. spheres and rotary ellipsoids, is in coherence with phantoms of big size (UCIN, BPAM-0001), but for small phantoms occurred quite serious discrepancy. Activity of real cases determined by calibration with phantom BPAM-0001 (reference phantom) is reduced from 9 to 44 %, when eq. 2 is used and relative uncertainty is reduced from 32% to maximum 12%. (authors)

  17. Transport of plutonium, americium, and curium from soils into plants by roots

    International Nuclear Information System (INIS)

    For assessing the dose from radionuclides in agricultural products by ingestion it is necessary to know the soil to plant transfer factors. The literature was entirely investigated, in order to judge the size of the soil to plant transfer factors. In total, 92 publications - from 1948 to 1978 -have been evaluated. As result, transfer factors from 10-9 to 10-3 have been found for Plutonium, and from 10-6 to 1 for Americium. For Curium only few data are available in literature. The considerable variation of the measured transfer factors is based on the dependence of these transfer factors from the ion exchange capacity of soils, from the amount of organic materials, from the pH-value, and from the mode of contamination. There are, in any case, contradictory data, although there has been detected a dependence of the transfer factors from these parameters. Chelating agenst increase the transfer factors to approximately 1300. As well, fertilizers have an influence on the size of the transfer factors - however, the relationships have been scarcely investigated. The distribution of actinides within the individual parts of plants has been investigated. The highest concentrations are in the roots; in the plant parts above ground the concentration of actinides decreases considerably. The most inferior transfer factors were measured for the respective seed or fruits. The soil to plant transfer factors of actinides are more dependend on the age of the plants within one growing period. At the beginning of the period, the transfer factor is considerably higher than at the end of this period. With respect to plants with a growing period of several years, correlations are unknown. (orig.)

  18. Inert matrices, uranium-free plutonium fuels and americium targets. Synthesis of CAPRA, SPIN and EFTTRA studies

    International Nuclear Information System (INIS)

    A first selection of inert-matrix materials, actinide support alone (Pu and Am based), and compound materials, U free plutonium burning fuels and heterogeneous americium targets are discussed. Basic properties, fabrication, and reprocessing studies, European in-pile and out-of-pile tests, performed recently in the framework of CAPRA, SPIN and EFTTRA programs, are reviewed here. Taking into account these studies and on the bases of the different requirements to be met in each of the fuels and targets, a number of materials have been selected as 'promising candidates'. Trends for further research on these materials are established. (author)

  19. Final Report on the Demonstration of Disposal of Americium and Curium Legacy Material Through the High Level Waste System

    International Nuclear Information System (INIS)

    This report provides the results of experimental demonstrations related to processing of a legacy solution containing americium and curium through the High Level Waste (HLW) system. The testing included eight experiments covering the baseline, mitigation, and enhanced nitrate processing studies. In general, each experiment studied the mixtures generated over a period of time to emulate the lifecycle of actual sludge in the High Level Waste system. While the data in previous reports remain valid, this report supercedes all the previous reports and provides a collective overview of the work

  20. Effect of a long-term release of plutonium and americium into an estuarine and coastal sea ecosystem

    International Nuclear Information System (INIS)

    This paper discusses the general problem of speciation of plutonium and americium in aquatic ecosystems and the implications relative to their fate in those systems. The following conclusions were reached: several oxidation states of plutonium coexist in the natural environment; the effect of environmental changes such as pH and Esub(h) values and complexes are probably the cause of these various oxidation states; a clearer definition of the 'concentration factor' should be given in view of the important role the sediments play in supplying plutonium for transfer through the food web. (author)

  1. Microstructure and elemental distribution of americium-containing MOX fuel under the short-term irradiation tests

    International Nuclear Information System (INIS)

    In order to investigate the effect of americium addition to MOX fuels on the irradiation behavior, the 'Am-1' program is being conducted in JAEA. The Am-1 program consists of two short-term irradiation tests of 10-minute and 24-hour irradiations and a steady-state irradiation test. The short-term irradiation tests were successfully completed and the post irradiation examinations (PIEs) are in progress. The PIEs for Am-containing MOX fuels focused on the microstructural evolution and redistribution behavior of Am at the initial stage of irradiation and the results to date are reported. (author)

  2. Neutron induced fission of 235sub(U)

    International Nuclear Information System (INIS)

    In order to achieve a better understanding of the fision process it is essential to get experimental data on the details of the mass, energy and angular distributions, and the mass versus energy and mass versus angular distribution correlations as function of excitation energy. The present work describes the result of such a measurement for 235U(n,f) with thermal 235U(n,f) reaction has a rather high cross section, especially for thermal neutrons. The changes in the average total kinetic energy relative to the thermal value have been measured at several neutron energies above thermal, and the angular anisotropy of the fission fragments averaged over all fragment masses has been determined in several measurements. Many of the thermal values, the average kinetic energy and average angular anisotropy values at higher neutron energies were compared with measurements using other techniques. Good agreement is found. It indicates that the chamber works as intended and it gives confidence to the data measured for the first time with the present setup. It furthermore allows to use the chamber with confidence in future measurements on less known fission reactions and at less explored excitation energies of the compound nucleus. (author)

  3. Resonance structure in the fission of (235U+n)

    International Nuclear Information System (INIS)

    A new multilevel reduced R-matrix analysis of the neutron-induced resonance cross sections of 235U has been carried out. We used as a constraint in the analysis the angular anisotropy measurements of Pattenden and Postma, obtaining a Bohr-channel (or J, K channel) representation of the resonances in a two-fission vector space for each spin state. Hambsch et al., have reported definitive measurements of the mass- and kinetic-energy distributions of fission fragments of (235U+n) in the resonance region and analyzed their results according to the fission-channel representation of Brosa et al., extracting relative contributions of the two asymmetric and one symmetric Brosa fission channels. We have explored the connection between Bohr-channel and asymmetric Brosa-channel representations. The results suggest that a simple rotation of coordinates in channel space may be the only transformation required; the multilevel fit to the total and partial cross sections is invariant to such a transformation. (orig.)

  4. Development of a methodology for the determination of americium and thorium by ICP-AES and their inter-element effect

    International Nuclear Information System (INIS)

    Due to the scarcity of good quality uranium resources, the growth of nuclear technology in India is dependent on the utilization of the vast thorium resources. Therefore, Advance Heavy Water Reactor is going to acquire significant role in the scenario of Indian nuclear technology, where (Th, Pu)O2 will be utilized as fuel in the outermost ring of the reactor core. This will lead to a complex matrix containing thorium as well as americium, which is formed due to β-decay of plutonium. The amount of americium is dependent on the burn up and the storage time of the Pu based fuels. In the present case, attempt was made to develop a method for the determination of americium as well as thorium by ICP-AES. Two emission lines of americium were identified and calibration curves were established for determination of americium. Though the detection limit of 283.236 nm line (5 ng mL-1) of americium was found to be better than that of 408.930 nm (11 ng mL-1), the former line is significantly interfered by large amount of thorium. Three analytical lines (i.e. 283.242, 283.730 and 401.913 nm) of thorium were identified and calibration curves were established along with their detection limits. It was observed that 283.242 and 401.913 nm line are having similar detection limits (18 and 13 ng mL-1, respectively) which are better than that of 283.730 nm (60 ng mL-1). This can be attributed to the high background of 283.273 nm channel of thorium. The spectral interference study revealed that even small amount of americium has significant contribution on 283.242 nm channel of thorium while the other two channels remain practically unaffected. Considering both these facts, spectral interference and analytical performance (detection limits and sensitivity), it was concluded that 401.913 nm line is the best analytical line out of the three lines for determination of thorium in presence of americium. (author)

  5. 238UF6 and 235UF6 spectra measurement in mid IR spectral range

    International Nuclear Information System (INIS)

    Making use of a diode laser one measured the absorption spectra of 238UF6 and 235UF6 molecules within v1+v3 combined oscillation band at λ=7.68 μm wavelength. To determine the possibility to measure 235UF6/ 238UF6 isotope ratio with the required accuracy one measured the absorption factors of 235UF6 and 238UF6 isotope specimens and determined the sources of the errors and the ways to minimize them

  6. Effect of radiolysis on leachability of plutonium and americium from 76-101 glass. [Glass containing 2 mole % plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Nash, K.L.; Fried, S.; Friedman, A.M.; Susak, N.; Rickert, P.; Sullivan, J.C.; Karim, D.P.; Lam, D.J.


    One aspect of the leachability of actinide-bearing glass which has not been adequately addressed is the effect of radiolysis of the system (glass-water) on the amount of actinides liberated from the glass. In the present study, we have investigated the leaching of plutonium and americium from 76-101 glass samples (containing 2 mole % plutonium) in the presence of a one megaRad/hour gamma-radiation field. The presence of the radiation field was found to increase the leaching rate of both plutonium and americium by a factor of five. Speciation studies of the plutonium in the leachate indicate that the plutonium is present predominantly in the higher oxidation states, Pu(V) and Pu(VI) and that it is significantly associated with colloidal particles. Examination of the glass surfaces with x-ray photoemission spectroscopy, XPS, both before and after leaching was carried out; these studies showed lower surface concentrations of plutonium in the samples of glass leached in the radiation field. 1 figure, 3 tables.

  7. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  8. Plutonium and americium in Arctic waters, the North Sea and Scottish and Irish coastal zones (in Fucus, Mytilus and Patella)

    International Nuclear Information System (INIS)

    Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were collected from the Irish coast in 1983. Fallout is found to dominate as a source of 239+240Pu north of latitude 650N, while for 238Pu a substantial fraction originates from European nuclear fuel reprocessing facilities. The 238Pu/239+240Pu isotope ratio provides clear evidence of the transport of effluent plutonium from the latter to Spitsbergen waters. Fallout plutonium in Arctic waters has a residence time of the order of several years, while for Pu from Sellafield we estimate mean residence times of 11-15 months in Scottish waters and, tentatively, 1.5-3 y during transport from the North Channel (north of the Irish Sea) to Spitsbergen. 241Am found in Arctic waters probably originates from the decay of fallout 241Pu and, like Pu, tentatively has a residence time of the order of several years. Americium from Sellafield has an estimated mean residence time of 4-6 months in Scottish waters. (author)

  9. 235U Holdup Measurement Program in support of facility shutdown

    International Nuclear Information System (INIS)

    In 1989, the Department of Energy directed shutdown of an enriched uranium processing facility at Savannah River Site. As part of the shutdown requirements, deinventory and cleanout of process equipment and nondestructive measurement of the remaining 235U holdup were required. The holdup measurements had safeguards, accountability, and nuclear criticality safety significance; therefore, a technically defensible and well-documented holdup measurement program was needed. Appropriate standards were fabricated, measurement techniques were selected, and an aggressive schedule was followed. Early in the program, offsite experts reviewed the measurement program, and their recommendations were adopted. Contact and far-field methods were used for most measurements, but some process equipment required special attention. All holdup measurements were documented, and each report was subjected to internal peer review. Some measured values were checked against values obtained by other methods; agreement was generally good

  10. Isotopic analysis of uranium hexafluoride highly enriched in U-235

    International Nuclear Information System (INIS)

    Isotopic analysis of uranium in the form of the hexafluoride by mass-spectrometry gives gross results which are not very accurate. Using a linear interpolation method applied to two standards it is possible to correct for this inaccuracy as long as the isotopic concentrations are less than about 10 per cent in U-235. Above this level, the interpolations formula overestimates the results, especially if the enrichment of the analyzed samples is higher than 1.3 with respect to the standards. A formula is proposed for correcting the interpolation equation and for the extending its field of application to high values of the enrichment (≅2) and of the concentration. It is shown that by using this correction the results obtained have an accuracy which depends practically only on that of the standards, taking into account the dispersion in the measurements. (authors)

  11. Combined procedure using radiochemical separation of plutonium, americium and uranium radionuclides for alpha-spectrometry

    International Nuclear Information System (INIS)

    Radiochemical separation of Pu, Am and U was tested from synthetic solutions and evaporator concentrate samples from nuclear power plants for isolation of each of them for alpha-spectrometry analysis. The separation was performed by anion-exchange chromatography, extraction chromatography, using TRU resin, and precipitation techniques. The aim of the study was to develop a sensitive analytical procedure for the sequential determination of 242Pu, 238Pu, 239+240Pu, 241Am and 235,238U in radioactive wastes. 238Pu, 242Pu, 243Am and 232U were used as tracers. The measurements of α emitting radionuclides were performed by semiconductor detector that is used especially when spectrometric information is needed. For synthetic solutions the chemical recovery was based on associated iron concentration and was about 93%. (author)

  12. Experimental Study on Behavior of Americium in Pyrochemical Process of Nitride Fuel Cycle

    International Nuclear Information System (INIS)

    R and D on the transmutation of long-lived minor actinides (MA) by the accelerator-driven system (ADS) using nitride fuels is underway at JAEA. In regard to reprocessing technology, pyrochemical process has several advantages in case of treating spent fuel with large decay heat and fast neutron emission, and recovering highly enriched N-15. In the pyrochemical reprocessing, plutonium and MA are dissolved in LiCl-KCl eutectic melts and selectively recovered into liquid cadmium (Cd) cathode by molten salt electrorefining. The electrochemical behavior in LiCl-KCl eutectic melts and the subsequent nitride formation behavior of plutonium and MA recovered in liquid Cd cathode are investigated. In this paper, recent results on electrochemical study of americium (Am) on electrolyses of AmN in LiCl-KCl eutectic melts and nitride formation of Am recovered in the liquid Cd cathode are presented. Electrochemical behavior of Am on anodic dissolution of AmN and recovery of Am into a liquid Cd cathode by electrolyses in LiCl-KCl eutectic melts was investigated by transient electrochemical techniques. The formal standard potential of Am(III)/Am(0) obtained with the liquid Cd electrode is more positive than that calculated for the solid metal electrode. The potential shift is considered to be attributed to the lowering of the activity of Am by the formation of the intermetallic compound with Cd. Potentiostatic electrolyses of AmN in LiCl-KCl eutectic melts containing AmCl3 at 773 K were carried out. Nitrogen gas generated by the anodic dissolution of AmN was observed, and the current efficiency was obtained from the ratio of the amount of released nitrogen gas and the passed electric charge to be 20 - 28 %. Am was recovered as Am-Cd alloy in the liquid Cd cathode, in which AmCd6 type phase was identified besides Cd phase. The recovered Am was converted to AmN by the nitridation-distillation combined method, in which the Am-Cd alloy was heated in nitrogen gas stream at 973 K. These

  13. Uranium-235 and childhood leukaemia around Greenham Common airfield

    International Nuclear Information System (INIS)

    There has been considerable publicity recently concerning the possible release of enriched uranium from the Greenham Common USAF base near Newbury in Berkshire. Evidence for the release relies on an internal report of the Atomic Weapons Research Establishment at Aldermaston, the authors of which postulated that it resulted from a fire in 1958 involving a B47 bomber standing on the runway. Their report contained a much publicised contour map of excess 235U levels estimated from the ratio of 235U to 238U in 26 evergreen leaf samples examined. The current concern of the inhabitants of Newbury centres mostly on the incidence of leukaemia, which was known beforehand to be slightly elevated in parts of West Berkshire, at least for young children. A number of cases have received considerable press publicity, with suggestions that their homes are located close to the base or the flight-path. The reports are, however, anecdotal and are not based on a complete register of cases. We have examined the evidence for this putative association by re-analysing the uranium data and determining the spatial relationship to the base of cases of childhood leukaemia diagnosed in the years 1966-87. We conclude that, although the excess uranium found has a non-random distribution, it does not support the pattern depicted by the contours and bears no relation to the incidence of childhood leukaemia for the period we examined. In any case, the increase in level of environmental radiation as a result of the putative release must be very small and is at variance with the reporting in some of the national press. (author)

  14. Adolescent idiopathic scoliosis: Retrospective analysis of 235 surgically treated cases

    Directory of Open Access Journals (Sweden)

    Unnikrishnan Ranjith


    Full Text Available Background : The surgical treatment of adolescent idiopathic scoliosis (AIS has taken great strides in the last two decades. There have been no long term reported studies on AIS from India with documented long term followup. In this study we review a single surgical team′s series of 235 surgically treated cases of AIS with a follow-up from two to six years. Materials and Methods : Pre operative charts, radiographs and MRI scans for 235 patients were collected for this study. The patients were grouped into three groups where anterior correction and fusion (n=47, posterior correction and fusion (n=123 and combined anterior release and posterior instrumentation (n=65 was performed. Each group was divided into two subgroups based on the surgical approach and instrumentation strategy (all screw construct or hybrid construct used. Patients were followed up for coronal and saggital plane corrections, apical vertebral translation (AVT, trunk balance and back pain. The percentage of correction was calculated in each group as well as sub groups. Results : The incidence of MRI detected intraspinal anomaly in this series is 5.9% with 3.4% of them requiring neurosurgical procedure along with scoliosis correction. Average coronal major curve correction was 66% in the all screw group and 58.5% in the hybrid group. The coronal plane correction was better when the all screw constructs were employed. Also, the AVT and trunk balance was better with the all screw constructs. The anterior corrections resulted in better correction of the AVT and trunk balance as compared to the posterior correction. There were eight (3.4% complications in this series. The coronal and saggital plane correction paralleled the published international standards. Conclusion : The coronal plane correction was better when all screw constructs were employed. Use of all pedicle screw systems obviated the need for costoplasty in most cases. The increased incidence of intraspinal anomaly may

  15. Preconcentration of low levels of americium and plutonium from waste waters by synthetic water-soluble metal-binding polymers with ultrafiltration

    International Nuclear Information System (INIS)

    A preconcentration approach to assist in the measurement of low levels of americium and plutonium in waste waters has been developed based on the concept of using water-soluble metal-binding polymers in combination with ultrafiltration. The method has been optimized to give over 90% recovery and accountability from actual waste water. (author)

  16. 40 CFR 80.235 - How does a refiner obtain approval as a small refiner? (United States)


    ... 40 Protection of Environment 16 2010-07-01 2010-07-01 false How does a refiner obtain approval as a small refiner? 80.235 Section 80.235 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...) The small refiner status application must contain the following information for the company...

  17. Dispersion of the Neutron Emission in U{sup 235} Fission (United States)

    Feynman, R. P.; de Hoffmann, F.; Serber, R.


    Equations are developed which allow the calculation of the average number of neutrons per U{sup235} fission from experimental measurements. Experimental methods are described, the results of which give a value of (7.8 + 0.6){sup ½} neutrons per U{sup 235} thermal fission.

  18. 24 CFR 990.235 - PHAs that will experience a subsidy increase. (United States)


    ... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false PHAs that will experience a subsidy increase. 990.235 Section 990.235 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued) OFFICE OF ASSISTANT SECRETARY FOR PUBLIC AND INDIAN HOUSING, DEPARTMENT OF HOUSING AND URBAN DEVELOPMENT THE...

  19. Determination of 235U/238U Ratio on Urine by ICP-MS

    International Nuclear Information System (INIS)

    LLNL Internal Dosimetry Program - The new procedure satisfies the requirement to determine 235U/238U ratio in bioassay urine samples. MDA - The LC and MDA95 for 235U are well below the required detection limit of 0.00035 μg/L. Turn around time - Analysis of 10 samples plus 2 QCs can be completed in one work day (8 hours).

  20. 40 CFR 52.235 - Control strategy for ozone: Oxides of nitrogen. (United States)


    ... nitrogen. 52.235 Section 52.235 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... for ozone: Oxides of nitrogen. EPA is approving an exemption request submitted by the Monterey Bay... the area from implementing the oxides of nitrogen (NOX) requirements for reasonably available...

  1. 15 CFR 23.5 - Report to the Office of Juvenile Justice and Delinquency Prevention. (United States)


    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Report to the Office of Juvenile Justice and Delinquency Prevention. 23.5 Section 23.5 Commerce and Foreign Trade Office of the Secretary... Office of Juvenile Justice and Delinquency Prevention. The Department of Commerce will compile and...

  2. R-matrix analyses of the 235U and 239Pu neutron cross sections

    International Nuclear Information System (INIS)

    The resonance parameter analysis code SAMMY was used to perform consistent resonance analyses of several 235U and 239Pu fission and capture cross section and transmission measurements up to 110 eV for 235U and up to 1 keV for 239Pu. The method of analysis, the measurement selection and the results are briefly outlined in this paper

  3. 46 CFR 10.235 - Suspension or revocation of merchant mariner credentials. (United States)


    ... 46 Shipping 1 2010-10-01 2010-10-01 false Suspension or revocation of merchant mariner credentials. 10.235 Section 10.235 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner Credentials §...

  4. Chemical behaviour of trivalent and pentavalent americium in saline NaCl-solutions. Studies of transferability of laboratory data to natural conditions. Interim report. Reported period: 1.2.1993-31.12.1993; Chemisches Verhalten von drei- und fuenfwertigem Americium in Salinen NaCl-Loesungen. Untersuchung der Uebertragbarkeit von Labordaten auf natuerliche Verhaeltnisse. Zwischenbericht. Berichtszeitraum 1.2.1993-31.12.1993

    Energy Technology Data Exchange (ETDEWEB)

    Runde, W.; Kim, J.I.


    In order to clarify the chemical behaviour of Americium in saline aqueous systems relevant for final storage this study deals with the chemical reactions of trivalent and pentavalent Americium in NaCl-solutions under the influence of radiolysis from its own alpha radiation. The focus of the study was on investigating the geologically relevant reactions, such as hydrolysis or carbonate- and chloride complexing in solid-liquid equilibriums. Comprehensive measurements on solubility and spectroscopic studies in NaCl-solutions were carried out in a CO{sub 2}-free atmosphere and 10{sup -2} atm CO{sub 2} partial pressure. Identification and characterisation of the AM (III) and AM(V) solid phases were supplemented by structural research with the chemically analogue EU (III) and Np(V) compounds. The alpha-radiation induced radiolysis in saline NaCl solutions and the redox behaviour of Americium which was influenced thereby were spectroscopically quantified. (orig.) [Deutsch] Zur Klaerung des chemischen Verhaltens von Americium in endlagerrelevanten salinen aquatischen Systemen befasst sich die vorliegende Arbeit mit den chemischen Reaktionen des drei- und fuenfwertigen Americiums in NaCl-Loesungen unter dem Einfluss der Radiolyse durch die eigene {alpha}-Strahlung. Der Schwerpunkt dieser Arbeit lag auf der Untersuchung der geologisch relevanten Reaktionen, wie Hydrolyse sowie Carbonat- und Chloridkomplexierung in fest-fluessig Gleichgewichtssystemen. Hierzu wurden umfassende Loeslichkeitsmessungen und spektroskopische Untersuchungen in NaCl-Loesungen, sowohl unter CO{sub 2}-freier Atmosphaere als auch unter 10{sup -2} atm CO{sub 2}-Partialdruck, durchgefuehrt. Die Identifizierung und Charakterisierung der Am(III)- und Am(V)-Festphasen wurde ergaenzt durch strukturelle Untersuchungen mit den chemisch analogen Eu(III)- und Np(V)-Verbindungen. Die von der {alpha}-Strahlung induzierte Radiolyse in salinen NaCl-Loesungen und das dadurch beeinflusste Redoxverhalten von Americium

  5. Influence of an alkoxy group on bis-triazinyl-pyridines for selective extraction of americium(III)

    International Nuclear Information System (INIS)

    The extraction of americium(III), curium(III), and lanthanides(III) from nitric acid by 2,6-bis-(5,6-dimethyl-[1,2,4]-triazin-3-yl)-pyridine and 2,6-bis-(5,6-dimethyl-[1,2,4]-triazin- 3-yl)-4-methoxy-pyridine was studied. The physico-chemical properties of these ligands, such as the protonation and complexation constants, were also determined to describe the influence of different substituent groups. The selectivity of substituted-BTP was confirmed both in complexation and in solvent extraction experiments. The presence of an alkoxy-group in position 4 of the pyridine decreases the BTP selectivity. Influence of a long alkyl chain on protonation and complexation constants was also studied with 2,6-bis-(5,6-dimethyl-[1,2,4]- triazin-3-yl)-4-dodecyloxy-pyridine. (authors)

  6. Solvent extraction of europium and americium into phenyltrifluoromethyl sulfone by using synergistic mixture of hydrogen dicarbollylcobaltate and 'classical' CMPO

    International Nuclear Information System (INIS)

    Extraction of microamounts of europium and americium by a phenyltrifluoromethyl sulfone (FS 13) solution of hydrogen dicarbollylcobaltate (H+B-) in the presence of octyl-phenyl-N,N-diisobutylcarbamoylmethyl phosphine oxide ('classical' CMPO, L) has been investigated. The equilibrium data have been explained assuming that the complexes HL+, HL2+, ML23+, ML33+ and ML43+ (M3+ Eu3+, Am3+) are extracted into the organic phase. The values of extraction and stability constants of the cationic complex species in FS 13 saturated with water have been determined. It was found that the stability constants of the corresponding complexes EuLn3+ and AmLn3+, where n 2, 3, 4 and L is 'classical' CMPO, in water-saturated FS 13 are comparable. (author)

  7. Recovery, purification and concentration of plutonium and americium from the aqueous wastes discharged in the reprocessing process studies

    International Nuclear Information System (INIS)

    For recovering and purifying plutonium and americium from the aqueous wastes occurring in the process studies on reprocessing, a standard procedure has been established for use in the laboratory works, through the preliminary tests of the precipitation as hydroxides and the anion exchange in nitrate media. The procedure was proven in the treatment of actual wastes, of which the results were contributed to determine the process conditions in the plutonium purification and product concentration of the JAERI Reprocessing Test Plant. The preliminary tests also include washing of U and Am recovery from the anion-exchanger in nitrate media, direct ion-exchange recovery of Pu from the TBP phase and elution of Am from the cation-exchanger. (auth.)

  8. Plutonium and americium in fish, shellfish and seaweed in the Irish environment and their contribution to dose

    International Nuclear Information System (INIS)

    Plutonium and americium activity concentrations in fish and shellfish landed in Ireland in the period 1988 to 1997 are presented. Activity concentrations in fish are low and often below detection limits, while those in mussels and oysters sampled on the northeast coast show no significant signs of decline. The estimated doses to hypothetical typical and heavy seafood consumers remain below 1 μSv yr-1 (committed effective dose).Plutonium activity concentrations measured in Fucus vesiculosus around the Irish coastline have not fallen appreciably in the ten year period between 1986 and 1996. Furthermore, the mean 238Pu/239,240Pu ratio of 0.17±0.05 in Fucus vesiculosus from the west coast of Ireland demonstrates the increasing significance of Sellafield-derived plutonium in those waters. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  9. The bone volume effect on the dosimetry of plutonium-239 and americium-241 in the skeleton of man and baboon

    International Nuclear Information System (INIS)

    Studies were undertaken using bone removed from young adult baboons, which had been contaminated with plutonium-239 at various times prior to sacrifice, and human bone from adult male (USTR Case 246), who had received an internal deposition of americium-241 as a result of a glove-box explosion 11 years prior to his death. The baboon bone was supplied by the CEA, France, and the human bone by the United States Transuranium registry. The bone samples, examined by qualitative and quantitative autoradiography with CR 39 detectors, demonstrated the rapid redistribution of bone surface-seeking radionuclides in younger primates due to growth and the slower, bone turnover driven redistribution in the adult human bone. In both species, primary and secondary surface deposits of radionuclide remained conspicious despite bone activity; true volumization of radionuclide was seldom seen. The dosimetric implications of these findings are discussed. (author) 21 refs.; 6 figs.; 4 tabs

  10. 235例院前急救分析

    Institute of Scientific and Technical Information of China (English)




  11. Simulated (n,f) cross section of isomeric 235m-U

    International Nuclear Information System (INIS)

    The neutron-induced fission cross section on the 235U, T1/2 ∼ 26 min isomer has been deduced for incident neutron energies in the range En=0.1-2.5 MeV, using the surrogate-reaction technique. In this technique, 236U fission probabilities measured in the 234U(t, pf) reaction have been converted into 235U(n,f) and 235mU(n,f) cross sections, using reaction theory to compensate for the differences in angular-momentum and parity distributions in the fissioning systems, transferred by the (t,p) and neutron-induced reactions. Based on the comparison between the 235U(n,f) cross section extracted in this work and independent experimental data, the deduced 235mU(n,f) cross section is believed to be reliable to 20% below En ∼ 0.5 MeV and 10% at higher energies. The surrogate-reaction technique, its validation in the case of the 235U(n,f) cross section, and the deduced 235mU(n,f) cross section are discussed. Validation of this method allows (n,f) cross sections for many short-lived nuclei, as well as isomeric nuclei, to be extracted from measured fission probabilities

  12. 21 CFR 2.35 - Use of secondhand containers for the shipment or storage of food and animal feed. (United States)


    ... storage of food and animal feed. 2.35 Section 2.35 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT... Foods § 2.35 Use of secondhand containers for the shipment or storage of food and animal feed. (a... State public health agencies have revealed practices whereby food and animal feed stored or shipped...

  13. DM235 (sunifiram): a novel nootropic with potential as a cognitive enhancer


    Ghelardini C; Galeotti N.; Gualtieri F.; Romanelli M; Bucherelli C.; Baldi E.; Bartolini A.


    DM235 (sunifiram), a new compound structurally related to piracetam, prevented the amnesia induced by scopolamine (1.5 mg kg–1 i.p.), after intraperitoneal (0.001–0.1 mg kg–1) or oral (0.01–0.1 mg kg–1) administration, as shown by a passive avoidance test in mice. The antiamnesic effect of DM235 was comparable to that of well-known nootropic drugs such as piracetam (30–100 mg kg–1 i.p.), aniracetam (100 mg kg–1 p.o.) or rolipram (30 mg kg–1 p.o.). DM235 also prevented mecamylamine (20 mg kg–1...

  14. Prompt-Neutron Emission from U235 Fission Fragments

    International Nuclear Information System (INIS)

    A gadolinium-loaded large liquid scintillation counter is being used in conjunction with a neutron beam from the HERALD reactor at the Atomic Weapons Research Establishment, Aldermaston, to study neutron emission in the fission process. In particular, the neutron emission from individual fission fragments is observed. A fission-fragment detector comprising two gold-silicon suríace barrier counters operating in coincidence is situated at the edge of a 1-m-diam. spherical scintillation tank. The solid-state counters are placed on opposite sides of an evaporated fissile deposit on a thin nickel backing. A system of collimators selects for measurement only those fission events that have fragments travelling in the direction along the incident neutron beam and along the axis of the scintillator. Numbers of neutrons detected within 10 ps of a fission event are recorded. The angular correlation of neutron emission with fragment direction is used to associate the neutrons with the particular fission fragment that emitted them. Energies of both fragments are available from the solid-state counters, and identification of fragment mass and of the total kinetic energy of the fragment pair is made. The number of neutrons emitted by each fragment of the pair has been measured as a function of both the fragment mass and the total kinetic energy of the pair for thermal neutrons incident on U2'35. The usual asymmetry in the distribution of excitation energy between the heavy and light fragments is observed. The variation of the number of neutrons from the pair as a function of mass ratio is also determined. (author)

  15. U-235 sample-mass determinations and intercomparisons

    International Nuclear Information System (INIS)

    The neutron-induced fission cross section of U-235 is not only one of the most-frequently used references but is also of direct importance in reactor applications. As a consequence, knowledge of this cross section is required with approx. 1% uncertainty as reflected in corresponding entries in request lists, which have persisted since the last 10 to 15 years. Measurements to that level of accuracy require the investigation of the contributing components, one of which is the fission mass. The latter is most often determined by others than the experimenter who measures the differential cross sections or integral reaction-rate ratios in a reactor test facility. The isotopic composition and the sample mass are usually obtained from associated chemistry departments or standard laboratories, however, the experimenter has still the responsibility to assure that the values he uses are adequately described by the quoted uncertainties. This can be achieved by comparing samples from different origins. It was in this spirit that an intercomparison of fission samples obtained from different US laboratories, which were involved in cross section measurements, was carried out in 1979. The notable outcome of this effort was that a bias of approx. 0.7% was found between the standard laboratory and other contributing laboratories (which was, however, within the stated uncertainty). The National Bureau of Standards (NBS) has since then worked on a redefinition of the mass assignments of its reference samples, has revised its mass scale by 0.8%, and has reduced its uncertainty by a factor of two (to about +-0.5%). However, this new mass scale includes values relative to others. In the present work these have been removed in order to compare mass scales as independent from one another as possible. Independence already appears hard to come by. Results are presented

  16. Targeted disruption of py235ebp-1: Invasion of erythrocytes by Plasmodium yoelii using an alternative py235 erythrocyte binding protein

    KAUST Repository

    Ogun, Solabomi A.


    Plasmodium yoelii YM asexual blood stage parasites express multiple members of the py235 gene family, part of the super-family of genes including those coding for Plasmodium vivax reticulocyte binding proteins and Plasmodium falciparum RH proteins. We previously identified a Py235 erythrocyte binding protein (Py235EBP-1, encoded by the PY01365 gene) that is recognized by protective mAb 25.77. Proteins recognized by a second protective mAb 25.37 have been identified by mass spectrometry and are encoded by two genes, PY01185 and PY05995/PY03534. We deleted the PY01365 gene and examined the phenotype. The expression of the members of the py235 family in both the WT and gene deletion parasites was measured by quantitative RT-PCR and RNA-Seq. py235ebp-1 expression was undetectable in the knockout parasite, but transcription of other members of the family was essentially unaffected. The knockout parasites continued to react with mAb 25.77; and the 25.77-binding proteins in these parasites were the PY01185 and PY05995/PY03534 products. The PY01185 product was also identified as erythrocyte binding. There was no clear change in erythrocyte invasion profile suggesting that the PY01185 gene product (designated PY235EBP-2) is able to fulfill the role of EBP-1 by serving as an invasion ligand although the molecular details of its interaction with erythrocytes have not been examined. The PY01365, PY01185, and PY05995/PY03534 genes are part of a distinct subset of the py235 family. In P. falciparum, the RH protein genes are under epigenetic control and expression correlates with binding to distinct erythrocyte receptors and specific invasion pathways, whereas in P. yoelii YM all the genes are expressed and deletion of one does not result in upregulation of another. We propose that simultaneous expression of multiple Py235 ligands enables invasion of a wide range of host erythrocytes even in the presence of antibodies to one or more of the proteins and that this functional

  17. Comparative XRPD and XAS study of the impact of the synthesis process on the electronic and structural environments of uranium-americium mixed oxides (United States)

    Prieur, D.; Lebreton, F.; Martin, P. M.; Caisso, M.; Butzbach, R.; Somers, J.; Delahaye, T.


    Uranium-americium mixed oxides are potential compounds to reduce americium inventory in nuclear waste via a partitioning and transmutation strategy. A thorough assessment of the oxygen-to-metal ratio is paramount in such materials as it determines the important underlying electronic structure and phase relations, affecting both thermal conductivity of the material and its interaction with the cladding and coolant. In 2011, various XAS experiments on U1-xAmxO2±δ samples prepared by different synthesis methods have reported contradictory results on the charge distribution of U and Am. This work alleviates this discrepancy. The XAS results confirm that, independently of the synthesis process, the reductive sintering of U1-xAmxO2±δ leads to the formation of similar fluorite solid solution indicating the presence of Am+III and U+V in equimolar proportions.

  18. Stability of penta- and hexavalent americium in the solutions of sodium peroxydisulfate and sodium bromate at intensive internal α-irradiation

    International Nuclear Information System (INIS)

    The spectrometric method has been used for studying the dependence of the rates of radiolytic reduction of Am(5) and (6) on the initial concentration of sodium persulfate and bromate, Am(5) and (6), acidity, and the dose rate of inner alpha-irradiation of the solutions. The high dose rates of inner alpha-irradiation of solutions (up to 3.25x1021 eV/lxmin-250Ci/l) have been attained with the aid of curium isotopes. The stability of americium (6) ions towards the action of ionizing radiation in solutions of sodium persulfate and bromate has been shown to be considerable lower than that of americium (5). The chemical difference has been shown in radiolytic behaviour between Am(5) and Am(6) ions in solutions of sodium persulfate and bromate. The equations have been derived showing the dependence of the rates of Am(6) and Am(5) reduction of different variables

  19. Inhibition of proliferation in bone tumor cells after irradiation by 235U, 147Pm, 153Sm

    International Nuclear Information System (INIS)

    The inhibition of proliferation in bone tumor cells after simple or mixed irradiation by 235U, 147Pm, 153Sm was studied. Experimental results indicated that proliferation of bone tumor cells was significantly inhibited at 12 h∼24 h after a simple irradiation by 235U (128.4 Bq), 147Pm (7.4 x 105 Bq), and 153Sm (7.4 x 105 Bq) as well as mixed irradiation by 235U + 147Pm (64.2 Bq + 3.7 x 105 Bq), 235U + 153Sm (64.2 Bq + 3.7 x 105 Bq), 147Pm + 153Sm (3.7 x 105 Bq + 3.7 x 105 Bq). The findings show that the inhibition rate with mixed irradiation was more than that with simple irradiation

  20. Study of correcting the effect of daughter age on determining 235U enrichment of fuel rods

    International Nuclear Information System (INIS)

    Gamma-ray passive technique is a very effective method to assay and determine 235U enrichment of nuclear power plant fuel rods. There is a weakness in this passive method, i.e. only after the uranium isotope daughters of UO2 pellets have reached to equilibrium with uranium parent, then the 235U enrichment can be determined. This weakness greatly restricts the application of the method. A new two-peak and two-window technique is developed that can overcome the interference of uranium daughter decay in determining 235U enrichment of nuclear fuel rods, and the results are very satisfactory. The new technique will play an important role in the gamma-ray passive technique for determining 235U enrichment of fuel rods. This new technique also makes the gamma-ray passive method perfectly. (11 figs., 6 tabs.)

  1. 77 FR 26737 - Foreign-Trade Zone 235-Lakewood, NJ: Notification of Proposed Production Activity; Cosmetic... (United States)


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF COMMERCE Foreign-Trade Zones Board Foreign-Trade Zone 235--Lakewood, NJ: Notification of Proposed Production Activity; Cosmetic Essence Innovations, LLC (Fragrance Bottling); Holmdel, NJ Cosmetic Essence...

  2. A Density Functional Study of Atomic Hydrogen and Oxygen Chemisorption on the Relaxed (0001) Surface of Double Hexagonal Close Packed Americium


    Dholabhai, P. P.; Atta-Fynn, R.; A.K. Ray


    Ab initio total energy calculations within the framework of density functional theory have been performed for atomic hydrogen and oxygen chemisorption on the (0001) surface of double hexagonal packed americium using a full-potential all-electron linearized augmented plane wave plus local orbitals method. Chemisorption energies were optimized with respect to the distance of the adatom from the relaxed surface for three adsorption sites, namely top, bridge, and hollow hcp sites, the adlayer str...

  3. Distribution, retention and dosimetry of plutonium and americium in the rat, dog and monkey after inhalation of an industrial-mixed uranium and plutonium oxide aerosol

    International Nuclear Information System (INIS)

    This study provides information on patterns of radiation dose in laboratory animals after inhalation exposure to an aerosol of one form of mixed uranium and plutonium oxide. The aerosol contained a mixture of UO2 and 750 deg C heat-treated PuO2 obtained from the ball milling operation in a mixed-oxide fuel fabrication process. Americium-241 from the decay of 241Pu was also present in the PuO2 matrix. Fischer-344 rats, Beagle dogs, and Cynomolgus and Rhesus monkeys inhaled aerosols re-generated from dry mixed oxide powders with particle size distribution characteristics similar to those observed in samples collected at the industrial site. Clearance from the lung and distribution in other tissues of the plutonium from this UO2 + PuO2 admixture was similar to what has been observed for PuO2 from laboratory-produced aerosols. The UO2-PuO2 aerosol was relatively insoluble in the lungs of all species. Monkeys and rats cleared plutonium and americium from their lungs faster than dogs. Very little plutonium or americium translocated within the first 2 yr after exposure to tissues other than tracheobronchial lymph nodes. The greater accumulation of plutonium and americium in the tracheobronchial lymph nodes of dogs as compared to monkeys and rats combined with the more rapid initial clearance of these radionuclides from the lungs of rats and monkeys suggests that errors could result from using data from a single animal species to estimate risk to humans from inhalation of these industrial aerosols. (author)

  4. Experimental study of Americium-241 biokinetics in Homarus Gammarus lobster. Analysis of the accumulation and detoxication mechanisms at the sub-cellular level

    International Nuclear Information System (INIS)

    The Americium 241 radioelement accumulation and elimination rate and mechanisms in the lobster organism have been experimentally studied; incorporation and detoxification capacities of each organ are evaluated. The existence of various biological compartments is shown; the major role of the digestive gland in accumulation of the radioelement, its distribution towards the various organs, and its resorption is comprehensively described, with an analysis at the subcellular and molecular levels. 401 p., 65 fig., 43 tab., 428 ref

  5. Determination of 235U/238U Ratio on Urine by ICP-MS

    Energy Technology Data Exchange (ETDEWEB)

    Collins, L; Gobaleza, A; Langston, R; Radev, R; Than, C; Wong, C; Wood-Zika, A


    LLNL Internal Dosimetry Program - The new procedure satisfies the requirement to determine {sup 235}U/{sup 238}U ratio in bioassay urine samples. MDA - The L{sub C} and MDA{sub 95} for {sup 235}U are well below the required detection limit of 0.00035 {mu}g/L. Turn around time - Analysis of 10 samples plus 2 QCs can be completed in one work day (8 hours).

  6. Comparative XRPD and XAS study of the impact of the synthesis process on the electronic and structural environments of uranium–americium mixed oxides

    Energy Technology Data Exchange (ETDEWEB)

    Prieur, D., E-mail: [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, D-76125 Karlsruhe (Germany); Lebreton, F. [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze cedex (France); Martin, P.M. [CEA, DEN, DEC/SESC/LLCC, 13108 Saint-Paul-Lez-Durance cedex (France); Caisso, M. [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze cedex (France); Butzbach, R. [Helmholtz Zentrum Dresden Rossendorf (HZDR), Institute of Radiochemistry, P.O. Box 10119, 01314 Dresden (Germany); Somers, J. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, D-76125 Karlsruhe (Germany); Delahaye, T. [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze cedex (France)


    Uranium–americium mixed oxides are potential compounds to reduce americium inventory in nuclear waste via a partitioning and transmutation strategy. A thorough assessment of the oxygen-to-metal ratio is paramount in such materials as it determines the important underlying electronic structure and phase relations, affecting both thermal conductivity of the material and its interaction with the cladding and coolant. In 2011, various XAS experiments on U{sub 1−x}Am{sub x}O{sub 2±δ} samples prepared by different synthesis methods have reported contradictory results on the charge distribution of U and Am. This work alleviates this discrepancy. The XAS results confirm that, independently of the synthesis process, the reductive sintering of U{sub 1−x}Am{sub x}O{sub 2±δ} leads to the formation of similar fluorite solid solution indicating the presence of Am{sup +III} and U{sup +V} in equimolar proportions. - Graphical abstract: Formation of (U{sup IV/V},Am{sup III})O{sup 2} solid solution by sol–gel and by powder metallurgy. - Highlights: • Uranium–americium mixed oxides were synthesized by sol–gel and powder metallurgy. • Fluorite solid solutions with similar local environment have been obtained. • U{sup V} and Am{sup III} are formed in equimolar proportions.

  7. An experimental study of americium-241 biokinetics in the Lobster Homarus Gammarus. Analysis of the accumulation/storage and detoxification processes at the subcellular level

    International Nuclear Information System (INIS)

    An experimental study of americium-241 kinetics has been conducted in the lobster Homarus gammmarus. The investigations were conducted at all the levels from the whole body to the subcellular and molecular levels. The animals were contaminated by a single or chronic ingestion of 241 Am labelled mussels. Assessments of accumulation, elimination and distribution of the radionuclide were established on organisms kept in the laboratory; they made it possible to demonstrate the importance of the digestive gland in the radionuclide transfer pathways. The preliminary results led to structural then ultrastructural investigations of the digestive gland in association with radioautographic studies and cellular extractions methods. Four cellular types were demonstrated, only two of them being implied in the radionuclide retention, the former being responsible for americium intake and the latter for its long-term retention. By means of biochemical techniques, subcellular accumulation was studied and the organelles implied in the nuclide retention were specified. Finally, a method of cellular nuclei dissociation was developed; it made it possible to analyse the molecular nature of americium ligands and to demonstrate the function of the protein nuclear matrix in the nuclide retention

  8. A new method for the determination of plutonium and americium using high pressure microwave digestion and alpha-spectrometry or ICP-SMS

    International Nuclear Information System (INIS)

    Plutonium and americium are radionuclides particularly difficult to measure in environmental samples because they are a-emitters and therefore necessitate a careful separation before any measurement, either using radiometric methods or ICP-SMS. Recent developments in extraction chromatography resins such as EichromR TRU and TEVA have resolved many of the analytical problems but drawbacks such as low recovery and spectral interferences still occasionally occur. Here, we report on the use of the new EichromR DGA resin in association with TEVA resin and high pressure microwave acid leaching for the sequential determination of plutonium and americium in environmental samples. The method results in average recoveries of 83 ± 15% for plutonium and 73 ± 22% for americium (n = 60), and a less than 10% deviation from reference values of four IAEA reference materials and three samples from intercomparisons exercises. The method is also suitable for measuring 239Pu in water samples at the μBq/l level, if ICP-SMS is used for the measurement. (author)

  9. Comparative XRPD and XAS study of the impact of the synthesis process on the electronic and structural environments of uranium–americium mixed oxides

    International Nuclear Information System (INIS)

    Uranium–americium mixed oxides are potential compounds to reduce americium inventory in nuclear waste via a partitioning and transmutation strategy. A thorough assessment of the oxygen-to-metal ratio is paramount in such materials as it determines the important underlying electronic structure and phase relations, affecting both thermal conductivity of the material and its interaction with the cladding and coolant. In 2011, various XAS experiments on U1−xAmxO2±δ samples prepared by different synthesis methods have reported contradictory results on the charge distribution of U and Am. This work alleviates this discrepancy. The XAS results confirm that, independently of the synthesis process, the reductive sintering of U1−xAmxO2±δ leads to the formation of similar fluorite solid solution indicating the presence of Am+III and U+V in equimolar proportions. - Graphical abstract: Formation of (UIV/V,AmIII)O2 solid solution by sol–gel and by powder metallurgy. - Highlights: • Uranium–americium mixed oxides were synthesized by sol–gel and powder metallurgy. • Fluorite solid solutions with similar local environment have been obtained. • UV and AmIII are formed in equimolar proportions

  10. Verification of 235U enrichment in SNM receipts at the DOE Feed Materials Production Center

    International Nuclear Information System (INIS)

    A diversity of uranium-bearing, nonirradiated materials with 235U assays from fully depleted to a maximum of 10 wt % 235U, is routinely returned to this DOE site for reprocessing. It is necessary to confirm the 235U isotopic content of Special Nuclear Material (SNM) receipts both for accountability and nuclear criticality safety purposed. Methods and instrumentation have been developed for an isotopic verification facility by which 235U isotopic content is rapidly and nondestructively determined. The 185 keV gamma photon emitted by 235U is measured using a dual-channel gamma spectrometer which incorporates automatic background subtraction and an optimized collimator/NaI(Tl) detector assembly. Measured activities are then related to 235U isotopic content by means of appropriate standards that have been destructively analyzed in the laboratory. Use of the described facility for the past seven years has resulted in improved nuclear safety procedures, better use of storage space and more stringent nuclear materials accountability

  11. Preliminary results from uranium/americium affinity studies under experimental conditions for cesium removal from NPP ''Kozloduy'' simulated wastes solutions

    International Nuclear Information System (INIS)

    We use the approach described by Westinghouse Savannah River Company using ammonium molybdophosphate (AMP) to remove elevated concentrations of radioactive cesium to facilitate handling waste samples from NPP Kozloduy. Preliminary series of tests were carried out to determine the exact conditions for sufficient cesium removal from five simulated waste solutions with concentrations of compounds, whose complexing power complicates any subsequent processing. Simulated wastes solutions contain high concentrations of nitrates, borates, H2C2O4, ethylenediaminetetraacetate (EDTA) and Citric acid, according to the composition of the real waste from the NPP. On this basis a laboratory treatment protocol was created. This experiment is a preparation for the analysis of real waste samples. In this sense the results are preliminary. Unwanted removal of non-cesium radioactive species from simulated waste solutions was studied with gamma spectrometry with the aim to find a compromise between on the one hand the AMP effectiveness and on the other hand unwanted affinity to AMP of Uranium and Americium. Success for the treatment protocol is defined by proving minimal uptake of U and Am, while at the same time demonstrating good removal effectiveness through the use of AMP. Uptake of U and Am were determined as influenced by oxidizing agents at nitric acid concentrations, proposed by Savannah River National laboratory. It was found that AMP does not significantly remove U and Am when concentration of oxidizing agents is more than 0.1M for simulated waste solutions and for contact times inherent in laboratory treatment protocol. Uranium and Americium affinity under experimental conditions for cesium removal were evaluated from gamma spectrometric data. Results are given for the model experiment and an approach for the real waste analysis is chosen. Under our experimental conditions simulated wastes solutions showed minimal affinity to AMP when U and Am are most probably in the

  12. Characteristics of plutonium and americium contamination at the former U.K. atomic weapons test ranges at Maralinga and Emu

    Energy Technology Data Exchange (ETDEWEB)

    Burns, P.A.; Cooper, M.B.; Lokan, K.H.; Wilks, M.J.; Williams, G.A. [Australian Radiation Lab., Melbourne, VIC (Australia)


    Physico-chemical studies on environmental plutonium are described, which provide data integral to an assessment of dose for the inhalation of artificial actinides by Australian Aborigines living a semi-traditional lifestyle at Maralinga and Emu, sites of U.K. atomic weapons tests between 1953 and 1963. The most significant area, from a radiological perspective, is the area contaminated by plutonium in a series of ``one point`` safety trials in which large quantities of plutonium were dispersed explosively at a location known as Taranaki. The activity distribution of plutonium and americium with particle size is quite different from the mass distribution, as a considerably higher proportion of the activity is contained in the finer (inhalable) fraction than of the mass. Except in areas which were disturbed through ploughing during a cleanup in 1967, most the activity remains in the top 1 cm of the surface. Much of the activity is in particulate form, even at distances > 20 km from the firing sites, and discrete particles have been located even at distances beyond 100 km. Data are presented which permit the assessment of annual committed doses through the inhalation pathway, for Aborigines living a semi-traditional lifestyle in the areas affected by the Taranaki firings in particular. (author).

  13. Evaluation of synthetic water-soluble metal-binding polymers with ultrafiltration for selective concentration of americium and plutonium

    International Nuclear Information System (INIS)

    Routine counting methods and ICP-MS are unable to directly measure the new US Department of Energy (DOE) regulatory level for discharge waters containing alpha-emitting radionuclides of 30 pCi/L total alpha or the 0.05 pCi/L regulatory level for Pu or Am activity required for surface waters at the Rocky Flats site by the State of Colorado. This inability indicates the need to develop rapid, reliable, and robust analytical techniques for measuring actinide metal ions, particularly americium and plutonium. Selective separation or preconcentration techniques would aid in this effort. Water-soluble metal-binding polymers in combination with ultrafiltration are shown to be an effective method for selectively removing dilute actinide ions from acidic solutions of high ionic strength. The actinide-binding properties of commercially available water-soluble polymers and several polymers which have been reported in the literature were evaluated. The functional groups incorporated in the polymers were pyrrolidone, amine, oxime, and carboxylic, phosphonic, or sulfonic acid. The polymer containing phosphonic acid groups gave the best results with high distribution coefficients and concentration factors for 241Am(III) and 238Pu(III)/(IV) at pH 4 to 6 and ionic strengths of 0.1 to 4

  14. Characterization of a Sealed Americium-Beryllium (AmBe) Source by Inductively Coupled Plasma Mass Spectrometry

    International Nuclear Information System (INIS)

    Two Americium-Beryllium neutron sources were dismantled, sampled (sub-sampled) and analyzed via inductively coupled plasma mass spectrometry (ICP-MS). Characteristics such as 'age' since purification, actinide content, trace metal content and inter and intra source composition were determined. The 'age' since purification of the two sources was determined to be 25.0 and 25.4 years, respectively. The systematic errors in the 'age' determination were ± 4 % 2s. The amount and isotopic composition of U and Pu varied substantially between the sub-samples of Source 2 (n=8). This may be due to the physical means of sub-sampling or the way the source was manufactured. Source 1 was much more consistent in terms of content and isotopic composition (n=3 sub-samples). The Be-Am ratio varied greatly between the two sources. Source 1 had an Am-Be ratio of 6.3 ± 52 % (1s). Source 2 had an Am-Be ratio of 9.81 ± 3.5 % (1s). In addition, the trace element content between the samples varied greatly. Significant differences were determined between Source 1 and 2 for Sc, Sr, Y, Zr, Mo, Ba and W.

  15. Use of radioanalytical methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in radioactive wastes

    International Nuclear Information System (INIS)

    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)

  16. Use of radioactive methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in waste radioactive

    International Nuclear Information System (INIS)

    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI+EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI+EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)

  17. Migration of the fission products strontium, technetium, iodine, cesium, and the actinides neptunium, plutonium, americium in granitic rock

    International Nuclear Information System (INIS)

    Rock samples were taken from drilling cores in granitic and granodioritic rock, and small (2x2x2 cm) rock tablets from the drilling cores were exposed to a groundwater solution containing one of the studied elements at race levels. The concentration of the element versus penetration depth in the rock tablet was measured radiometrically. The sorption on the mineral faces and the migration into the rock was studied, by an autoradiographic technique. The cationic fission products strontium and cesium had apparent diffusivities of 10-13-10-14 m2/s. They migrate mainly in fissures or filled fractures containing e.g., calcite, epidote or chlorite or in veins with hgih capacity minerals (e.g. biotite). The anionic fission products iodine and technetium had apparent diffusivities of about 10-14 m2/s. These species migrate along mineral boundaries and in open fractures and to a minor extent in high capacity mineral veins. The migration of the actinides neptunium, plutonium and americium is very slow (in the mm-range after 2-3 years contact time). The apparent diffusivities were about 10-15 m2/s. The actinide migration into the rock was largely confined to fissures. (orig./HP)

  18. Distribution of plutonium, americium, and several rare earth fission product elements between liquid cadmium and LiCl-KCl eutectic

    International Nuclear Information System (INIS)

    Separation factors were measured that describe the partition between molten cadmium and molten LiCl-KCl eutectic of plutonium, americium, praseodymium, neodymium, cerium, lanthanum, gadolinium, dysprosium, and yttrium. The temperature range was 753-788 K, and the range of concentrations was that allowed by the sensitivity of the chemical analysis methods. Mean separation factors were derived for Am-Pu, Nd-Am, Nd-Pu, Nd-Pr, Gd-La, Dy-La, La-Ce, La-Nd, Y-La, and Y-Nd. Where previously published data were available, agreement was good. For convenience, the following series of separation factors relative to plutonium was derived by combining the measured separation factors: Pu, 1.00 (basis); Am, 1.54; Pr, 22.0; Nd, 23.4; Ce, 26; La, 70; Gd, 77; Dy, 270; Y, 3000. These data are used in calculating the distribution of the actinide and rare earth elements in the prochemical reprocessing of spent fuel from the Integral Fast Reactor. (orig.)

  19. Characteristics of plutonium and americium contamination at the former U.K. atomic weapons test ranges at Maralinga and Emu

    International Nuclear Information System (INIS)

    Physico-chemical studies on environmental plutonium are described, which provide data integral to an assessment of dose for the inhalation of artificial actinides by Australian Aborigines living a semi-traditional lifestyle at Maralinga and Emu, sites of U.K. atomic weapons tests between 1953 and 1963. The most significant area, from a radiological perspective, is the area contaminated by plutonium in a series of ''one point'' safety trials in which large quantities of plutonium were dispersed explosively at a location known as Taranaki. The activity distribution of plutonium and americium with particle size is quite different from the mass distribution, as a considerably higher proportion of the activity is contained in the finer (inhalable) fraction than of the mass. Except in areas which were disturbed through ploughing during a cleanup in 1967, most the activity remains in the top 1 cm of the surface. Much of the activity is in particulate form, even at distances > 20 km from the firing sites, and discrete particles have been located even at distances beyond 100 km. Data are presented which permit the assessment of annual committed doses through the inhalation pathway, for Aborigines living a semi-traditional lifestyle in the areas affected by the Taranaki firings in particular. (author)

  20. Measured solubilities and speciations of neptunium, plutonium, and americium in a typical groundwater (J-13) from the Yucca Mountain region

    International Nuclear Information System (INIS)

    Solubility and speciation data are important in understanding aqueous radionuclide transport through the geosphere. They define the source term for transport retardation processes such as sorption and colloid formation. Solubility and speciation data are useful in verifying the validity of geochemical codes that are part of predictive transport models. Results are presented from solubility and speciation experiments of 237NpO2+, 239Pu4+, 241Am3+/Nd3+, and 243Am3+ in J-13 groundwater (from the Yucca Mountain region, Nevada, which is being investigated as a potential high-level nuclear waste disposal site) at three different temperatures (25 degree, 60 degree, and 90 degree C) and pH values (5.9, 7.0, and 8.5). The solubility-controlling steady-state solids were identified and the speciation and/or oxidation states present in the supernatant solutions were determined. The neptunium solubility decreased with increasing temperature and pH. Plutonium concentrations decreased with increasing temperature and showed no trend with pH. The americium solutions showed no clear solubility trend with increasing temperature and increasing pH

  1. Fractionation of 238U/235U by reduction during low temperature uranium mineralisation processes (United States)

    Murphy, Melissa J.; Stirling, Claudine H.; Kaltenbach, Angela; Turner, Simon P.; Schaefer, Bruce F.


    Investigations of ‘stable’ uranium isotope fractionation during low temperature, redox transformations may provide new insights into the usefulness of the 238U/235U isotope system as a tracer of palaeoredox processes. Sandstone-hosted uranium deposits accumulate at an oxidation/reduction interface within an aquifer from the low temperature reduction of soluble U(VI) complexes in groundwaters, forming insoluble U(IV) minerals. This setting provides an ideal environment in which to investigate the effects of redox transformations on 238U/235U fractionation. Here we present the first coupled measurements of 238U/235U isotopic compositions and U concentrations for groundwaters and mineralised sediment samples from the same redox system in the vicinity of the high-grade Pepegoona sandstone-hosted uranium deposit, Australia. The mineralised sediment samples display extremely variable 238U/235U ratios (herein expressed as δUCRM145238, the per-mil deviation from the international NBL standard CRM145). The majority of mineralised sediment samples have δUCRM145238 values between -1.30±0.05 and 0.55±0.12‰, spanning a ca. 2‰ range. However, one sample has an unusually light isotopic composition of -4.13±0.05‰, which suggests a total range of U isotopic variability of up to ca. 5‰, the largest variation found thus far in a single natural redox system. The 238U/235U isotopic signature of the mineralised sediments becomes progressively heavier (enriched in 238U) along the groundwater flow path. The groundwaters show a greater than 2‰ variation in their 238U/235U ratios, ranging from δUCRM145238 values of -2.39±0.07 to -0.71±0.05‰. The majority of the groundwater data exhibit a clear systematic relationship between 238U/235U isotopic composition and U concentration; samples with the lowest U concentrations have the lowest 238U/235U ratios. The preferential incorporation of 238U during reduction of U(VI) to U(IV) and precipitation of uranium minerals leaves

  2. Standard test method for measurement of 235U fraction using enrichment meter principle

    CERN Document Server

    American Society for Testing and Materials. Philadelphia


    1.1 This test method covers the quantitative determination of the fraction of 235U in uranium using measurement of the 185.7 keV gamma-ray produced during the decay of 235U. 1.2 This test method is applicable to items containing homogeneous uranium-bearing materials of known chemical composition in which the compound is considered infinitely thick with respect to 185.7 keV gamma-rays. 1.3 This test method can be used for the entire range of 235U fraction as a weight percent, from depleted (0.2 % 235U) to highly enriched (97.5 % 235U). 1.4 Measurement of items that have not reached secular equilibrium between 238U and 234Th may not produce the stated bias when low-resolution detectors are used with the computational method listed in Annex A2. 1.5 The values stated in SI units are to be regarded as standard. No other units of measurement are included in this standard. 1.6 This standard may involve hazardous materials, operations, and equipment. This standard does not purport to address all of the safety co...

  3. Fine structure at the diffusion welded interface of Fe3Al/Q235 dissimilar materials

    Indian Academy of Sciences (India)

    Wang Juan; Li Yajiang; Wu Huiqiang


    The interface of Fe3Al/Q235 dissimilar materials joint, which was made by vacuum diffusion welding, combines excellently. There are Fe3Al, FeAl phases and -Fe (Al) solid solution at the interface of Fe3Al/Q235. Aluminum content decreases from 28% to 1.5% and corresponding phase changes from Fe3Al with DO3 type body centred cubic (bcc) structure to -Fe (Al) solid solution with B2 type bcc structure. All phases are present in sub-grain structure level and there is no obvious brittle phases or micro-defects such as pores and cracks at the interface of Fe3Al/Q235 diffusion joint.

  4. Determination of parameters of Johnson-Cook models of Q235 B steel%Q235 B钢Johnson-Cook模型参数的确定

    Institute of Scientific and Technical Information of China (English)

    林莉; 支旭东; 范锋; 孟上九; 苏俊杰


    使用万能材料试验机、扭转试验机和霍普金森拉杆装置研究了Q235B钢在常温~950℃的准静态、动态力学性能,获得了Q235 B强度与等效塑性应变,应变率和温度的关系以及延性与应力三轴度,应变率和温度的关系。基于实验结果,修改了Johnson-Cook(J-C)强度模型中的应变强化项以及Johnson-Cook失效模型中的温度软化项,并结合数值仿真标定了相关模型参数。最后通过Taylor撞击试验验证了模型参数的有效性。%Strength and ductility data for Q235 B steel from 20 ℃ to 950 ℃ were obtained from tension tests with smooth cylindrical specimens (SCSs).The strain rate sensitivity was studied by conducting split hopkinson tension bar (SHTB)tests and uniaxial tension tests of SCSs.The influence of stress triaxiality on ductility was revealed by conducting upsetting tests of cylinder specimens,tension tests of pre-notched cylinder specimens and torsion tests of SCSs.Slightly modified versions of two Johnson-Cook (J-C ) models describing flow stress and failure strain were presented to characterize the properties of Q235 B steel as a function of strain rate,temperature and stress triaxiality.The corresponding model parameters were calibrated based on the test data and with the help of finite element simulation.The validity of the model parameters was verified with Taylor impact tests.

  5. Determination of 235U isotope abundance by measuring selected pairs of fission products

    International Nuclear Information System (INIS)

    A new method to determine experimentally the isotopic abundance of uranium has been developed by measuring the ratios of selected fission product pairs. The relationship between the 235U abundance and the ratios of 14 MeV neutron-induced fission products, which are N(3892Sr)/N(44105Ru) and N(3892Sr)/N(53135I), have been obtained. The results of 4 test samples show that the relative deviations between the measured and the reference 235U abundances are less than ±3%.

  6. Determination of U235 enrichment from nuclear fuel by neutronic activation

    International Nuclear Information System (INIS)

    The enrichment of 235U in UO2 pellets samples through the instrumental neutron activation analysis method (I.N.A.A.) was determined. By high resolution gamma-ray spectrometry (H.R.G.S.), from analysis of isotopic ratios between fission products peaks from 235U and 239Np different energies peaks from 238U, the enrichment was achieved. The 'Boatstrap' statistics technique for the analytical results, which is based in shaping results of an unknown distribution to the Gaussian distribution by B replications in interested statistics such as: the mean and its standard error, was introduced. (M.J.C.)

  7. Corrosion Resistance of Plasma Sprayed Ceramic CompositeCoatings on Q235 Substrate

    Institute of Scientific and Technical Information of China (English)


    The corrosion resistance of SiO2/Al2O3, TiO2/Al2O3 and (SiO2+TiO2)/Al2O3 ceramic composite coatings on Q235 substrate fabricated by means of plasma spraying was investigated. The results show that Al2O3+13 wt pct TiO2 ceramic coating has the highest density, the lowest connected porosity and the best corrosion resistance. The corrosion mechanism of Q235 with ceramic coating has also been studied.

  8. Analysis of the 235U neutron cross sections in the resolved resonance range

    International Nuclear Information System (INIS)

    Using recent high-resolution measurements of the neutron transmission of 235U and the spin-separated fission cross-section data of Moore et al., a multilevel analysis of the 235U neutron cross sections was performed up to 300 eV. The Dyson Metha Δ3 statistics were used to help locate small levels above 100 eV where resonances are not clearly resolved even in the best resolution measurements available. The statistical properties of the resonance parameters are discussed

  9. Analysis of the 235U neutron cross sections in the resolved resonance range

    International Nuclear Information System (INIS)

    Using recent high-resolution measurements of the neutron transmission of 235U and the spin-separated fission cross-section data of Moore et al., a multilevel analysis of the 235U neutron cross sections was performed up to 300 eV. The Dyson Metha Δ3 statistics were used to help locate small levels above 100 eV where resonances are not clearly resolved even in the best resolution measurements available. The statistical properties of the resonance parameters are discussed. 13 refs., 8 figs., 1 tab

  10. Total kinetic energy release in the fast neutron-induced fission of $^{235}$U


    Yanez, R; Loveland, W.; King, J.; Barrett, J. S.; Fotiades, N.; Lee, H. Y.


    We have measured the total kinetic energy (TKE) release for the $^{235}$U(n,f) reaction for $E_{n}$=2-100 MeV using the 2E method with an array of Si PIN diode detectors. The neutron energies were determined by time of flight measurements using the white spectrum neutron beam at the LANSCE facility. (To calibrate the apparatus, the TKE release for $^{235}$U(n$_{th}$,f) was also measured using a thermal neutron beam from the OSU TRIGA reactor). The TKE decreases non-linearly from 169.0 MeV to ...

  11. Total kinetic energy release in the fast neutron-induced fission of $^{235}$U


    Yanez, R; Loveland, W.; King, J.; Barrett, J. S.; Fotiades, N.; Lee, H. Y.


    We have measured the total kinetic energy (TKE) release for the $^{235}$U(n,f) reaction for $E_{n}$=2-100 MeV using the 2E method with an array of Si PIN diode detectors. The neutron energies were determined by time of flight measurements using the white spectrum neutron beam at the LANSCE facility. To benchmark the TKE measurement, the TKE release for $^{235}$U(n$_{th}$,f) was also measured using a thermal neutron beam from the Oregon State University TRIGA reactor, giving pre-neutron emissi...

  12. The role of natural organic matter in the migration behaviour of americium in the Boom Clay - Part 1: migration experiments

    International Nuclear Information System (INIS)

    Full text of publication follows: In demonstrating the suitability of Boom Clay as reference site for studying the disposal of radioactive waste, the role of the relatively high amount of Natural Organic Matter (NOM) present in the Boom Clay on the mobility of critical radionuclides needs to be investigated thoroughly. It is generally accepted that trivalent actinides and lanthanides form strong complexes with humic substances. Complexation of these trivalent radionuclides with NOM present in the Boom Clay may therefore have two opposite effects. If complexed by the aqueous phase NOM (the mobile NOM), the radionuclide transport will be governed by the mobility of these dissolved radionuclide- NOM species. If complexed by the solid phase NOM (the immobile NOM) the migration will be retarded. One of the aims of the EC projects TRANCOM-Clay and TRANCOM-II was to investigate the role of mobile NOM as radionuclide carrier in order to develop a conceptual model for inclusion in a performance assessment (PA) model. The migration behaviour of Americium (used as an analogue for the critical radionuclide Pu) was investigated by complexing 241Am with radiolabelled (14C-labelled) NOM before passing through undisturbed Boom Clay cores contained in columns. The use of two different radionuclides, allows the migration behaviour of both the NOM and the Am to be followed. The results of the migration experiments showed that the Am-NOM complexes dissociated when they came into contact with Boom Clay and that the bulk of Am became immobilised (either as Am complexed to immobile NOM or sorbed to the mineral phase). Only a small percentage of the complex persisted as 'stabilised' Am-OM complex which exhibited slow dissociation kinetics upon moving through the Boom Clay. When the applied radionuclide source also contains Am in the form of an inorganic solid phase (when Am is applied above the solubility limit), a continuous source of Am exists to form 'temporarily stabilised' Am

  13. Molten salt extraction (MSE) of americium from plutonium metal in CaCl2-KCl-PuCl3 and CaCl2-PuCl3 salt systems

    International Nuclear Information System (INIS)

    Molten salt extraction (MSE) of americium-241 from reactor-grade plutonium has been developed using plutonium trichloride salt in stationary furnaces. Batch runs with oxidized and oxide-free metal have been conducted at temperature ranges between 750 and 945C, and plutonium trichloride concentrations from one to one hundred mole percent. Salt-to-metal ratios of 0.10, 0.15, and 0 30 were examined. The solvent salt was either eutectic 74 mole percent CaCl2 endash 26 mole percent KCl or pure CaCl2. Evidence of trivalent product americium, and effects of temperature, salt-to-metal ratio, and oxide contamination on the americium extraction efficiency are given. 24 refs, 20 figs, 13 tabs

  14. Plutonium, americium and radiocaesium in the marine environment close to the Vandellos I nuclear power plant before decommissioning

    International Nuclear Information System (INIS)

    The Vandellos nuclear power plant (NPP), releasing low-level radioactive liquid waste to the Mediterranean Sea, is the first to be decommissioned in Spain, after an incident which occurred in 1989. The presence, distribution and uptake of various artificial radionuclides (radiocaesium, plutonium and americium) in the environment close to the plant were studied in seawater, bottom sediments and biota, including Posidonia oceanica, fish, crustaceans and molluscs. Seawater, sediments and Posidonia oceanica showed enhanced levels in the close vicinity of the NPP, although the effect was restricted to its near environment. Maximum concentrations in seawater were 11.6±0.5 Bq m-3 and 16.9±1.2 mBq m-3 for 137Cs and 239,240Pu, respectively. When sediment concentrations were normalized to excess 210Pb, they showed both the short-distance transport of artificial radionuclides from the Vandellos plant and the long-distance transport of 137Cs from the Asco NPP. Posidonia oceanica showed the presence of various gamma-emitters attributed to the impact of the Chernobyl accident, on which the effect of the NPP was superimposed. Seawater, sediment and Posidonia oceanica collected near the plant also showed an enhancement of the plutonium isotopic ratio above the fallout value. The uptake of these radionuclides by marine organisms was detectable but limited. Pelagic fish showed relatively higher 137Cs concentrations and only in the case of demersal fish was the plutonium isotopic ratio increased. The reported levels constitute a set of baseline values against which the impact of the decommissioning operations of the Vandellos I NPP can be studied

  15. Determination by gamma-ray spectrometry of the plutonium and americium content of the Pu/Am separation scraps. Application to molten salts; Determination par spectrometrie gamma de la teneur en plutonium et en americium de produits issus de separation Pu/Am. Application aux bains de sels

    Energy Technology Data Exchange (ETDEWEB)

    Godot, A. [CEA Valduc, Dept. de Traitement des Materiaux Nucleaires, 21 - Is-sur-Tille (France); Perot, B. [CEA Cadarache, Dept. de Technologie Nucleaire, Service de Modelisation des Transferts et Mesures Nucleaires, 13 - Saint-Paul-lez-Durance (France)


    Within the framework of plutonium recycling operations in CEA Valduc (France), americium is extracted from molten plutonium metal into a molten salt during an electrolysis process. The scraps (spent salt, cathode, and crucible) contain extracted americium and a part of plutonium. Nuclear material management requires a very accurate determination of the plutonium content. Gamma-ray spectroscopy is performed on Molten Salt Extraction (MSE) scraps located inside the glove box, in order to assess the plutonium and americium contents. The measurement accuracy is influenced by the device geometry, nuclear instrumentation, screens located between the sample and the detector, counting statistics and matrix attenuation, self-absorption within the spent salt being very important. The purpose of this study is to validate the 'infinite energy extrapolation' method employed to correct for self-attenuation, and to detect any potential bias. We present a numerical study performed with the MCNP computer code to identify the most influential parameters and some suggestions to improve the measurement accuracy. A final uncertainty of approximately 40% is achieved on the plutonium mass. (authors)

  16. Recovery of plutonium and americium from laboratory acidic waste solutions using tri-n-octylamine and octylphenyl-N-N- diisobutylcarbamoylmethylphosphine oxide. (United States)

    Michael, K M; Rizvi, G H; Mathur, J N; Kapoor, S C; Ramanujam, A; Iyer, R H


    Plutonium from acidic waste solutions has been recovered quantitatively using tri-n-octylamine (TnOA) in xylene and americium using a mixture of octylphenyl-N-N- diisobutylcarbamoylmethylphosphine oxide (CMPO) and TBP in dodecane by extraction and extraction chromatographic methods. The Pu ( IV ) TnOA species extracted into the organic phase from higher nitric acid concentrations has been confirmed as (R(3)NH)(2)Pu(NO(3))(6) (where R(3)N = TnOA by employing slope analysis as well as spectrophotometric studies. PMID:18966958

  17. Theoretical investigation of pressure-induced structural transitions in americium using GGA+U and hybrid density functional theory methods

    DEFF Research Database (Denmark)

    Verma, Ashok K.; Modak, P.; Sharma, Surinder M.;


    First-principles calculations have been performed for americium (Am) metal using the generalized gradient approximation + orbital-dependent onsite Coulomb repulsion via Hubbard interaction (GGA+U) and hybrid density functional theory (HYB-DFT) methods to investigate various ground state properties...... phase in order to match the experimental data. Thus, neither the GGA+U nor the HYB-DFT methods are able to describe the energetics of Am metal properly in the entire pressure range from 0 GPa to 50 GPa with a single choice of their respectiveU and α parameters. Low binding-energy peaks in the...

  18. Dissertation on the computer-based exploitation of a coincidence multi parametric recording. Application to the study of the disintegration scheme of Americium 241

    International Nuclear Information System (INIS)

    After having presented the meaning of disintegration scheme (alpha and gamma emissions, internal conversion, mean lifetime), the author highlights the benefits of the use of multi-parametric chain for the recording of correlated parameters, and of the use of a computer for the analysis of bi-parametric information based on contour lines. Using the example of Americium 241, the author shows how these information are obtained (alpha and gamma spectrometry, time measurement), how they are chosen, coded, analysed and stored, and then processed by contour lines

  19. Uptake of curium (244Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    International Nuclear Information System (INIS)

    Curium (244Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium. (author)

  20. Uptake of curium (/sup 244/Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Miramand, P.; Germain, P.; Arzur, J.C.


    Curium (/sup 244/Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium.


    International Nuclear Information System (INIS)

    Pre-eclampsia (PE) is multisystem and multifactorial complication of pregnancy. The precise cause of pre-eclampsia has not been determined but mal adoption of the rennin and angiotensinogen (AGT) system may play a role. The products of genes involving the components of this system may be potential candidates for pre-eclampsia and hypertension related to pregnancy. This study was designed to determine whether the M235T variants of AGT gene were associated with the prevalence of pre-eclampsia and also to evaluate the role of plasma AGT in the development of the disease. Hence, developed, rapid and reliable PCR based assay was used to screen individuals for the M235T alleles. This assay was also used to genotype prospectively both recruited pregnant women with pre-eclampsia (n=24) and controls (n=11). Plasma AGT was determined by radioimmunoassay (RIA). The results of the PCR based assay revealed a significant association of 235T allele with the prevalence of all pre-eclamptic patients, Chi-square (x2) = 3.714, P0.05). Also, pre-eclamptic women exhibited significant higher levels of plasma AGT (52.15 ± 1.63) versus controls (44.76 ± 4.6) with P value < 0.001. This gave clear evidence that T235T allele and plasma AGT contributed to the development of pre-eclampsia with pregnancy and correlated with severity of the disease

  2. 19 CFR 10.235 - Filing of claim for preferential tariff treatment. (United States)


    ... 19 Customs Duties 1 2010-04-01 2010-04-01 false Filing of claim for preferential tariff treatment... Trade Partnership Act § 10.235 Filing of claim for preferential tariff treatment. (a) Declaration. In connection with a claim for preferential tariff treatment for an article described in § 10.233(a)(1)...

  3. An ideal cascade for uranium 235 enrichment by centrifuge jet nozzle process

    International Nuclear Information System (INIS)

    The design of an ideal cascade for the process of isotope separation by centrifugation for the U235 enrichment, is presented. A selection of building materials used in fabrication of isotope separation plants, showing the importance of aluminium, due the bauxite mines in Northern Brazil, is done. (M.C.K.)

  4. Calculation of Prompt Fission Neutron Spectra for ~(235)U (n,f)

    Institute of Scientific and Technical Information of China (English)


    The prompt fission neutron spectra for neutron-induced fission of 235U at En<5 MeV are calculated using the nuclear evaporation theory with a semi-empirical model, in which the non-constant temperature and the constant temperature related to the Fermi gas model

  5. 50 CFR 23.5 - How are the terms used in these regulations defined? (United States)


    ... participate in or support a recovery activity for that species in cooperation with one or more of the species... ENDANGERED SPECIES OF WILD FAUNA AND FLORA (CITES) Introduction § 23.5 How are the terms used in these... context otherwise requires, in this part: Affected by trade means that either a species is known to be...

  6. Relationship of blood pressure variability and angiotensinogen T235M polymorphism with Binswanger’s disease

    Institute of Scientific and Technical Information of China (English)



    Objective To detect the relationship of blood pressure variability(BPV) and angiotensinogen(AGT) T235M polymorphism with Binswanger’s disease(BD). Methods Totally 122 cases with BD and 108 cases with essential hypertension had been enrolled. Ambulatory blood pressure monitoring was used to get the data

  7. Verification of 235U mass content in nuclear fuel plates by an absolute method

    International Nuclear Information System (INIS)

    Nuclear Safeguards is referred to a verification System by which a State can control all nuclear materials (NM) and nuclear activities under its authority. An effective and efficient Safeguards System must include a system of measurements with capabilities sufficient to verify such NM. Measurements of NM using absolute methods could eliminate the dependency on NM Standards, which are necessary for other relative or semi-absolute methods. In this work, an absolute method has been investigated to verify the 235U mass content in nuclear fuel plates of Material Testing Reactor (MTR) type. The most intense gamma-ray signature at 185.7 keV emitted after α-decay of the 235U nuclei was employed in the method. The measuring system (an HPGe-spectrometer) was mathematically calibrated for efficiency using the general Monte Carlo transport code MCNP-4B. The calibration results and the measured net count rate were used to estimate the 235U mass content in fuel plates at different detector-to-fuel plate distances. Two sets of fuel plates, containing natural and low enriched uranium, were measured at the Fuel Fabrication Facility. Average accuracies for the estimated 235U masses of about 2.62% and 0.3% are obtained for the fuel plates containing natural and low enriched uranium; respectively, with a precision of about 3%

  8. MGAU: A new analysis code for measuring {sup 235}U enrichments in arbitrary samples

    Energy Technology Data Exchange (ETDEWEB)

    Gunnink, R.; Ruhter, W.D.; Miller, P. [Lawrence Livermore National Lab., CA (United States); Goerten, J.; Swinhoe, M.; Wagner, H. [Commission of the European Communities, Luxembourg (Luxembourg). Safeguards Directorate; Verplancke, J. [Canberra Applied Systems Europe, Zellik (Belgium); Bickel, M.; Abousahl, S. [Inst. for Reference Materials and Measurements, Geel (Belgium)


    We have developed a computerized analysis method for determining {sup 235}U enrichment in uranium items where no suitable reference standards exist or where nonreproducible conditions make calibration impossible. The method requires no calibrations and is capable of accuracies of 1--2% in only a few minutes.

  9. MGAU: A new analysis code for measuring 235U enrichments in arbitrary samples

    International Nuclear Information System (INIS)

    We have developed a computerized analysis method for determining 235U enrichment in uranium items where no suitable reference standards exist or where nonreproducible conditions make calibration impossible. The method requires no calibrations and is capable of accuracies of 1--2% in only a few minutes

  10. Determination of 235U isotope abundance by difference method of fission yield

    International Nuclear Information System (INIS)

    Background: Determination of the uranium isotope abundance ratio of fuel pins is a significant stage for the quality control in safe operations of reactor. Purpose: The aim is to establish a method to examine the 235U abundance of fuel rod with fast neutron as an excitation source. Methods: Taking the fission-yield ratios of Y-bar88Rb/Y-bar104Tc and Y-bar92Sr/Y-bar104Tc as the subjects of research, the relation curves between the average yield ratios and the 235U isotopic abundance as well as the expressions Y-bar1/Y-bar2=f(H0), in which the average yield ratio (Y-bari/Y-barj ) is a function of the 235U isotopic abundance (H0), were obtained and presented based on the previous studies. Results: In order to testify the accuracy of the method, the simulation sample of 72.2% is measured by working curve, and RSD is less than 2%. Within the limit of error, the results of sample analysis are in correspondence with those of passive gamma ray method. Conclusion: All of these results indicate that the method is feasible to determine the 235U abundance of fuel rod. (authors)

  11. 33 CFR 183.235 - Level flotation test without weights for persons capacity. (United States)


    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Level flotation test without..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) BOATING SAFETY BOATS AND ASSOCIATED EQUIPMENT Flotation Requirements for Outboard Boats Rated for Engines of More Than 2 Horsepower Tests § 183.235 Level...

  12. 40 CFR 266.235 - What waste treatment does the storage and treatment conditional exemption allow? (United States)


    ... 40 Protection of Environment 26 2010-07-01 2010-07-01 false What waste treatment does the storage... HAZARDOUS WASTES AND SPECIFIC TYPES OF HAZARDOUS WASTE MANAGEMENT FACILITIES Conditional Exemption for Low-Level Mixed Waste Storage, Treatment, Transportation and Disposal. Treatment § 266.235 What...

  13. Quantification of 235 U and 226 Ra in soil samples by means of Gamma spectroscopy

    International Nuclear Information System (INIS)

    In this work it is presented the Gamma Spectroscopy method which is realized in the Environmental Radiological Surveillance Laboratory using the option of deconvolution of a commercial software for the quantification of 235 U and 226 Ra; also is presented the method for the 226 Ra correction activity. (Author)

  14. 78 FR 68813 - Foreign-Trade Zone 235-Lakewood, New Jersey Application for Reorganization/Expansion Under... (United States)


    ... (Board Order 1008, 63 FR 67854, 12/09/98) and expanded on November 20, 2008 (Board Order 1589, 73 FR... Foreign-Trade Zones Board Foreign-Trade Zone 235--Lakewood, New Jersey Application for Reorganization...) Board by the Township of Lakewood, New Jersey, grantee of FTZ 235, requesting authority to...

  15. 29 CFR 2.35 - Effect of DOL support on Title VII employment nondiscrimination requirements and on other... (United States)


    ... 29 Labor 1 2010-07-01 2010-07-01 true Effect of DOL support on Title VII employment nondiscrimination requirements and on other existing statutes. 2.35 Section 2.35 Labor Office of the Secretary of... Effect of DOL support on Title VII employment nondiscrimination requirements and on other...

  16. Application of double nuclear system concept for description of mass distribution of the 235U+n fission products

    International Nuclear Information System (INIS)

    A total mass distribution of the 235U+n nuclei fission fragments on the all mass (charge) range is obtained. The calculation data have good agreement with the experimental results that confirms the correct choice of theoretical model and concept of the nuclear complex formation (double nuclear system) like an intermediate system for description of the 235U+n fission processes

  17. Effects of NVP-BEZ235 on the proliferation, migration, apoptosis and autophagy in HT-29 human colorectal adenocarcinoma cells. (United States)

    Yu, Yang; Yu, Xiaofeng; Ma, Jianxia; Tong, Yili; Yao, Jianfeng


    The phosphoinositide 3 kinase (PI3K)/Akt/mammalian target of the rapamycin (mTOR) pathway plays a significant role in colorectal adenocarcinoma. NVP-BEZ235 (dactolisib) is a novel dual inhibitor of PI3K/mTOR. The effects of NVP-BEZ235 in human colorectal adenocarcinoma are still unclear. In the present study, we aimed to explore the proliferation, migration, apoptosis and autophagy in HT-29 human colorectal adenocarcinoma cells. HT-29 human colorectal adenocarcinoma cells were treated with NVP-BEZ235 (0, 0.001, 0.01, 0.1, 1 and 3 µM) for 24 and 48 h, respectively. Cells were also treated with NVP-BEZ235 (0.1 µM), DDP (100, 300 and 1,000 µM), and NVP-BEZ235 (0.1 µM) combined with DDP (100, 300 and 1,000 µM) respectively, and cultured for 24 h after treatment. MTT assay was utilized to evaluate the effects of NVP-BEZ235 alone or NVP-BEZ235 combined with cis-diamminedichloroplatinum (DDP) on proliferation of HT-29 cells. Cell wound-scratch assay was used detect cell migration. In addition, expression of microtubule-associated proteins 1A/1B light chain 3B (MAP1LC3B and LC3B) in HT-29 cells was detected by immunofluorescence at 48 h after NVP-BEZ235 (1 µM) treatment. Expression of proteins involved in cell cycle and proliferation (p-Akt, p-mTOR and cyclin D1), apoptosis (cleaved caspase-3), and autophagy (cleaved LC3B and Beclin-1) were detected by western blot analysis. NVP-BEZ235 inhibited the proliferation and migration of HT-29 human colorectal adenocarcinoma cells. NVP-BEZ235 decreased protein expression of p-Akt, p-mTOR and cyclin D1, and increased protein expression of cleaved caspase-3, cleaved LC3B and Beclin-1 as the concentrations and the incubation time of NVP-BEZ235 increased. In addition, NVP-BEZ235 and DDP had synergic effects in inhibiting cell proliferation and migration. The expression of protein involved in apoptosis (cleaved caspase-3) was higher in drug combination group compared to the NVP-BEZ235 single treatment group. NVP-BEZ235

  18. Electron microscopic and agarose gel electrophoretic studies on apoptosis in immune cells induced by enriched 235U

    International Nuclear Information System (INIS)

    At present, the apoptosis in Molt-4 cell (a human acute lymphoblastic leukemia cell line) and Ana-1 cell (a macrophage cell line) were studied after internal irradiation with enriched 235U. The cumulative radiation absorption dose of 235U in cultural cells through different periods were estimated. The morphological changes, which observed by electron microscopy, indicated that Molt-4 and Ana-1 immune cells after incubation with 235U, displayed nuclear fragmentation, margination of condensed chromatin, as well as the membrane-bounded apoptotic bodies formation. The agarose gel electrophoretic observations showed the DNA ladder pattern formation in Molt-4 cell as well as in Ana-1 cell. The experimental results showed that apoptosis induced by 235U in immune cells, were dependent on the 235U-treated time and cumulative radiation absorption dose

  19. Investigation of solubility of cesium, strontium, barium, rare-earth, uranium and americium fluorides in acid nitrosyl fluoride (NOFx3HF)

    International Nuclear Information System (INIS)

    Solubility of Am and other elements, which are fission products, in acid nitrosylfluoride has been studied. Cesium fluoride has maximum solubility; uranium tetrafluoride is also noticeably soluble; americium trifluoride is practically insoluble; fluorides of rare earth elements are slightly soluble in NOFx3HF. Analysis of the solid phase obtained after treating the mixture of the above fluorides with acid nitrosylfluoride has shown that cesium fluoride reacts with NOFx3HF with the formation of an acid salt (CsFxHF), whereas fluorides of alkaline and rare earth elements remain unchanged. The behaviour of a mixture of cesium, barium, and lanthanum fluorides in the process of three-multiple treating with acid nitrosylfluoride has been studied. It is shown that more than 98% of cesium fluoride and 5% of barium fluoride pass into the mother liquor while lanthanum fluoride remains completely in the solid phase. The data on americium fluoride solubility in acid nitrosylfluoride have indicated that it behaves in the same way as fluorides of rare earth elements; it is practically insoluble in HOFx3HF

  20. Determining the americium transmutation rate and fission rate by post-irradiation examination within the scope of the ECRIX-H experiment

    International Nuclear Information System (INIS)

    The ECRIX-H experiment aims to assess the feasibility of transmuting americium micro-dispersed in an inert magnesia matrix under a locally moderated neutron flux in the Phénix reactor. A first set of examinations demonstrated that pellet behaviour was satisfactory with moderate swelling at the end of the irradiation. Additional post-irradiation examinations needed to be conducted to confirm the high transmutation rate so as to definitively conclude on the success of the ECRIX-H experiment. This article presents and discusses the results of these new examinations. They confirm the satisfactory behaviour of the MgO matrix not only during the basic irradiation but also during post-irradiation thermal transients. These examinations also provide additional information on the behaviour of fission products both in the americium-based particles and in the MgO matrix. These results particularly validate the transmutation rate predicted by the calculation codes using several different analytical techniques. The fission rate is also determined

  1. A comparison of pitting susceptibility of Q235 and HRB335 carbon steels used for reinforced concrete

    Directory of Open Access Journals (Sweden)



    Full Text Available The phase structure and the pitting susceptibility of two carbon steels, Q235 and HRB335, used for reinforced concrete, are investigated by phase observation, polarization curve measure-ments, electrochemical impedance spectroscopy, and Mott-Schottky analysis. It is found that Q235 is ferrite and HRB335 is pearlite. Q235 is more susceptible to chloride ions leading to pit-ting than HRB335. The polarization curves show that the breakdown potential of the passive film in saturated Ca(OH2 solution containing 0.4 M NaCl is 0 V for Q235 and 0.34 V for HRB335. The Mott-Schottky analyses show that passive films formed on Q235 and HRB335 in saturated Ca(OH2 solution containing chloride ions behave like an n-type semiconductor. The passive film formed on Q235 has a higher donor density, which explains why Q235 is more susceptible to pitting than HRB335.

  2. Simultaneous evaluation for (n,f) cross section of 235U, 239Pu, 238U and (n,γ) cross sections of 238U

    International Nuclear Information System (INIS)

    The fission cross sections for 235U, 238U, 239Pu, the capture cross sections for 238U and the ratios for 239Pu(n,f)/235U(n,f), 238U(m,f)/235U(n,f), 238U(n,γ)/235U(n,f) were firstly evaluated respectively. The experimental data were collected, analysed, selected and corrected. The data were fitted with spline fit program

  3. Fuel cycle cost comparison of choices in U-235 recycle in the HTGR

    International Nuclear Information System (INIS)

    An analysis of alternative options for the recycle of discharged makeup U-235 (''residual'' makeup) in HTGRs shows that the three-particle system which has been the reference plan remains optimal. This result considers both the resource utilization and the handling costs attendant to the alternative strategies (primarily in the recycle facility and in waste disposal). Furthermore, this result appears to be true under all forseeable economic conditions. A simple risk assessment indicates that recycle cost (including reprocessing, refabrication, and related waste disposal) would have to double or triple in order for the alternative U-235 recycle schemes to become attractive. This induces some degree of confidence in the choice of staying with the reference cycle in spite of the large degree of uncertainty over recycle and its costs

  4. The 235U Prompt Fission Neutron Spectrum in the BR1 Reactor at SCK•CEN (United States)

    Wagemans, Jan; Malambu, Edouard; Borms, Luc; Fiorito, Luca


    The BR1 research reactor at SCK•CEN has a spherical cavity in the graphite above the reactor core. In this cavity an accurately characterised Maxwellian thermal neutron field is present. Different converters can be loaded in the cavity in order to obtain other types of neutron (and gamma) irradiation fields. Inside the so-called MARK III converter a fast 235U(n,f) prompt fission neutron field can be obtained. With the support of MCNP calculations, irradiations in MARK III can be directly related to the pure 235U(n,f) prompt fission neutron spectrum. For this purpose MARK III spectrum averaged cross sections for the most relevant fluence dosimetry reactions have been determined. A calibration factor for absolute measurements has been determined applying activation dosimetry following ISO/IEC 17025 standards.

  5. Active Neutron Interrogation and Delayed Neutron Counting (AIDNEC) for assay of 235U

    International Nuclear Information System (INIS)

    A method has been developed for non destructive assay of 235U using active neutron interrogation followed by delayed neutron counting (AIDNEC) system. The neutrons from a plasma focus (PF) device were used to bombard the samples containing low enriched uranium ranging from 13 mg to 5 g. The PF device generates (1.2±0.3) x109 D-D fusion neutrons per shot with a pulse width of 46±5 ns. The delayed neutrons were monitored using a bank of six 3He detectors. The sensitivity of the system was found to be about 1000 cps per gram over the accumulation time of 25 seconds per neutron pulse of ∼109. The detection limit of the system is estimated to be 18 mg of 235U. (author)

  6. Studies of Neutron-Induced Fission of 235U, 238U, and 239Pu (United States)

    Duke, Dana; TKE Team


    A Frisch-gridded ionization chamber and the double energy (2E) analysis method were used to study mass yield distributions and average total kinetic energy (TKE) release from neutron-induced fission of 235U, 238U, and 239Pu. Despite decades of fission research, little or no TKE data exist for high incident neutron energies. Additional average TKE information at incident neutron energies relevant to defense- and energy-related applications will provide a valuable observable for benchmarking simulations. The data can also be used as inputs in theoretical fission models. The Los Alamos Neutron Science Center-Weapons Neutron Research (LANSCE - WNR) provides a neutron beam from thermal to hundreds of MeV, well-suited for filling in the gaps in existing data and exploring fission behavior in the fast neutron region. The results of the studies on 238U, 235U, and 239Pu will be presented. LA-UR-14-24921.

  7. Determination of U-235 quantity in fresh fuel elements by neutron coincidence collar technique

    International Nuclear Information System (INIS)

    The U-235 quantity per lenght of fresh fuel assemblies of the Angra-I first recharge was determined by Neutron Coincidence Collar technique (N.C.C.). This technique is well-founded in fresh fuel assemblies activation by thermal neutrons from AmLi source to generate U-235 fission neutrons. These neutrons are detected by coincidence method in polyethylene structure where 18 He-3 detectors were placed. The coincidence counting results, in active mode (AmLi), showed 0,7% to standard deviation and equal to 1,49% to mass in 1000s of counting. The accuracies of different calibration methods were evaluated and compared. The results showed that the operator declared values are consistent. This evaluation was part of technical-exchange program between Safeguards Laboratory from C.N.E.N. and Los Alamos National Lab., United States. (author)

  8. Candidate processes for diluting the 235U isotope in weapons-capable highly enriched uranium

    International Nuclear Information System (INIS)

    The United States Department of Energy (DOE) is evaluating options for rendering its surplus inventories of highly enriched uranium (HEU) incapable of being used to produce nuclear weapons. Weapons-capable HEU was earlier produced by enriching uranium in the fissile 235U isotope from its natural occurring 0.71 percent isotopic concentration to at least 20 percent isotopic concentration. Now, by diluting its concentration of the fissile 235U isotope in a uranium blending process, the weapons capability of HEU can be eliminated in a manner that is reversible only through isotope enrichment, and therefore, highly resistant to proliferation. To the extent that can be economically and technically justified, the down-blended uranium product will be made suitable for use as commercial reactor fuel. Such down-blended uranium product can also be disposed of as waste if chemical or isotopic impurities preclude its use as reactor fuel

  9. In-situ gamma-PHA measurements to support unconditional release of 235-F chiller units

    International Nuclear Information System (INIS)

    The Analytical Development Section of Savannah River Technology Center (SRTC) was requested by the Facility Decommission Division (FDD) to conduct in-situ gamma-ray pulse height analysis measurements to support the unconditional release of 235-F chiller units. The chiller units were used to cool process water in the 235-F facility. The measurements' main goal is to confirm that there is no process-related contaminants present on the chillers. For each of the two F-area clean water chillers, the authors have acquired ten gamma-ray pulse height analysis spectra. This report will discuss the purpose of the measurements, the experimental setup, data acquisition, calculations and results, and a conclusion of the study

  10. Calculation of prompt fission neutron spectra for 235U(n,f)

    Institute of Scientific and Technical Information of China (English)

    CHEN Yong-Jing; JIA Min; TAO Xi; QIAN Jing; LIU Ting-Jin; SHU Neng-Chuan


    The prompt fission neutron spectra for the neutron-induced fission of 235U at En < 5 MeV are calculated using nuclear evaporation theory with a semi-empirical model,in which the nonconstant and constant temperatures related to the Fermi gas model are taken into account. The calculated prompt fission neutron spectra reproduce the experimental data well.For the n(thermal)+235U reaction,the average nuclear temperature of the fission fragment,and the probability distribution of the nuclear temperature,are discussed and compared with the Los Alamos model.The energy carried away by γ rays emitted from each fragment is also obtained and the results are in good agreement with the existing experimental data.

  11. Accurate determination of the 235U isotope abundance by gamma spectrometry

    International Nuclear Information System (INIS)

    The purpose of this manual is to serve as guide in applications of the Certified Reference Material EC-NRM-171/NBS-SRM-969 for accurate U-235 isotope abundance measurements on bulk uranium samples by means of gamma spectrometry. The manual provides a thorough description of this non-destructive assay technique. Crucial measurement parameters affecting the accuracy of the gamma-spectrometric U-235 isotope abundance determination are discussed in detail and, whereever possible, evaluated quantitatively. The correction terms and tolerance limits given refer both to physical and chemical properties of the samples under assay and to relevant parameters of typical measurement systems such as counting geometry, signal processing, data evaluation and calibration. (orig.)

  12. Statistical properties of the 235U resonance parameters up to 300 eV

    International Nuclear Information System (INIS)

    An accurate resonance analysis of the 235U neutron cross sections up to 300 eV is in progress for the ENDF/B-VI files. A detailed discussion of the data base and a description of the method of resonance analysis have been given elsewhere. The purpose of this paper is to report on the statistical properties of the 235U resonance parameters and compare our results with those of previous analyses. The statistical properties of nuclear levels are of both technical and theoretical interest. From the technical viewpoint, these properties are the basis for an extrapolation into the unresolved resonance region, which is of relevance to the calculation of effective group cross sections for reactor design. From the theoretical viewpoint, the resonance parameters obtained from a multilevel R-matrix analysis of a consistent set of neutron cross sections should satisfy a set of statistical properties arising from general properties of the nuclear Hamiltonian

  13. The 235U Prompt Fission Neutron Spectrum in the BR1 Reactor at SCK•CEN

    Directory of Open Access Journals (Sweden)

    Wagemans Jan


    Full Text Available The BR1 research reactor at SCK•CEN has a spherical cavity in the graphite above the reactor core. In this cavity an accurately characterised Maxwellian thermal neutron field is present. Different converters can be loaded in the cavity in order to obtain other types of neutron (and gamma irradiation fields. Inside the so-called MARK III converter a fast 235U(n,f prompt fission neutron field can be obtained. With the support of MCNP calculations, irradiations in MARK III can be directly related to the pure 235U(n,f prompt fission neutron spectrum. For this purpose MARK III spectrum averaged cross sections for the most relevant fluence dosimetry reactions have been determined. A calibration factor for absolute measurements has been determined applying activation dosimetry following ISO/IEC 17025 standards.

  14. Chromosome aberrations induced in human lymphocytes by U-235 fission neutrons. Pt. 2

    International Nuclear Information System (INIS)

    Blood samples were spiked with Na-24 to study the separate effect of this nuclide on the incidence of chromosomal aberrations in neutron irradiated blood samples. A delay of 96 h was allowed before cultivation, so the results of chromosomal aberration analysis could be compared with the results obtained by direct irradiation of blood samples with U-235 fission neutrons. The absorbed dose was calculated using a simple conservative model. From the results obtained we can conclude that Na-24 alone was not the reason for the difference in the incidence of chromosomal aberrations between blood samples cultivated immediately after 'in vitro' irradiation by U-235 fission neutrons and samples which were cultivated after 96 h storage. (orig.)

  15. Evaluation of the fission cross sections for U-233 and U-235

    International Nuclear Information System (INIS)

    Activities of evaluation of nuclear data was started in Japan, 1963, and the results were published as JENDL-1., JENDL-2 and JENDL-3.1. The revised edition, JENDL-3.2 is now under preparation. The evaluation works of the fission cross sections for U-233 and U-235 and the encountered problems are discussed. For the 1 to 7 MeV region of U-233 cross section, the data by Poenitz adopted in JENDL-2 were discarded and finally ratio data by the Tohoku University were adopted in JENDL-3. The resolved resonance parameters for heavy nuclides including U-233 and U-235 are treated with the Reich-Moore formula in JENDL-3.2 instead of the previously used Breit and Wigner formula. (T.H.)

  16. Investigating Prompt Fission Neutron Emission from 235U(n,f) in the Resolved Resonance Region


    Göök Alf; Hambsch Franz-Josef; Oberstedt Stephan


    Investigations of prompt emission in fission is of importance in understanding the fission process in general and the sharing of excitation energy among the fission fragments in particular. Experimental activities at IRMM on prompt neutron emission from fission in response to OECD/NEA nuclear data requests is presented in this contribution. Main focus lies on currently on-going investigations of prompt neutron emission from the reaction 235U(n,f) in the region of the resolved resonances. For ...

  17. Measurement of 235U fission reaction-rates in combined device

    International Nuclear Information System (INIS)

    Fission reaction-rates of 235U (wrapped with Cd of 0.8 mm) in the combined setup were measured, using the enriched uranium fission chamber and capturing detector. The method of detecting the low-energy scattering, neutron background was studied. The experimental error is ±6.0%-±10.2%. The results was compared with the ones of 238U the fission reaction-rates. (authors)

  18. Criticality study of the storage of radioactive waste containing 235U

    International Nuclear Information System (INIS)

    The purpose of this study is to define the conditions of storage of nuclear waste drums containing 350 g of 235U (per drum). This study is valid for a square pitch stacking of cylindrical drums whose height/diameter ratio does not exceed 3. The reflector effect of concrete is taken into account. This study defines a conservative case that can be used under any hypothesis of moderation, of radiation coupling between drums and of fissile material density. (A.C.)

  19. Yields of Gamma- and X-Ray Radiation of Alpha-Decays of 235U

    International Nuclear Information System (INIS)

    Precise knowledge of gamma- and X-rays emission probabilities of uranium isotopes is vital for accurate gamma-spectrometric determination of the isotopic composition and quantity of uranium. The peak intensity ratio methods employing high resolution gammaspectrometry and intrinsic efficiency calibration approach are known to provide most accurate and reliable isotopic information. When applied to unshielded and moderately shielded material, these methods largely benefit from de-convolution of the 90-100 keV narrow spectral interval, which contains intense gamma- and X-ray lines of major uranium isotopes 235U and 238U. These are the 92.37 keV and 92.79 keV gamma-rays of 238U/234Th, and the 93.35 keV ThKα1 X-rays from alpha-decay of 235U. Although the emission probability ratios of these lines were accurately established, their absolute yields are still lacking accuracy. For instance, as resulted from recent study, the yields of 234Th lines become corrected by 30%, compared with their previous values. This consequently raised a question regarding validity of the yield data for the 93.35 keV line of 235U and triggered the present experimental study. This study was later extended to the reexamination of emission probabilities of other 235U gamma-lines with energies above 205 keV. The experimental data used in the current work was collected using SRM 969 and CRM 146 reference uranium samples. (author)

  20. Effect of laser cutting parameters on surface quality of low carbon steel (S235)


    I. Miraoui; M. Boujelbene; D. Katundi; E. Bayraktar; M. Zaied


    Purpose: This work analysis surface roughness parameters as a function of Laser power and cutting speed. The surface roughness parameters are determined after statistical analysis (ANOVA) and propose a simple mathematical model.Design/methodology/approach: Machining were carried out by Laser cutting (CO2) of sheet metal (low carbon steel, S235) produces different surface quality. The statistical processing of the experimental results enabled development of a mathematical model to calculate th...

  1. Measurements of delayed neutron parameters for U-235 and Np-237

    Energy Technology Data Exchange (ETDEWEB)

    Loaiza, D.


    Delayed neutrons are emitted by excited nuclei formed in beta decay of fission products called delayed neutron precursors. About 1% of the total neutrons released in fission are delayed neutrons; however, this small fraction plays an important role in nuclear reactor control. The delayed neutrons determine the time-dependent behavior of reactors, and knowledge of parameters used to predict neutron emission rate is essential for establishing reactivity worths. The delayed neutron yields, decay constants, and the absolute yield for the six-group delayed neutrons have been measured for U-235 and Np-237. This experiment has been called for in the forecast of experiments needed to support operations in the US. The bare U-235 metal assembly Godiva IV at the Los Alamos Critical Experiment Facility (LACEF) provided the source of neutrons. Godiva IV generated about 10{sup 7} total fissions in the samples for the infinite and instantaneous irradiation needed to accentuate the shorter and longer-lived groups of delayed neutrons. The detection system used in the experiment consisted of 20 He-3 tubes embedded in a polyethylene cylinder. The delayed neutron activity resulting from the fast neutron-induced fission has been measured. The measured absolute yield for U-235 was determined to be 0.0163 {+-} 0.009 neutrons/fission. This value compares very well with the well-established Keepin absolute yield of 0.0165 {+-} 0.0005. The newly measured absolute yield value for Np-237 was 0.0126 {+-} 0.0007, which compares well to the recently reported value of 0.0129 {+-} 0.0004 by Saleh and Parish. The measured values for U-235 are corroborated with period (e-folding time) versus reactivity calculations.

  2. A Fast Test for Excessive U235 Concentrations in Enriched Fuel Elements

    International Nuclear Information System (INIS)

    This paper describes a new non-destructive method of detecting areas of enriched fuel elements containing excessive U235 , and an instrument designed to inspect uranium-aluminium alloy fuel for the NRU reactor using the new method. The new method is as precise as conventional methods but is m u c h faster. The improvement in test speed depends on the application, but typically m a y be a factor of four. Alternatively, the method m a y be used to improve the precision of the test without increasing the testing time. The method may be used when the U235 concentration in selected areas of a fuel element is estimated by measuring the intensity of 184-keV γ-rays (from the natural decay of U235 ) and when an area is considered acceptable if the measured intensity from it is less than a limiting intensity equivalent to the maximum allowable concentration. It the measured intensity is much less or much greater than the limiting intensity, much less time is required to make this decision than when they are nearly the same. The new method takes advantage of this. It thus inspects each area only as long as is necessary to make a decision with the required confidence. The average time taken in practical cases is less than that taken by conventional methods which inspect each area for a pre-selected time chosen to give the required confidence in the most difficult cases - when the measured and limiting intensities are nearly the same. The new method is based on sequential sampling theory. It may also be used to detect areas with undesirably low U235 concentration. (author)

  3. Statistical properties of the S-wave resonances of {sup 235}U

    Energy Technology Data Exchange (ETDEWEB)

    Leal, L.C.; Derrien, H.; Larson, N.M.


    The resonance parameters of {sup 235}U in the energy range 0 eV to 2.25 keV were obtained from a generalized least squares analysis of a large set of experimental data using the Reich-Moore formalism in the fitting code SAMMY. The aim of the present paper is to present the statistical properties of the s-wave resonance parameters generated from this study.

  4. Uranium content and 235U/238U isotopic ratio in dental porcelain powders determined by neutron activation analysis

    International Nuclear Information System (INIS)

    The uranium contents and 235U/238U isotopic ratios in 48 dental porcelain powders of 8 brands marketed in Japan were determined by non-destructive neutron activation analysis. The photopeak counts of 277.6 keV of 239Np formed by the 238U(n,γ)239U (yield to)239Np + β- reaction and at 1.595.2 keV of 140La produced by 235U fission were measured with a Ge(Li) semiconductor detector system to determine the uranium content and 235U/238U isotopic ratio. The results of the analysis are tabulated and their significance discussed. (author)

  5. Fission fragment mass and angular distribution in 6,7Li+235,238U reactions

    International Nuclear Information System (INIS)

    Fission fragment (FF) angular distributions for 6,7Li+235,238U reactions and mass distributions for 6,7Li+ 238U reactions have been measured at energies near and above the Coulomb barrier. The angle integrated fission cross sections for 6Li induced reactions at sub-barrier energies are found to be higher than 7Li induced reactions possibly due to larger contribution of breakup induced fission in case of the former compared to the latter. The FF anisotropy for 6,7Li+235U was found to be smaller than 6,7Li+238U, manifesting the effect of target ground state spin. The statistical saddle point (SSP) model predictions were found to be consistent with the measured FF anisotropy for 6,7Li+235U, however they were under-estimated for 6,7Li+238U particularly at lower energies. Observation of larger FWHM of FF folding angle distribution and sharp increase in peak to valley ratio for FF mass distribution with the decrease in bombarding energy in 6,7Li+238U reactions confirms the presence of breakup induced fission. (authors)

  6. Fission fragment mass and angular distribution in 6,7Li+235,238U reactions

    Directory of Open Access Journals (Sweden)

    Santra S.


    Full Text Available Fission fragment (FF angular distributions for 6,7Li+235,238U reactions and mass distributions for 6,7Li+238U reactions have been measured at energies near and above the Coulomb barrier. The angle integrated fission cross sections for 6Li induced reactions at sub-barrier energies are found to be higher than 7Li induced reactions possibly due to larger contribution of breakup induced fission in case of the former compared to the latter. The FF anisotropy for 6,7Li+235U was found to be smaller than 6,7Li+238U, manifesting the effect of target ground state spin. The statistical saddle point (SSP model predictions were found to be consistent with the measured FF anisotropy for 6,7Li+235U, however they were under-estimated for 6,7Li+238U particularly at lower energies. Observation of larger FWHM of FF folding angle distribution and sharp increase in peak to valley ratio for FF mass distribution with the decrease in bombarding energy in 6,7Li+238U reactions confirms the presence of breakup induced fission.

  7. Isotope fractionation of 238U and 235U during biologically-mediated uranium reduction (United States)

    Stirling, Claudine H.; Andersen, Morten B.; Warthmann, Rolf; Halliday, Alex N.


    A series of laboratory-controlled microbial experiments using gram-negative sulphate-reducing bacteria (Desulfovibrio brasiliensis) inoculated with natural uranium were performed to investigate 238U/235U fractionation during bacterially-mediated U reduction. Control experiments, without bacteria to drive U reduction, were conducted in parallel. Paired measurements of 238U/235U and U concentration for both the residual growth medium solution and the accumulated biologically-mediated precipitate were obtained using multiple-collector inductively coupled plasma mass spectrometry (MC-ICPMS). The control experiments show that only minor (similar α values. Competing processes such as U co-precipitation (e.g. adsorption) may act to lower the apparent value for α and possibly play a secondary role both in the microbial experiments of this study and in natural U reduction settings where variable α values are found. These results may suggest that microbes adept at inducing U(VI) reduction play a crucial role in facilitating significant 238U/235U isotope fractionation in nature.

  8. Resonance analysis and evaluation of the 235U neutron induced cross sections

    International Nuclear Information System (INIS)

    Neutron cross sections of fissile nuclei are of considerable interest for the understanding of parameters such as resonance absorption, resonance escape probability, resonance self-shielding,and the dependence of the reactivity on temperature. In the present study, new techniques for the evaluation of the 235U neutron cross sections are described. The Reich-Moore formalism of the Bayesian computer code SAMMY was used to perform consistent R-matrix multilevel analyses of the selected neutron cross-section data. The Δ3-statistics of Dyson and Mehta, along with high-resolution data and the spin-separated fission cross-section data, have provided the possibility of developing a new methodology for the analysis and evaluation of neutron-nucleus cross sections. The results of the analysis consists of a set of resonance parameters which describe the 235U neutron cross sections up to 500 eV. The set of resonance parameters obtained through a R-matrix analysis are expected to satisfy statistical properties which lead to information on the nuclear structure. The resonance parameters were tested and showed good agreement with the theory. It is expected that the parametrization of the 235U neutron cross sections obtained in this dissertation represents the current state of art in data as well as in theory and, therefore, can be of direct use in reactor calculations. 44 refs., 21 figs., 8 tabs

  9. Total kinetic energy release in the fast neutron-induced fission of $^{235}$U

    CERN Document Server

    Yanez, R; King, J; Barrett, J S; Fotiades, N; Lee, H Y


    We have measured the total kinetic energy (TKE) release for the $^{235}$U(n,f) reaction for $E_{n}$=2-100 MeV using the 2E method with an array of Si PIN diode detectors. The neutron energies were determined by time of flight measurements using the white spectrum neutron beam at the LANSCE facility. To benchmark the TKE measurement, the TKE release for $^{235}$U(n$_{th}$,f) was also measured using a thermal neutron beam from the Oregon State University TRIGA reactor, giving pre-neutron emission $E^*_{TKE}=170.7\\pm0.4$ MeV in good agreement with known values. Our measurements are thus absolute measurements. The TKE in $^{235}$U(n,f) decreases non-linearly from 169.0 MeV to 161.4 MeV for $E_{n}$=2-90 MeV. Comparison of the data with the multi-modal fission model of Brosa indicates the TKE decrease is a consequence of the growth of symmetric fission and the corresponding decrease of asymmetric fission with increasing neutron energy. The average TKE associated with the Brosa superlong, standard I and standard II ...

  10. Molecular jet emission and a spectroscopic survey of S235AB

    CERN Document Server

    Burns, R A; Hirota, T; Motogi, K; Imai, I; Omodaka, T


    Context. The S235AB star forming region houses a massive young stellar object which has recently been reported to exhibit possible evidence of jet rotation - an illusive yet crucial component of disk aided star formation theories. Aims. To confirm the presence of a molecular counterpart to the jet and to further study the molecular environment in in S235AB. Methods. We search for velocity wings in the line emission of thermal SiO (J=2-1, v=0), a tracer of shocked gas, which would indicate the presence of jet activity. Utilising other lines detected in our survey we use the relative intensities of intra species transitions, isotopes and hyperfine transitions to derive opacities, temperatures, column densities and abundances of various molecular species in S235AB. Results. The SiO (J=2-1, v=0) emission exhibits velocity wing of up to 75 km/s above and below the velocity of the star, indicating the presence of a jet. The molecular environment describes an evolutionary stage resemblant of a hot molecular core.

  11. New signposts of massive star formation in the S235A-B region

    CERN Document Server

    Felli, M; Massi, F; Robberto, M; Cesaroni, Riccardo; Felli, Marcello; Massi, Fabrizio; Robberto, Massimo


    We report on new aspects of the star-forming region S235AB revealed through high-resolution observations at radio and mid-infrared wavelengths. Using the Very Large Array, we carried out sensitive observations of S235AB in the cm continuum (6, 3.6, 1.3, and 0.7) and in the 22 GHz water maser line. These were complemented with Spitzer Space Telescope Infrared Array Camera archive data to clarify the correspondence between radio and IR sources. We made also use of newly presented data from the Medicina water maser patrol, started in 1987, to study the variability of the water masers found in the region. S235A is a classical HII region whose structure is now well resolved. To the south, no radio continuum emission is detected either from the compact molecular core or from the jet-like structure observed at 3.3 mm, suggesting emission from dust in both cases. We find two new compact radio continuum sources (VLA-1 and VLA-2) and three separate maser spots. VLA-1 coincides with one of the maser spots and with a pre...

  12. Calculation of resonance self-shielding for 235U from 0 to 2250 eV

    International Nuclear Information System (INIS)

    Over the years, the evaluated 235U cross sections in the resolved energy range have been extensively revised. A major accomplishment was the first evaluation released to the ENDF/B-VI library. In that evaluation, the low energy range bound was lowered to 10-5 eV, and the upper limit raised to 2,250 eV. Several high-resolution measurements in conjunction with the Bayesian computer code SAMMY were used to perform the analysis of the 235U resonance parameters. SAMMY uses the Reich-Moore formalism, which is adequate for representing neutron cross sections of fissile isotopes, and a generalized least-squares (Bayes) technique for determining the energy-dependence of the neutron cross sections. Recently a re-evaluation of the 235U cross section in the resolved resonance region was completed. This evaluation has undergone integral tests in various laboratories throughout the USA and abroad. The evaluation has been accepted for inclusion in ENDF/B-VI release 5. The intent of this work is to present results of calculations of self-shielded fission rates carried out with these resonance parameters and to compare those fission rates with experimental data. Results of this comparison study provide an assessment of the resonance parameters with respect to the calculation of self-shielded group cross sections

  13. Activation Doppler Measurements on U 238 and U 235 in Some Fast Reactor Spectra

    International Nuclear Information System (INIS)

    Measurements of the Doppler effect in U-238 capture and U-235 fission have been made by means of the activation technique in three different neutron spectra in the fast critical assembly FR0. The experiments involved the irradiation of thin uranium metal foils or oxide disks, which were heated in a small oven located at the core centre. The measurements on U-238 were extended to 1780 deg K and on U-235 to 1470 deg K. A core region surrounding the oven was homogenized in order to facilitate the interpretation of results. The reaction rates in the uranium samples were detected by gamma counting. The experimental method was checked with regard to systematic errors by irradiations in a thermal spectrum. The data obtained for U-238 capture were corrected for the effect of neutron collisions in the oven wall, and were extrapolated to zero sample thickness. In the softest spectrum (core 5) a Doppler effect (relative increase in capture rate) of 0.260 ± 0.018 was obtained on heating from 343 to 1780 deg K, and in the hardest spectrum (core 3) the corresponding value was 0.030 ± 0.003. An appreciable Doppler effect in U-235 fission was obtained only in the softest spectrum, in which the measured increase in fission rate on heating from 320 to 1470 deg K was 0.007 ± 0.003

  14. Inhaled americium dioxide

    International Nuclear Information System (INIS)

    This project includes experiments to determine the effects of Zn-DTPA therapy on the retention, translocation and biological effects of inhaled 241AmO2. Beagle dogs that received inhalation exposure to 241AmO2 developed leukopenia, clincial chemistry changes associated with hepatocellular damage, and were euthanized due to respiratory insufficiency caused by radiation pneumonitis 120 to 131 days after pulmonary deposition of 22 to 65 μCi 241Am. Another group of dogs that received inhalation exposure to 241AmO2 and were treated daily with Zn-DTPA had initial pulmonary deposition of 19 to 26 μCi 241Am. These dogs did not develop respiratory insufficiency, and hematologic and clinical chemistry changes were less severe than in the non-DTPA-treated dogs

  15. Phytic acid as a corrosion inhibitor for 235 steel in NaCl solution%植酸自组装膜对Q235钢在氯化钠溶液中的缓蚀作用

    Institute of Scientific and Technical Information of China (English)

    王凤平; 胡隋军; 唐丽娜


    The corrosion inhibition of phytic acid on Q235 steel in NaCl solution was investigated by weight loss technique ,scanning electronic microscopy and the energy spectrum of X rays .The results show that inhibition efficiency of phytic acid on Q 235 steel in NaCl solution is obviously different at different pH .Phytic acid can accelerate the corrosion rate of Q 235 steel under acidic condition .But under neutral and alkaline condition ,phytic acid has excellent corrosion inhibition for 235steel in NaCl solution .Nevertheless ,the corrosion inhibition efficiency of phytic acid for Q235 steel in NaCl solu-tion increases with increasing phytic acid concentration under neutral and alkaline condition .If the concentration of phytic acid is 0 .5% ,the inhibition efficiency is more than 90% .%从植物中提取的植酸作金属缓蚀剂对环境保护具有重要意义.采用失重法、扫描电子显微镜和X射线能谱研究了植酸对Q235钢在NaCl溶液中的缓蚀行为以及影响因素.失重实验结果表明,不同p H值植酸对Q 235钢的缓蚀效果明显不同,在酸性条件下植酸加速Q235钢的腐蚀,在中性及碱性条件下,植酸对Q235钢的腐蚀具有明显的抑制作用.中性或碱性条件下,NaCl溶液中植酸对Q235钢缓蚀效率随植酸浓度的增加而增加,植酸浓度达0.5%以上时,缓蚀效率高达90%以上.扫描电镜结果表明,植酸处理后的Q235钢表面生成膜在不同pH下明显不同,碱性条件下的生成膜明显好于酸性条件下的生成膜.

  16. Isotope fractionation of 238U and 235U during biologically-mediated uranium reduction (United States)

    Stirling, Claudine H.; Andersen, Morten B.; Warthmann, Rolf; Halliday, Alex N.


    A series of laboratory-controlled microbial experiments using gram-negative sulphate-reducing bacteria (Desulfovibrio brasiliensis) inoculated with natural uranium were performed to investigate 238U/235U fractionation during bacterially-mediated U reduction. Control experiments, without bacteria to drive U reduction, were conducted in parallel. Paired measurements of 238U/235U and U concentration for both the residual growth medium solution and the accumulated biologically-mediated precipitate were obtained using multiple-collector inductively coupled plasma mass spectrometry (MC-ICPMS). The control experiments show that only minor (<0.1‰), if any 238U/235U fractionation occurs during co-precipitation with calcite. This implies that carbonate sediments are capable of faithfully recording the signature of the global ocean during Earth's major climatic events, including oxygenation and de-oxygenation transitions in the marine environment. The results for the microbial experiments demonstrate that the 238U/235U composition of the unreacted growth medium containing U(VI) is isotopically lighter than the composition of the U(IV)-bearing precipitate as U(VI) is consumed, in agreement with field-based observations of microbially-mediated U reduction. Uranium isotopic shifts of up to 0.8‰ were observed between the liquid and solid phases. These observations can be modelled using a Rayleigh distillation approach describing kinetic uptake in a closed system, which yields a fractionation factor α of 0.99923 ± 0.00004 (ε = -0.77 ± 04‰) for U(VI)-U(IV) reduction mediated by the D. brasiliensis microbe. This fractionation behaviour is consistent with that observed in field-based redox environments, which give rise to similar α values. Competing processes such as U co-precipitation (e.g. adsorption) may act to lower the apparent value for α and possibly play a secondary role both in the microbial experiments of this study and in natural U reduction settings where

  17. Partitioning studies in China and the separation of americium and fission product rare earths with dialkyl phosphinic acid and its thio-substituted derivatives

    International Nuclear Information System (INIS)

    Studies on the TRPO extractions process for recovering actinides from highly active waste (HAW) and its application to the pretreatment of Chinese HAW are described. The removal of Sr by di-cyclohexyl 18 crown 6 and the removal of Cs by spherical titanium ferrous hexa-cyanate from acidic waste are also described. Results of the extraction of trivalent americium and fission product rare earths (FPREs) by dialkyl-phosphinic, dialkyl-mono-thio-phosphinic and dialkyl-di-thio-phosphinic acids are reported. Dialkyl-thio-phosphinic acid (commercial product Cyanex 301, alkyl =2, 4, 4-methyl-pentyl) shows very high selectivity towards Am. Using 1M Cyanex 301 -kerosene as extractant, 99.9 % Am can be separated from 0.5M(Pr+Nd)(NO3)3 solution with 3-4 extraction stages and 3-4 scrubbing stages. (authors)

  18. Theoretical and experimental study of the bio-geochemical behaviour of americium 241 in simplified rhizosphere conditions. Application to a calcareous agricultural soil

    International Nuclear Information System (INIS)

    Americium 241, is one of the most radio-toxic contaminant produced during the nuclear fuel cycle. It can be found in all environmental compartments, in particular the soils. The main goals of this study are to identify, quantify and model the effect of the main factors controlling the mobility of 241Am in the rhizosphere and the agricultural soils. The physico-chemical parameters of the soil and of the soil solution, the potential role of microorganisms on the sorption-desorption processes, and the speciation of americium in solution have been more particularly studied. 241Am remobilization has been studied at the laboratory using leaching experiments performed in controlled conditions on reworked calcareous soils artificially contaminated with 241Am. The soil samples have been washed out in different hydrodynamic conditions by solutions with various compositions. The eluted solution has been analyzed (pH, conductivity, ionic composition, Fetot, organic acids, 241Am) and its bacterial biomass content too. The overall results indicate that 241Am remobilization is contrasted and strongly linked with the condition under study (pH, ionic strength, glucose and/or citrate concentration). Therefore, a solution in equilibrium with the soil or containing small exudate concentrations (10-4 M) re-mobilizes only a very small part of the americium fixed on the solid phase. The desorption of 241Am corresponds to a solid/liquid coefficient of partition (Kd) of about 105 A significant addition of glucose induces an important dissolution of soil carbonates by the indirect action of microorganisms, but does not significantly favor the 241Am remobilization. On the other hand, the presence of strong citrate concentrations (≥ 10-2 M) allows 300 to 10000 time greater re-mobilizations by the complexing of 241Am released after the dissolution of the carrying phases. Finally, the colloidal transport of 241Am has been systematically observed in a limited but significant extend and

  19. An evaluation of the VM/VF ratio to standard UO2 and MOX fuel with 4,5% enrichment and 1% of americium insertion

    International Nuclear Information System (INIS)

    A growing interest exists in the development of techniques for burning and transmuting minor actinides. Some indicate the possibility of differentiated burnup when studying different VM/VF. The VM/VF ratio, moderator volume/fuel volume, is directly related with the value obtained for the multiplication factor k. There is a VM/VF for which k is maximum, and this is directly related with the fuel composition. This work is a study to find a better value of VM/VF, using the WIMS-D5 code, considering a UO2 fuel and a MOX fuel, with 1% Americium insertion. The following parameters were appraised: spectrum hardening, boron worth, and reactivity temperature coefficients. (author)

  20. Recovery of Americium-241 from lightning rod by the method of chemical treatment; Recuperacion del Americio-241 provenientes de los pararrayos por el metodo de tratamiento quimico

    Energy Technology Data Exchange (ETDEWEB)

    Cruz, W.H., E-mail: [Instituto Peruano de Energia Nuclear (GRRA/IPEN), Lima (Peru). Division de Gestion de Residuos Radiactivos


    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ({sup 241}Am), fewer and Radium 226 ({sup 226}Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of {sup 241}Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The {sup 241}Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel {sup 241}Am technique was used electrodeposition. (author)

  1. An R matrix analysis of the 235U neutron-induced cross sections up to 500 eV

    International Nuclear Information System (INIS)

    In this paper a detailed evaluation of the R matrix resonance parameters describing the interaction of neutrons with 235U has been performed up to 500 eV using the most recent high-resolution measurements of the 235U neutron cross sections. The availability of 235U spin-separated neutron cross-section data, in conjunction with the use of the Δ3 statistics of Metha and Dyson, has made possible a detailed study of the statistical distribution of the resonance parameters and their average values. The present R matrix resonance parameters have been converted into equivalent sets of Adler- Adler parameters and multipole momentum space expansion parameters. Extensive validation of this evaluation has been performed by comparing self-shielded fission rates computed with these R matrix parameters with the measurements of Czirr; a test of the ENDF/B unresolved resonance formalism for the calculation of 235U of self-shielding factors is also presented

  2. Preliminary application of 241-Americium calcaneus bone mineral density measurement in osteoporosis. Comparison with double X-ray densitometry of the lumber spine

    International Nuclear Information System (INIS)

    Bone mineral density (BMD) of calcaneus in 54 normals, 45 Osteoporosis, 25 suspected osteoporosis and 16 other non-osteoporosis patients, a total of 140 cases were measured by HUAKE (HK-1) 241-Americium BMD absorpmetry, among them 43 were compared with that of lumber spine (L2 - L4) measured by Lunar Corporation's Expert-XL absorpmeter. BMD of normal group of calcaneus was (409.8 +- 79.4) mg/cm2. The BMD were decreased slowly with the increasing age. The BMD of osteoporosis, suspected osteoporosis and non-osteoporosis group were 230.3 +- 62.3, 395.7 +- 57.4 and 363.3 +- 51.9 mg/cm2 respectively. The BMD of osteoporosis group was much lower than that of normal group, and also lower than that of the other two groups, among 26 patients (57.78%) had bone fracture, all was in accordance with the clinical diagnosis of osteoporosis. The BMD of suspected osteoporosis and non-osteoporosis had no significant difference with normal group. The coefficient variation (CV) of BMD in repeated measurement in calcaneus of 4 participants was less than 1.2%. The correlative coefficient (r) between BMD of calcaneus and lumber spine (L2 - L4) group was 0.6824. The correlative coefficient of normal young adult-matched percentage and T value in 2 groups were 0.6863 and 0.6755 respectively, whereas aged-matched percentage, Z value were 0.4614 and 0.5009 respectively. In conclusion 241-Americium calcaneus BMD absorpmetry has the advantage of low price, easy to operate, reliable and valuable in diagnosis osteoporosis. The correlations of calcaneus and lumber spine BMD, normal young adult-matched percentage and T value were rather good

  3. Safe handling of kilogram amounts of fuel-grade plutonium and of gram amounts of plutonium-238, americium-241 and curium-244

    International Nuclear Information System (INIS)

    During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239Pu containing 8-12% 240Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241Am, 243Am and 244Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)

  4. Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu

    International Nuclear Information System (INIS)

    Differential-neutron-emission cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232Th, 233U, 235U and 238U inelastic-scattering values, poor agreement is observed for 240Pu, and a serious discrepancy exists in the case of 239Pu

  5. Test spectra experimental construction for evaluating gamma-spectrometry computer codes for the 235U determination

    Directory of Open Access Journals (Sweden)

    Karfopoulos Konstantinos L.


    Full Text Available The determination of 235U in environmental samples from its 185.72 keV photons may require the deconvolution of the multiplet photopeak at ~186 keV, due to the co-existence of the 186.25 keV photons of 226Ra in the spectrum. Successful deconvolution depends on many parameters, such as the detector characteristics, the activity concentration of the 235U and 226Ra in the sample, the background continuum in the 186 keV energy region and the gamma-spectrometry computer code used. In this work two sets of experimental test spectra were constructed for examining the deconvolution of the multiplet photopeak performed by different codes. For the construction of the test spectra, a high-resolution low energy germanium detector was used. The first series consists of 140 spectra and simulates environmental samples containing various activity concentration levels of 235U and 226Ra. The second series consists of 280 spectra and has been derived by adding 137Cs, corresponding to various activity concentration levels, to specific first series test spectra. As the 137Cs backscatter edge is detected in the energy region of the multiplet photopeak at ~186 keV, this second series of test spectra tests the analysis of the multiplet photopeak in high background continuum conditions. The analysis of the test spectra is performed by two different g-spectrometry analysis codes: (a spectrum unix analysis code, a computer code developed in-house and (b analysis of germanium detector spectra, a program freely available from the IAEA. The results obtained by the two programs are compared in terms of photopeak detection and photopeak area determination.

  6. Absolute measurement of $sup 235$U fission cross-section for 2200 m/sec neutrons

    Energy Technology Data Exchange (ETDEWEB)

    Borcea, C.; Borza, A.; Buta, A.


    The results of an absolute fission cross-section measurement of /sup 235/ U are presented; the thermal neutrons were selected by the time-of-flight method. The principle of the method and the experimental apparatus are described. The method had the advantage of avoiding the use of an intermediate cross section in the neutron flux determination by choice of a B target thick enough to absorb all thermal neutrons. Target preparation, efficiency determination, corrections, etc., are reported. The value determined was 581.7 plus or minus 7.8 barns. (6 figures, 4 tables) (RWR)

  7. Measurement of reflect neutron for 252Cf in cement cylinder by method of 235U fission

    International Nuclear Information System (INIS)

    The experiment theory of Research of neutron reflected coefficient for 252Cf in cement reflector was introduced. The fission rate of 235U with reflector, without reflector and with background was measured. The neutron reflected coefficient with cement reflector was concluded from fission rate and the reflected coefficient for different neutron source in the same experiment model was compared. The relation of reflected coefficient with angle was analyzed. The technology of solid track was researched and the best etch condition was explored. The trend of discharge count with coders thickness and etch thickness was gained. Efficiency for spark auto counters was measured and the technology of solid track was developed. (authors)

  8. Neutron shielding verification measurements and simulations for a 235-MeV proton therapy center

    CERN Document Server

    Newhauser, W D; Dexheimer, D; Yan, X; Nill, S


    The neutron shielding at the Massachusetts General Hospital's 235-MeV proton therapy facility was investigated with measurements, analytical calculations, and realistic three-dimensional Monte Carlo simulations. In 37 of 40 cases studied, the analytical calculations predicted higher neutron dose equivalent rates outside the shielding than the measured, typically by more than a factor of 10, and in some cases more than 100. Monte Carlo predictions of dose equivalent at three locations are, on average, 1.1 times the measured values. Except at one location, all of the analytical model predictions and Monte Carlo simulations overestimate neutron dose equivalent.

  9. Activity of HMR 3647 Compared to Those of Six Compounds against 235 Strains of Enterococcus faecalis


    Hoellman, Dianne B.; Lin, Gengrong; Jacobs, Michael R.; Appelbaum, Peter C.


    Agar dilution was used to test the activities of HMR 3647, erythromycin A, azithromycin, clarithromycin, roxithromycin, clindamycin, and quinupristin-dalfopristin against 235 strains of Enterococcus faecalis. HMR 3647 was the most active compound (MICs at which 50 and 90% of the isolates are inhibited [MIC50 and MIC90, respectively] of 0.06 and 4.0 μg/ml, respectively). The MIC50 and MIC90 (with the MIC50 given first and the MIC90 given second; both in micrograms per milliliter) for other com...

  10. Fission product yields from 22 MeV neutron-induced fission of 235U

    International Nuclear Information System (INIS)

    The chain yields of 28 product nuclides were determined for the fission of 235U induced by 22 MeV neutrons for the first time. Absolute fission rate was monitored with a double-fission chamber. Fission product activities were measured by HPGe γ-ray spectrometry. Time of flight technique was used to measure the neutron spectrum in order to estimate fission events induced by break-up neutrons and scattering neutrons. A mass distribution curve was obtained and the dependence of fission yield on neutron energy is discussed

  11. A `Water Spout' Maser Jet in S235AB-MIR


    Burns, Ross A.; Imai, Hiroshi; HANDA, Toshihiro; Omodaka, Toshihiro; Nakagawa, Akiharu; NAGAYAMA, Takumi; Ueno, Yuji


    We report on annual parallax and proper motion observations of H2O masers in S235AB-MIR, which is a massive young stellar object in the Perseus Arm. Using multi-epoch VLBI astrometry we measured a parallax of pi = 0.63 +- 0.03 mas, corresponding to a trigonometric distance of D = 1.56+-0.09 kpc, and source proper motion of ( u alpha cos d , u d) = (0.79 +- 0.12, -2.41 +- 0.14) mas/yr. Water masers trace a jet of diameter 15 au which exhibits a definite radial velocity gradient perpendicular t...

  12. New signposts of massive star formation in the S235A-B region (United States)

    Felli, M.; Massi, F.; Robberto, M.; Cesaroni, R.


    Aims.We report on new aspects of the star-forming region S235AB revealed through high-resolution observations at radio and mid-infrared wavelengths. Methods: .Using the Very Large Array, we carried out sensitive observations of S235AB in the cm continuum (6, 3.6, 1.3, and 0.7) and in the 22 GHz water maser line. These were complemented with Spitzer Space Telescope Infrared Array Camera archive data to clarify the correspondence between radio and IR sources. We made also use of newly presented data from the Medicina water maser patrol, started in 1987, to study the variability of the water masers found in the region. Results: .S235A is a classical HII region whose structure is now well resolved. To the south, no radio continuum emission is detected either from the compact molecular core or from the jet-like structure observed at 3.3 mm, suggesting emission from dust in both cases. We find two new compact radio continuum sources (VLA-1 and VLA-2) and three separate maser spots. VLA-1 coincides with one of the maser spots and with a previously identified IR source (M 1). VLA-2 lies towards S235B and represents the first radio detection from this peculiar nebula that may represent an ionized wind from a more evolved star. The two other maser spots coincide with an elongated structure previously observed within the molecular core in the C34S line. This structure is perpendicular to a bipolar molecular outflow observed in HCO+(1-0) and may trace the associated equatorial disk. The Spitzer images reveal a red object towards the molecular core. This is the most viable candidate for the embedded source originating the outflow and maser phenomenology. Conclusions: .The picture emerging from these and previous data shows the extreme complexity of a small (≤0.5 pc) star-forming region where widely different stages of stellar evolution are present.

  13. Critical experiments to determine amount of U-235 in research reactor fuel assemblies

    International Nuclear Information System (INIS)

    Four different critical core configurations of the IRR1 [Bettan, M., Hirshfeld H., Levine, S.H., 2002. Method to determine the burnup of the IRR1 fuel assemblies. In: Proceedings of the 21st Conference of the Nuclear Societies in Israel, p. 38-41], Cores 1, 2, 3, and 4, have been used to determine experimentally the reactivity changes caused by interchanging different fuel assemblies (FAs) in the same core position [Bettan, M., Hirshfeld H., Levine, S.H., 2002. Method to determine the burnup of the IRR1 fuel assemblies. In: Proceedings of the 21st Conference of the Nuclear Societies in Israel, p. 38-41; Levine, S.H., Kim, S.S., 1985. Development of an asymmetric multiple-position neutron source (AMPNS) method to monitor the criticality of a degraded reactor core. Ann. Nucl. Energy 12, 517; IAEA-TECDOC-633, 1992. Determination of research fuel burnup, January]. The different fuel assemblies varied in their burnup or loss in U-235 causing the core reactivity to change systematically with each FA interchange. The control blade height was altered to compensate for this change in the core reactivity to maintain the core critical. The control blade reactivity worth as a function of its height was measured by period measurements so that the reactivity change due to the interchange of an FA was determined. The WIMS/EXT2 [WIMS-D4: Winfrith Improved Multigroup Scheme (WIMS) code system, 1969. Computer Code Package CCC-576, RSICC/ORNL, Oak Ridge, TN; Fowler, T.B. et al., 1967. EXTERMINATOR-II: A FORTRAN IV Code for solving multigroup diffusion equations in two dimensions, ORNL-4078, ORNL, April] codes are used to evaluate the change in core reactivity as a function of FA U-235 or burnup. By relating the calculation of the reactivity change with the measured reactivity change, the burnup or U-235 mass in each FA is determined. The U-235 mass of the FAs gave good agreement between measurements made of the same FA in different cores and appears to bring better agreement between

  14. Neutron cross sections for uranium-235 (ENDF/B-IV Release 3)

    International Nuclear Information System (INIS)

    The resonance parameters in ENDF6 (Release 2) U235 were adjusted to make the average capture and fission cross sections below 900 eV agree with selected differential capture and fission measurements. The measurements chosen were the higher of the credible capture measurements and the lower of the fission results, yielding a higher epithermal alpha. In addition, the 2200 m/s cross sections were adjusted to obtain agreement with the integral value of K1. As a result, criticality calculations for thermal benchmarks, and agreement with a variety of integral parameters, are improved

  15. Test of the ENDF/B [Evaluated Nuclear Data File] unresolved resonance formalism for 235U

    International Nuclear Information System (INIS)

    It is common practice in ENDF/B [Evaluated Nuclear Data File] to represent neutron cross sections in the unresolved resonance region by specifying the average values and distribution laws of resonance parameters. This formalism allows the calculation of resonance self-shielding and of its variation with temperature. The purpose of this paper is to present a test of the validity of the formalism by comparing self-shielding factors computed with the ENDF/B unresolved formalism with values computed with the resolved resonance parameters recently evaluated for the neutron cross sections of 235U

  16. 235U fission product gamma spectra: a comparison between experiment and calculation

    International Nuclear Information System (INIS)

    Recent measurements of 235U fission product gamma spectra (ORNL), after reduction to a broad group structure, were compared with results of corresponding summation calculations which were made with the UKFPDD-1 fission product data base. In order to facilitate convenient integration of the summation results, weighted sums of decaying exponentials were accurately fitted to them using an iterative least-squares method described. The comparisons between experiment and calculation reveal significant deficiencies in data for short-lived nuclides which prevent the accurate calculation of short-term ( 5 MeV are also examined briefly and possible causes for them are discussed. (author)

  17. Beyond G-band : a 235 GHz InP MMIC amplifier (United States)

    Dawson, Douglas; Samoska, Lorene; Fung, A. K.; Lee, Karen; Lai, Richard; Grundbacher, Ronald; Liu, Po-Hsin; Raja, Rohit


    We present results on an InP monolithic millimeter- wave integrated circuit (MMIC) amplifier having 10-dB gain at 235 GHz. We designed this circuit and fabricated the chip in Northrop Grumman Space Technology's (NGST) 0.07- m InP high electron mobility transistor (HEMT) process. Using a WR3 (220-325 GHz) waveguide vector network analyzer system interfaced to waveguide wafer probes, we measured this chip on-wafer for -parameters. To our knowledge, this is the first time a WR3 waveguide on-wafer measurement system has been used to measure gain in a MMIC amplifier above 230 GHz.

  18. Are 0.1%-accurate gamma-ray assays possible for 235U solutions

    International Nuclear Information System (INIS)

    The factors influencing the accuracy of passive gamma-ray assay of uniform, homogeneous solution samples have been studied in some detail, particularly for the assay of 235U in uranium solutions. Factors considered are the overall long-term electronic stability, the information losses caused by the rate-related electronic processes of pulse pileup and dead-time, and the self-attenuation of gamma rays within the samples. Both experimental and computational studies indicate that gamma-ray assay procedures for solution samples of moderate size (from approx. 10 to perhaps a few hundred milliliters) are now capable of accuracies approaching 0.1% in many practical cases

  19. Comparison and validation of different 235U fast fission delayed neutron group parameters

    International Nuclear Information System (INIS)

    The differences between 235U fast fission delayed neutron group parameters in ENDF/B7, JEFF 3.1, JENDL 3.3, CENDL 2.2 and Keepin datum were analyzed. The delayed neutron group parameters were validated by experiments on CFBR-II. The Keepin delayed neutron group parameters are more accurate than delayed neutron group parameters in the primary nuclear databases. The eight-group delayed neutron parameters in JEEF 3.1 are better than six-group delayed neutron parameters in other databases. (authors)

  20. O polimorfismo AGT*M235T na disfunção cardíaca de etiologia isquêmica aguda: projeto gisca AGT*M235T polymorphism in acute ischemic cardiac dysfunction: the gisca project

    Directory of Open Access Journals (Sweden)

    Claudia Guerra Murad Saud


    Full Text Available FUNDAMENTO: O polimorfismo AGT*M235T tem sido associado a elevados níveis séricos de angiotensinogênio (AGT, hipertensão arterial sistêmica e disfunção cardíaca (DC. OBJETIVO: Testar a hipótese de haver associação entre polimorfismo AGT*M235T e o risco de desenvolver disfunção cardíaca (insuficiência cardíaca ou disfunção sistólica ventricular esquerda assintomática pós-síndrome coronariana aguda (SCA, durante o período de internação hospitalar. MÉTODOS: Foram estudados 363 pacientes (idade média 62 ± 12 anos, sendo 233 (64% homens e 130 (36% mulheres, todos da mesma coorte, internados por SCA. Compararam-se dados clínicos e genéticos dos 117 (32,2% que evoluíram com disfunção cardíaca (grupo caso com os dos 246 (67,8%, que não desenvolveram tal condição (grupo controle. O polimorfismo AGT*M235T foi determinado por análise de sequenciamento e estava em equilíbrio de Hardy-Weinberg. RESULTADOS: Houve diferença significativa na distribuição dos genótipos nas mulheres, com predomínio do genótipo *235MM no grupo controle (p = 0,001 e do alelo *235T no grupo caso. Em ambos os sexos, nos modelos de regressão logística, o diagnóstico de infarto de parede anterior na admissão foi fator de incremento no risco de DC, enquanto angina instável na admissão, ausência do alelo *235T, glicemia 60 e BACKGROUND: AGT*M235T polymorphism has been associated with high serum angiotensinogen (AGT levels, systemic hypertension and cardiac dysfunction (CD. OBJECTIVE: To test the hypothesis of AGT*M235T polymorphism being associated with the risk of developing cardiac dysfunction (heart failure or asymptomatic left ventricular systolic dysfunction after acute coronary syndrome (ACS during hospitalization. METHODS: A total of 363 patients (mean age of 62 ± 12 years, of whom 233 (64% were men and 130 (36% were women, all from the same cohort and hospitalized for ACS, were studied. Clinical and genetic data from the 117

  1. Prompt Fission Neutron Experiments on 235U(n,f) and 252Cf(SF) (United States)

    Göök, A.; Hambsch, F.-J.; Oberstedt, S.; Vidali, M.

    For nuclear modeling and improved evaluation of nuclear data knowledge about fluctuations of the prompt neutron multiplicity as a function of incident neutron energy is requested for the major actinides 235U and 239Pu. Experimental investigations of the prompt fission neutron emission in resonance neutron induced fission on 235U are taking place at the GELINA facility of the IRMM. The experiment employs an array of neutron scintillation-detectors (SCINTIA) in conjunction with a newly designed 3D position sensitive twin Frisch-grid ionization chamber. A preparatory experiment on prompt fission neutron emission in 252Cf(SF) was undertaken to verify analysis procedures relevant for the implementation of the SCINTIA neutron detector array. The available literature data on the TKE dependence of the multiplicity show strong deviations. Therefore, effort was focused on investigating experimental factors in low efficiency neutron counting experiments that may lead to faulty determination of this dependence. Taking these factors into account a result that agree well with data from high efficiency neutron counting experiments is obtained.

  2. Propagation Channel Comparison between 23.5 and 45 GHz in Conference Scenario

    Directory of Open Access Journals (Sweden)

    Jianwu Dou


    Full Text Available The characteristics of propagation channel at 23.5 and 45 GHz in an indoor conference room are studied based on hybrid approach. A ray-based simulator which includes the reflection, penetration, diffraction, and diffuse scattering is adopted to generate the massive channel realizations. This platform is well calibrated in path and power delay profile (PDP levels according to some specified measurements at different frequencies. Subsequently, according to the simulated channel samples, the statistical channel model for both the large and small scale characteristics is established based on the alpha-beta approach and extended Saleh-Valenzuela (S-V structure, respectively. Results show that the slope of fitted path loss (PL is less than free space due to the waveguide effect for both 23.5 and 45 GHz in indoor scenario and larger PL is experienced at higher frequency. Additionally, the cluster is more centralized with less spreads and decaying faster in delay domain at 45 GHz.

  3. New Precision Measurements of the U235(n,γ) Cross Section (United States)

    Jandel, M.; Bredeweg, T. A.; Bond, E. M.; Chadwick, M. B.; Couture, A.; O'Donnell, J. M.; Fowler, M.; Haight, R. C.; Kawano, T.; Reifarth, R.; Rundberg, R. S.; Ullmann, J. L.; Vieira, D. J.; Wouters, J. M.; Wilhelmy, J. B.; Wu, C. Y.; Becker, J. A.


    The neutron capture cross section of U235 was measured for the neutron incident energy region between 4 eV and 1 MeV at the DANCE facility at the Los Alamos Neutron Science Center with an unprecedented accuracy of 2-3% at 1 keV. The new methodology combined three independent measurements. In the main experiment, a thick actinide sample was used to determine neutron capture and neutron-induced fission rates simultaneously. In the second measurement, a fission tagging detector was used with a thin actinide sample and detailed characteristics of the prompt-fission gamma rays were obtained. In the third measurement, the neutron scattering background was characterized using a sample of Pb208. The relative capture cross section was obtained from the experiment with the thick U235 sample using a ratio method after the subtraction of the fission and neutron scattering backgrounds. Our result indicates errors that are as large as 30% in the 0.5-2.5 keV region, in the current knowledge of neutron capture as embodied in major nuclear data evaluations. Future modifications of these databases using the improved precision data given herein will have significant impacts in neutronics calculations for a variety of nuclear technologies.

  4. Fission-Neutron Spectra of U235, Pu239 And Cf252

    International Nuclear Information System (INIS)

    Measurements of the fission neutron spectra from the neutron-induced fission of U235 and Pu239, and the spontaneous fission of Cf252, have been made. The spectra were measured with a time-of-flight technique using a plastic scintillator as the fission-neutron detector. The low energy part of the Cf252 fission-neutron spectrum (below 0.3 MeV) was also measured with a Li6 -glass detector replacing the plastic scintillator. The fissile materials were mounted in xenon-gas scintillation cham-bers. The primary neutrons were produced by a 2.5-MeV Van de Graaff accelerator with top terminal pulsing. The resolving time of the time-of-flight equipment was better than 3 ns. Results fitted to Maxwellian distributions, √Ee-E/T, are presented for neutron-induced fissions of U235 at 40 keV and 1.5 MeV of incident neutron energy and for Pu239 at 40 keV. Results are also given for the fission-neutron energy spectrum of Cf252. (author)

  5. PC based manual and safety logic card test setup for 235 MWe PHWRs

    International Nuclear Information System (INIS)

    Fuel handling controls for 235 MWe PHWR make use of Manual and Logic cards (MLCs) for providing safety interlocks. These cards consist of various type of logic blocks. By connecting these logic blocks all the safety interlocks required for fuel handling controls have been provided. Previously trouble shooting of these cards was done by means of logic probe. Since the method was manual, it was laborious and time consuming. PC based test setup has overcome this drawback and detects the fault at the component level within few seconds. It also gives printout of status of faulty MLC cards. Here motherboard has been designed having slots for insertion of MLC cards. The input/output connection of these cards are coming to two 50 pin FRC connectors. PC communicates through 144 line digital input/output card with MLC card under test. Software is user friendly and outputs suitable input patterns to the card under test and checks for output pattern. It compares this output pattern with compare pattern and detects the fault and displays the symptoms. This system is currently in use at test facility for fuelling machine for 235 MWe PHWR reactor at Refuelling Technology Division, Hall-7. This test setup has been proposed for use at NAPP and future reactors. (author). 4 figs., 1 annexure

  6. Consistent Data Assimilation of Actinide Isotopes: 235U and 239Pu

    International Nuclear Information System (INIS)

    In this annual report we illustrate the methodology of the consistent data assimilation that allows to use the information coming from integral experiments for improving the basic nuclear parameters used in cross section evaluation. A series of integral experiments were analyzed using the EMPIRE evaluated files for 235U, 238U, and 239Pu. Inmost cases the results have shown quite large worse results with respect to the corresponding existing evaluations available for ENDF/B-VII. The observed discrepancies between calculated and experimental results were used in conjunction with the computed sensitivity coefficients and covariance matrix for nuclear parameters in a consistent data assimilation. Only the GODIVA and JEZEBEL experimental results were used, in order to exploit information relative to the isotope of interest that are, in this particular case: 235U and 239Pu. The results obtained by the consistent data assimilation indicate that with reasonable modifications (mostly within the initial standard deviation) it is possible to eliminate the original large discrepancies on the Keff of the two critical configurations. However, some residual discrepancy remains for a few fission spectral indices that are, most likely, to be attributed to the detector cross sections.

  7. A multi-wavelength study of star formation activity in the S235 complex

    CERN Document Server

    Dewangan, L K; Luna, A; Anandarao, B G; Ninan, J P; Mallick, K K; Mayya, Y D


    We have carried out an extensive multi-wavelength study to investigate the star formation process in the S235 complex. The S235 complex has a sphere-like shell appearance at wavelengths longer than 2 $\\mu$m and harbors an O9.5V type star approximately at its center. Near-infrared extinction map traces eight subregions (having A$_{V}$ $>$ 8 mag), and five of them appear to be distributed in an almost regularly spaced manner along the sphere-like shell surrounding the ionized emission. This picture is also supported by the integrated $^{12}$CO and $^{13}$CO intensity maps and by Bolocam 1.1 mm continuum emission. The position-velocity analysis of CO reveals an almost semi-ring like structure, suggesting an expanding H\\,{\\sc ii} region. We find that the Bolocam clump masses increase as we move away from the location of the ionizing star. This correlation is seen only for those clumps which are distributed near the edges of the shell. Photometric analysis reveals 435 young stellar objects (YSOs), 59\\% of which ar...

  8. Molecular Emission in Dense Massive Clumps from the Star-Forming Regions S231-S235

    CERN Document Server

    Ladeyschikov, D A; Tsivilev, A P; Sobolev, A M


    The article deals with observations of star-forming regions S231-S235 in 'quasi-thermal' lines of ammonia (NH$_3$), cyanoacetylene (HC$_3$N) and maser lines of methanol (CH$_3$OH) and water vapor (H$_2$O). S231-S235 regions is situated in the giant molecular cloud G174+2.5. We selected all massive molecular clumps in G174+2.5 using archive CO data. For the each clump we determined mass, size and CO column density. After that we performed observations of these clumps. We report about first detections of NH$_3$ and HC$_3$N lines toward the molecular clumps WB89 673 and WB89 668. This means that high-density gas is present there. Physical parameters of molecular gas in the clumps were estimated using the data on ammonia emission. We found that the gas temperature and the hydrogen number density are in the ranges 16-30 K and 2.8-7.2$\\times10^3$ cm$^{-3}$, respectively. The shock-tracing line of CH$_3$OH molecule at 36.2 GHz is newly detected toward WB89 673.

  9. Measuring the absorption mean cross section in 6Li relative to 235U fission

    International Nuclear Information System (INIS)

    Due to the fact that the neutron absorption cross section in 6Li is used as one of standards for determinaton of neutron-physical characteristics of fast reactors the ratio of mean cross sections for absorption by 6Li (A6) and 235U fission F25 are experimentalli investigated. The measurements have been performed in the KBR-8, KBR-10,BFS/39/1 bfs-44, BFS/45a-1 and BFS-46 critical assemblies which are characterized by various neutron spectra by means of a lithium counter with semiconductor detectors. Ratios A6/F25 for investigated assemblies constituted respectively 0.605+-0.009; 0.604+-0.004; 0.581+-0.009; 0.590+-0.574+-0.005. The values of 235U diffusion mean cross sections obtained on the base of these fata and calculated using the CRAB-1 program (given in brackets) are equal respectively 1.53+-0.005 (1.51) 2.38+-0.08 (2.42); 1.935+-0.060 (1.95); 1.89+-0.08 (1.95); 1.780+-0.11 (1.69); 1.90+-0.06 (1.89)

  10. 235 U consumption and 239 Pu formation on IPR-R1 reactor

    International Nuclear Information System (INIS)

    On the present world conjuncture it is necessary a rigorous storage and utilization control of nuclear materials under safeguard, specially those considered as strategic and those that could be used on the nuclear armaments fabrications as 235U and 239Pu. Brazil have signed and ratified many international pacts related to the peaceful utilization of the nuclear materials, making the compromise to attend nuclear safeguard procedures accorded with international regulatory organizations. The main goal of this work is the development of a simplified method for the estimation of the 239Pu productivity during the operation of the IPR-R1, TRIGA Mark-1 type, nuclear research reactor, that can achieve the maximum power of 100 KWt. A computational algorithm have been made to calculate the consumption of 235U on the fuel elements used on the reactor and the subsequent 239Pu formation (by the neutronic capture process), using the power generated by the reactor since the first criticality. The particular geometry of this kind of reactor allowed the calculation of the burn factors of the fuel elements discriminated by nuclear concentric rings, based on the thermal neutrons field distribution observed on experiments accomplished during a time period in similar reactors and on the IPR-R1. The simplified block diagram of the process, based on the calculation described above, is presented

  11. Studies of the Fission Integrals of U-235 and Pu-239 with Cadmium and Filters

    International Nuclear Information System (INIS)

    The resonance fissions in U235 and Pu239 have been studied using cadmium and boron filters. Fission chambers were used as detectors and the experiments were performed in beam geometry. The neutron energy distribution in the beams transmitted through the different filters was determined with a fast chopper. From the cadmium filter, measurements the fission resonance integrals were determined. The values obtained were 278±9 b for U235 and 301±10 b for Pu239; 0.5 eV 239 measurements were made in which the fission events were detected from the fission product activity in irradiated foils. Contrary to what has been reported elsewhere the value of the Pu239 resonance integral, found in this way, agreed well with that obtained from the fission chamber measurement. The experiments with the boron filters yielded results which, for the thin filter, agreed well with those calculated from the cross section data given in the Karlsruhe compilation. The discrepancy was larger for the thick filter but the values did not disagree outside the common limits of error

  12. Critical Experiments to Determine Amount of U-235 in Research Reactor Fuel Assemblies

    International Nuclear Information System (INIS)

    Seven different critical core configurations of the IRR1 have been used to determine experimentally the reactivity changes caused by interchanging different fuel assemblies in the same core position(1'2). The data obtained with the first four critical configurations, Cores 1, 2, 3, and 4, are analyzed in this report; the other three will be analyzed and reported in a later paper. The different fuel assemblies (highly enriched MTR type fuel assemblies) interchanged in these cores varied in their burnup or loss in U-235, thus changing the core keff w i t h each interchange. The k∞ of a fuel assembly is a function of its U-235 inventory. The fuel assemblies interchange forced the control blade to alter its height in order to compensate for the change in core reactivity. The control blade reactivity worth as a function of its height was measured by period measurements so the reactivity changes due to the fuel assemblies interchange could be determined. Several different fuel assemblies in each core were measured in this manner. This experimental data can be calculated using reactor physics codes

  13. R-matrix analysis of the 235U neutron cross sections

    International Nuclear Information System (INIS)

    The ENDFB-V representation of the 235U neutron cross sections in the resolved resonance region is unsatisfactory: below 1 eV the cross sections are given by ''smooth files'' (file 3) rather than by resonance parameters; above 1 eV the single-level formalism used by ENDFB-V necessitates a structured file 3 contribution consisting of more than 1300 energy points; furthermore, information on level-spins has not been included. Indeed the ENDFB-V 235U resonance region is based on an analysis done in 1970 for ENDFB-III and therefore does not include the results of high quality measurements done in the past 18 years. The present paper presents the result of an R-matrix multilevel analysis of recent measurements as well as older data. The analysis also extends the resolved resonance region from its ENDFB-V upper limit of 81 eV to 110 eV. 13 refs., 2 figs., 1 tab

  14. Calculation of 235U(n,n') cross sections for ENDF/B-VI

    International Nuclear Information System (INIS)

    Cross sections for neutron-induced reactions on 235U between 0.01 and 20 MeV have been calculated in a preliminary analysis for the ENDF/B-VI evaluation with particular emphasis on neutron inelastic scattering. A deformed optical model potential that fits total, elastic, inelastic, and low-energy average resonance data is used to calculate direct (n,n') cross sections and transmission coefficients for a Hauser-Feshbach statistical theory analysis using a multiple fission barrier representation. Direct cross sections for higher-lying vibrational states are provided from DWBA calculations, normalized using B(E/ital l/) values determined from (d,d') and Coulomb excitation data. Initial fission barrier parameters and transition state density enhancements appropriate to the compound systems involved were obtained from previous analyses, especially fits to charged-particle fission probability data. Further modifications to fit 235U(n,f) data were small, and the final fission parameters are generally consistent with published values. The results from this preliminary analysis are compared with the ENDF/B-V evaluation as well as with experimental data. 26 refs., 5 figs., 3 tabs

  15. Total kinetic energy release in the fast neutron-induced fission of $^{235}$U

    CERN Document Server

    Yanez, R; King, J; Barrett, J S; Fotiades, N; Lee, H Y


    We have measured the total kinetic energy (TKE) release for the $^{235}$U(n,f) reaction for $E_{n}$=2-100 MeV using the 2E method with an array of Si PIN diode detectors. The neutron energies were determined by time of flight measurements using the white spectrum neutron beam at the LANSCE facility. (To calibrate the apparatus, the TKE release for $^{235}$U(n$_{th}$,f) was also measured using a thermal neutron beam from the OSU TRIGA reactor). The TKE decreases non-linearly from 169.0 MeV to 161.4 MeV for $E_{n}$=2-90 MeV. The standard deviation of the TKE distribution is constant from $E_{n}$=20-90 MeV. Comparison of the data with the multi-modal fission model of Brosa indicates the TKE decrease is a consequence of the growth of symmetric fission and the corresponding decrease of asymmetric fission with increasing neutron energy. The average TKE associated with the Brosa superlong, standard I and standard II modes for a given mass is independent of neutron energy.

  16. Prompt Gamma Radiation from Fragments in the Thermal Fission of 235U

    International Nuclear Information System (INIS)

    Measurements were made on the gamma radiation emitted from fission fragments in slow neutron induced fission of 235U. The fragments were detected with solid state detectors of the surface barrier type and the gamma radiation with a Nal(Tl) scintillator. Mass selection was used so that the gamma radiation could be measured as a function of fragment mass. Time discrimination between the fission gammas and the prompt neutrons released in the fission process was employed to reduce the background. The gamma radiation emitted during different time intervals after the fission event was studied with the help of a collimator, the position of which was changed along the path of the fission fragments. In this way a decay curve was obtained from which the life-time of one of the gamma-emitting states could be estimated. The relative yield of the gamma-rays was determined as a function of mass for different gamma-ray energy portions and two specific time intervals after the fission events. Comparisons were made with data obtained from 252 Cf-fission. Attention is drawn to some features which seem to be the same in 235U and 252 Cf-fission

  17. Actinide Oxidation State and O/M Ratio in Hypostoichiometric Uranium-Plutonium-Americium U0.750Pu0.246Am0.004O2-x Mixed Oxides. (United States)

    Vauchy, Romain; Belin, Renaud C; Robisson, Anne-Charlotte; Lebreton, Florent; Aufore, Laurence; Scheinost, Andreas C; Martin, Philippe M


    Innovative americium-bearing uranium-plutonium mixed oxides U1-yPuyO2-x are envisioned as nuclear fuel for sodium-cooled fast neutron reactors (SFRs). The oxygen-to-metal (O/M) ratio, directly related to the oxidation state of cations, affects many of the fuel properties. Thus, a thorough knowledge of its variation with the sintering conditions is essential. The aim of this work is to follow the oxidation state of uranium, plutonium, and americium, and so the O/M ratio, in U0.750Pu0.246Am0.004O2-x samples sintered for 4 h at 2023 K in various Ar + 5% H2 + z vpm H2O (z = ∼15, ∼90, and ∼200) gas mixtures. The O/M ratios were determined by gravimetry, XAS, and XRD and evidenced a partial oxidation of the samples at room temperature. Finally, by comparing XANES and EXAFS results to that of a previous study, we demonstrate that the presence of uranium does not influence the interactions between americium and plutonium and that the differences in the O/M ratio between the investigated conditions is controlled by the reduction of plutonium. We also discuss the role of the homogeneity of cation distribution, as determined by EPMA, on the mechanisms involved in the reduction process. PMID:26907589

  18. 238U/235U variations in meteorites: extant 247Cm and implications for Pb-Pb dating. (United States)

    Brennecka, G A; Weyer, S; Wadhwa, M; Janney, P E; Zipfel, J; Anbar, A D


    The 238U/235U isotope ratio has long been considered invariant in meteoritic materials (equal to 137.88). This assumption is a cornerstone of the high-precision lead-lead dates that define the absolute age of the solar system. Calcium-aluminum-rich inclusions (CAIs) of the Allende meteorite display variable 238U/235U ratios, ranging between 137.409 +/- 0.039 and 137.885 +/- 0.009. This range implies substantial uncertainties in the ages that were previously determined by lead-lead dating of CAIs, which may be overestimated by several million years. The correlation of uranium isotope ratios with proxies for curium/uranium (that is, thorium/uranium and neodymium/uranium) provides strong evidence that the observed variations of 238U/235U in CAIs were produced by the decay of extant curium-247 to uranium-235 in the early solar system, with an initial 247Cm/235U ratio of approximately 1.1 x 10(-4) to 2.4 x 10(-4). PMID:20044543

  19. High accuracy/high precision determination of 235U in nondestructive assay standards by gamma-ray spectroscopy

    International Nuclear Information System (INIS)

    High precision gamma spectrometry measurements have been made on five sets of five uranium isotope abundance reference materials for nondestructive assay (NDA). These sets are intended for international safeguards use as primary reference materials for the determination of the 235U abundance in homogeneous uranium bulk material by gamma spectrometry. The measurements are to determine the counting rate uniformity of the 235U 185.7 keV gamma as well as the 235U isotope abundance for each sample. Since the samples are packaged such that the U3O8 is infinitely thick for the 185.7 keV gamma, the measured counting rate is not dependent on the material density. In addition, the activity observed by the detector is colimated to simulate calibration conditions used to measure bulk material in the field. The results of this study indicate that accuracy of 235U determination via gamma spectrometry, in the range of few hundredths of a percent (2sigma), is achievable. The main requirement for achieving this level of accuracy is a set of standards whose 235U isotope abundance are known to within 0.01% (2sigma)

  20. Distribution of nanomole quantities of 235U in young and adult Japanese quail and in the F1 generation. Comparison with 153Gd

    International Nuclear Information System (INIS)

    Enriched uranium, 93.16% for 235U, served as a tracer of uranium deposition in an avian species, the Japanese quail. A second label, 153Gd, provided for monitoring of procedures and for estimation of the 235U content of live eggs. Depositions of 235U were greater than for 153Gd in all tissues except the yolk sac and the liver. Skeletal levels for 235U were age- and sex-dependent. Feathers contained only 0.11% of the 235U tracer in contrast to 50% of the endogenous uranium. The results show that 235U provides for tracing uranium metabolism in small animals, since in quail the tracer increased the uranium burden of the body by only 1-8%. (author)

  1. Comparison of {sup 235}U fission cross sections in JENDL-3.3 and ENDF/B-VI

    Energy Technology Data Exchange (ETDEWEB)

    Kawano, Toshihiko [Kyushu Univ., Fukuoka (Japan); Carlson, Allan D. [National Institute of Standards and Technology (United States); Matsunobu, Hiroyuki [Data Engineering, Inc., Fujisawa, Kanagawa (Japan); Nakagawa, Tsuneo; Shibata, Keiichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Talou, Patrick; Young, Philip G.; Chadwick, Mark B. [Los Alamos National Laboratory, Los Alamos, NM (United States)


    Comparisons of evaluated fission cross sections for {sup 235}U in JENDL-3.3 and ENDF/B-VI are carried out. The comparisons are made for both the differential and integral data. The fission cross sections as well as the fission ratios are compared with the experimental data in detail. Spectrum averaged cross sections are calculated and compared with the measurements. The employed spectra are the {sup 235}U prompt fission neutron spectrum, the {sup 252}Cf spontaneous fission neutron spectrum, and the neutron spectrum produced by a {sup 9}Be(d, xn) reaction. For {sup 235}U prompt fission neutron spectrum, the ENDF/B-VI evaluation reproduces experimental averaged cross sections. For {sup 252}Cf and {sup 9}Be(d, xn) neutron spectra, the JENDL-3.3 evaluation gives better results than ENDF/B-VI. (author)

  2. Analysis of 235U enrichment by chemical exchange in U(IV) - U(VI) system on anionite

    International Nuclear Information System (INIS)

    Full text: A theoretical study about the 235U enrichment by chemical exchange method in U(IV)-U(VI) system on anion-exchange resins is presented. The 235U isotope concentration profiles along the band were numerically calculated using an accurate mathematical model and simulations were carried out for the situation of product and waste withdrawal and feed supply. By means of numerical simulation, an estimation of the migration time, necessary for a desired enrichment degree, was obtained. The required migration distance, the production of uranium 3 at.% 235U per year and the plant configuration are calculated for different operating conditions. An analysis of the process scale for various experimental conditions is also presented. (authors)

  3. Performance evaluation of indigenous thermal ionization mass spectrometer for determination of 235U/238U atom ratios

    International Nuclear Information System (INIS)

    A magnetic sector based Thermal Ionization Mass Spectrometer (TIMS) designed and developed at Technical Physics Division, B.A.R.C., was evaluated for its performance for the determination of 235U/238U atom ratios in uranium samples. This consisted of evaluating the precision and accuracy on the 235U/238U atom ratios in various isotopic reference materials as well as indigenously generated uranium samples. The results obtained by the indigenous TIMS were also compared with those obtained using a commercially available TIMS system. The internal and external precision were found to be around 0.1% for determining 235U/238U atom ratios close to those of natural uranium ( i.e. 0.00730). (author)


    Energy Technology Data Exchange (ETDEWEB)

    Duncan, A.; Sindelar, R.


    Plutonium-containing materials are destined for storage in the 235-F vault. The projected amount of stored materials will require the presence of neutron absorber materials. The leading design concept is for the neutron absorber materials to be in non-load-bearing borated aluminum plates lining the walls of the vault. A comprehensive evaluation of the borated aluminum plate materials was performed to identify a suitable material, and verify that these materials would remain effective as neutron absorbers under normal service conditions and for design-basis events, including the fire accident scenario, throughout a 20-year service life. Aluminum 1100 with boron additions is the recommended neutron absorber material for plutonium material storage in the 235-F vault based on boron loading capacity and durability in the storage environment. Borated aluminum 1100 is commercially available up to 4.5 wt. % boron. A detailed comparison was made of the physical, mechanical, and corrosion properties of borated aluminum alloy 1100 to standard alloy 1100-O (-O designating the fully annealed condition) to demonstrate near-equivalency in properties and to justify application of alloy 1100-O properties to the borated product as needed for the degradation analysis. The expected degradation of the borated aluminum is extremely low for storage conditions, including the bounding scenario of an aggressive atmospheric condition. A maximum loss of 0.00029 inches/year would be expected under potentially aggressive atmospheric conditions and would result in a fractional loss of only 0.42 wt. % of the boron present in a 7mm plate for a 20-year storage period. The fraction of Boron-10 consumption by spontaneous neutrons is expected to be less than 10{sup -8} for the 20-year storage in 235-F fully loaded with Pu materials. The borated aluminum alloy 1100 will be thermally stable and unaltered up to near-melt temperature (643°C). Mechanical testing data at elevated temperatures show that the

  5. 238U/235U determinations of some commonly used reference materials and U-bearing accessory minerals (Invited) (United States)

    Condon, D.; Noble, S.; McLean, N.; Bowring, S. A.


    We have determined 238U/235U ratios for a suite of commonly used natural (CRM 112a, SRM 950a, HU-1) and synthetic (IRMM 184 and CRM U500) uranium reference materials in addition to several U-bearing accessory phases (zircon and monazite) by thermal ionisation mass-spectrometry (TIMS) using the IRMM 3636 233U-236U double spike to accurately correct for mass fractionation. The 238U/235U values for the natural uranium reference materials differ, by up to 0.1%, from the widely used ‘consensus’ value (137.88) with all having 238U/235U values less than 137.88. Similarly, initial 238U/235U data from zircon and monazite yield 238U/235U values that are lower than the ‘consensus’ value. The data obtained from U-bearing minerals is used to assess how the uncertainty in the 238U/235U ratio contributes to the systematic discordance observed in 238U/206Pb and 235U/207Pb dates (Mattinson, 2000; Schoene et al., 2006) which has traditionally been wholly attributed to error in the U decay constants. The 238U/235U determinations made on the synthetic reference materials yield results that are considerably more precise and accurate than the certified values (0.02% vs. 0.1% for CRM U500). The calibration of isotopic tracers used for U-daughter geochronology that are partially based upon these reference materials, and the resultant age determinations, will benefit from increased accuracy and precision. Mattinson, J.M., 2000. Revising the “gold standard”—the uranium decay constants of Jaffey et al., 1971. Eos Trans. AGU, Spring Meet. Suppl., Abstract V61A-02. Schoene B., Crowley J.L., Condon D.C., Schmitz M.D., Bowring S.A., 2006, Reassessing the uranium decay constants for geochronology using ID-TIMS U-Pb data. Geochimica et Cosmochimica Acta 70: 426-445

  6. Study of Relationship Between Neutron Energy and Fission Yields of 95Zr, 140Ba and 147Nd From 235U

    Institute of Scientific and Technical Information of China (English)


    This work measures fission yields of 235U induced by neutrons with energy of thermal, 3.0, 5.0, 5.5, 8.0 and 14.8 MeV. The main purpose is to study the relationship between neutron energy and fission fields of 95Zr,140Ba and 147Nd from 235U by measuring the radioactivity of foil with direct gamma spectrometry. The fission yields induced by fast neutrons are get by fast-thermal-ratio method which based on yields from thermal neutrons, yields by thermal neutron are come from absolute measurement. Since fast-thermal-ratio method eliminates uncertainties of gamma intensity, gamma

  7. Prompt γ-rays from the Fast Neutron Induced Fission on 235,238U and 232Th (United States)

    Lebois, M.; Wilson, J. N.; Halipré, P.; Leniau, B.; Matea, I.; Oberstedt, A.; Oberstedt, S.; Verney, D.

    Preliminary results from the first experiment using the LICORNE neutron source at the IPN Orsay are presented. Prompt fission gamma rays from fast-neutron induced fission of 238U, 232Th and 235U were detected. Thick samples of around 50 g of 238U and 232Th are used for the first part of the experiment. An ionisation chamber containing ∼ 10 mg samples of 238U and 235U to provide a fission trigger is used for the second part of the experiment. Gamma rays have been detected using 17 high efficiency BaF2 detectors and 6 LaBr3 scintillator detectors.

  8. Investigation of forming mechanism of instantaneous neutron spectrum of 235U, 239Pu, 252Cf nuclei fission

    International Nuclear Information System (INIS)

    Formation mechanism of prompt neutrons spectrum during the fission of the 235U, 239Pu nuclei by thermal and fast neutrons and spontaneous fission of 252Cf is investigated. The formation procedure for prompt neutrons spectrum during the fission of nuclei as superposition of three partial evaporation Weisskopf spectra with the mean energy of neutrons 0.4, 2.06 and 2.8 MeV is proposed. Formation mechanism of the spectrum just as during the fission of the 235U, 239Pu nuclei by thermal and fast neutrons, so spontaneous fission of the 252Cf nuclei is identical

  9. Quantitative determination of 235U and 238U by measuring the gamma radiation from short-lived fission products

    International Nuclear Information System (INIS)

    On the basis of two successive activations of the sample by neutrons of different energy distribution and of measuring the gamma radiation from the resulting short-lived fission products the masses of uranium 235 and 238, the enrichment and the uranium concentration have been determined. The procedure can only be used for unirradiated uranium. The analysis takes 50 min. The method has been tested with samples of 10 g and up to 90% enrichment. The minimum detectable amounts were 1 mg 235U and 1 g 238U, respectively, with the random error of measurement being 4%. (author)

  10. Reich-Moore and Adler-Adler representations of the 235U cross sections in the resolved resonance region

    International Nuclear Information System (INIS)

    In the first part of this paper, a reevaluation of the low-energy neutron cross sections of 235U is described. This reevaluation was motivated by the discrepancy between the measured and computed temperature coefficients of reactivity and is based on recent measurements of the fission cross section and of η in the thermal and subthermal neutron energy regions. In the second part of the paper, we discuss the conversion of the Reich-Moore resonance parameters, describing the neutron cross sections of 235U in the resolved resonance region, into equivalent Adler-Adler resonance parameters and into equivalent momentum space multipole resonance parameters

  11. Reich-Moore and Adler-Adler representations of the 235U cross sections in the resolved resonance region

    International Nuclear Information System (INIS)

    In the first part of this paper, a reevaluation of the low-energy neutron cross sections of 235U is described. This reevaluation was motivated by the discrepancy between the measured and computed temperature coefficients of reactivity and is based on recent measurements of the fission cross section and of η in the thermal and subthermal neutron energy regions. In the second part of the paper, we discuss the conversion of the Reich-Moore resonance parameters, describing the neutron cross sections of 235U in the resolved resonance region, into equivalent Adler-Adler resonance parameters and into equivalent momentum space multipole resonance parameters. 25 refs., 4 figs., 5 tabs

  12. Searching for U-235m produced by Nuclear Excitation by Electronic Transition (United States)

    Chodash, Perry; Norman, Eric; Burke, Jason; Wilks, Scott; Casperson, Robert


    Nuclear excitation by electronic transition (NEET) is a rare nuclear excitation that is predicted to occur in numerous isotopes, including U-235. When a nuclear transition matches the energy and the multipolarity of an electronic transition, there is a possibility that NEET will occur. If NEET were to occur in U-235, the nucleus would be excited to its 1/2 + isomeric state that subsequently decays by internal conversion with a decay energy of 77 eV and a half-life of 26 minutes. Theory predicts that NEET can occur in partially ionized uranium plasma with a charge state of 23 +. A pulsed Nd:YAG laser operating at 1064 nm with a pulse energy of 780 mJ and a pulse width of 9 ns was used to generate the uranium plasma. The laser was focused on small samples of both depleted uranium and highly enriched uranium. The plasma conditions created by the intense laser pulse were varied by changing the spot size of the laser on the target. The resulting plasma was collected on a plate and the internal conversion electrons were focused onto a microchannel plate detector by a series of electrostatic lenses. First results will be presented. Nuclear excitation by electronic transition (NEET) is a rare nuclear excitation that is predicted to occur in numerous isotopes, including U-235. When a nuclear transition matches the energy and the multipolarity of an electronic transition, there is a possibility that NEET will occur. If NEET were to occur in U-235, the nucleus would be excited to its 1/2 + isomeric state that subsequently decays by internal conversion with a decay energy of 77 eV and a half-life of 26 minutes. Theory predicts that NEET can occur in partially ionized uranium plasma with a charge state of 23 +. A pulsed Nd:YAG laser operating at 1064 nm with a pulse energy of 780 mJ and a pulse width of 9 ns was used to generate the uranium plasma. The laser was focused on small samples of both depleted uranium and highly enriched uranium. The plasma conditions created by the

  13. Standard specification for uranium metal enriched to more than 15 % and less Than 20 % 235U

    CERN Document Server

    American Society for Testing and Materials. Philadelphia


    1.1 This specification covers nuclear grade uranium metal that has either been processed through an enrichment plant, or has been produced by the blending of highly enriched uranium with other uranium, to obtain uranium of any 235U concentration below 20 % (and greater than 15 %) and that is intended for research reactor fuel fabrication. The scope of this specification includes specifications for enriched uranium metal derived from commercial natural uranium, recovered uranium, or highly enriched uranium. Commercial natural uranium, recovered uranium and highly enriched uranium are defined in Section 3. The objectives of this specification are to define the impurity and uranium isotope limits for commercial grade enriched uranium metal. 1.2 This specification is intended to provide the nuclear industry with a standard for enriched uranium metal which is to be used in the production of research reactor fuel. In addition to this specification, the parties concerned may agree to other appropriate conditions. ...

  14. Investigating Prompt Fission Neutron Emission from 235U(n,f) in the Resolved Resonance Region (United States)

    Göök, Alf; Hambsch, Franz-Josef; Oberstedt, Stephan


    Investigations of prompt emission in fission is of importance in understanding the fission process in general and the sharing of excitation energy among the fission fragments in particular. Experimental activities at IRMM on prompt neutron emission from fission in response to OECD/NEA nuclear data requests is presented in this contribution. Main focus lies on currently on-going investigations of prompt neutron emission from the reaction 235U(n,f) in the region of the resolved resonances. For this reaction strong fluctuations of fission fragment mass distributions and mean total kinetic energy have been observed [Nucl. Phys. A 491, 56 (1989)] as a function of incident neutron energy in the resonance region. In addition fluctuations of prompt neutron multiplicities were also observed [Phys. Rev. C 13, 195 (1976)]. The goal of the present study is to verify the current knowledge of prompt neutron multiplicity fluctuations and to study correlations with fission fragment properties.

  15. Investigating Prompt Fission Neutron Emission from 235U(n,f in the Resolved Resonance Region

    Directory of Open Access Journals (Sweden)

    Göök Alf


    Full Text Available Investigations of prompt emission in fission is of importance in understanding the fission process in general and the sharing of excitation energy among the fission fragments in particular. Experimental activities at IRMM on prompt neutron emission from fission in response to OECD/NEA nuclear data requests is presented in this contribution. Main focus lies on currently on-going investigations of prompt neutron emission from the reaction 235U(n,f in the region of the resolved resonances. For this reaction strong fluctuations of fission fragment mass distributions and mean total kinetic energy have been observed [Nucl. Phys. A 491, 56 (1989] as a function of incident neutron energy in the resonance region. In addition fluctuations of prompt neutron multiplicities were also observed [Phys. Rev. C 13, 195 (1976]. The goal of the present study is to verify the current knowledge of prompt neutron multiplicity fluctuations and to study correlations with fission fragment properties.

  16. Measurements of γ-ray Energy and Multiplicity from 235U(nthermal using STEFF

    Directory of Open Access Journals (Sweden)

    Pollitt A.J.


    Full Text Available The amount of energy carried by γ-rays during the fission process is an important consideration when developing new reactor designs. Many studies of γ-ray energy and multiplicity, from a multitude of fissioning systems, were measured during the 1970s. However the data from such experiments largely underestimates the heating effect caused by γ-rays in the structure of a reactor. It is therefore essential to obtain more accurate measurements of the energy carried during γ-ray emission. As such, the OECD Nuclear Energy Agency has put out a high priority request [1] for measurements of the mean γ-ray energy and multiplicity to an accuracy better than 7.5 percent from several fissioning systems; including 235U(nthermal. Measurements of the rays from these fissioning nuclei were performed with the SpecTrometer for Exotic Fission Fagments (STEFF.

  17. The effect of temperature on the average volume of Barkhausen jump on Q235 carbon steel (United States)

    Guo, Lei; Shu, Di; Yin, Liang; Chen, Juan; Qi, Xin


    On the basis of the average volume of Barkhausen jump (AVBJ) vbar generated by irreversible displacement of magnetic domain wall under the effect of the incentive magnetic field on ferromagnetic materials, the functional relationship between saturation magnetization Ms and temperature T is employed in this paper to deduce the explicit mathematical expression among AVBJ vbar, stress σ, incentive magnetic field H and temperature T. Then the change law between AVBJ vbar and temperature T is researched according to the mathematical expression. Moreover, the tensile and compressive stress experiments are carried out on Q235 carbon steel specimens at different temperature to verify our theories. This paper offers a series of theoretical bases to solve the temperature compensation problem of Barkhausen testing method.

  18. A report on stress analysis of seal disc of 235 MWe PHWR

    International Nuclear Information System (INIS)

    The seal disc is an important component of pressurized heavy water reactor. When mounted, this becomes a part of the coolant channel and hence is a pressure boundary for the heavy water coolant inside the channel. Detailed stress analysis of seal disc of 235 MWe PHWR (MAPP) is done. Linear elastic analysis showed that stresses are more than the allowable values as per ASME code Section III, Division 1. This makes it necessary to invoke the special provision of MB-3228.1 (1986). An elasto-plastic analysis was done to find out the collapse load which showed that the seal disc is safe for all stages of loadings. (author). 2 tabs., 7 figs

  19. An indigenous system for in-service inspection of coolant channels of 235 MWe PHWRs

    International Nuclear Information System (INIS)

    In-service inspection of coolant channels of nuclear power plants is essential to provide information on ageing effects. A channel inspection system (BARCIS- BARC Channel Inspection System) for in-service inspection of coolant channels of 235 MWe PHWRs has been recently developed at BARC. The need for such a system was being felt for quite sometime. The system is designed with the aim to minimise radiation exposure to inspection personnel and to perform the inspection so as to minimise reactor downtime. Sixteen coolant channels of RAPS-2 and fourteen coolant channels of MAPS-2 have been inspected using BARCIS MARK-1 system. Details of the system developed and the results of inspection are presented. (author). 3 refs., 3 tabs., 5 figs

  20. High accuracy 235U(n,f data in the resonance energy region

    Directory of Open Access Journals (Sweden)

    Paradela C.


    Full Text Available The 235U neutron-induced cross section is widely used as reference cross section for measuring other fission cross sections, but in the resonance region it is not considered as an IAEA standard because of the scarce experimental data covering the full region. In this work, we deal with a new analysis of the experimental data obtained with a detection setup based on parallel plate ionization chambers (PPACs at the CERN n_TOF facility in the range from 1 eV to 10 keV. The relative cross section has been normalised to the IAEA value in the region between 7.8 and 11 eV, which is claimed as well-known. Comparison with the ENDF/B-VII evaluation and the IAEA reference file from 100 eV to 10 keV are provided.