WorldWideScience

Sample records for americium 234

  1. 1976 Hanford americium accident

    International Nuclear Information System (INIS)

    Heid, K.R.; Breitenstein, B.D.; Palmer, H.E.; McMurray, B.J.; Wald, N.

    1979-01-01

    This report presents the 2.5-year medical course of a 64-year-old Hanford nuclear chemical operator who was involved in an accident in an americium recovery facility in August 1976. He was heavily externally contaminated with americium, sustained a substantial internal deposition of this isotope, and was burned with concentrated nitric acid and injured by flying debris about the face and neck. The medical care given the patient, including the decontamination efforts and clinical laboratory studies, are discussed. In-vivo measurements were used to estimate the dose rates and the accumulated doses to body organs. Urinary and fecal excreta were collected and analyzed for americium content. Interpretation of these data was complicated by the fact that the intake resulted both from inhalation and from solubilization of the americium embedded in facial tissues. A total of 1100 μCi was excreted in urine and feces during the first 2 years following the accident. The long-term use of diethylenetriaminepentate (DTPA), used principally as the zinc salt, is discussed including the method, route of administration, and effectiveness. To date, the patient has apparently experienced no complications attributable to this extensive course of therapy, even though he has been given approximately 560 grams of DTPA. 4 figures, 1 table

  2. Chemistry of americium

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.

    1976-01-01

    Essential features of the descriptive chemistry of americium are reviewed. Chapter titles are: discovery, atomic and nuclear properties, collateral reading, production and uses, chemistry in aqueous solution, metal, alloys, and compounds, and, recovery, separation, purification. Author and subject indexes are included. (JCB)

  3. Americium in water and sediments

    International Nuclear Information System (INIS)

    Coughtrey, P.J.; Jackson, D.; Jones, C.H.; Thorne, M.C.

    1984-01-01

    Data for americium 241 in aquatic environments are presented derived from areas contaminated solely by global fallout, and also from areas contaminated by radioactive waste discharges. For several water bodies, in particular the Mediterranean, comprehensive data are given characterising the inputs, distribution, geochemical behaviour and biological availability of americium. Many data are also reported for concentrations of americium in North European coastal waters (e.g. English Channel, North Sea, Irish Sea, Baltic Sea, Barents Sea and the Eastern Atlantic). Much of the discussion in this section is in terms of the behaviour of americium relative to plutonium. (Auth.)

  4. Recycling of americium

    International Nuclear Information System (INIS)

    Hagstroem, Ingela

    1999-12-01

    Separation of actinides from spent nuclear fuel is a part of the process of recycling fissile material. Extracting agents for partitioning the high level liquid waste (HLLW) from conventional PUREX reprocessing is studied. The CTH-process is based on three consecutive extraction cycles. In the first cycle protactinium, uranium, neptunium and plutonium are removed by extraction with di-2-ethylhexyl-phosphoric acid (HDEHP) from a 6 M nitric acid HLLW solution. Distribution ratios for actinides, fission products and corrosion products between HLLW and 1 M HDEHP in an aliphatic diluent have been investigated. To avoid addition of chemicals the acidity is reduced by a tributylphosphate (TBP) extraction cycle. The distribution ratios of elements present in HLLW have been measured between 50 % TBP in an aliphatic diluent and synthetic HLLW in range 0.1-6 M nitric acid. In the third extraction cycle americium and curium are extracted. To separate trivalent actinides from lanthanides a method based on selective stripping of the actinides from 1 M HDEHP is proposed. The aqueous phase containing ammonia, diethylenetriaminepentaacetic acid (DTPA) and lactic acid is recycled in a closed loop after reextraction of the actinides into a second organic phase also containing 1 M HDEHP. Distribution ratios for americium and neodymium have been measured at varying DTPA and lactic acid concentrations and at varying pH. Nitrogen-donor reagents have been shown to have a potential to separate trivalent actinides from lanthanides. 2,2':6,2''-terpyridine as extractant follows the CHON-principle and can in synergy with 2-bromodecanoic acid separate americium from europium. Distribution ratios for americium and europium, in the range of 0.02-0.12 M nitric acid, between nitric acid and 0.02 M terpyridine with 1 M 2-bromodecanoic acid in tert-butylbenzene (TBB) was investigated. Comparison with other nitrogen-donor reagents show that increasing lipophilicity of the molecule, by substitution of

  5. Americium-241 - ED 4308

    International Nuclear Information System (INIS)

    Ammerich, M.; Frot, P.; Gambini, D.; Gauron, C.; Moureaux, P.; Herbelet, G.; Lahaye, T.; Le Guen, B.; Pihet, P.; Rannou, A.; Vidal, E.

    2012-12-01

    This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)

  6. Plutonium and americium separation from salts

    International Nuclear Information System (INIS)

    Hagan, P.G.; Miner, F.J.

    1976-01-01

    Salts or materials containing plutonium and americium are dissolved in hydrochloric acid, heated, and contacted with an alkali metal carbonate solution to precipitate plutonium and americium carbonates which are thereafter readily separable from the solution

  7. Transmutation of Americium in Fast Neutron Facilities

    OpenAIRE

    Zhang, Youpeng

    2011-01-01

    In this thesis, the feasibility to use a medium sized sodium cooled fast reactor fully loaded with MOX fuel for efficient transmutation of americium is investigated by simulating the safety performance of a BN600-type fast reactor loaded with different fractions of americium in the fuel, using the safety parameters obtained with the SERPENT Monte Carlo code. The focus is on americium mainly due to its long-term contribution to the radiotoxicity of spent nuclear fuel and its deterioration on c...

  8. Metabolism of americium-241 in dairy animals

    International Nuclear Information System (INIS)

    Sutton, W.W.; Patzer, R.G.; Mullen, A.A.; Hahn, P.B.; Potter, G.D.

    1978-10-01

    Groups of lactating cows and goats were used to examine americium-241 metabolism in dairy animals. Following either single oral or intravenous nuclide doses, samples of milk, urine, blood, and feces were taken over a 168-hr collection period and the americium concentrations were determined by gamma counting. Gastrointestinal uptake of americium by both cows and goats was estimated to be 0.014% of the respective oral doses. The cumulative percentage of oral dose transported to milk and urine was 4.4 x 10 -4 and 1.1 x 10 -3 respectively for cows and 4.4 x 10 -3 and 1.2 x 10 -3 respectively for goats. The relatively high americium concentrations noted in caprine milk following the oral doses are discussed. Plasma concentrations of americium decreased rapidly following all intravenous injections. The average percentage of injected americium transferred to milk, urine, and feces was 3, 6, and 2% respectively for cows and 2, 4, and 2% respectively for goats. In both intravenously dosed groups, approximately 30% of all americium released from the body was found in the urine during the first 24 hrs after injection. All animals were sacrificed 8 to 9 days after dosing. Bovine bone retained the greatest fraction of the administered dose followed by the liver. However, liver retained the greatest amount of americium in the goats following both oral and intravenous doses. Comparisons are presented between americium-241 and plutonium-238 transport in dairy cows

  9. Production of americium isotopes in France

    International Nuclear Information System (INIS)

    Koehly, G.; Bourges, J.; Madic, C.; Nguyen, T.H.; Lecomte, M.

    1984-12-01

    The program of productions of americium 241 and 243 isotopes is based respectively on the retreatment of aged plutonium alloys or plutonium dioxide and on the treatment of plutonium targets irradiated either in CELESTIN reactors for Pu-Al alloys or OSIRIS reactor for plutonium 242 dioxide. All the operations, including americium final purifications, are carried out in hot cells equipped with remote manipulators. The chemical processes are based on the use of extraction chromatography with hydrophobic SiO 2 impregnated with extracting agents. Plutonium targets and aged plutonium alloys are dissolved in nitric acid using conventional techniques while plutonium dioxide dissolutions are performed routine at 300 grams scale with electrogenerated silver II in 4M HNO 3 at room temperature. The separation between plutonium and americium is performed by extraction of Pu(IV) either on TBP/SiO 2 or TOAHNO 3 /SiO 2 column. Americium recovery from waste streams rid of plutonium is realized by chromatographic extraction of Am(III) using mainly TBP and episodically DHDECMP as extractant. The final purification of both americium isotopes uses the selective extraction of Am(VI) on HDDiBMP/SiO 2 column at 60 grams scale. Using the overall process a total amount of 1000 grams of americium 241 and 100 grams of americium 243 has been produced nowadays and the AmO 2 final product indicates a purity better than 98.5%

  10. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-22

    Acqueous Chloride mission is to recover plutonium and americium from pyrochemical residues (undesirable form for utilization and storage) and generate plutonium oxide and americium oxide. Plutonium oxide is recycled into Pu metal production flowsheet. It is suitable for storage. Americium oxide is a valuable product, sold through the DOE-OS isotope sales program.

  11. Formation of americium and europium humate complexes

    International Nuclear Information System (INIS)

    Minai, Y.; Tominaga, T.; Meguro, Y.

    1991-01-01

    Binding constants of americium and europium with a humic acid were determined to study if complex formation of trivalent actinide-humates affects dissolved species of the actinides in hydrosphere. The purified humic acid was characterized by means of UV-vis, IR, and pH titration, indicating high carboxylate capacity and low aromaticity. Binding constants of americium and europium humates were determined at pH 4.6 and 6.0 by solvent extraction using 241 Am or 152 Eu as a tracer. The binding constants for americium-humate obtained preliminarily suggest that complexes with humic acid are not negligible in speciation of trivalent actinides in hydrosphere. The obtained binding constants were nearly identical with those determined previously by the same procedures, but with humic acids of different origin and compositions. (author)

  12. Biosorption of americium by alginate beads

    International Nuclear Information System (INIS)

    Borba, Tania Regina de; Marumo, Julio Takehiro; Goes, Marcos Maciel de; Ferreira, Rafael Vicente de Padua; Sakata, Solange Kazumi

    2009-01-01

    The use of biotechnology to remove heavy metals from wastes plays great potential in treatment of radioactive wastes and therefore the aim of this study was to evaluate the biosorption of americium by alginate beads. Biosorption has been defined as the property of certain biomolecules to bind and remove selected ions or other molecules from aqueous solutions. The calcium alginate beads as biosorbent were prepared and analyzed for americium uptaking. The experiments were performed in different solution activity concentrations, pH and exposure time. The results suggest that biosorption process is more efficient at pH 4 and for 75, 150, 300 Bq/mL and 120 minutes were necessary to remove almost 100% of the americium-241 from the solution. (author)

  13. New Fecal Method for Plutonium and Americium

    International Nuclear Information System (INIS)

    Maxwell, S.L. III

    2000-01-01

    A new fecal analysis method that dissolves plutonium oxide was developed at the Westinghouse Savannah River Site. Diphonix Resin (Eichrom Industries), is used to pre-concentrate the actinides from digested fecal samples. A rapid microwave digestion technique is used to remove the actinides from the Diphonix Resin, which effectively extracts plutonium and americium from acidic solutions containing hydrofluoric acid. After resin digestion, the plutonium and americium are recovered in a small volume of nitric acid that is loaded onto small extraction chromatography columns, TEVA Resin and TRU Resin (Eichrom Industries). The method enables complete dissolution of plutonium oxide and provides high recovery of plutonium and americium with good removal of thorium isotopes such as thorium-228

  14. New fecal method for plutonium and americium

    International Nuclear Information System (INIS)

    Maxwell, S.L.; Fauth, D.J.; Nichols, S.T.

    2001-01-01

    A new fecal analysis method that dissolves plutonium oxide was developed at the Westinghouse Savannah River Site. Diphonix Resin R (Eichrom Technologies), is used to pre-concentrate the actinides from digested fecal samples. A rapid microwave digestion technique is used to remove the actinides from the Diphonix Resin R , which effectively extracts plutonium and americium from acidic solutions containing hydrofluoric acid. After resin digestion, the plutonium and americium are recovered in a small volume of nitric acid that is loaded onto small extraction chromatography columns, TEVA Resin and TRU Resin (Eichrom Technologies). The method enables complete dissolution of plutonium oxide and provides high recovery of plutonium and americium with good removal of thorium isotopes such as 228 Th. (author)

  15. Transmutation of Americium in Fast Neutron Facilities

    International Nuclear Information System (INIS)

    Zhang, Youpeng

    2011-01-01

    In this thesis, the feasibility to use a medium sized sodium cooled fast reactor fully loaded with MOX fuel for efficient transmutation of americium is investigated by simulating the safety performance of a BN600-type fast reactor loaded with different fractions of americium in the fuel, using the safety parameters obtained with the SERPENT Monte Carlo code. The focus is on americium mainly due to its long-term contribution to the radiotoxicity of spent nuclear fuel and its deterioration on core's safety parameters. Applying the SAS4A/SASSYS transient analysis code, it is demonstrated that the power rating needs to be reduced by 6% for each percent additional americium introduction into the reference MOX fuel, maintaining 100 K margin to fuel melting, which is the most limiting failure mechanism. Safety analysis of a new Accelerator Driven System design with a smaller pin pitch-to-diameter ratio comparing to the reference EFIT-400 design, aiming at improving neutron source efficiency, was also performed by simulating performance for unprotected loss of flow, unprotected transient overpower, and protected loss-of-heat-sink transients, using neutronic parameters obtained from MCNP calculations. Thanks to the introduction of the austenitic 15/15Ti stainless steel with enhanced creep rupture resistance and acceptable irradiation swelling rate, the suggested ADS design loaded with nitride fuel and cooled by lead-bismuth eutectic could survive the full set of transients, preserving a margin of 130 K to cladding rupture during the most limiting transient. The thesis concludes that efficient transmutation of americium in a medium sized sodium cooled fast reactor loaded with MOX fuel is possible but leads to a severe power penalty. Instead, preserving transmutation rates of minor actinides up to 42 kg/TWh th , the suggested ADS design with enhanced proton source efficiency appears like a better option for americium transmutation

  16. Preparation of americium source for smoke detector

    International Nuclear Information System (INIS)

    Ramaswami, A.; Singh, R.J.; Manohar, S.B.

    1994-01-01

    This report describes the method developed for the preparation of 241 Am source for smoke detector. Americium was electrodeposited from iso-propyl alcohol medium on silver backing. Thin layer of gold (few hundred micro gram thick) was plated on the americium source to make it safe for handling. The thickness of plated gold was such that the alpha radiations from the 241 Am source could escape out of the gold layer and cause ionisation in the surrounding air. The performance of the prepared sources were checked in a smoke detector and was found to be satisfactory and comparable to the imported sources. (author). 1 refs., 2 figs., 1 tab

  17. Redox chemistry of americium in nitric acid media

    International Nuclear Information System (INIS)

    Picart, S.; Jobelin, I.; Armengol, G.; Adnet, JM.

    2004-01-01

    The redox properties of the actinides are very important parameters for speciation studies and spent nuclear fuel reprocessing based on liquid-liquid extraction of actinides at different oxidation states (as in the Purex or Sesame process). They are also very useful for developing analytical tools including coulometry and redox titration. This study addressed the americium(IV)/americium(III) and americium(VI)/americium(V) redox couples, focusing on exhaustive acquisition of the thermodynamic and kinetic parameters of americium oxidation at an electrode in a complexing nitric acid medium. (authors)

  18. 1976 Hanford americium exposure incident: psychological aspects

    International Nuclear Information System (INIS)

    Brown, W.R.

    1982-01-01

    Accidents involving exposure to radiation or radioactive materials may involve an unusual degree of emotional trauma. Methods that may be employed in dealing with such trauma are discussed in relation to a specific accident in which a radiation worker was injured and seriously contaminated with americium-241

  19. Americium migration in basalt and implications to repository risk analysis

    International Nuclear Information System (INIS)

    Rickert, P.G.

    1980-01-01

    Experiments were performed with americium as a minor component in groundwater. Batch adsorption, migration through column, and filtration experiments were performed. It was determined in batch experiments that americium is strongly adsorbed from solution. It was determined with filtration experiments that large percentages of the americium concentrations suspended by the contact solutions in batch experiments and suspended by the infiltrating groundwater in migration experiments were associated with particulate. Filtration was determined to be the primary mode of removal of americium from infiltrating groundwater in a column of granulated basalt (20 to 50 mesh) and an intact core of permeable basalt. Fractionally, 0.46 and 0.22 of the americium component in the infiltrating groundwater was transported through the column and core respectively. In view of these filtration and migration experiment results, the concept of K/sub d/ in the chromatographic sense is meaningless for predicting americium migration in bedrock by groundwater transport at near neutral pH

  20. Procedure for the analysis of americium in complex matrices

    International Nuclear Information System (INIS)

    Knab, D.

    1978-02-01

    A radioanalytical procedure for the analysis of americium in complex matrices has been developed. Clean separations of americium can be obtained from up to 100 g of sample ash, regardless of the starting material. The ability to analyze large masses of material provides the increased sensitivity necessary to detect americium in many environmental samples. The procedure adequately decontaminates from rare earth elements and natural radioactive nuclides that interfere with the alpha spectrometric measurements

  1. The relative physiological and toxicological properties of americium and plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Carter, R.E.; Busch, E.; Johnson, O. [and others

    1951-11-15

    The relative physiological and toxicological properties of americium and plutonium have been studied following their intravenous administration to rats. The urinary and fecal excretion of americium was similar to that of plutonium administered as Pu(N0{sub 3}){sub 4}. The deposition of americium the tissues and organs of the rat was also similar to that observed for plutonium. The liver and the skeleton were the major sites of deposition. Zirconium citrate administered 15 minutes after injection of americium increased the urinary excretion of americium and decreased the amount found in the liver and the skeleton at 4 and 16 days. LD{sub 30}{sup 50} studies showed americium was slightly less toxic when given in the acute toxic range than was plutonium. The difference was, however, too slight to be important in establishing a larger tolerance does for americium. Survival studies, hematological observations, bone marrow observations, comparison of tumor incidence and the incidence of skeletal abnormalities indicated that americium and plutonium have essentially the same chronic toxicity when given on an equal {mu}c. basis. These studies support the conclusion that the tolerance values for americium should be essentially the same as those for Plutonium.

  2. Investigation of americium-241 metal alloys for target applications

    International Nuclear Information System (INIS)

    Conner, W.V.; Rockwell International Corp., Golden, CO

    1982-01-01

    Several 241 Am metal alloys have been investigated for possible use in the Lawrence Livermore National Laboratory Radiochemical Diagnostic Tracer Program. Several properties were desired for an alloy to be useful for tracer program applications. A suitable alloy would have a fairly high density, be ductile, homogeneous and easy to prepare. Alloys investigated have included uranium-americium, aluminium-americium, and cerium-americium. Uranium-americium alloys with the desired properties proved to be difficult to prepare, and work with this alloy was discontinued. Aluminium-americium alloys were much easier to prepare, but the alloy consisted of an aluminium-americium intermetallic compound (AmAl 4 ) in an aluminum matrix. This alloy could be cast and formed into shapes, but the low density of aluminum, and other problems, made the alloy unsuitable for the intended application. Americium metal was found to have a high solid solubility in cerium and alloys prepared from these two elements exhibited all of the properties desired for the tracer program application. Cerium-americium alloys containing up to 34 wt% americium have been prepared using both co-melting and co-reduction techniques. The latter technique involves co-reduction of cerium tetrafluoride and americium tetrafluoride with calcium metal in a sealed reduction vessel. Casting techniques have been developed for preparing up to eight 2.2 cm (0.87 in) diameter disks in a single casting, and cerium-americium metal alloy disks containing from 10 to 25 wt% 241 Am have been prepared using these techniques. (orig.)

  3. Surface complexation modeling of americium sorption onto volcanic tuff.

    Science.gov (United States)

    Ding, M; Kelkar, S; Meijer, A

    2014-10-01

    Results of a surface complexation model (SCM) for americium sorption on volcanic rocks (devitrified and zeolitic tuff) are presented. The model was developed using PHREEQC and based on laboratory data for americium sorption on quartz. Available data for sorption of americium on quartz as a function of pH in dilute groundwater can be modeled with two surface reactions involving an americium sulfate and an americium carbonate complex. It was assumed in applying the model to volcanic rocks from Yucca Mountain, that the surface properties of volcanic rocks can be represented by a quartz surface. Using groundwaters compositionally representative of Yucca Mountain, americium sorption distribution coefficient (Kd, L/Kg) values were calculated as function of pH. These Kd values are close to the experimentally determined Kd values for americium sorption on volcanic rocks, decreasing with increasing pH in the pH range from 7 to 9. The surface complexation constants, derived in this study, allow prediction of sorption of americium in a natural complex system, taking into account the inherent uncertainty associated with geochemical conditions that occur along transport pathways. Published by Elsevier Ltd.

  4. Self-irradiation and oxidation effects on americium sesquioxide and Raman spectroscopy studies of americium oxides

    Energy Technology Data Exchange (ETDEWEB)

    Horlait, Denis [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France); Caraballo, Richard [CEA, DEN, DTCD/SECM/LMPA, F-30207 Bagnols-sur-Cèze Cedex (France); Lebreton, Florent [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France); Jégou, Christophe [CEA, DEN, DTCD/SECM/LMPA, F-30207 Bagnols-sur-Cèze Cedex (France); Roussel, Pascal [Unité de Catalyse et Chimie du Solide, UMR 8012 CNRS, Ecole Nationale Supérieure de Chimie de Lille BP 90108, 59652 Villeneuve d’Ascq Cedex (France); Delahaye, Thibaud, E-mail: thibaud.delahaye@cea.fr [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France)

    2014-09-15

    Americium oxides samples were characterized by X-ray diffraction (XRD) and Raman spectroscopy, with an emphasis on their structural behavior under oxidation and self-irradiation. Raman spectra of americium dioxide (AmO{sub 2}) and sesquioxide (Am{sub 2}O{sub 3}) were obtained for the first time. With the help of literature data on isostructural oxides, Raman signatures of Ia-3 C-type Am{sub 2}O{sub 3} and P-3m1 A-type Am{sub 2}O{sub 3} are identified. For AmO{sub 2,} a clear band is noted at 390 cm{sup −1}. Its nature is compared to that of the other actinide dioxides. Am{sub 2}O{sub 3} evolution under ambient conditions and against {sup 241}Am α self-irradiation was monitored by powder XRD. The sample, initially composed of A-type Am{sub 2}O{sub 3} as major phase as well as C2/m B-type and C-type structures as minor phases, progressively oxidizes to Fm-3m AmO{sub 2−δ} over a few months. On the basis of diffractogram refinements, evolutions of unit cell volumes caused by self-irradiation are also determined and discussed. - Graphical abstract: The evolution of americium oxide under ambient conditions was monitored using XRD (X-ray diffraction) and Raman spectroscopy. After a thermal treatment under reducing conditions, a polyphasic sample mainly composed of A- and C-type americium sesquioxides is evidenced by XRD and Raman spectroscopy. The sample then evolves through two processes: oxidation and self-irradiation. The first one provokes the progressive appearance of F-type americium dioxide while the initial phases disappear, whereas the main effect of the second is a structural swelling with time. - Highlights: • The first Raman spectroscopy measurements on americium oxides were performed. • Observed Am{sub 2}O{sub 3} Raman bands were identified thanks to data on analogue compounds. • AmO{sub 2} assumed T{sub 2g} band presents a shift compared to the actinide dioxide series. • Am{sub 2}O{sub 3} evolution under self-irradiation and oxidation was also

  5. Higher Americium Oxidation State Research Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    Mincher, Bruce J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Law, Jack D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Goff, George S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Moyer, Bruce A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Lumetta, Gregg J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shehee, Thomas C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hobbs, David T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-12-18

    The partitioning of hexavalent Am from dissolved nuclear fuel requires the ability to efficiently oxidize Am(III) to Am(VI) and to maintain that oxidation state for a length of time sufficient to perform the separation. Several oxidants have been, or are being developed. Chemical oxidants include Ag-catalyzed ozone, Ag-catalyzed peroxydisulfate, Cu(III) periodate, and sodium bismuthate. Hexavalent americium has also now successfully been prepared by electrolysis, using functionalized electrodes. So-called auto-reduction rates of Am(VI) are sufficiently slow to allow for separations. However, for separations based on solvent extraction or ion exchange using organic resins, the high valence state must be maintained under the reducing conditions of the organic phase contact, and a holding oxidant is probably necessary. Until now, only Cu(III) periodate and sodium bismuthate oxidation have been successfully combined with solvent extraction separations. Bismuthate oxidation provided the higher DAm, since it acts as its own holding oxidant, and a successful hot test using centrifugal contactors was performed. For the other oxidants, Ag-catalyzed peroxydisulfate will not oxidize americium in nitric acid concentrations above 0.3 M, and it is not being further investigated. Peroxydisulfate in the absence of Ag catalysis is being used to prepare Am(V) in ion exchange work, discussed below. Preliminary work with Ag-catalyzed ozone has been unsuccessful for extractions of Am(VI) from 6.5 M HNO3, and only one attempt at extraction, also from 6.5 M HNO3, using the electrolytic oxidation has been attempted. However, this high acid concentration was based on the highest Am extraction efficiency using the bismuthate oxidant; which is only sparingly soluble, and thus the oxidation yield is based on bismuthate solubility. Lower acid concentrations may be sufficient with alternative oxidants and work with Ag-ozone, Cu(III) and electrolysis is on-going. Two non

  6. Feasibility of the fabrication of americium targets

    International Nuclear Information System (INIS)

    Haas, D.; Somers, J.

    1999-01-01

    The paper compares the processes used at ITU for the fabrication of americium targets for transmutation: powder mixing process, sol-gel method and the infiltration by an active solution of inactive pellets. The advantages of the latter process, related mainly to the lower level of dust formation, are stressed. Moreover, the radiological constraints on the fabrication as a function of Am content and of selected fabrication process are evaluated. As conclusion, the feasibility of Am target fabrication has been demonstrated on a laboratory scale, based on experimental results evaluation. The penalties due to radiological constraints in a semi-industrial process are acceptable. The future developments consist in the construction of a laboratory fully dedicated to minor actinides fuel pins or targets fabrication. (author)

  7. Americium/Curium Disposition Life Cycle Planning Study

    International Nuclear Information System (INIS)

    Jackson, W.N.; Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.

    1998-01-01

    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS)

  8. Plutonium and Americium Geochemistry at Hanford: A Site Wide Review

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Felmy, Andrew R.

    2012-08-23

    This report was produced to provide a systematic review of the state-of-knowledge of plutonium and americium geochemistry at the Hanford Site. The report integrates existing knowledge of the subsurface migration behavior of plutonium and americium at the Hanford Site with available information in the scientific literature regarding the geochemistry of plutonium and americium in systems that are environmentally relevant to the Hanford Site. As a part of the report, key research needs are identified and prioritized, with the ultimate goal of developing a science-based capability to quantitatively assess risk at sites contaminated with plutonium and americium at the Hanford Site and the impact of remediation technologies and closure strategies.

  9. Americium/Curium Disposition Life Cycle Planning Study

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, W.N. [Westinghouse Savannah River Company, AIKEN, SC (United States); Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.

    1998-04-30

    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS).

  10. PROCESS FOR SEPARATING AMERICIUM AND CURIUM FROM RARE EARTH ELEMENTS

    Science.gov (United States)

    Baybarz, R.D.; Lloyd, M.H.

    1963-02-26

    This invention relates to methods of separating americium and curium values from rare earth values. In accordance with the invention americium, curium, and rare earth values are sorbed on an anion exchange resin. A major portion of the rare earth values are selectively stripped from the resin with a concentrated aqueous solution of lithium chloride, and americium, curium, and a minor portion of rare earth values are then stripped from the resin with a dilute aqueous solution of lithium chloride. The americium and curium values are further purified by increasing the concentration of lithium chloride in the solution to at least 8 molar and selectively extracting rare earth values from the resulting solution with a monoalkylphosphoric acid. (AEC)

  11. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, Kyle Shelton [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-09-28

    These are a set of slides intended for an information session as part of recruiting activities at Brigham Young University. It gives an overview of aqueous chloride operations, specifically on plutonium and americium purification/recovery. This presentation details the steps taken perform these processes, from plutonium size reduction, dissolution, solvent extraction, oxalate precipitation, to calcination. For americium recovery, it details the CLEAR (chloride extraction and actinide recovery) Line, oxalate precipitation and calcination.

  12. 1976 Hanford americium-exposure incident: external decontamination procedures

    International Nuclear Information System (INIS)

    Jech, J.J.; Berry, J.R.; Breitenstein, B.D.

    1982-01-01

    An accident resulted in the deposition on an injured workman's skin surfaces, in acid-burned areas and in lacerations, of something in excess of 6 mCi americium-241. The external decontamination procedures used, the change in americium content of the skin during the course of treatment, and some of the unusual problems encountered from the extrusion of foreign material and flaking of skin and scar tissue are described

  13. Preparation of americium metal of high purity and determination of the heat of formation of the hydrated trivalent americium ion

    International Nuclear Information System (INIS)

    Spirlet, J.C.

    1975-10-01

    In order to redetermine some physical and chemical properties of americium metal, several grams of Am-241 have been prepared by two independent methods: lanthanum reduction of the oxide and thermal dissociation of the intermetallic compound Pt 5 Am. After its separation from excess lanthanum or alloy constituent by evaporation, americium metal was further purified by sublimation at 1100 deg C and 10 -6 Torr. Irrespective of the method of preparation, the americium samples displayed the same d.h.c.p. crystal structure. As determined by vacuum hot extraction, the oxygen, nitrogen and hydrogen contents are equal to or smaller than 250, 50 and 20 ppm, respectively. The heats of solution of americium metal (d.c.h.p. structure) in aqueous hydrochloric acid solutions have been measured at 298.15+-0.05K. The standard enthalpy of formation of Am 3+ (aq) is obtained as -616.7+-1.2 kJ mol -1 [fr

  14. Citric complexes, neodymium citrate and americium citrate

    International Nuclear Information System (INIS)

    Bouhlassa, Saidati.

    1981-06-01

    The behaviour of neodymium and americium has been studied in citric aqueous medium by two methods: solvent extraction of elements at tracer scale as chelates and by potentiometry. So range of pH and concentrations of elements and citric acid never reached before have been explored: 10 -7 -1 M, 10 -10 -3 , Csub(H3 Cit) -1 M, 1 2 O; AmCit, xH 2 O; NdCit 2 Co(NH 3 ) 6 , 8H 2 O; AmCit 2 Co(NH 3 ) 6 , xH 2 O and Nd 3 (OH) 4 (Cit) 4 NH 4 (Co(NH 3 ) 6 ) 2 , 18H 2 O. Their spectroscopic and crystallographic characteristics have been listed and studied. The nephelauxetic effect has been estimated from citric complexes as well as from citrates of these elements. The structure of the complexes in solution has been discussed on the basis of analysis of hypersensitive transition in different complexes [fr

  15. Applicability of insoluble tannin to treatment of waste containing americium

    International Nuclear Information System (INIS)

    Matsumura, T.; Usuda, S.

    1998-01-01

    The applicability of insoluble tannin adsorbent to the treatment of aqueous waste contaminated with americium has been investigated. Insoluble tannin is considered highly applicable because it consists of only carbon, hydrogen and oxygen and so its volume can be easily reduced by incineration. This report describes measurements of the americium distribution coefficient in low concentration nitric acid. The americium distribution coefficients were found to decrease with increasing concentration of nitric acid and sodium nitrate, and with increasing temperature. At 25 C in 2.0 x 10 -3 M HNO 3 , the distribution coefficient was found to be 2000 ml g -1 . The adsorption capacity was determined by column experiments using europium as a simulant of americium, and found to be 7 x 10 -3 mmol g -1 -dried tannin in 0.01 M HNO 3 at 25 C, which corresponds to approximately 1.7 mg- 241 Am/g-adsorbent(dried). The prospect of applying the adsorbent to the treatment of aqueous waste contaminated with americium appears promising. (orig.)

  16. A process for the recovery of americium from analytical wastes

    International Nuclear Information System (INIS)

    Brossard, P.; Kwinta, J.; Schwander, Y.

    1984-12-01

    The object of the present work is to define a procedure for the extraction of americium contained in hundreds of liters of liquid analytical wastes. The main objective is to produce wastes for which the americium concentration is lower than 0,5 mg/l, the operations being carried out in glove boxes. Dihexyl N, N-diethylcarbamylmethylene phosphonate (DHDECMP) is used for the extraction of americium. Experimental laboratory results and procedure design are described. Distribution coefficient, DHDECMP concentration, addition of TBP, influence of PH and temperature are studied. A bank of mixer-settlers appears to be the most appropriate laboratory equipment to handle large volume of solution with a good efficiency

  17. The selective extraction of americium from high level liquid wastes

    Energy Technology Data Exchange (ETDEWEB)

    Adnet, J.M.; Donnet, L.; Brossard, P.; Bourges, J.

    1996-12-31

    One of the possible ways selected by CEA for the partitioning of minor actinides from solutions containing fission products is the selective extraction of the oxidized species. This papers deals with the latest developments in the electrochemical oxidation of americium in nitric media to the oxidation states (IV) and (VI). Oxidized americium is generated and stabilized through the use of poly anionic ligands such as the phospho tungstate. With in view the use of such ligands in the treatment of real liquid wastes, the complexation of several metallic ions has been investigated A first experiment done with a real liquid waste to prove the possibility to selectively extract the oxidized americium is presented. (authors). 8 refs.

  18. Synergistic extraction behaviour of americium from simulated acidic waste solutions

    International Nuclear Information System (INIS)

    Pathak, P.N.; Veeraraghavan, R.; Mohapatra, P.K.; Manchanda, V.K.

    1998-01-01

    The extraction behaviour of americium has been investigated with mixtures of 3-phenyl-4-benzoyl-5-isoxazolone (PBI) and oxodonors viz. tri-n-butyl phosphate (TBP), tri-n-octyl phosphine oxide (TOPO) and di-n-butyl octanamide (DBOA) using dodecane as the diluent from 1-6 M HNO 3 media. It is observed that D Am remains unaltered with PBI concentration (in the range 0.06-0.1 M) at 1.47 M TBP in the entire range of HNO 3 concentration. PBI and TBP in combination appears more promising compared to other synergistic systems. The possibility of using this mixture for americium removal from high level liquid waste solution has been explored. Extraction studies indicated that prior removal of uranium by 20% TBP in dodecane is helpful in the quantitative recovery of americium in three contacts. Effect of lanthanides on D Am is found to be marginal. (orig.)

  19. Covalency in Americium(III) Hexachloride.

    Science.gov (United States)

    Cross, Justin N; Su, Jing; Batista, Enrique R; Cary, Samantha K; Evans, William J; Kozimor, Stosh A; Mocko, Veronika; Scott, Brian L; Stein, Benjamin W; Windorff, Cory J; Yang, Ping

    2017-06-28

    Developing a better understanding of covalency (or orbital mixing) is of fundamental importance. Covalency occupies a central role in directing chemical and physical properties for almost any given compound or material. Hence, the concept of covalency has potential to generate broad and substantial scientific advances, ranging from biological applications to condensed matter physics. Given the importance of orbital mixing combined with the difficultly in measuring covalency, estimating or inferring covalency often leads to fiery debate. Consider the 60-year controversy sparked by Seaborg and co-workers ( Diamond, R. M.; Street, K., Jr.; Seaborg, G. T. J. Am. Chem. Soc. 1954 , 76 , 1461 ) when it was proposed that covalency from 5f-orbitals contributed to the unique behavior of americium in chloride matrixes. Herein, we describe the use of ligand K-edge X-ray absorption spectroscopy (XAS) and electronic structure calculations to quantify the extent of covalent bonding in-arguably-one of the most difficult systems to study, the Am-Cl interaction within AmCl 6 3- . We observed both 5f- and 6d-orbital mixing with the Cl-3p orbitals; however, contributions from the 6d-orbitals were more substantial. Comparisons with the isoelectronic EuCl 6 3- indicated that the amount of Cl 3p-mixing with Eu III 5d-orbitals was similar to that observed with the Am III 6d-orbitals. Meanwhile, the results confirmed Seaborg's 1954 hypothesis that Am III 5f-orbital covalency was more substantial than 4f-orbital mixing for Eu III .

  20. The ingestion of plutonium and americium by range cattle

    International Nuclear Information System (INIS)

    Blincoe, C.; Bohman, V.R.; Smith, D.D.

    1981-01-01

    The intake of plutonium and americium in the diet of cattle grazing on plutonium contaminated desert range was determined. Daily feed intake of the grazing animals was also determined so that the amount of nuclides ingested daily could be ascertained. Soil ingested by range cattle constituted the principal and possibly only source of ingested plutonium and americium and resulted in a daily intake of 3600-6600 pCi 238 Pu, 85,000-400,000 pCi 239 Pu, and 11,000-31,000 pCi 241 Am daily. Determining transuranic intake by direct measurement and from the composition and contamination of the diet gave identical results. (author)

  1. 234 - 237_Uduma_Elementall

    African Journals Online (AJOL)

    pc

    metals are associated with a range of neurolo technique can also provide a rapid evaluatio thereby providing .... range is even wider from Beryllium to Uranium. U). http://dx.doi.org/10.4314/bajopas.v1. 234. DISPERSIVE ... associated with metal ore mining and processing in. Nigeria and provides a robust tool for economic.

  2. 1976 Hanford americium exposure incident: overview and perspective

    International Nuclear Information System (INIS)

    Thompson, R.C.

    1982-01-01

    Salient features of the 1976 Hanford americium exposure incident are discussed. Comparisons are made with previous human and animal exposure data, and conclusions drawn relative to the injured workman, to health physics practices, and to the adequacy of current exposure limits

  3. Determination of plutonium, americium and curium in the marine environment

    International Nuclear Information System (INIS)

    Grenaut, CLaude; Germain, Pierre; Miramand, Pierre.

    1982-01-01

    The method used in the Laboratory for plutonium, americium and curium determination in marine samples (water, sediments, animals, plants) is presented. It is a modification of a procedure based on adsorption on ion exchange resins developed by other authors. The preliminary preparation of the samples, the radiochemical procedures and electrodeposition are described so as to be used as a practical handbook [fr

  4. Reduction Rates for Higher Americium Oxidation States in Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Grimes, Travis Shane [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mincher, Bruce Jay [Idaho National Lab. (INL), Idaho Falls, ID (United States); Schmitt, Nicholas C [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-30

    The stability of hexavalent americium was measured using multiple americium concentrations and nitric acid concentrations after contact with the strong oxidant sodium bismuthate. Contrary to our hypotheses Am(VI) was not reduced faster at higher americium concentrations, and the reduction was only zero-order at short time scales. Attempts to model the reduction kinetics using zero order kinetic models showed Am(VI) reduction in nitric acid is more complex than the autoreduction processes reported by others in perchloric acid. The classical zero-order reduction of Am(VI) was found here only for short times on the order of a few hours. We did show that the rate of Am(V) production was less than the rate of Am(VI) reduction, indicating that some Am(VI) undergoes two electron-reduction to Am(IV). We also monitored the Am(VI) reduction in contact with the organic diluent dodecane. A direct comparison of these results with those in the absence of the organic diluent showed the reduction rates for Am(VI) were not statistically different for both systems. Additional americium oxidations conducted in the presence of Ce(IV)/Ce(III) ions showed that Am(VI) is reduced without the typical growth of Am(V) observed in the systems sans Ce ion. This was an interesting result which suggests a potential new reduction/oxidation pathway for Am in the presence of Ce; however, these results were very preliminary, and will require additional experiments to understand the mechanism by which this occurs. Overall, these studies have shown that hexavalent americium is fundamentally stable enough in nitric acid to run a separations process. However, the complicated nature of the reduction pathways based on the system components is far from being rigorously understood.

  5. Kinetics and mechanism of oxidation of americium(III) to americium(VI) in dilute phosphoric acid solutions

    International Nuclear Information System (INIS)

    Milyukova, M.S.; Litvina, M.N.; Myasoedov, B.F.

    1980-01-01

    The reaction between trivalent americium and a mixture of silver with ammonium persulfate in 0.1-3M H 3 PO 4 solutions was studied. Hexavalent americium was found to be the product of interaction under these conditions. Americium oxidation is described with a first order equation with rate constants k=18.7 hr -1 and k=8.74 hr -1 for 0.1-0.5M and 1M H 3 PO 4 , respectively. The activation energy calculated from the temperature dependence of the rate of americium oxidation by a mixture of Ag 3 PO 4 with (NH 4 ) 2 S 2 O 8 is 9.1 kcal/mole. The stability of Am(VI) in 0.1-1M H 3 PO 4 was studied. No reduction of Am(VI) over a period of 30-40 hrs was observed; after that the reduction of Am(VI) follows a zero order law with the apparent rate constant k=0.0036 hr -1 . The mechanism of Am(III) oxidation with a mixture of silver and ammonium persulfate is discussed. (author)

  6. 49 CFR 234.223 - Gate arm.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Gate arm. 234.223 Section 234.223 Transportation... Maintenance Standards § 234.223 Gate arm. Each gate arm, when in the downward position, shall extend across... clearly viewed by approaching highway users. Each gate arm shall start its downward motion not less than...

  7. 49 CFR 234.105 - Activation failure.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Activation failure. 234.105 Section 234.105... of Warning System Malfunction § 234.105 Activation failure. Upon receipt of a credible report of warning system malfunction involving an activation failure, a railroad having maintenance responsibility...

  8. 20 CFR 234.60 - Escheat.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Escheat. 234.60 Section 234.60 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT LUMP-SUM PAYMENTS Miscellaneous § 234.60 Escheat. Any payment under this part which would be payable to any state, political...

  9. 40 CFR 52.234 - Source surveillance.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Source surveillance. 52.234 Section 52.234 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS California § 52.234 Source surveillance. (a) Except in...

  10. 48 CFR 234.005-1 - Competition.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Competition. 234.005-1 Section 234.005-1 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE SPECIAL CATEGORIES OF CONTRACTING MAJOR SYSTEM ACQUISITION 234.005-1 Competition. (1) A...

  11. 49 CFR 234.251 - Standby power.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Standby power. 234.251 Section 234.251 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION..., Inspection, and Testing Inspections and Tests § 234.251 Standby power. Standby power shall be tested at least...

  12. 32 CFR 234.16 - Gambling.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Gambling. 234.16 Section 234.16 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.16 Gambling. Gambling in any form, or the operation of gambling devices, is...

  13. 49 CFR 234.259 - Warning time.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Warning time. 234.259 Section 234.259..., Inspection, and Testing Inspections and Tests § 234.259 Warning time. Each crossing warning system shall be tested for the prescribed warning time at least once every 12 months and when the warning system is...

  14. Americium extraction by alkylpyrocatechin from alkaline salt solutions

    International Nuclear Information System (INIS)

    Karalova, Z.K.; Rodionova, L.M.; Myasoedov, B.F.

    1984-01-01

    Effect of iron, aluminium, calcium, and sodium nitrates on americium extraction by 0.1 mol/l DOP solution [4-(α-α dioctylethyl) pyrocatechin] in toluene from a mixture of 2 mol/l NaOH with 0.1 mol/l EDTA has been investigated. It has been shown that americium extraction does not change essen-- tially in the presence of salts that permits to use DOP for Am extraction from alkaline solutions in the presence of outside salts. Verification of the above method of extraction of radioactive isotopes has been carried out. According to the data obtained double extraction provides a preparation of alkaline solutions practically free from radioactive isotopes. DOP application for Am extraction from alkaline salt solutions allows one to carry out repeated Am concentration and separation from accompanying elements. Conditions, under which Fe(3)-Am(3) pair separation coefficient achieves nx10 2 -10 4 , have been found out

  15. Contribution to the study of higher valency states of americium

    International Nuclear Information System (INIS)

    Langlet, Jean.

    1976-01-01

    Study of the chemistry of the higher valencies of americium in aqueous solutions and especially the autoreduction phenomenon. First a purification method of americium solutions is studied by precipitation, solvent extraction and ion exchange chromatography. Studies of higher valency states chemical properties are disturbed by the autoreduction phenomenon changing Am VI and Am V in Am III more stable. Stabilization of higher valency states, characterized by a steady concentration of Am VI in solution, can be done by complexation of Am VI and Am V ions or by a protecting effect of foreign ions. The original medium used has a complexing effect by SO 4 2- ions and a protecting effect by the system S 2 O 8 2- -Ag + consuming H 2 O 2 main reducing agent produced by water radiolysis. These effects are shown by the study of Am VI in acid and basic solutions. A mechanism of the stabilization effect is given [fr

  16. Method for removal of plutonium impurity from americium oxides and fluorides

    Science.gov (United States)

    FitzPatrick, J.R.; Dunn, J.G.; Avens, L.R.

    1987-02-13

    Method for removal of plutonium impurity from americium oxides and fluorides. AmF/sub 4/ is not further oxidized to AmF/sub 6/ by the application of O/sub 2/F at room temperature thereto, while plutonium compounds present in the americium sample are fluorinated to volatile PuF/sub 6/, which can readily be separated therefrom, leaving the purified americium oxides and/or fluorides as the solid tetrafluoride thereof.

  17. Research program on development of advanced treatment technology for americium-containing aqueous waste in NUCEF

    International Nuclear Information System (INIS)

    Mineo, Hideaki; Matsumura, Tatsuro; Tsubata, Yasuhiro

    1996-10-01

    A research program was prepared on the development of an advanced treatment process for the americium-containing concentrated aqueous waste in NUCEF, than allows americium recovery for the reuse and the reduction of TRU waste generation. A preliminary analysis was conducted on the separation requirements based on the components estimated for the waste. An R and D strategy was proposed from the view to reduce TRU waste generated in the processing that the highest priority is given on the control of TRU leakage such as americium into the effluent stream after americium recovery and the minimization of salt used in the separation over the decontamination of impurities from americium. The extraction chromatographic method was selected as a candidate technology for americium separation under the principle to use reagents that are functional in acidic conditions such as bidentate extractants of DHEDECMP, CMPO or diamides, considering the larger flexibilities in process modification and possible multi-component separation with compact equipment and the past achievements on the recovery of kg quantities of americium. Major R and D items extracted are screening and evaluation of extractants for americium and plutonium, optimization of separation conditions, selection of denitration method, equipment developments and development of solidification methods of discarded americium after reuse and of various kinds of separation residues. In order to cope these items, four steps of R and D program were proposed, i.e., fundamental experiment in beaker-scale on screening and evaluation of extractants, flowsheet study in bench-scale using simulated and small amount of americium aqueous waste solution to evaluate candidate process, americium recovery test in iron-shielded cell to be installed in NUCEF. It is objected to make recovery of 100g orders of americium used for research on fundamental TRU fuel properties. (J.P.N.)

  18. Ingestion Pathway Transfer Factors for Plutonium and Americium

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-07-28

    Overall transfer factors for major ingestion pathways are derived for plutonium and americium. These transfer factors relate the radionuclide concentration in a given foodstuff to deposition on the soil. Equations describing basic relationships consistent with Regulatory Guide 1.109 are followed. Updated values and coefficients from IAEA Technical Reports Series No. 364 are used when a available. Preference is given to using factors specific to the Savannah River Site.

  19. 1976 Hanford americium-exposure incident: decontamination and treatment facility

    International Nuclear Information System (INIS)

    Berry, J.R.; McMurray, B.J.; Jech, J.J.; Breitenstein, B.D.; Quigley, E.J.

    1982-01-01

    An injured worker, contaminated with over 6 mCi of americium-241, required special treatment and housing for 4 months. This paper is a description of the design and management of the facility in which most of the treatment and housing occurred. The problems associated with contamination control, waste handling, supplies, and radiological concerns during the two-stage transfer of the patient from a controlled situation to his normal living environment are discussed in detail

  20. Americium-241: the most useful isotope of the actinide elements

    International Nuclear Information System (INIS)

    Navratil, J.D.

    1984-01-01

    Used extensively in nuclear gauges and in many other areas, this man-made element (Atomic Number 95) was first isolated in weighable amounts during World War II. Americium is now a very useful by-product of the nuclear industry and is produced in kilogram amounts by appropriate recovery, separation and purification processes. A review will be presented of its discovery, nuclear and chemical properties, and uses, with emphasis on its production process and separations chemistry

  1. Extraction separation of americium and curium. A review

    International Nuclear Information System (INIS)

    Petrzilova, H.

    1976-11-01

    A survey is given of extraction systems suitable for transplutonium element separation and preparation as well as for the practical application of their nuclear properties. Methods are discussed in detail of separating the actinide and the lanthanide fractions from fission and corrosion products and of separating americium from curium. The description is completed with flowsheets showing the separation of transplutonium elements from irradiated targets and waste solutions after spent fuel reprocessing. (L.K.)

  2. Ingestion Pathway Transfer Factors for Plutonium and Americium

    International Nuclear Information System (INIS)

    Blanchard, A.

    1999-01-01

    Overall transfer factors for major ingestion pathways are derived for plutonium and americium. These transfer factors relate the radionuclide concentration in a given foodstuff to deposition on the soil. Equations describing basic relationships consistent with Regulatory Guide 1.109 are followed. Updated values and coefficients from IAEA Technical Reports Series No. 364 are used when a available. Preference is given to using factors specific to the Savannah River Site

  3. On the structure of thorium and americium adenosine triphosphate complexes

    International Nuclear Information System (INIS)

    Mostapha, Sarah; Berton, Laurence; Boubals, Nathalie; Zorz, Nicole; Charbonnel, Marie-Christine; Fontaine-Vive, Fabien; Den Auwer, Christophe; Solari, Pier Lorenzo

    2014-01-01

    The actinides are chemical poisons and radiological hazards. One challenge to better appraise their toxicity and develop countermeasures in case of exposure of living organisms is to better assess pathways of contamination. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, nucleotides and in particular adenosine triphosphate nucleotide (ATP) may be considered critical target building blocks for actinides. Combinations of spectroscopic techniques (Fourier transformed Infra Red [FTIR], Electro-spray Ionization Mass Spectrometry [ESI-MS], and Extended X-ray Absorption Fine Structure [EXAFS]) with quantum chemical calculations have been implemented in order to assess the actinides coordination arrangement with ATP. We describe and compare herein the interaction of ATP with thorium and americium; thorium(IV) as a representative of actinide(IV) like plutonium(IV) and americium(III) as a representative of all heavier actinides. In the case of thorium, an insoluble complex is readily formed. In the case of americium, a behavior identical to that described previously for lutetium has been observed with insoluble and soluble complexes. The comparative study of ATP complexation with Th(IV) and Am(III) shows their ability to form insoluble complexes for which a structural model has been proposed by analogy with previously described Lu(III) complexes. (authors)

  4. On the structure of thorium and americium adenosine triphosphate complexes.

    Science.gov (United States)

    Mostapha, Sarah; Fontaine-Vive, Fabien; Berthon, Laurence; Boubals, Nathalie; Zorz, Nicole; Solari, Pier Lorenzo; Charbonnel, Marie Christine; Den Auwer, Christophe

    2014-11-01

    The actinides are chemical poisons and radiological hazards. One challenge to better appraise their toxicity and develop countermeasures in case of exposure of living organisms is to better assess pathways of contamination. Because of the high chemical affinity of those actinide elements for phosphate groups and the ubiquity of such chemical functions in biochemistry, nucleotides and in particular adenosine triphosphate nucleotide (ATP) may be considered critical target building blocks for actinides. Combinations of spectroscopic techniques (Fourier transformed Infra Red [FTIR], Electrospray Ionization Mass Spectrometry [ESI-MS], and Extended X-ray Absorption Fine Structure [EXAFS]) with quantum chemical calculations have been implemented in order to assess the actinides coordination arrangement with ATP. We describe and compare herein the interaction of ATP with thorium and americium; thorium(IV) as a representative of actinide(IV) like plutonium(IV) and americium(III) as a representative of all heavier actinides. In the case of thorium, an insoluble complex is readily formed. In the case of americium, a behavior identical to that described previously for lutetium has been observed with insoluble and soluble complexes. The comparative study of ATP complexation with Th(IV) and Am(III) shows their ability to form insoluble complexes for which a structural model has been proposed by analogy with previously described Lu(III) complexes.

  5. The EFTTRA-T4 experiment on americium transmutation

    CERN Document Server

    Konings, R J M; Dassel, G; Pijlgroms, B J; Somers, J; Toscano, E

    2000-01-01

    In the EFTTRA-T4 experiment the irradiation behaviour of a target containing americium dispersed in MgAl sub 2 O sub 4 was studied. Pellets containing 10-12 wt% sup 2 sup 4 sup 1 Am were fabricated by the infiltration method. However, it was found that the americium, intended to be present as AmO sub 2 sub - sub x , formed a compound, probably AmAlO sub 3 , during sintering. The T4 target was irradiated in the High Flux Reactor (HFR) Petten from August 1996 to January 1998 (358.4 fpd's). Post-test burn-up calculations indicated that the sup 2 sup 4 sup 1 Am concentration is reduced to 4% of the initial value at the end of the irradiation. The fraction of the initial americium atoms that were fissioned is 28%. Non-destructive and destructive examinations of the target indicated that swelling of the target pellets occurred. This is attributed to accumulation of helium, produced by alpha decay of sup 2 sup 4 sup 2 Cm that occurs in the transmutation scheme of sup 2 sup 4 sup 1 Am.

  6. Gut uptake factors for plutonium, americium and curium

    International Nuclear Information System (INIS)

    Harrison, J.D.

    1982-01-01

    Data on estimates of the absorption of plutonium, americium and curium from the human gut based on measurements of uptake in other mammalian species are reviewed. It is proposed that for all adult members of the public ingesting low concentrations of plutonium in food and water, 0.05% would be an appropriate value of absorption except when the conditions of exposure are known and a lower value can be justified. For dietary intakes of americium and curium, the available data do not warrant a change from the ICRP value of 0.05%. For newborn children ingesting americium, curium and soluble forms of plutonium, a value of 1% absorption is proposed for the first 3 months of life during which the infant is maintained on a milk diet. It is proposed that a value of 0.5% should be used for the first year of life to take account of the gradual maturation of the gut. In considering the ingestion of insoluble oxides of plutonium by infants, it is proposed that absorption is taken as 0.1% for the first 3 months and 0.05% for the first year. (author)

  7. Extraction of pentavalent americium by di(2-ethylhexyl)phosphoric acid

    International Nuclear Information System (INIS)

    Molochnikova, N.P.; Myasoedov, B.F.; Frenkel, V.Ya.

    1983-01-01

    Conditions have been found for the extraction of americium(V) by HDEHP in octane from acetate buffer solutions at pH 4.5-5.0 in the presence of ammonium persulphate which was necessary to stabilize oxidized americium under these conditions. The effect of the nature of a solvent on the extraction coefficient of americium(V) was studied. Macroamounts of americium(V) were extracted by 0.5M HDEHP in octane. The absorption spectrum of americium(V) in the extract has been recorded. The stability of americium(V) in the organic phase was evaluated. The absence of interfering influence of the anions of phosphotungstic acids on the extraction of americium(V) by 0.5M HDEHP in octane makes it possible to separate americium(V) from trivalent actinides during one extraction from acetate solutions at pH 4.5-5.0 in the presence of 10 -3 M potassium phosphotungstate; the separation factor is about 10 3 . (author)

  8. Airborne plutonium-239 and americium-241 concentrations measured from the 125-meter Hanford Meteorological Tower

    International Nuclear Information System (INIS)

    Sehmel, G.A.

    1978-01-01

    Airborne plutonium-239 and americium-241 concentrations and fluxes were measured at six heights from 1.9 to 122 m on the Hanford meteorological tower. The data show that plutonium-239 was transported on nonrespirable and small particles at all heights. Airborne americium-241 concentrations on small particles were maximum at the 91 m height

  9. 48 CFR 234.004 - Acquisition strategy.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Acquisition strategy. 234..., DEPARTMENT OF DEFENSE SPECIAL CATEGORIES OF CONTRACTING MAJOR SYSTEM ACQUISITION 234.004 Acquisition strategy. (1) See 209.570 for policy applicable to acquisition strategies that consider the use of lead system...

  10. Robotic sample preparation for radiochemical plutonium and americium analyses

    International Nuclear Information System (INIS)

    Stalnaker, N.; Beugelsdijk, T.; Thurston, A.; Quintana, J.

    1985-01-01

    A Zymate robotic system has been assembled and programmed to prepare samples for plutonium and americium analyses by radioactivity counting. The system performs two procedures: a simple dilution procedure and a TTA (xylene) extraction of plutonium. To perform the procedures, the robotic system executes 11 unit operations such as weighing, pipetting, mixing, etc. Approximately 150 programs, which require 64 kilobytes of memory, control the system. The system is now being tested with high-purity plutonium metal and plutonium oxide samples. Our studies indicate that the system can give results that agree within 5% at the 95% confidence level with determinations performed manually. 1 ref., 1 fig., 1 tab

  11. Implications of plutonium and americium recycling on MOX fuel fabrication

    International Nuclear Information System (INIS)

    Renard, A.; Pilate, S.; Maldague, Th.; La Fuente, A.; Evrard, G.

    1995-01-01

    The impact of the multiple recycling of plutonium in power reactors on the radiation dose rates is analyzed for the most critical stage in a MOX fuel fabrication plant. The limitation of the number of Pu recycling in light water reactors would rather stem from reactor core physics features. The case of recovering americium with plutonium is also considered and the necessary additions of shielding are evaluated. A comparison between the recycling of Pu in fast reactors and in light water reactors is presented. (author)

  12. Effect of 241-americium on bone marrow stroma

    International Nuclear Information System (INIS)

    Heuvel, R. van den

    1990-01-01

    The regulation of haemopoiesis occurs via complex interactions between the stroma and the haemopoietic cells. An attempt to further clarifying the mechanisms and the exact role of the stroma in the regulation was made in a study. Results revealed that the murine bone marrow stromal cells are highly radiosensitive after injection with 241-americium and can thus be considered as a target population after internal contamination. In addition, observations are made which may be important for risk estimation for the developing animal and during pregnancy. Contamination in utero and by lactation shows persistent damage up to 1 year after contamination at an average annual dose of 5 cGy. (author)

  13. Solubility of americium-241 in in vitro bovine ruminal-gastrointestinal fluids and predicted tissue retention and milk secretion of field-ingested americium-241

    International Nuclear Information System (INIS)

    Barth, J.

    1978-01-01

    The alimentary solubility and behavior of americium-241 were studied in an artificial rumen and simulated bovine gastrointestinal fluids. Rumen juice was augmented with americium-241 nitrate solution and incubated for 24 hours. This juice was successively converted by the addition of bile and enzymes and adjustment of the pH to simulate the digestive stages of the abomasum, duodenum, jejunum, and lower small intestine. Fluid samples were collected from each of these digestive stages and radioanalyzed for soluble americium-241. Shortly after the addition of americium-241 to rumen juice, an average of 15.3% remained soluble while 7.2% remained soluble following the incubation period. The solubility decreased to 5.3% following the abomasal period and increased to 11.6% and 20.0% when maintained at pH 4.0 and 5.0, respectively, in the duodenal phase. The solubility increased to 52% during the jejunal incubation period and was reduced to 44.8% during the lower intestinal incubation period. The sharp rise in americium-241 solubility during the jejunal incubation perid was found to be due mainly to the action of bile. Predictions of tissue retention and milk secretion of americium-241 ingested by grazing cattle at Area 13 of the Nevada Test Site are included

  14. Analysis of americium, plutonium and technetium solubility in groundwater

    Energy Technology Data Exchange (ETDEWEB)

    Takeda, Seiji [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1999-08-01

    Safety assessments for geologic disposal of radioactive waste generally use solubilities of radioactive elements as the parameter restricting the dissolution of the elements from a waste matrix. This study evaluated americium, plutonium and technetium solubilities under a variety of geochemical conditions using the geochemical model EQ3/6. Thermodynamic data of elements used in the analysis were provided in the JAERI-data base. Chemical properties of both natural groundwater and interstitial water in buffer materials (bentonite and concrete) were investigated to determine the variations in Eh, pH and ligand concentrations (CO{sub 3}{sup 2-}, F{sup -}, PO{sub 4}{sup 3-}, SO{sub 4}{sup 2-}, NO{sub 3}{sup -} and NH{sub 4}{sup +}). These properties can play an important role in the complexation of radioactive elements. Effect of the groundwater chemical properties on the solubility and formation of chemical species for americium, plutonium and technetium was predicted based on the solubility analyses under a variety of geochemical conditions. The solubility and speciation of the radioactive elements were estimated, taking into account the possible range of chemical compositions determined from the groundwater investigation. (author)

  15. Plutonium and americium in the foodchain lichen-reindeer-man

    International Nuclear Information System (INIS)

    Jaakkola, T.; Hakanen, M.; Keinonen, M.; Mussalo, H.; Miettinen, J.K.

    1977-01-01

    The atmospheric nuclear tests have produced a worldwide fallout of transuranium elements. In addition to plutonium measurable concentrations of americium are to be found in terrestrial and aquatic environments. The metabolism of plutonium in reindeer was investigated by analyzing plutonium in liver, bone, and lung collected during 1963-1976. To determine the distribution of plutonium in reindeer all tissues of four animals of different ages were analyzed. To estimate the uptake of plutonium from the gastrointestinal tract in reindeer, the tissue samples of elk were also analyzed. Elk which is of the same genus as reindeer does not feed on lichen but mainly on deciduous plants, buds, young twigs, and leaves of trees and bushes. The composition of its feed corresponds fairly well to that of reindeer during the summer. Studies on behaviour of americium along the foodchain lichen-reindeer-man were started by determining the Am-241 concentrations in lichen and reindeer liver. The Am-241 results were compared with those of Pu-239,240. The plutonium contents of the southern Finns, whose diet does not contain reindeer tissues, were determined by analyzing autopsy tissue samples (liver, lung, and bone). The southern Finns form a control group to the Lapps consuming reindeer tissues. Plutonium analyses of the placenta, blood, and tooth samples of the Lapps were performed

  16. Uptake and recovery of americium and uranium by Anacystis biomass

    International Nuclear Information System (INIS)

    Liu, H.H.; Jiunntzong Wu

    1993-01-01

    The optimum conditions for the uptake of americium and uranium from wastewater solutions by Anacystis nidulans cells, and the recovery of these radionuclides were studied. The optimum pH range for both actinides was in the acidic region between 3.0 and 5.0. In a pH 3.5 solution with an algal biomass of 70 μg/mL, up to 95% of the Am and U were taken up by the cells. However, the uptake levels were lowered considerably when ethylene dinitrilotetraacetic acid (EDTA) or iron or calcium ions were present in the solutions. Most of the radionuclides taken up by the cells could also be desorbed by washing with salt solutions. Of nine salt solutions tested, ammonium carbonate was the most effective. Our experiments using algal biomass to remove radionuclides from wastewater showed that about 92% of americium and 85% of uranium in wastewater could be taken up by algal biomass, from which about 46% of the Am and 82% of the U originally present in the wastewater could be recovered by elution with a salt solution. 17 refs., 7 figs., 2 tabs

  17. Extraction of americium of different oxidation states in two-phase aqueous system based on polyethylene glycol

    International Nuclear Information System (INIS)

    Molochnikova, N.P.; Frenkel', V.Ya.; Myasoedov, B.F.; Shkinev, V.M.; Spivakov, B.Ya.; Zolotov, Yu.A.

    1987-01-01

    Americium extraction in different oxidation states in two-phase aqueous system based on polyethylene glycol is investigated. Conditions for quantitative extraction of americium (3) and americium (5) from ammonium sulfate solutions within pH=3-5 interval in the presence of arsenazo 3 are found. Composition of the produced americium complexes with reagent is determined; americium (3) interacts with arsenazo 3 in ammonium sulfate solutions with the formation of MeR and Me 2 R composition complexes. Absorption spectrum characteristics of americium (3) and- (5) complexes with arsenazo 3 in ammonium sulfate solutions and extracts based polyethylene glycol aqueous solutions are given. Molar extinction coefficients of americium complexes with arsenazo (3) in these solutions are determined

  18. Rare earth elements during diagenesis of abyssal sediments: analogies with a transuranic element americium

    International Nuclear Information System (INIS)

    Boust, D.

    1987-03-01

    One of the possibilities for the storage of high-level radioactive wastes consists in burying them into abyssal sediments, the sediments being supposed to barrier out radionuclides migration. The objective of the work was to estimate the efficiency of sediment barrier with respect to americium. As there is no americium in abyssal sediments, an indirect approach was used: the behaviour of the rare earth elements, the best natural analogs of americium. They were analysed in a 15 m long core, from the Cap Verde abyssal plateau. The terrigenous phase derived from the African continent was modified by short-term processes (1-1000 years); the intermediate rare earth elements were dissolved. Mineral coatings, enriched in rare earth appeared. After burial, the evolution continued at a much slower rate (10 5 - 10 6 years). The rare elements of the mineral coatings derived from the dissolution of the terrigenous phase and from an additional source, deeper in the sediment column. The fluxes of rare earth elements from sediment to water column were estimated. In suboxic sediments, the dissolved particulate equilibrium was related to redox conditions. The short-term reactivity of americium was studied in laboratory experiments. Simple americium migration models showed that the sediments barrier was totally efficient with respect to americium. In the conditions, neptunium 237 a daughter product of americium 241 could induce fluxes of 10 16 atoms per year per ton of stored waste (10 -8 Ci y-1), during millions years, towards the water column [fr

  19. Analysis of biological samples for americium and curium

    International Nuclear Information System (INIS)

    Miglio, J.J.

    1976-01-01

    A method of analyzing biological materials by liquid scintillation counting for americium and curium which greatly reduces the contribution from 40 K is described. The method employs an extractant liquid scintillation cocktail using N,N,N-trioctyl-N-methyl-ammonium chloride as the extractant. Instrument as well as tissue backgrounds are reduced. The lowered backgrounds allow picocurie level samples to be analyzed by liquid scintillation counting instead of alpha pulse height analysis. The samples are reduced to a carbon-free ash and then dissolved in 8M LiNo 3 which is also 10 -2 M in HNO 3 . An aliquot is placed in a liquid scintillation vial along with the extractant-scintillator, shaken and counted

  20. Pretreatment of americium/curium solutions for vitrification

    International Nuclear Information System (INIS)

    Rudisill, T.S.

    1996-01-01

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment

  1. Determination of the oxygen-metal-ratio of uranium-americium mixed oxides

    International Nuclear Information System (INIS)

    Bartscher, W.

    1982-01-01

    During the dissolution of uranium-americium mixed oxides in phosphoric acid under nitrogen tetravalent uranium is oxidized by tetravalent americium. The obtained hexavalent uranium is determined by constant potential coulometry. The coulombs measured are equivalent to the oxygen in excess of the minimum composition of UO 2 x AmO 1 . 5 . The total uranium content of the sample is determined in a subsequent coulometric titration. The oxygen-metal ratio of the sample can be calculated for a given uranium-americium ratio. An excess of uranium dioxide is necessary in order to suppress the oxidation of water by tetravalent americium. The standard deviation of the method is 0.0017 O/M units. (orig.) [de

  2. In-line measurement of plutonium and americium in mixed solutions

    International Nuclear Information System (INIS)

    Li, T.K.

    1981-01-01

    A solution assay instrument (SAI) has been developed at the Los Alamos National Laboratory and installed in the plutonium purification and americium recovery process area in the Los Alamos Plutonium Processing Facility. The instrument is designed for accurate, timely, and simultaneous nondestructive analysis of plutonium and americium in process solutions that have a wide range of concentrations and Am/Pu ratios. For a 25-mL sample, the assay precision is 5 g/L within a 2000-s count time

  3. Biochemical fractionation and cellular distribution of americium and plutonium in the biomass of freshwater macrophytes

    International Nuclear Information System (INIS)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.Ya.

    2011-01-01

    Accumulation of americium ( 241 Am) and plutonium ( 238,242 Pu) and their distribution in cell compartments and biochemical components of the biomass of freshwater aquatic plants Elodea canadensis, Ceratophyllum demersum and Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory experiments. Americium and plutonium taken up from water by Elodea canadensis apical shoots were mainly absorbed by structural components of plant cells (90% for 241 Am; 89% for 238 Pu and 82-87% for 242 Pu). About 10-18% of isotope activity was recorded in the cytosol fraction. The major concentration (76-92%) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-24% of americium activity was registered in the fraction of proteins and carbohydrates, and just a minor concentration (<1%) in the lipid fraction. The distribution of plutonium in the biomass fractions of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides of cell walls of freshwater submerged macrophytes. (author)

  4. Distribution of uranium, americium and plutonium in the biomass of freshwater macrophytes

    International Nuclear Information System (INIS)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.YA.

    2010-01-01

    Accumulation of uranium ( 238 U), americium ( 241 Am) and plutonium ( 242 Pu) and their distribution in cell compartments and biochemical components of the biomass of aquatic plants Elodea canadensis, Ceratophyllum demersum, Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory batch experiments. Isotopes of uranium, americium and plutonium taken up from the water by Elodea canadensis apical shoots were mainly absorbed by cell walls, plasmalemma and organelles. A small portion of isotopes (about 6-13 %) could be dissolved in cytoplasm. The major portion (76-92 %) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-23 % of americium activity was registered in the fraction of proteins and carbohydrates, and just a small portion (< 1%) in lipid fraction. The distribution of plutonium in the biomass fraction of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides in Elodea biomass. Distribution of uranium in the biomass of Elodea differed essentially from that of transuranium elements: a considerable portion of uranium was recorded in the fraction of protein and carbohydrates (51 %). From our data we can assume that uranium has higher affinity to carbohydrates than proteins. (authors)

  5. Distribution of uranium, americium and plutonium in the biomass of freshwater macrophytes

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.YA. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)

    2010-07-01

    Accumulation of uranium ({sup 238}U), americium ({sup 241}Am) and plutonium ({sup 242}Pu) and their distribution in cell compartments and biochemical components of the biomass of aquatic plants Elodea canadensis, Ceratophyllum demersum, Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory batch experiments. Isotopes of uranium, americium and plutonium taken up from the water by Elodea canadensis apical shoots were mainly absorbed by cell walls, plasmalemma and organelles. A small portion of isotopes (about 6-13 %) could be dissolved in cytoplasm. The major portion (76-92 %) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-23 % of americium activity was registered in the fraction of proteins and carbohydrates, and just a small portion (< 1%) in lipid fraction. The distribution of plutonium in the biomass fraction of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides in Elodea biomass. Distribution of uranium in the biomass of Elodea differed essentially from that of transuranium elements: a considerable portion of uranium was recorded in the fraction of protein and carbohydrates (51 %). From our data we can assume that uranium has higher affinity to carbohydrates than proteins. (authors)

  6. Selective dissolution of americium by ferricyanide ions in basic aqueous solutions

    International Nuclear Information System (INIS)

    Meyer, D.; Fouchard, S.; Simoni, E.

    2000-01-01

    Americium exhibits a soluble form in aqueous alkaline media under oxidizing conditions which is not the case for the other Transplutonium Elements (TPE). This property can be exploited for High Level Liquid Waste (HLLW) treatment to extract Am, one of the main radionuclides responsible for the long term radiotoxicity of nuclear waste. The Soluble Am compound can be obtained by adding a concentrated basic solution of ferricyanide ions (Fe(CN) 6 3- ) to a trivalent americium hydroxide precipitate. The method allows complete and rapid extraction of americium via its soluble form in alkaline solutions. Under these conditions, other TPE and lanthanides remain in the solid state as precipitates of highly insoluble trivalent hydroxides. In the case of dissolution involving large amounts of americium, the formation of the soluble americium species is followed by the appearance of a reddish precipitate in the basic solution. Dissolution of the reddish solid in NaOH or NaOH/Fe(CN) 6 3- media demonstrated the existence of a media dependent solubility of the precipitate, and therefore the existence of at least two forms of soluble Am. Spectroscopic studies (UV-visible, EXAFS-XANES) of this reddish solid led to the determination of an Am oxidation state (pentavalent americium) and its possible formula (Na 2 AmVO 2 (OH) 3 .nH 2 O). Electrochemical studies show that the only possible oxidation reaction of trivalent americium in the working media yields the pentavalent form, and that the hexavalent state is unattainable. Stoichiometric and spectroscopic studies show that not all the ferricyanide ions required for complete dissolution of Am remain in the free Fe(CN) 6 3- form. This observation supports the view that this dissolution of Am(III) solid compound is much more complex than a simple oxidation by the ferricyanide ions. The existence of a molecular interaction between Am(V)O 2 + and ferricyanide ions is highly probable. This work demonstrates that the selective dissolution

  7. 24 CFR 234.26 - Project requirements.

    Science.gov (United States)

    2010-04-01

    ... Commissioner for the purpose of constructing or converting the project in phases or stages, any special right..., the management company, the real estate broker, and the project developer, but the lender must ensure... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Project requirements. 234.26...

  8. 49 CFR 234.213 - Grounds.

    Science.gov (United States)

    2010-10-01

    ... Maintenance Standards § 234.213 Grounds. Each circuit that affects the proper functioning of a highway-rail... in the circuit. This requirement does not apply to: circuits that include track rail; alternating current power distribution circuits that are grounded in the interest of safety; and common return wires...

  9. Effect of americium-241 on luminous bacteria. Role of peroxides

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)

    2011-04-15

    The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.

  10. Americium/Curium Melter 2A Pilot Tests

    International Nuclear Information System (INIS)

    Smith, M.E.; Fellinger, A.P.; Jones, T.M.; Miller, C.B.; Miller, D.H.; Snyder, T.K.; Stone, M.E.; Witt, D.C.

    1998-05-01

    Isotopes of americium (Am) and curium (Cm) were produced in the past at the Savannah River Site (SRS) for research, medical, and radiological applications. These highly radioactive and valuable isotopes have been stored in an SRS reprocessing facility for a number of years. Vitrification of this solution will allow the material to be more safely stored until it is transported to the DOE Oak Ridge Reservation for use in research and medical applications. To this end, the Am/Cm Melter 2A pilot system, a full-scale non- radioactive pilot plant of the system to be installed at the reprocessing facility, was designed, constructed and tested. The full- scale pilot system has a frit and aqueous feed delivery system, a dual zone bushing melter, and an off-gas treatment system. The main items which were tested included the dual zone bushing melter, the drain tube with dual heating and cooling zones, glass compositions, and the off-gas system which used for the first time a film cooler/lower melter plenum. Most of the process and equipment were proven to function properly, but several problems were found which will need further work. A system description and a discussion of test results will be given

  11. Density of simulated americium/curium melter feed solution

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.S.

    1997-09-22

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70{degrees} C. The measured density decreased linearly at a rate of 0.0007 g/cm3/{degree} C from an average value of 1.2326 g/cm{sup 3} at 20{degrees} C to an average value of 1.1973g/cm{sup 3} at 70{degrees} C.

  12. Density of simulated americium/curium melter feed solution

    International Nuclear Information System (INIS)

    Rudisill, T.S.

    1997-01-01

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to Oak Ridge National Laboratory and use in heavy isotope production programs. Prior to vitrification, a series of in-tank oxalate precipitation and nitric/oxalic acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Following nitric acid dissolution and oxalate destruction, the solution will be denitrated and evaporated to a dissolved solids concentration of approximately 100 g/l (on an oxide basis). During the Am/Cm vitrification, an airlift will be used to supply the concentrated feed solution to a constant head tank which drains through a filter and an in-line orifice to the melter. Since the delivery system is sensitive to the physical properties of the feed, a simulated solution was prepared and used to measure the density as a function of temperature between 20 to 70 degrees C. The measured density decreased linearly at a rate of 0.0007 g/cm3/degree C from an average value of 1.2326 g/cm 3 at 20 degrees C to an average value of 1.1973g/cm 3 at 70 degrees C

  13. Americium adsorption on the surface of macrophytic algae

    Energy Technology Data Exchange (ETDEWEB)

    Carvalho, F.P.; Fowler, S.W.

    1985-01-01

    Data are presented on the rates at which americium (Am) deposits upon blade surfaces of three benthic algal species (Ulva rigida, Fucus vesiculosus and Gigartina stellata) following short-term exposures (1-6 h). Am is taken up in direct proportion to the ambient radionuclide concentration in sea water. Uptake by the green alga was 3 to 5 times greater than that for the brown and red species. Experimental evidence indicated that Am accumulation is a passive process and that adsorption takes place mainly on the thin outer organic coating of the seaweed. The Am transport coefficients are quite similar to that previously found for the naturally occurring ..cap alpha..-emitter /sup 210/Po, but are an order of magnitude lower than a plutonium transport coefficient reported in the literature. Release of labelled extracellular products associated with the algal surface coating is considered to be responsible for the rapid loss of Am observed previously in macroalgae and may in fact serve as a mechanism for transferring Am to filter feeding zooplankton. (author).

  14. Americium adsorption on the surface of macrophytic algae

    International Nuclear Information System (INIS)

    Carvalho, F.P.; Fowler, S.W.

    1985-01-01

    Data are presented on the rates at which americium (Am) deposits upon blade surfaces of three benthic algal species (Ulva rigida, Fucus vesiculosus and Gigartina stellata) following short-term exposures (1-6 h). Am is taken up in direct proportion to the ambient radionuclide concentration in sea water. Uptake by the green alga was 3 to 5 times greater than that for the brown and red species. Experimental evidence indicated that Am accumulation is a passive process and that adsorption takes place mainly on the thin outer organic coating of the seaweed. The Am transport coefficients are quite similar to that previously found for the naturally occurring α-emitter 210 Po, but are an order of magnitude lower than a plutonium transport coefficient reported in the literature. Release of labelled extracellular products associated with the algal surface coating is considered to be responsible for the rapid loss of Am observed previously in macroalgae and may in fact serve as a mechanism for transferring Am to filter feeding zooplankton. (author)

  15. The rapid determination of americium curium, and uranium in urine by ultrafiltration

    International Nuclear Information System (INIS)

    Stradling, G.N.; Popplewell, D.S.; Ham, G.J.; Griffin, R.

    1975-01-01

    The rapid ultrafiltration method developed for the assay of plutonium has been extended to the determination of americium, curium and uranium in urine. The limits of detection for americium and curium, and uranium are 0.09 and 0.12 dm -1 l -1 respectively, and the analysis time excluding counting less than 2 hours. The method can therefor be effectively used as a rapid screening procedure. When the reference level for plutonium is exceeded, the α activity may require to be characterised. The single ultrafiltration technique must be modified for turbid urine samples. The method is inappropriate, except for uranium, when the urine contains DTPA. (author)

  16. 20 CFR 234.46 - Amount of the RLS payable.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Amount of the RLS payable. 234.46 Section 234...-SUM PAYMENTS Residual Lump-Sum Payment § 234.46 Amount of the RLS payable. The gross RLS amount is... this chapter, respectively.) The amount of the RLS payable is equal to the gross RLS minus the sum of...

  17. Synthesis of uranyl acetylacetonate free of thorium 234

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Rendon, R.; Solache R, M.; Tenorio, D. (Instituto Nacional de Investigaciones Nucleares, Mexico City)

    1983-01-01

    A technique is described for synthesizing uranyl acetylacetonate free of thorium-234, and the method utilized in identifying it. The aim in the preparation of the thorium-234 free compound was to study the chemical effects produced by U-238 decay by means of detection only of the thorium-234 decay product.

  18. 24 CFR 234.65 - Nature of title.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Nature of title. 234.65 Section 234.65 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... OWNERSHIP MORTGAGE INSURANCE Eligibility Requirements-Individually Owned Units § 234.65 Nature of title. A...

  19. 32 CFR 234.12 - Restriction on animals.

    Science.gov (United States)

    2010-07-01

    ... 32 National Defense 2 2010-07-01 2010-07-01 false Restriction on animals. 234.12 Section 234.12 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED) MISCELLANEOUS CONDUCT ON THE PENTAGON RESERVATION § 234.12 Restriction on animals. Animals, except guide dogs...

  20. 49 CFR 234.201 - Location of plans.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Location of plans. 234.201 Section 234.201..., Inspection, and Testing Maintenance Standards § 234.201 Location of plans. Plans required for proper maintenance and testing shall be kept at each highway-rail grade crossing warning system location. Plans shall...

  1. 46 CFR 153.234 - Fore and aft location.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Fore and aft location. 153.234 Section 153.234 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) CERTAIN BULK DANGEROUS CARGOES SHIPS CARRYING... Containment Systems § 153.234 Fore and aft location. Except as allowed in § 153.7, each ship must meet the...

  2. 40 CFR 86.233-94-86.234-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.233-94-86.234-94 Section 86.233-94-86.234-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR... New Medium-Duty Passenger Vehicles; Cold Temperature Test Procedures §§ 86.233-94—86.234-94 [Reserved] ...

  3. Medical management after contamination and incorporation of americium in occupational exposure. Medizinische Massnahmen nach Kontamination und Inkorporation von Americium bei beruflicher Strahlenexposition

    Energy Technology Data Exchange (ETDEWEB)

    Gensicke, F.; Stopp, G.; Scheler, R.; Klucke, H.; Czarwinski, R.; Naumann, M.; Hoelzer, F.; Ott, R.; Schmidt, I. (Staatliches Amt fuer Atomsicherheit und Strahlenschutz, Berlin (Germany, F.R.). Abt. Strahlenschutzmedizin)

    1990-10-01

    In handling with an ampule of {sup 241}Am-nitrate solution one person received an contamination of the body surface, especially the face and the hairs, and an internal contamination of americium. The paper presents the results obtained in medical management to reduced the contamination of the skin and of the incorporated radionuclide. The radioactivity of the body surface could be reduced up to small local areas. After treatment with DTPA (Ditripentat) the internal exposure decrease about 83%. (orig.).

  4. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1975-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  5. Total and Compound Formation Cross Sections for Americium Nuclei: Recommendations for Coupled-Channels Calculations

    Energy Technology Data Exchange (ETDEWEB)

    Escher, J. E. [Lawrence Livermore National Lab. (LLNL), Livermore, CA (United States)

    2017-04-11

    Calculations for total cross sections and compound-nucleus (CN) formation cross sections for americium isotopes are described, for use in the 2017 NA-22 evaluation effort. The code ECIS 2006 was used in conjunction with Frank Dietrich's wrapper `runtemplate'.

  6. Evaluation of the readsorption of plutonium and americium in dynamic fractionations of environmental solid samples

    DEFF Research Database (Denmark)

    Petersen, Roongrat; Hou, Xiaolin; Hansen, Elo Harald

    2008-01-01

    extractions. The degree of readsorption in dynamic and conventional batch extraction systems are compared and evaluated by using a double-spiking technique. A high degree of readsorption of plutonium and americium (>75%) was observed in both systems, and they also exhibited similar distribution patterns...

  7. Migration ability of plutonium and americium in the soils of Polessie State Radiation-Ecological Reserve

    International Nuclear Information System (INIS)

    Svetlana Ovsiannikova; Maryna Papenia; Katsiaryna Voinikava; Galina Sokolik; Sergey Svirschevsky; Justin Brown; Lindys Skipperud

    2010-01-01

    The physicochemical forms of radionuclides in soils determine the processes of their entry into the soil solutions, redistribution in the soil profile, soil-plant and soil-ground or surface waters transfer as well as spreading outside the contaminated area. The vertical distribution of plutonium and americium and their physicochemical forms in soils of Polessie State Radiation-Ecological Reserve (PSRER) were studied with the aim of establishing the potential for radionuclide migration. Samples of alluvial soddy-podzolic and peaty soils with a low (1-3%) and relatively high (∼80% of dry sample mass) content of organic matter have been selected for investigation. A method employing sequential selective extraction has been used for analysis of radionuclide physicochemical forms in the soils. Activity concentrations of 238 Pu, 239,240 Pu and 241 Am in the samples were determined via radiochemical analysis with alpha-spectrometric identification of radionuclides. The results indicate that the main proportion of plutonium and americium remains in the 0-20 cm soil layer. The inventories of mobile and biologically available forms of plutonium and americium, expressed as a percentage of the total radionuclide content in soil, lie in the ranges of 1.1-9.4 and 2.7-29% respectively. Greater proportions of mobile and biologically available forms of radionuclides appear to be associated with mineral soil as compared to organic soil. In both mineral and organic soils, the portion of mobile americium is higher than plutonium. The inventories of mobile forms of plutonium and americium increase with the depth of soils. (author)

  8. Interaction and diffusion transport of americium in soils

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    The final disposal of High Level Radioactive Wastes (HLRW) is based on its long-term storage in underground facilities located in geological stable sites with a multi-barrier system, the so called Deep Geological Repositories (DGR), that will keep HLRW confined for >10.000 years. After this period of time, leachates rich in long-live radioisotopes might escape from DGR and start to transport towards the biosphere. There is still a lack of information concerning the interaction and transport in soils of some radionuclides present in HLRW, especially for radionuclides that present a high sorption, such as americium (Am). Having reliable information about the mobility of radionuclides in soils is crucial in order to develop risk assessment models and to take proper decisions in case of soil contamination. The aim of the present work was, by means of laboratory scale experiments, to study the interaction and, for first time, to evaluate the diffusion transport of {sup 241}Am in soils. The {sup 241}Am interaction in soils was assessed by applying sorption batch assays to 20 soil samples with contrasted edaphic properties which allowed us to quantify the solid-liquid distribution coefficient (K{sub d}) and desorption percentage. K{sub d} (Am) values ranged from 10{sup 3} to 10{sup 5} L kg{sup -1} and desorption percentages were always less than 2% which denoted a high capacity of the soil to incorporate the Am and a low reversibility of the sorption process. The influence of soil properties in {sup 241}Am interaction was studied by means of multiple linear and multivariate regressions. Although a single correlation between K{sub d} (Am) values and a soil property was not found, the main properties affecting {sup 241}Am interaction in soils were soil pH, carbonate and organic matter contents in the soil. Finally, additional batch assays at different controlled pH were done to study Am sorption as a function of the contact solution pH. A variation of the Am sorption

  9. Neutron induced fission of 234U

    Directory of Open Access Journals (Sweden)

    Pomp S.

    2012-02-01

    Full Text Available The fission fragment properties of 234U(n,f were investigated as a function of incident neutron energy from 0.2 MeV up to 5 MeV. The fission fragment mass, angular distribution and kinetic energy were measured with a double Frisch-grid ionization chamber using both analogue and digital data acquisition techniques. The reaction 234U(n,f is relevant, since it involves the same compound nucleus as formed after neutron evaporation from highly excited 236U*, the so-called second-chance fission of 235U. Experimental data on fission fragment properties like fission fragment mass and total kinetic energy (TKE as a function of incident neutron energy are rather scarce for this reaction. For the theoretical modelling of the reaction cross sections for Uranium isotopes this information is a crucial input parameter. In addition, 234U is also an important isotope in the Thorium-based fuel cycle. The strong anisotropy of the angular distribution around the vibrational resonance at En = 0.77 MeV could be confirmed using the full angular range. Fluctuations in the fragment TKE have been observed in the threshold region around the strong vibrational resonance at En = 0.77 MeV. The present results are in contradiction with corresponding literature values. Changes in the mass yield around the vibrational resonance and at En = 5 MeV relative to En = 2 MeV show a different signature. The drop in mean TKE around 2.5 to 3 MeV points to pair breaking as also observed in 235,238U(n,f. The measured two-dimensional mass yield and TKE distribution have been described in terms of fission modes. The yield of the standard 1 (S1 mode shows fluctuations in the threshold of the fission cross section due to the influence of the resonance and levels off at about 20% yield for higher incident neutron energies. The S2 mode shows the respective opposite behaviour. The mean TKE of both modes decreases with En. The decrease in mean TKE overrules the increase in S1 yield, so the mean

  10. Neutron induced fission of 234U

    Science.gov (United States)

    Hambsch, F.-J.; Al-Adili, A.; Oberstedt, S.; Pomp, S.

    2012-02-01

    The fission fragment properties of 234U(n,f) were investigated as a function of incident neutron energy from 0.2 MeV up to 5 MeV. The fission fragment mass, angular distribution and kinetic energy were measured with a double Frisch-grid ionization chamber using both analogue and digital data acquisition techniques. The reaction 234U(n,f) is relevant, since it involves the same compound nucleus as formed after neutron evaporation from highly excited 236U*, the so-called second-chance fission of 235U. Experimental data on fission fragment properties like fission fragment mass and total kinetic energy (TKE) as a function of incident neutron energy are rather scarce for this reaction. For the theoretical modelling of the reaction cross sections for Uranium isotopes this information is a crucial input parameter. In addition, 234U is also an important isotope in the Thorium-based fuel cycle. The strong anisotropy of the angular distribution around the vibrational resonance at En = 0.77 MeV could be confirmed using the full angular range. Fluctuations in the fragment TKE have been observed in the threshold region around the strong vibrational resonance at En = 0.77 MeV. The present results are in contradiction with corresponding literature values. Changes in the mass yield around the vibrational resonance and at En = 5 MeV relative to En = 2 MeV show a different signature. The drop in mean TKE around 2.5 to 3 MeV points to pair breaking as also observed in 235,238U(n,f). The measured two-dimensional mass yield and TKE distribution have been described in terms of fission modes. The yield of the standard 1 (S1) mode shows fluctuations in the threshold of the fission cross section due to the influence of the resonance and levels off at about 20% yield for higher incident neutron energies. The S2 mode shows the respective opposite behaviour. The mean TKE of both modes decreases with En. The decrease in mean TKE overrules the increase in S1 yield, so the mean TKE is dropping

  11. Separation of 234Th from 90Y

    International Nuclear Information System (INIS)

    Chobola, R.; Erdoes, E.; Mell, P.; Solymosi, J.; Vincze, A; Toeroek, L.; Ranga, T.; Volent, G.

    1999-01-01

    A relatively simple procedure has been developed for the determination of 90 Sr in natural aqueous samples. The method consists mainly of a Fe(III)-hydroxide co-precipitation step, followed by the separation of 90 Y with the mixture of yttrium oxalate and yttrium ammonium oxalate salts. This method was tested using a large number of natural water samples and 234 Th contamination was observed in the prepared yttrium samples. The analysis has therefore been extended to include the separation of thorium from yttrium, which is made by DOWEX-50W-X cation exchange resin and citric acid as chelating agent. The experience and results of this new method are discussed. (author)

  12. Colloidal 234Th and the turnover of oceanic DOC

    International Nuclear Information System (INIS)

    Murray, J.W.; Balistrieri, L.S.

    1994-01-01

    234 Th has been proposed to be a tracer for the labile, colloidal fraction of DOC in seawater. During the recent North Atlantic Bloom Experiment (NABE) the turnover of DOC was directly measured. 234 Th and total suspended matter (C p ) were also measured by different research groups. Using the NABE 234 Th data the authors have calculated the turnover rate of colloidal material using the Brownian Pumping model of Honeyman and Santschi and the 4-box particle cycling model of Moran and Buesseler. The rate constants for colloid cycling determined from the 234 Th data agree well with the experimentally determined rate constants for turnover of DOC

  13. Structural characterisations and mechanistic investigations of the selective dissolution of americium by the ferricyanide ions in alkaline media. Application for the partitioning americium curium

    International Nuclear Information System (INIS)

    Fouchard, Sebastien

    2000-01-01

    Americium exhibits a high solubility form in basic media under oxidant conditions, unlike the other Transplutonium elements (TPE). This property can be used in the frame of High Level Liquid Waste (HLLW) treatment in order to extract preferentially the americium element, the main responsible of the long term radiotoxicity of the nuclear waste. This soluble compound can be obtained by addition of a concentrated basic solution of Fe(CN) 6 3- ions on Am(OH) 3 precipitates. This technique enables a rapid extraction of Am by the synthesis of this soluble form in alkaline solutions. Under these conditions, the other TPE remain in the solid state as trivalent hydroxide solids, strongly insoluble. In the case of dissolutions involving large amounts of Am(OH) 3 , the formation of the soluble complex is concomitant with the appearance of a reddish precipitate in the basic solution. Dissolution experiments which were carried out on this solid in NaOH/Fe(CN) 6 3- have demonstrated the dependency of the solubility equilibria with the media. Spectroscopic studies (UV Visible, XAS) on the precipitate have enabled the determination of the chemical structure and the oxidation state of the americium in the solid: Na 2 Am(V)O 2 (OH) 3 ,nH 2 O. Electrochemical studies on the americium solution have confirmed that the oxidation of Am(OH) 3 by the Fe(CN) 6 3- ions in basic media could only lead to the pentavalent form. A stoichiometric study carries out between a AmO 2 + ion and one Fe(CN) 6 3- ion and the spectroscopic characterisation of this reaction have demonstrated that the Fe(CN) 6 3- ion didn't remain as an un-complexed form in solution after the alkaline mixing. These results tend to prove that this dissolution of Am(OH) 3 is much more complex than a simple oxidation by the Fe(CN) 6 3- ions. The existence of molecular interactions between AmO 2 + and Fe(CN) 6 3- has been postulated and a mechanistic scheme has been proposed in order to explain the appearance of the soluble

  14. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning

    1986-01-01

    of the Irish Sea) to Spitsbergen. 241Am found in Arctic waters probably originates from the decay of fallout 241Pu and, like Pu, tentatively has a residence time of the order of several years. Americium from Sellafield has an estimated mean residence time of 4–6 months in Scottish waters.......Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were...... collected from the Irish coast in 1983. Fallout is found to dominate as a source of 239+240Pu north of latitude 65°N, while for 238Pu a substantial fraction originates from European nuclear fuel reprocessing facilities. The 238Pu/239+240Pu isotope ratio provides clear evidence of the transport of effluent...

  15. Biochemical behaviour of plutonium and americium and geochemical modelling of the soil solution

    International Nuclear Information System (INIS)

    Bryan, N.D.; Livens, F.R.; Horrill, A.D.

    1994-01-01

    Field observations suggest that plutonium and americium in the environment are present in very different chemical forms in the interstitial waters of an intertidal sediment. Thermodynamic modelling using the PHREEQE code predicts that plutonium is present entirely in oxidation state (V) as the PuO 2 CO 3 - ion, whereas americium is present entirely in oxidation state (III), largely as the uncharged Am(OH)CO 3 species, but with significant concentrations of the Am 3+ and the AmSO 4 + ions. There are, however, differences between these predictions and others published for a very similar system which apparently arise from uncertainties in the thermodynamic data. Field data cannot resolve these differences unambiguously. (author) 29 refs.; 3 tabs

  16. High-purity germanium detection system for the in vivo measurement of americium and plutonium

    International Nuclear Information System (INIS)

    Tyree, W.H.; Falk, R.B.; Wood, C.B.; Liskey, R.W.

    1976-01-01

    A high-purity germanium (HPGe) array, photon-counting system has been developed for the Rocky Flats Plant Body-Counter Medical Facility. The newly improved system provides exceptional resolutions of low-energy X-ray and gamma-ray spectra associated with the in vivo deposition of plutonium and americium. Described are the operational parameters of the system and some qualitative results illustrating detector performance for the photon emissions produced from the decay of plutonium and americium between energy ranges from 10 to 100 kiloelectron volts. Since large amounts of data are easily generated with the system, data storage, analysis, and computer software developments continue to be an essential ingredient for processing spectral data obtained from the detectors. Absence of quantitative data is intentional. The primary concern of the study was to evaluate the effects of the various physical and electronic operational parameters before adding those related entirely to a human subject

  17. Electrodeposition of americium on a liquid cadmium cathode from a molten salt bath

    International Nuclear Information System (INIS)

    Laplace, A.; Lacquement, J.; Maillard, C.; Donner, L.

    2004-01-01

    A high-activity experiment involving the electrode position of americium on a liquid cadmium cathode from a LiCl-KCl eutectic with about 3 g of AmO 2 was conducted in a shielded cell in the ATALANTE complex. After describing the electrolyzer and the experimental conditions, the authors discuss the preparation of the LiCl-KCl-AmCl 3 solution and briefly review its electrochemical properties. It was clearly confirmed that Am(III) reduction on an inert solid cathode occurs in two steps forming Am(II) before Am(0), whereas only one reduction step was observed on liquid cadmium. The main results of this study concern americium electrode position on the liquid cadmium cathode (recovery yields, current densities, problems encountered). The solvent properties of cadmium for actinide/lanthanide separation are discussed. (authors)

  18. Determination of americium and plutonium in autopsy tissue: methods and problems

    International Nuclear Information System (INIS)

    Boyd, H.A.; Eutsler, B.C.; McInroy, J.F.

    1979-01-01

    The current methods used by the tissue analysis program at LASL for the determination of americium and plutonium in autopsy tissue are described. Problems affecting radiochemical yield are discussed. Included are problems associated with sample preparation, separation of plutonium from large amounts of bone ash, and reagent contamination. The average 242 Pu tracer yield for 1800 Pu determinations is 78 +- 12%. The average 242 Am tracer yield is 85 +- 7% for 40 determinations

  19. Final Radiological Assessment of External Exposure for CLEAR-Line Americium Recovery Operations

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Adam C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Belooussova, Olga N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hetrick, Lucas Duane [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-11-12

    Los Alamos National Laboratory is currently planning to implement an americium recovery program. The americium, ordinarily isotopically pure 241Am, would be extracted from existing Pu materials, converted to an oxide and shipped to support fabrication of americium oxide-beryllium neutron sources. These operations would occur in the currently proposed Chloride Extraction and Actinide Recovery (CLEAR) line of glove boxes. This glove box line would be collocated with the currently-operational Experimental Chloride Extraction Line (EXCEL). The focus of this document is to provide an in-depth assessment of the currently planned radiation protection measures and to determine whether or not further design work is required to satisfy design-goal and ALARA requirements. Further, this document presents a history of americium recovery operations in the Department of Energy and high-level descriptions of the CLEAR line operations to provide a basis of comparison. Under the working assumptions adopted by this study, it was found that the evaluated design appears to mitigate doses to a level that satisfies the ALARA-in-design requirements of 10 CFR 835 as implemented by the Los Alamos National Laboratory procedure P121. The analyses indicate that extremity doses would also meet design requirements. Dose-rate calculations were performed using the radiation transport code MCNP5 and doses were estimated using a time-motion study developed in consort with the subject matter expert. A copy of this report and all supporting documentation are located on the Radiological Engineering server at Y:\\Rad Engineering\\2013 PROJECTS\\TA-55 Clear Line.

  20. Quantitative determination of americium and curium in solutions using potassium tungstophosphate

    International Nuclear Information System (INIS)

    Chistyakov, V.M.; Baranov, A.A.; Erin, E.A.; Timoaeev, G.A.

    1990-01-01

    Two methods of americium (4) and curium (4) titration-replacement and redox ones - have been considered. According to the replacement method thorium nitrate solution was used as a titrant and the final point of titration was determined spectophotometrically. Using the method developed, on the basis of experimental data, the composition of thorium (4) complex with potassium tungstophosphate was determined. In case of the redox titration sodium nitrite was used, and the final titration point was indicated either spectrophotometrically or potentiometrically

  1. Medical management after contamination and incorporation of americium in occupational exposure

    International Nuclear Information System (INIS)

    Gensicke, F.; Stopp, G.; Scheler, R.; Klucke, H.; Czarwinski, R.; Naumann, M.; Hoelzer, F.; Ott, R.; Schmidt, I.

    1990-01-01

    In handling with an ampule of 241 Am-nitrate solution one person received an contamination of the body surface, especially the face and the hairs, and an internal contamination of americium. The paper presents the results obtained in medical management to reduced the contamination of the skin and of the incorporated radionuclide. The radioactivity of the body surface could be reduced up to small local areas. After treatment with DTPA (Ditripentat) the internal exposure decrease about 83%. (orig.) [de

  2. Experimental studies to validate model calculations and maximum solubility limits for Plutonium and Americium

    International Nuclear Information System (INIS)

    2017-01-01

    This report focuses on studies of KIT-INE to derive a significantly improved description of the chemical behaviour of Americium and Plutonium in saline NaCl, MgCl 2 and CaCl 2 brine systems. The studies are based on new experimental data and aim at deriving reliable Am and Pu solubility limits for the investigated systems as well as deriving comprehensive thermodynamic model descriptions. Both aspects are of high relevance in the context of potential source term estimations for Americium and Plutonium in aqueous brine systems and related scenarios. Americium and Plutonium are long-lived alpha emitting radionuclides which due to their high radiotoxicity need to be accounted for in a reliable and traceable way. The hydrolysis of trivalent actinides and the effect of highly alkaline pH conditions on the solubility of trivalent actinides in calcium chloride rich brine solutions were investigated and a thermodynamic model derived. The solubility of Plutonium in saline brine systems was studied under reducing and non-reducing conditions and is described within a new thermodynamic model. The influence of dissolved carbonate on Americium and Plutonium solubility in MgCl 2 solutions was investigated and quantitative information on Am and Pu solubility limits in these systems derived. Thermodynamic constants and model parameter derived in this work are implemented in the Thermodynamic Reference Database THEREDA owned by BfS. According to the quality assurance approach in THEREDA, is was necessary to publish parts of this work in peer-reviewed scientific journals. The publications are focused on solubility experiments, spectroscopy of aquatic and solid species and thermodynamic data. (Neck et al., Pure Appl. Chem., Vol. 81, (2009), pp. 1555-1568., Altmaier et al., Radiochimica Acta, 97, (2009), pp. 187-192., Altmaier et al., Actinide Research Quarterly, No 2., (2011), pp. 29-32.).

  3. 46 CFR 169.234 - Integral fuel oil tank examinations.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 7 2010-10-01 2010-10-01 false Integral fuel oil tank examinations. 169.234 Section 169... VESSELS Inspection and Certification Drydocking Or Hauling Out § 169.234 Integral fuel oil tank examinations. (a) Each fuel oil tank with at least one side integral to the vessel's hull and located within...

  4. 30 CFR 285.233-285.234 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 2 2010-07-01 2010-07-01 false 285.233-285.234 Section 285.233-285.234 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE RENEWABLE ENERGY ALTERNATE USES OF EXISTING FACILITIES ON THE OUTER CONTINENTAL SHELF Issuance of OCS Renewable Energy Leases...

  5. 17 CFR 256.234 - Accounts payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... associate companies. These accounts shall include notes and balances in open accounts due to associate... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Accounts payable to associate companies. 256.234 Section 256.234 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION...

  6. 34 CFR 75.234 - The conditions of the grant.

    Science.gov (United States)

    2010-07-01

    ... 34 Education 1 2010-07-01 2010-07-01 false The conditions of the grant. 75.234 Section 75.234 Education Office of the Secretary, Department of Education DIRECT GRANT PROGRAMS How Grants Are Made... cooperative agreement, the Secretary includes conditions that state the explicit character and extent of...

  7. 12 CFR 23.4 - Investment in personal property.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Investment in personal property. 23.4 Section... Provisions § 23.4 Investment in personal property. (a) General rule. A national bank may acquire specific... business or for entry into the leasing business; and (2) The bank's aggregate investment in property held...

  8. Adsorption-Desorption Characteristics of Plutonium and Americium with Sediment Particles in the Estuarine Environment

    International Nuclear Information System (INIS)

    Murray, C.N.; Fukai, R.

    1976-01-01

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237 Pu was in particulate form, larger than 0.45pm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  9. Bis(2-ethylhexyl)sulfoxide as an extractant for americium(III) from aqueous nitrate media

    International Nuclear Information System (INIS)

    Shukla, J.P.; Kedari, C.S.

    1992-01-01

    Solvent extraction separation of Am(III) from dilute aqueous nitrate media into n-dodecane by bis(2-ethylhexyl)sulfoxide (BESO) has been investigated over a wide range of experimental conditions. Very poor extractability of Am(III) necessitated the use of calcium nitrate as the salting-out agent. Effects of certain variables such as acidity, extractant concentration, salting-out agent concentration, organic diluents on the metal extraction by BESO have been examined in detail. By increasing the concentration of BESO in organic phase or calcium nitrate in aqueous phase, nearly quantitative extraction of americium even from moderate acidity is accomplished. Slope analyses applied to Am(III) distribution experiments from acidic nitrate solutions indicate predominant formation of the trisolvated organic phase complex, Am(NO 3 ) 3 *3BESO for which equilibrium constant is found to be, log K x = 1.99. Extraction behavior of Am(III) has also been evaluated in the presence of several water-miscible polar organic solvents to study their possible synergistic effects on its extraction. Extractability of americium increased 5 to 10-fold with increasing concentration of some of these additives, with maximum enhancement being observed in the presence of acetone or acetonitrile. Recovery of BESO from loaded americium is easily obtained using dilute nitric acid as the strippant. (author) 30 refs.; 2 figs.; 5 tabs

  10. Fabrication of uranium-americium mixed oxide pellet from microsphere precursors: Application of CRMP process

    Science.gov (United States)

    Remy, E.; Picart, S.; Delahaye, T.; Jobelin, I.; Lebreton, F.; Horlait, D.; Bisel, I.; Blanchart, P.; Ayral, A.

    2014-10-01

    Mixed uranium-americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Recently, several processes have been developed in order to validate fabrication flowchart in terms of material specifications such as density and homogeneity but also to suggest simplifications for lowering industrial costs and hazards linked to dust generation of highly contaminating and irradiating compounds. This study deals with the application of an innovative route using mixed oxide microspheres obtained from metal loaded resin bead calcination, called Calcined Resin Microsphere Pelletization (CRMP). The synthesis of mixed oxide microsphere precursor of U0.9Am0.1O2±δ is described as well as its characterisation. The use of this free-flowing precursor allows the pressing and sintering of one pellet of U0.9Am0.1O2±δ. The ceramic obtained was characterised and results showed that its microstructure is dense and homogeneous and its density attains 95% of the theoretical density. This study validates the scientific feasibility of the CRMP process applied to the fabrication of uranium and americium-containing materials.

  11. Influence of dissolved organic substances in groundwater on sorption behavior of americium and neptunium

    International Nuclear Information System (INIS)

    Boggs, S. Jr.; Seitz, M.G.

    1984-01-01

    Groundwaters typically contain dissolved organic carbon consisting largely of high molecular weight compounds of humic and fulvic acids. To evaluate whether these dissolved organic substances can enhance the tranport of radionuclides through the groundwater system, experiments were conducted to examine the sorption of americium and neptunium onto crushed basalt in the presence of dissolved humic- and fulvic-acid organic carbon introduced into synthetic groundwater. The partitioning experiments with synthetic groundwater show that increasing the concentration of either humic or fulvic acid in the water has a significant inhibiting effect on sorption of both americium and neptunium. At 22 0 C, adsorption of these radionuclides, as measured by distribution ratios (the ratio of nuclide sorbed onto the solid to nuclide in solution at the end of the experiment), decreased by 25% to 50% by addition of as little as 1 mg/L dissolved organic carbon and by one to two orders of magnitude by addition of 100 to 200 mg/L dissolved organic carbon. Distribution ratios measured in solutions reacted at 90 0 C similarly decreased with the addition of dissolved organic carbon but generally ranged from one to two orders of magnitude higher than those determined in the 22 0 C experiment. These results suggest that organic carbon dissolved in deep groundwaters may significantly enhance the mobility of radionuclides of americium and neptunium. 23 references, 5 figures, 11 tables

  12. 14 CFR 234.5 - Form of reports.

    Science.gov (United States)

    2010-01-01

    ... REGULATIONS AIRLINE SERVICE QUALITY PERFORMANCE REPORTS § 234.5 Form of reports. Except where otherwise noted... in accounting and reporting directives issued by the Bureau of Transportation Statistics' Assistant...

  13. Physics of plutonium and americium recycling in PWR using advanced fuel concepts

    International Nuclear Information System (INIS)

    Hourcade, E.

    2004-01-01

    PWR waste inventory management is considered in many countries including Frances as one of the main current issues. Pu and Am are the 2 main contents both in term of volume and long term radio-toxicity. Waiting for the Generation IV systems implementation (2035-2050), one of the mid-term solutions for their transmutation involves the use of advanced fuels in Pressurized Water Reactors (PWR). These have to require as little modification as possible of the core internals, the cooling system and fuel cycle facilities (fabrication and reprocessing). The first part of this paper deals with some neutronic characteristics of Pu and/or Am recycling. In a second part, 2 technical solutions MOX-HMR and APA-DUPLEX-84 are presented and the third part is devoted to the study of a few global strategies. The main neutronic parameters to be considered for Pu and Am recycling in PWR are void coefficient, Doppler coefficient, fraction of delayed neutrons and power distribution (especially for heterogeneous configurations). The modification of the moderation ratio, the opportunity to use inert matrices (targets), the optimisation of Uranium, Plutonium and Americium contents are the key parameters to play with. One of the solutions (APA-DUPLEX-84) presented here is a heterogeneous assembly with regular moderation ratio composed with both target fuel rods (Pu and Am embedded in an inert matrix) and standard UO 2 fuel rods. An EPR (European Pressurised Reactor) type reactor, loaded only with assemblies containing 84 peripheral targets, can reach an Americium consumption rate of (4.4; 23 kg/TWh) depending on the assembly concept. For Pu and Am inventories stabilisation, the theoretical fraction of reactors loaded with Pu + Am or Pu assemblies is about 60%. For Americium inventory stabilisation, the fraction decreases down to 16%, but Pu is produced at a rate of 18.5 Kg/TWh (-25% compared to one through UOX cycle)

  14. Accumulation of americium-241 in the biomass of aquatic plants of the Yenisei river: experimental study

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A.; Bolsunovsky, A.Y.A.; Bondareva, L.G. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)

    2004-07-01

    Due to the operation of the Mining-and-Chemical Combine (Krasnoyarsk-26), which has been manufacturing weapons-grade plutonium for several decades, the Yenisei River is contaminated with transuranic elements (including {sup 241}Am). {sup 241}Am was found in the riverside soil, sediment and in the biomass of aquatic plants (Bolsunovsky et al., 1999, 2002). Aquatic plants are an important link in the migration of radionuclides in an aquatic ecosystem. In laboratory experiments, we investigated accumulation of {sup 241}Am by the submerged macrophyte from the Yenisei River: the pond weed (Elodea canadensis) and the aquatic moss (Fontinalis antipyretica), and release of {sup 241}Am from the biomass. The content of {sup 241}Am was measured on a Canberra (USA) gamma-spectrometer. The experiments showed that specific accumulation and concentration factors of {sup 241}Am in the plants were in inverse proportion to their biomass. We obtained new data on release of {sup 241}Am from the biomass of macrophyte. Americium-241 was more firmly fixed in the biomass of the aquatic moss. In 12 months, the biomass of the aquatic moss released about 30% of the initial americium activity into the water. To compare, the biomass of the pond weed released into the water medium up to 64% of the initial {sup 241}Am activity in 1.5 4 months. The release rate was dependent on the decomposition rate of the plant biomass. The experiments showed that submerged macrophyte of the Yenisei River can accumulate considerable activities of {sup 241}Am and retain americium for long periods of time in biomass. (author)

  15. Speciation of americium in seawater and accumulation in the marine sponge Aplysina cavernicola.

    Science.gov (United States)

    Maloubier, Melody; Michel, Hervé; Solari, Pier Lorenzo; Moisy, Philippe; Tribalat, Marie-Aude; Oberhaensli, François R; Dechraoui Bottein, Marie Yasmine; Thomas, Olivier P; Monfort, Marguerite; Moulin, Christophe; Den Auwer, Christophe

    2015-12-21

    The fate of radionuclides in the environment is a cause of great concern for modern society, seen especially in 2011 after the Fukushima accident. Among the environmental compartments, seawater covers most of the earth's surface and may be directly or indirectly impacted. The interaction between radionuclides and the marine compartment is therefore essential for better understanding the transfer mechanisms from the hydrosphere to the biosphere. This information allows for the evaluation of the impact on humans via our interaction with the biotope that has been largely undocumented up to now. In this report, we attempt to make a link between the speciation of heavy elements in natural seawater and their uptake by a model marine organism. More specifically, because the interaction of actinides with marine invertebrates has been poorly studied, the accumulation in a representative member of the Mediterranean coralligenous habitat, the sponge Aplysina cavernicola, was investigated and its uptake curve exposed to a radiotracer (241)Am was estimated using a high-purity Ge gamma spectrometer. But in order to go beyond the phenomenological accumulation rate, the speciation of americium(III) in seawater must be assessed. The speciation of (241)Am (and natural europium as its chemically stable surrogate) in seawater was determined using a combination of different techniques: Time-Resolved Laser-Induced Fluorescence (TRLIF), Extended X-ray Absorption Fine Structure (EXAFS) at the LIII edge, Attenuated Total Reflectance Fourier Transform Infrared (ATR-FTIR) spectroscopy and Scanning Electron Microscopy (SEM) and the resulting data were compared with the speciation modeling. In seawater, the americium(III) complex (as well as the corresponding europium complex, although with conformational differences) was identified as a ternary sodium biscarbonato complex, whose formula can be tentatively written as NaAm(CO3)2·nH2O. It is therefore this chemical form of americium that is

  16. Uptake of plutonium and americium by barley from two contaminated Nevada Test Site soils

    International Nuclear Information System (INIS)

    Schulz, R.K.; Tompkins, G.A.; Leventhal, L.; Babcock, K.L.

    1976-01-01

    Barley (Hordeum vulgare, Var. Atlas 68) plant uptake of Pu 239 , Pu 240 , and Am 241 was studied using two soil samples collected from widely separated areas of the Nevada Test Site. Each area had been previously contaminated with plutonium and americium as a result of a separate high explosive (nonnuclear) detonation of a device containing plutonium. The plants were grown on 3-kg soil samples in a controlled environment chamber. The plutonium concentration ratio (plutonium concentration in dry plant tissue/plutonium concentration in dry soil) was in the order of 10 -5 for plant vegetative material. The plutonium concentration ratio for the grain was 20 to 100 times lower than that in the vegetative material. Concentration ratios for americium were in the order of 10 -4 for vegetative growth and 25 to 75 times lower for the grain. These results imply that americium is more available to plants than plutonium. Plutonium-bearing particles were identified in a soil sample using an autoradiographic technique and then separated from the soil samples. The Pu 239 oxide equivalent diameters of plutonium-bearing particles could be described by a log-normal distribution function in the range of 0.2 to 0.7 μm. The actual diameters of the particles were 2 to 3 times the PuO 2 equivalent diameter. Microprobe analyses of the surface region of particles greater than 2 μm showed the following order of abundance: U, Pu is greater than O is greater than Al is greater than Si is greater than Fe is greater than Mg. Photographs obtained with a scanning electron microscope revealed that some of the particles are quite irregular and have large specific surface areas which might enhance solubility and plant uptake

  17. Fabrication of uranium–americium mixed oxide pellet from microsphere precursors: Application of CRMP process

    Energy Technology Data Exchange (ETDEWEB)

    Remy, E. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Picart, S., E-mail: sebastien.picart@cea.fr [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Delahaye, T. [Fuel Cycle Technology Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Jobelin, I. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Lebreton, F.; Horlait, D. [Fuel Cycle Technology Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Bisel, I. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Blanchart, P. [Heterogeneous Materials Research Group, Centre Européen de la Céramique, F-87068 Limoges (France); Ayral, A. [Institut Européen des Membranes, CNRS-ENSCM-UM2, CC47, University Montpellier 2, F-34095 Montpellier cedex 5 (France)

    2014-10-15

    Highlights: • Dust free process for (U,Am)O{sub 2} transmutation target fabrication. • Synthesis of U{sub 0.9}Am{sub 0.1}O{sub 2} mixed oxide microspheres from ion exchange resin. • Fabrication of dense U{sub 0.9}Am{sub 0.1}O{sub 2} pellet with 95% TD from mixed oxide microspheres. - Abstract: Mixed uranium–americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Recently, several processes have been developed in order to validate fabrication flowchart in terms of material specifications such as density and homogeneity but also to suggest simplifications for lowering industrial costs and hazards linked to dust generation of highly contaminating and irradiating compounds. This study deals with the application of an innovative route using mixed oxide microspheres obtained from metal loaded resin bead calcination, called Calcined Resin Microsphere Pelletization (CRMP). The synthesis of mixed oxide microsphere precursor of U{sub 0.9}Am{sub 0.1}O{sub 2±δ} is described as well as its characterisation. The use of this free-flowing precursor allows the pressing and sintering of one pellet of U{sub 0.9}Am{sub 0.1}O{sub 2±δ}. The ceramic obtained was characterised and results showed that its microstructure is dense and homogeneous and its density attains 95% of the theoretical density. This study validates the scientific feasibility of the CRMP process applied to the fabrication of uranium and americium-containing materials.

  18. Recovery of Americium-241 from lightning rod by the method of chemical treatment

    International Nuclear Information System (INIS)

    Cruz, W.H.

    2013-01-01

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ( 241 Am), fewer and Radium 226 ( 226 Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241 Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241 Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241 Am technique was used electrodeposition. (author)

  19. Comparison of acid leachate and fusion methods to determine plutonium and americium in environmental samples

    International Nuclear Information System (INIS)

    Smith, L.L.; Markun, F.; TenKate, T.

    1992-06-01

    The Analytical Chemistry Laboratory at Argonne National Laboratory performs radiochemical analyses for a wide variety of sites within the Department of Energy complex. Since the chemical history of the samples may vary drastically from site to site, the effectiveness of any analytical technique may also vary. This study compares a potassium fluoride-pyrosulfate fusion technique with an acid leachate method. Both normal and high-fired soils and vegetation samples were analyzed for both americium and plutonium. Results show both methods work well, except for plutonium in high-fired soils. Here the fusion method provides higher accuracy

  20. Influence of biofilms on migration of uranium, americium and europium in the environment

    International Nuclear Information System (INIS)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-01-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  1. Rad Calc III: Radioanalysis calculation program for plutonium and americium determination

    International Nuclear Information System (INIS)

    Blackadar, J.M.; Wong, A.S.; Stalnaker, N.D.; Willerton, J.R.

    2000-01-01

    The radiochemistry team of the Analytical Chemistry Group has supported nuclear materials production and management programs at Los Alamos National Laboratory since the 1940s. Routinely, plutonium and americium contents in various matrices (such as metals, oxides, process solutions, and waste streams) are determined by direct alpha and gamma analyses. Over the years, analysts have written a number of computer programs to calculate analytical results. In 1999, the program was enhanced and upgraded to produce Rad Calc III. The new program, written in Visual Basic 4.0, corrects limitations of previous versions, offers enhanced features, and incorporates user suggestions to customize the program and make it more user friendly

  2. Recovery of americium from slag and crucible wastes and its purification

    International Nuclear Information System (INIS)

    Michael, K.M.; Dabholkar, G.M.; Vijayan, K.; Ramamoorthy, N.; Narayanan, C.V.; Jambunathan, U.; Kapoor, S.C.

    1990-01-01

    A method of recovery and purification of americium-241 from slag waste streams is described. Extraction of Am from slag solution of 0.16 M HNO 3 was carried out by tri-n-butyl phosphate. After stripping with acetic acid, Am was precipitated at pH 1. This was followed by metathesis to remove Ca. Final separation of Pu from Am solution was achieved by anion exchange method using Dowex 1x4 anion exchange resin. Details of large scale recovery of Am from slag are also described. (author). 12 refs., 11 tabs., 1 fig

  3. Distribution coefficients for plutonium and americium on particulates in aquatic environments

    International Nuclear Information System (INIS)

    Sanchez, A.L.; Schell, W.R.; Sibley, T.H.

    1982-01-01

    The distribution coefficients of two transuranic elements, plutonium and americium, were measured experimentally in laboratory systems of selected freshwater, estuarine, and marine environments. Gamma-ray emitting isotopes of these radionuclides, 237 Pu and 241 Am, were significantly greater than the sorption Ksub(d) values, suggesting some irreversibility in the sorption of these radionuclides onto sediments. The effects of pH and of sediment concentration on the distribution coefficients were also investigated. There were significant changes in the Ksub(d) values as these parameters were varied. Experiments using sterilized and nonsterilized samples for some of the sediment/water systems indicate possible bacterial effects on Ksub(d) values. (author)

  4. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning

    1986-01-01

    collected from the Irish coast in 1983. Fallout is found to dominate as a source of 239+240Pu north of latitude 65°N, while for 238Pu a substantial fraction originates from European nuclear fuel reprocessing facilities. The 238Pu/239+240Pu isotope ratio provides clear evidence of the transport of effluent...... of the Irish Sea) to Spitsbergen. 241Am found in Arctic waters probably originates from the decay of fallout 241Pu and, like Pu, tentatively has a residence time of the order of several years. Americium from Sellafield has an estimated mean residence time of 4–6 months in Scottish waters....

  5. Laboratory investigation of the role of desorption kinetics on americium transport associated with bentonite colloids.

    Science.gov (United States)

    Dittrich, Timothy Mark; Boukhalfa, Hakim; Ware, Stuart Douglas; Reimus, Paul William

    2015-10-01

    Understanding the parameters that control colloid-mediated transport of radionuclides is important for the safe disposal of used nuclear fuel. We report an experimental and reactive transport modeling examination of americium transport in a groundwater-bentonite-fracture fill material system. A series of batch sorption and column transport experiments were conducted to determine the role of desorption kinetics from bentonite colloids in the transport of americium through fracture materials. We used fracture fill material from a shear zone in altered granodiorite collected from the Grimsel Test Site (GTS) in Switzerland and colloidal suspensions generated from FEBEX bentonite, a potential repository backfill material. The colloidal suspension (100 mg L(-1)) was prepared in synthetic groundwater that matched the natural water chemistry at GTS and was spiked with 5.5 × 10(-10) M (241)Am. Batch characterizations indicated that 97% of the americium in the stock suspension was adsorbed to the colloids. Breakthrough experiments conducted by injecting the americium colloidal suspension through three identical columns in series, each with mean residence times of 6 h, show that more than 95% of the bentonite colloids were transported through each of the columns, with modeled colloid filtration rates (k(f)) of 0.01-0.02 h(-1). Am recoveries in each column were 55-60%, and Am desorption rate constants from the colloids, determined from 1-D transport modeling, were 0.96, 0.98, and 0.91 h(-1) in the three columns, respectively. The consistency in Am recoveries and desorption rate constants in each column indicates that the Am was not associated with binding sites of widely-varying strengths on the colloids, as one binding site with fast kinetics represented the system accurately for all three sequential columns. Our data suggest that colloid-mediated transport of Am in a bentonite-fracture fill material system is unlikely to result in transport over long distance scales because

  6. Study of the extraction and the purification of americium and trivalent actinides contained in effluents with supported liquid membranes

    International Nuclear Information System (INIS)

    Guillou, P.

    1990-12-01

    The supported liquid membrane technique is studied and developed for americium recovery from uranium or plutonium matrices and decontamination of liquid radioactive wastes. First tests on uranium-nickel solutions with a flat membrane showed the easiness of the operation and the efficiency of the process. Acid-resistant (10 N), interchangeable elements with hollow fibers, are developed and also a computerized automatic device. The different tests on americium solutions demonstrate the feasibility and the reliability of the system. Influence of various parameters on transfer kinetics is investigated

  7. 238U, 234U and 232Th in seawater

    International Nuclear Information System (INIS)

    Chen, J.H.; Edwards, R.L.; Wasserburg, G.J.

    1986-01-01

    We have developed techniques to determine 238 U, 234 U and 232 Th concentrations in seawater by isotope dilution mass spectrometry. Using these techniques, we have measured 238 U, 234 U and 232 Th in vertical profiles of unfiltered, acidified seawater from the Atlantic and 238 U and 234 U in vertical profiles from the Pacific. Determinations of 234 U/ 238 U at depths ranging from 0 to 4900 m in the Atlantic (7 0 44'N, 40 0 43'W) and the Pacific (14 0 41'N, 160 0 01'W) Oceans are the same within experimental error (±5per mille, 2σ). The average of these 234 U/ 238 U measurements is 144±2per mille (2σ) higher than the equilibrium ratio of 5.472 x 10 -5 . U concentrations, normalized to 35per mille salinity, range from 3.162 to 3.281 ng/g, a range of 3.8%. The average concentration of the Pacific samples (31 0 4'N, 159 0 1'W) is ∝1% higher than that of the Atlantic (7 0 44'N, 40 0 43'W and 31 0 49'N, 64 0 6'W). 232 Th concentrations from an Atlantic profile range from 0.092 to 0.145 pg/g. The observed constancy of the 234 U/ 238 U ratio is consistent with the predicted range of 234 U/ 238 U using a simple two-box model and the residence time of deep water in the ocean determined from 14 C. The variation in salinity-normalized U concentrations suggests that U may be much more reactive in the marine environment than previously thought. (orig./WB)

  8. Influence of glacial meltwater on global seawater δ234U

    Science.gov (United States)

    Arendt, Carli A.; Aciego, Sarah M.; Sims, Kenneth W. W.; Das, Sarah B.; Sheik, Cody; Stevenson, Emily I.

    2018-03-01

    We present the first published uranium-series measurements from modern Greenland Ice Sheet (GrIS) runoff and proximal seawater, and investigate the influence of glacial melt on global seawater δ234U over glacial-interglacial (g-ig) timescales. Climate reconstructions based on closed-system uranium-thorium (U/Th) dating of fossil corals assume U chemistry of seawater has remained stable over time despite notable fluctuations in major elemental compositions, concentrations, and isotopic compositions of global seawater on g-ig timescales. Deglacial processes increase weathering, significantly increasing U-series concentrations and changing the δ234U of glacial meltwater. Analyses of glacial discharge from GrIS outlet glaciers indicate that meltwater runoff has elevated U concentrations and differing 222Rn concentrations and δ234U compositions, likely due to variations in subglacial residence time. Locations with high δ234U have the potential to increase proximal seawater δ234U. To better understand the impact of bulk glacial melt on global seawater δ234U over time, we use a simple box model to scale these processes to periods of extreme deglaciation. We account for U fluxes from the GrIS, Antarctica, and large Northern Hemisphere Continental Ice Sheets, and assess sensitivity by varying melt volumes, duration and U flux input rates based on modern subglacial water U concentrations and compositions. All scenarios support the hypothesis that global seawater δ234U has varied by more than 1‰ through time as a function of predictable perturbations in continental U fluxes during g-ig periods.

  9. Transmutation of americium and curium incorporated in zirconia-based host materials

    Energy Technology Data Exchange (ETDEWEB)

    Raison, P.E. [CEA Cadarache, 13 - Saint-Paul-lez-Durance (France). Dept. d' Etudes des Combustibles; Haire, R.G. [Oak Ridge National Lab., TN (United States)

    2001-07-01

    Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO{sub 2}-ZrO{sub 2}-Y{sub 2}O{sub 3}. It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO{sub 2} content. The Cm{sub 2}O{sub 3}-ZrO{sub 2} system was also investigated. It was found that at 25 mol% of CmO{sub 1.5}, the Cm(III) stabilized zirconia in its cubic form (a = 5.21 {+-}0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO{sub 1.5}, a pyrochlore oxide - Cm{sub 2}Zr{sub 2}O{sub 7} - is formed (a = 10.63 {+-}0.02 Angstrom). (author)

  10. Fuel cycle covariance of plutonium and americium separations to repository capacity using information theoretic measures

    International Nuclear Information System (INIS)

    Scopatz, Anthony; Schneider, Erich; Li, Jun; Yim, Man-Sung

    2011-01-01

    A light water reactor, fast reactor symbiotic fuel cycle scenario was modeled and parameterized based on thirty independent inputs. Simultaneously and stochastically choosing different values for each of these inputs and performing the associated fuel cycle mass-balance calculation, the fuel cycle itself underwent Monte Carlo simulation. A novel information theoretic metric is postulated as a measure of system-wide covariance. This metric is the coefficient of variation of the set of uncertainty coefficients generated from 2D slices of a 3D contingency table. It is then applied to the fuel cycle, taking fast reactor used fuel plutonium and americium separations as independent variables and the capacity of a fully-loaded tuff repository as the response. This set of parameters is known from prior studies to have a strong covariance. When measured with all 435 other input parameters possible, the fast reactor plutonium and americium separations pair was found to be ranked the second most covariant. This verifies that the coefficient of variation metric captures the desired sensitivity of sensitivity effects in the nuclear fuel cycle. (author)

  11. Contribution to the prediction of americium, plutonium and neptunium behaviour in the geosphere: chemical data

    International Nuclear Information System (INIS)

    Robouch, P.

    1989-01-01

    An exhaustive bibliographic review on hydrolysis of americium gives the stability constants, at zero ionic strength. No evidence of Am(OH) 4 - formation was found by solubility studies up to pH 2 (CO 3 ) 3 characterised by its X-ray diffraction pattern is studied at a high ionic strength. All the published results on Am in carbonate media are reinterpreted using these stability constants (Am-OH-CO 3 complexes are not needed). No evidence of Am(CO 3 ) 4 5- formation was found by spectrophotometry up to 3M. Literature results are used to determine the formal redox potentials at pH = 9.4 and to calculate the formation constants, at zero ionic strength. The formation of complexes between americium and humic materials (purified fulvic and humic acids) has been studied by a spectrophotometric technique. The results are interpreted by the formation of a 1:1 complexe. Solubility of the solid PuO 2 (CO 3 ) is measured in bicarbonate media at high ionic strength, to obtain the solubility product and formation constants of the PuO 2 (CO 3 ) i 2-2i complexes [fr

  12. Production of a square geometry Americium standard source for use with photodiodes

    Energy Technology Data Exchange (ETDEWEB)

    Costa, Priscila; Geraldo, Bianca; Raele, Marcus P.; Marumo, Júlio T.; Vicente, Roberto; Zahn, Guilherme S.; Genezini, Frederico A., E-mail: priscila3.costa@usp.br, E-mail: fredzini@ipen.br [Instituto de Pesquisas Energéticas e Nucleares (IPEN/CNEN-SP), São Paulo, SP (Brazil)

    2017-07-01

    In the development of a thermal neutron detector using a square photodiode and a thin boron film, a radioactive calibration source with the same geometry was needed. An americium-243 standard source was produced by electrodeposition aiming at the calibration of a PIN-type silicon photodiode with a detection area of 10 x 10 mm{sup 2}. To produce the samples two tests were performed. In the first test, a square stainless steel plate (10 x 10 mm{sup 2}) was fixed on the surface of the conventional plate, which was removed after deposition. To reduce the loss of activity of the source, in the second test nail polish was applied on the silver plate leaving only an area of 10 x 10 mm{sup 2} without varnish coating. Once the electrodeposition process was completed, the activity concentration measurement was performed by alpha particle spectrometry. The first method presented a lower activity when compared to the total activity of Am-243 added initially. For the second method, the total activity was concentrate in the exposed square region (without nail polish). The results showed that it is possible to obtain a square geometry source; furthermore, the surrounding nail polish was not contaminated by {sup 243}Am. The comparison of these two approaches indicated that the second method was more efficient as it was possible to concentrate all the americium activity in the delimited square area. (author)

  13. Comparison of Americium-Beryllium neutron spectrum obtained using activation foil detectors and NE-213 spectrometer

    International Nuclear Information System (INIS)

    Sunny, Sunil; Subbaiah, K.V.; Selvakumaran, T.S.

    1999-01-01

    Neutron spectrum of Americium - Beryllium (α,n) source is measured with two different spectrometers vis-a-vis activation foils (foil detectors) and NE-213 organic scintillator. Activity induced in the foils is measured with 4π-β-γ sodium iodide detector by integrating counts under photo peak and the saturation activity is found by correcting to elapsed time before counting. The data on calculated activity is fed into the unfolding code, SAND-II to obtain neutron spectrum. In the case of organic scintillator, the pulse height spectrum is obtained using MCA and this is processed with unfolding code DUST in order to get neutron spectrum. The Americium - Beryllium (α,n) neutron spectrum thus obtained by two different methods is compared. It is inferred that the NE-213 scintillator spectrum is in excellent agreement with the values beyond 1MeV. Neutron spectrum obtained by activation foils depends on initial guess spectrum and is found to be in reasonable agreement with NE-213 spectrum. (author)

  14. The distribution of plutonium-239 and americium-241 in the Syrian hamster following its intravenous administration as citrate

    International Nuclear Information System (INIS)

    Rodwell, P.; Stather, J.W.

    1978-01-01

    Actinide distribution in various tissues and the skeleton of hamsters by liquid scintillation counting or isotope dilution. For plutonium 57% of activity was concentrated in the skeleton and more than 90% in the liver and skeleton after seven days. For americium the liver retained more than 50% of total activity and 25% was excreted in urine within seven days. (U.K.)

  15. Three Replicons of Rhizobium sp. Strain NGR234 Harbor Symbiotic Gene Sequences

    Science.gov (United States)

    Flores, Margarita; Mavingui, Patrick; Girard, Lourdes; Perret, Xavier; Broughton, William J.; Martínez-Romero, Esperanza; Dávila, Guillermo; Palacios, Rafael

    1998-01-01

    Rhizobium sp. strain NGR234 contains three replicons: the symbiotic plasmid or pNGR234a, a megaplasmid (pNGR234b), and the chromosome. Symbiotic gene sequences not present in pNGR234a were analyzed by hybridization. DNA sequences homologous to the genes fixLJKNOPQGHIS were found on the chromosome, while sequences homologous to nodPQ and exoBDFLK were found on pNGR234b. PMID:9811668

  16. Worldwide bioassay data resources for plutonium/americium internal dosimetry studies

    International Nuclear Information System (INIS)

    Miller, G.; Bertelli, L.; Little, T.; Guilmette, R.; Riddell, T.; Filipy, R.

    2005-01-01

    Full text: Biokinetic models are the scientific underpinning of internal dosimetry. These models describe how materials of interest taken into the body by various routes (for example inhalation) are transported through the body, allowing the modelling of bioassay measurements and the estimation of radiation dose. The International Commission on Radiation Protection (ICRP) publishes biokinetic models for use in internal dosimetry. These models represent the consensus judgement of a committee of experts, based on human and animal data. Nonetheless, it is important to validate biokinetic models using directly applicable data, in a scientifically transparent manner, especially for internal dosimetry research purposes (as opposed to radiation protection), as in epidemiology studies. Two major goals would be to determine individual variations of model parameters for the purpose of assessing this source of uncertainty in internal dose calculations, and to determine values of workplace specific parameters (such as particle solubility in lung fluids) for different representative workplaces. Furthermore, data on the observed frequency of intakes under various conditions can be used in the interpretation of bioassay data. All of the above may be couched in the terminology of Bayesian statistical analysis and amount to the determination of the Bayesian prior probability distributions needed in a Bayesian interpretation of bioassay data. The authors have direct knowledge of several significant databases of plutonium/americium bioassay data (including autopsy data). The purpose of this paper is to acquaint the worldwide community with these resources and to invite others who may know of other such databases to participate with us in a publication that would document the content, form, and the procedures for seeking access to these databases. These databases represent a tremendous scientific resource in this field. Examples of databases known to the authors include: the

  17. 14 CFR 234.6 - Baggage-handling statistics.

    Science.gov (United States)

    2010-01-01

    ... PROCEEDINGS) ECONOMIC REGULATIONS AIRLINE SERVICE QUALITY PERFORMANCE REPORTS § 234.6 Baggage-handling... transmittal letter accompanying the data for on-time performance in the form and manner set forth in accounting and reporting directives issued by the Director, Office of Airline Information. [Docket No. 48524...

  18. 22 CFR 23.4 - Representative value in exchange.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Representative value in exchange. 23.4 Section... Representative value in exchange. Representative value in exchange for the collection of a fee means foreign currency equivalent to the prescribed United States dollar fee at the current rate of exchange at the time...

  19. Complex formation of trivalent americium with salicylic acid at very low concentrations

    International Nuclear Information System (INIS)

    Melanie Mueller; Margret Acker; Steffen Taut; Gert Bernhard; Forschungszentrum Dresden-Rossendorf, Dresden

    2010-01-01

    For the first time, the complexation of americium(III) with salicylic acid was studied at trace metal concentrations using a 2.0 m Long Path Flow Cell for UV-vis spectroscopy. The detection limit of Am(III) in aqueous solution at pH 3.0 was found to be 5 x 10 -9 M. Two Am(III)-salicylate complexes were formed at pH 5.0 in 0.1 M NaClO 4 , indicated by a clear red shift of the absorption maximum. The absorption spectra obtained from spectrophotometric titration were analyzed by means of factor analysis and complex stabilities were calculated to be log β 110 = 2.56 ± 0.08 and log β 120 = 3.93 ± 0.19. (author)

  20. Plutonium and americium concentrations and vertical profiles in some Italian mosses used as bioindicators

    International Nuclear Information System (INIS)

    Testa, C.; Desideri, D.; Meli, M.A.; Guerra, F.; Degetto, S.; Jia, G.; Gerdol, R.

    1998-01-01

    We have examined the uptake of actinide elements Am and Pu by different species of lichen and moss collected in two locations (Urbino, Central Italy; Alps region, North-east Italy). Plutonium and americium were separated and determined by extraction chromatography, electrodeposition and alpha-spectrometry. This paper summarizes our results with a special emphasis on the vertical profiles of these actinides in two different species of mosses. Several 1-2 cm depth sections were obtained and dated by 210 Pb method. A typical peak for 239,240 Pu and 241 Am was found in the very old moss species ('Sphagnum Compactum') at a depth corresponding to the period 1960-1970 which was the period characterized by the maximum nuclear weapon tests. In a younger moss species ('Neckeria Crispa') no peak was observed and the regression curves showed that Am is more mobile than 239,240 Pu and 238 Pu. (author)

  1. The uptake of plutonium-239, 240, americium-241, strontium-90 into plants

    International Nuclear Information System (INIS)

    Popplewell, D.S.; Ham, G.J.; Johnson, T.E.

    1984-01-01

    This report describes the results of measurements on the uptake of plutonium, americium, strontium-90 and caesium-137 into peas, beet, oats, sweet corn, tomatoes and vegetable marrow grown in tubs containing radioactively-contaminated silts. The silts had been taken from an area of West Cumbria commonly referred to as the Ravenglass estuary. The experiments are categorised as being carried out under non-standard conditions because of the manner in which the radioactivity came to be incorporated into the growth medium. The growth medium was representative of conditions which could arise when the estuarine silt moves inland under the influence of wind and tide and mixes with the adjacent farm land. The silt had been contaminated by radioactive effluents from the nuclear fuels reprocessing plant at Sellafield and this contamination had been brought about by natural means. (Auth.)

  2. Separation of trivalent americium and europium by purified Cyanex 301 immobilized in macro porous polymer

    International Nuclear Information System (INIS)

    Jing Chen; Veltkamp, A.C.; Booij, A.S.

    2002-01-01

    High separation ability of purified Cyanex 301 towards trivalent americium over europium in liquid-liquid extraction is confirmed. Solvent 2-nitrophenyl octyl ether (NPOE) lowered the partitioning of Am 3+ but remained the separation ability over europium. Solvent toluene and 3-octanone lowered the separation factor to ∼ 1000. It is feasible to separate Am 3+ from Eu 3+ by Cyanex 301 which was immobilized in the macro porous polymer (MPP). 3-Octanone is a suitable solvent for dissolving NH 4 OH-saponified Cyanex 301 and MPP is a suitable solid supported material for column operation. A five-step column experiment demonstrated the feasibility to separate Am 3+ from Eu 3+ in column which was packed with Cyanex 301-impregnated MPP. (author)

  3. Spectral properties of americium(III) in silicate matrices. Concentration-dependent up-conversion emission

    International Nuclear Information System (INIS)

    Assefa, Zerihun; Haire, R.G.; Stump, N.

    2002-01-01

    We have been pursuing the spectroscopic properties of actinide ions in silicate matrices. One facet of these studies involves the behavior of Stokes and anti-Stokes emissions exhibited by Am 3+ in these hosts. Several attributes have been found to influence the spectral profile, which include excitation wavelength, laser power, and dopant-concentration. Excitation with the 514.5 nm (19435 cm -1 ) line of argon laser provides anti-Stokes emissions at 21100 and ∼19920 cm -1 in the borosilicate matrices. This up-conversion was found to proceed through a multi-photon scheme, and the efficiency increases with increased dopant concentration. Based on our concentration-dependent studies, the up-conversion is suggested to involve a cross-relaxation process [( 5 D 1' , 7 F 0' ) ( 7 F 6' , 7 F 2' )] between neighboring americium ions. (author)

  4. Standard practice for The separation of americium from plutonium by ion exchange

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2001-01-01

    1.1 This practice describes the use of an ion exchange technique to separate plutonium from solutions containing low concentrations of americium prior to measurement of the 241Am by gamma counting. 1.2 This practice covers the removal of plutonium, but not all the other radioactive isotopes that may interfere in the determination of 241Am. 1.3 This practice can be used when 241Am is to be determined in samples in which the plutonium is in the form of metal, oxide, or other solid provided that the solid is appropriately sampled and dissolved (See Test Methods C758, C759, and C1168). 1.4 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  5. Magnesium ionophore II as an extraction agent for trivalent europium and americium

    Energy Technology Data Exchange (ETDEWEB)

    Makrlik, Emanuel [Czech Univ. of Life Sciences, Prague (Czech Republic). Faculty of Environmental Sciences; Vanura, Petr [Univ. of Chemistry and Technology, Prague (Czech Republic). Dept. of Analytical Chemistry

    2016-11-01

    Solvent extraction of microamounts of trivalent europium and americium into nitrobenzene by using a mixture of hydrogen dicarbollylcobaltate (H{sup +}B{sup -}) and magnesium ionophore II (L) was studied. The equilibrium data were explained assuming that the species HL{sup +}, HL{sup +}{sub 2}, ML{sup 3+}{sub 2}, and ML{sup 3+}{sub 3} (M{sup 3+} = Eu{sup 3+}, Am{sup 3+}; L=magnesium, ionophore II) are extracted into the nitrobenzene phase. Extraction and stability constants of the cationic complex species in nitrobenzene saturated with water were determined and discussed. From the experimental results it is evident that this effective magnesium ionophore II receptor for the Eu{sup 3+} and Am{sup 3+} cations could be considered as a potential extraction agent for nuclear waste treatment.

  6. Separation of oxidized americium from lanthanides by use of pillared metal(IV) phosphate-phosphonate hybrid materials

    Energy Technology Data Exchange (ETDEWEB)

    Burns, J.D.; Clearfield, A. [Texas A and M Univ., College Station, TX (United States). Dept. of Chemistry; Borkowski, M.; Reed, D.T. [Los Alamos National Laboratory, Carlsbad, NM (United States). Earth and Environmental Sciences Div.

    2012-07-01

    Closing the nuclear fuel cycle in the US poses many challenges, one of which is found in the waste streams, which contain both trivalent lanthanides and actinides. The separation of americium from the raffinate will dramatically reduce the long-term radiotoxicity of the waste. The sorption of americium in both the tri- and pentavalent oxidation states was observed for four M(IV) phosphate-phosphonate ion exchange materials in nitric acid at pH 2. High selectivity was observed for reduced Am(III) with K{sub d} values ca. 6 x 10{sup 5} mL/g, while the K{sub d} values for Am(V) were much lower. A new method of synthesizing and stabilizing AmO{sub 2}{sup +} to yield a lifetime of at least 24 h in acidic media using a combination of sodium persulfate and calcium hypochlorite will be described.

  7. Separation of oxidized americium from lanthanides by use of pillared metal(IV) phosphate-phosphonate hybrid materials

    International Nuclear Information System (INIS)

    Burns, J.D.; Clearfield, A.; Borkowski, M.; Reed, D.T.

    2012-01-01

    Closing the nuclear fuel cycle in the US poses many challenges, one of which is found in the waste streams, which contain both trivalent lanthanides and actinides. The separation of americium from the raffinate will dramatically reduce the long-term radiotoxicity of the waste. The sorption of americium in both the tri- and pentavalent oxidation states was observed for four M(IV) phosphate-phosphonate ion exchange materials in nitric acid at pH 2. High selectivity was observed for reduced Am(III) with K d values ca. 6 x 10 5 mL/g, while the K d values for Am(V) were much lower. A new method of synthesizing and stabilizing AmO 2 + to yield a lifetime of at least 24 h in acidic media using a combination of sodium persulfate and calcium hypochlorite will be described.

  8. Upper limits to americium concentration in large sized sodium-cooled fast reactors loaded with metallic fuel

    International Nuclear Information System (INIS)

    Zhang, Youpeng; Wallenius, Janne

    2014-01-01

    Highlights: • The americium transmutation capability of Integral Fast Reactor was investigated. • The impact from americium introduction was parameterized by applying SERPENT Monte Carlo calculations. • Higher americium content in metallic fuel leads to a power penalty, preserving consistent safety margins. - Abstract: Transient analysis of a large sized sodium-cooled reactor loaded with metallic fuel modified by different fractions of americium have been performed. Unprotected loss-of-offsite power, unprotected loss-of-flow and unprotected transient-over-power accidents were simulated with the SAS4A/SASSYS code based on the geometrical model of an IFR with power rating of 2500 MW th , using safety parameters obtained with the SERPENT Monte Carlo code. The Ti-modified austenitic D9 steel, having higher creep rupture strength, was considered as the cladding and structural material apart from the ferritic/martensitic HT9 steel. For the reference case of U–12Pu–1Am–10Zr fuel at EOEC, the margin to fuel melt during a design basis condition UTOP is about 50 K for a maximum linear rating of 30 kW/m. In order to maintain a margin of 50 K to fuel failure, the linear power rating has to be reduced by ∼3% and 6% for 2 wt.% and 3 wt.% Am introduction into the fuel respectively. Hence, an Am concentration of 2–3 wt.% in the fuel would lead to a power penalty of 3–6%, permitting a consumption rate of 3.0–5.1 kg Am/TW h th . This consumption rate is significantly higher than the one previously obtained for oxide fuelled SFRs

  9. Recovery and purification of uranium-234 from aged plutonium-238

    International Nuclear Information System (INIS)

    Keister, P.L.; Figgins, P.W.; Watrous, R.M.

    1978-01-01

    The current production methods used to recover and purify uranium-234 from aged plutonium-238 at Mound Laboratory are presented. The three chemical separation steps are described in detail. In the initial separation step, the bulk of the plutonium is precipitated as the oxalate. Successively lower levels of plutonium are achieved by anion exchange in nitrate media and by anion exchange in chloride media. The procedures used to characterize and analyze the final U 3 O 8 are given

  10. 8 CFR 234.4 - International airports for entry of aliens.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false International airports for entry of aliens. 234.4 Section 234.4 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS DESIGNATION OF PORTS OF ENTRY FOR ALIENS ARRIVING BY CIVIL AIRCRAFT § 234.4 International airports for entry...

  11. 20 CFR 234.19 - Effect of payment on future entitlement.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Effect of payment on future entitlement. 234.19 Section 234.19 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT LUMP-SUM PAYMENTS Lump-Sum Death Payment § 234.19 Effect of payment on future entitlement...

  12. Uptake of americium-241 by plants from contaminated Chernobyl exclusive zone test site soils

    International Nuclear Information System (INIS)

    Rashydov, N.M.

    2002-01-01

    Americium-241 was found to accumulate in soils and biological objects of the environment. Its concentration has increased many times after the Chernobyl disaster and can be expected to increase about 40 times in the future. This research concentrated on the contaminated exclusive Chernobyl zone polluted by trace radionuclides, their behavior and accumulation by various plant species. Special attention is devoted to the bioavailability of 241 Am to the plants Galium rivale, G. tinctorium, G. aparine, G. intermedium, Berteroa incana, Artemisia absinthium, A. vulgaris, Centaurea borysthenica, C. arenaria, Cirsium arvense, Succissa pratensis, Solidago virgaurea, Linaria vulgaris, Lepidium ruderale, Stenactis annua, Veronica maxima, Verbascum lychnitis, Euphorbia cyparissias, Genista tinctoria, Erigeron canadensis, Oenothera biennis, Betula pendula and Quercus robur, which were collected from the Chernobyl, Kopachi, and Yanov districts. The plant samples of Oenothera biennis, Betula pendula and Quercus robur were collected from the Yanov district, where the soil contamination by 241 Am and 137 Cs was at the level of 660 and 27 MBq/m 2 , respectively. Gamma spectroscopy and radiochemical methods were used to estimate the activity concentration of 137 Cs, 90 Sr, 238 Pu, 239+240 Pu, 241 Am. The radionuclides were measured in the dry green mass of the plant samples and in the dry soils. The contamination of the Oenothera biennis, Betula pendula and Quercus robur samples by 137 Cs was (5.8±1,5)x10 6 , (7.4±1.1)x10 5 , and (2.6±0.2)x10 6 Bq/kg dry mass, respectively, and contamination by 241 Am was 47±5, 45±3 and 3.2±0.2 Bq/kg, respectively. The soil-to-plant transfer ratio for 137 Cs ranged lay within the interval of 0.2 to 0.03 Bq/kg : Bq/m 2 , the the transfer ratio for 241 Am did not exceed 7x10 -5 Bq/kg : Bq/m 2 . The coefficient of the relative contents of the 241 Am/ 239+240 Pu radionuclides in the various plant samples varied from 3.2 to 8.3, while for soil from

  13. Contrasts between the marine and freshwater biological interactions of plutonium and americium

    International Nuclear Information System (INIS)

    Livingston, H.D.; Bowen, V.T.

    1975-01-01

    Whether in lakes or the oceans the transuranic elements plutonium and americium are taken up by marine organisms, with concentration factors that would class them as nice, typical heavy metals. There is no evidence for strong, widespread discrimination against the transuranics by either plant or animal absorptive surfaces. In both freshwater and marine situations the major reservoir of Pu and Am soon becomes the sediments, and organisms are more exposed to uptake of these nuclides the closer is their ecological involvement with the sediments. Although there is little evidence that this can be an ionic strength effect, it does appear that Pu may be somewhat more available, biologically, in marine environments, and Am, conversely, in fresh water. We incline to the belief that details of these behaviors are usually controlled by local availability of organic complexers. No compelling evidence exists of increase in Pu concentration at higher levels of food chains; in marine situations this appears true of Am as well, but a few data suggest that in fresh water fish there is a progressive increase, in higher trophic levels, in the ratio Am to Pu. Although marine and fresh water biogeochemistries of transuranics are much more similar than we had expected, it will generally be dangerous to extrapolate from one to the other. In both systems there appears to us no question that we are observing real element biogeochemistry, not the redistribution of inert, labelled, fallout fragments

  14. Multicompartment kinetic models for the metabolism of americium, plutonium and uranium in rats

    International Nuclear Information System (INIS)

    Sontag, W.

    1986-01-01

    To examine the kinetic behaviour of americium, plutonium and uranium in male and female rats, an extended mammillary model has been developed, composed of 10 compartments connected with 17 linear transfer coefficients. The 10 compartments describe the behaviour of the three nuclides in the blood, skeleton, liver and kidney; the remaining activity is assigned to one residual organ. Each organ is divided into two compartments, short- and long-term. In the skeleton the short-term compartment has been assumed to be the bone surface and marrow, and the long-term compartment the deep bone; in the liver, evidence suggests that the short-term compartment is physiologically associated with lysosomes and the long-term compartment identical with telolysosomes. Influence of age, sex and different nuclides on the transfer coefficients and the absorbed radiation dose are discussed. By using the transfer coefficients calculated for intravenous injection, the behaviour of the nuclides in skeleton and liver during continuous intake has been calculated. The behaviour of the three nuclides in skeleton and liver after intravenous injection has also been calculated with the additional assumption that from the fifth day the animals were treated continuously with a chelating agent. (UK)

  15. Development and Testing of an Americium/Lanthanide Separation Flowsheet Using Sodium Bismuthate

    Energy Technology Data Exchange (ETDEWEB)

    Jack Law; Bruce Mincher; Troy Garn; Mitchell Greenhalgh; Nicholas Schmitt; Veronica Rutledge

    2014-04-01

    The separation of Am from the lanthanides and curium is a key step in proposed advanced fuel cycle scenarios. The partitioning and transmutation of Am is desirable to minimize the long-term heat load of material interred in a future high-level waste repository. A separation process amenable to process scale-up remains elusive. Given only subtle chemistry differences within and between the ions of the trivalent actinide and lanthanide series this separation is challenging ; however, higher oxidation states of americium can be prepared using sodium bismuthate and separated via solvent extraction using diamylamylphosphonate (DAAP) extraction. Among the other trivalent metals only Ce is also oxidized and extracted. Due to the long-term instability of Am(VI) , the loaded organic phase is readily selectively stripped to partition the actinide to a new acidic aqueous phase. Batch extraction distribution ratio measurements were used to design a flowsheet to accomplish this separation. Additionally, crossflow filtration was investigated as a method to filter the bismuthate solids from the feed solution prior to extraction. Results of the filtration studies, flowsheet development work and flowsheet performance testing using a centrifugal contactor are detailed.

  16. Speciation and bioavailability of Americium-241 in the fresh water environment

    International Nuclear Information System (INIS)

    Bierkens, J.

    1986-01-01

    Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241 Am in the freshwater environment aim to establish a relation between the behavior of 241 Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241 Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241 Am. Based on the registration of the 241 Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241 Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241 Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241 Am with some other metals ( 240 Pu, 64 Cu, 198 Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241 Am in organisms can be explained from its chemical characteristics

  17. Americium and plutonium in water, biota, and sediment from the central Oregon coast

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, Reinald Dreas [Oregon State Univ., Corvallis, OR (United States)

    1982-06-01

    Plutonium-239, 240 and americium-241 were measured in the mussel Mytilus californianus from the region of Coos Bay, OR. The flesh of this species has a plutonium concentration of about 90 fCi/kg, and an Am-241/Pu-239, 240 ratio that is high relative to mixed fallout, ranging between two and three. Transuranic concentrations in sediment, unfiltered water, and filterable particulates were also measured; none of these materials has an Am/Pu ratio as greatly elevated as the mussels, and there is no apparent difference in the Am/Pu ratio of terrestrial runoff and coastal water. Sediment core profiles do not allow accumulation rates or depositional histories to be identified, but it does not appear that material characterized by a high Am/Pu ratio has ever been introduced to this estuary. Other bivalves (Tresus capax and Macoma nasuta) and a polychaete (Abarenicola sp.) do not have an elevated Am/Pu ratio, although the absolute activity of plutonium in the infaunal bivalves is roughly four times that in the mussels.

  18. Americium and plutonium in water, biota, and sediment from the central Oregon coast

    International Nuclear Information System (INIS)

    Nielsen, R.D.

    1982-06-01

    Plutonium-239, 240 and americium-241 were measured in the mussel Mytilus californianus from the region of Coos Bay, OR. The flesh of this species has a plutonium concentration of about 90 fCi/kg, and an Am-241/Pu-239, 240 ratio that is high relative to mixed fallout, ranging between two and three. Transuranic concentrations in sediment, unfiltered water, and filterable particulates were also measured; none of these materials has an Am/Pu ratio as greatly elevated as the mussels, and there is no apparent difference in the Am/Pu ratio of terrestrial runoff and coastal water. Sediment core profiles do not allow accumulation rates or depositional histories to be identified, but it does not appear that material characterized by a high Am/Pu ratio has ever been introduced to this estuary. Other bivalves (Tresus capax and Macoma nasuta) and a polychaete (Abarenicola sp.) do not have an elevated Am/Pu ratio, although the absolute activity of plutonium in the infaunal bivalves is roughly four times that in the mussels

  19. In Vitro Dissolution Tests of Plutonium and Americium Containing Contamination Originating From ZPPR Fuel Plates

    Energy Technology Data Exchange (ETDEWEB)

    William F. Bauer; Brian K. Schuetz; Gary M. Huestis; Thomas B. Lints; Brian K. Harris; R. Duane Ball; Gracy Elias

    2012-09-01

    Assessing the extent of internal dose is of concern whenever workers are exposed to airborne radionuclides or other contaminants. Internal dose determinations depend upon a reasonable estimate of the expected biological half-life of the contaminants in the respiratory tract. One issue with refractory elements is determining the dissolution rate of the element. Actinides such as plutonium (Pu) and Americium (Am) tend to be very refractory and can have biological half-lives of tens of years. In the event of an exposure, the dissolution rates of the radionuclides of interest needs to be assessed in order to assign the proper internal dose estimates. During the November 2011 incident at the Idaho National Laboratory (INL) involving a ZPPR fuel plate, air filters in a constant air monitor (CAM) and a giraffe filter apparatus captured airborne particulate matter. These filters were used in dissolution rate experiments to determine the apparent dissolution half-life of Pu and Am in simulated biological fluids. This report describes these experiments and the results. The dissolution rates were found to follow a three term exponential decay equation. Differences were noted depending upon the nature of the biological fluid simulant. Overall, greater than 95% of the Pu and 93% of the Am were in a very slow dissolving component with dissolution half-lives of over 10 years.

  20. Removal of plutonium and Americium from hydrochloric acid waste streams using extraction chromatography

    International Nuclear Information System (INIS)

    Schulte, L.D.; FitzPatrick, J.R.; Salazar, R.R.; Schake, B.S.; Martinez, B.T.

    1995-01-01

    Extraction chromatography is under development as a method to lower actinide activity levels in hydrochloric acid (HCl) effluent streams. Successful application of this technique for radioactive liquid waste treatment would provide a low activity feedstream for HCl recycle, reduce the loss of radioactivity to the environment in aqueous effluents, and lower the quantity and improve the form of solid waste generated. The extraction of plutonium and americium from HCl solutions was examined for several commercial and laboratory-produced sorbed resin materials. Polymer beads were coated with n-octyl(phenyl)-N,N-diisobutylcarbamoyl- methylphosphine oxide (CMPO) and either tributyl phosphate (TBP), or diamyl amylphosphonate (DAAP). Distribution coefficients for Pu and Am were measured by contact studies in 1-10 M HCl, while varying REDOX conditions, actinide loading levels, and resin formulations. Flow experiments were run to evaluate actinide loading and elution under varied conditions. Significant differences in the actinide distribution coefficients in contact experiments, and in actinide retention in flow experiments were observed as a function of resin formulation

  1. Cleanex process: a versatile solvent extraction process for recovery and purification of lanthanides, americium, and curium

    International Nuclear Information System (INIS)

    Bigelow, J.E.; Collins, E.D.; King, L.J.

    1979-01-01

    At a concentration of 1 M in straight-chain hydrocarbon diluent, HDEHP will extract americium, curium, and other trivalent actinide and lanthanide elements from dilute acid or salt solutions. The solute is back-extracted with more concentrated acid, either nitric or hydrochloric. The process has been used in the continuous, countercurrent mode, but its greatest advantage arises in batch extractions where the excess acid can be titrated with NaOH to produce a final acidity of about 0.03 M. Under these conditions, 99% recovery can be achieved, usually in one stage. Cleanex was used on the 50-liter scale at the Transuranium Processing Plant at Oak Ridge for 12 years to provide a broad spectrum cleanup to transuranium elements before applying more sophisticated techniques for separating individual products. The process is also used routinely to recover excessive losses of curium and/or californium from plant waste streams. The solvent system is relatively resistant to radiation damage, being usable up to 200 W-h/liter

  2. Assessment of radiation doses from residential smoke detectors that contain americium-241

    International Nuclear Information System (INIS)

    O'Donnell, F.R.; Etnier, E.L.; Holton, G.A.; Travis, C.C.

    1981-10-01

    External dose equivalents and internal dose commitments were estimated for individuals and populations from annual distribution, use, and disposal of 10 million ionization chamber smoke detectors that contain 110 kBq (3 μCi) americium-241 each. Under exposure scenarios developed for normal distribution, use, and disposal using the best available information, annual external dose equivalents to average individuals were estimated to range from 4 fSv (0.4 prem) to 20 nSv (2 μrem) for total body and from 7 fSv to 40 nSv for bone. Internal dose commitments to individuals under post disposal scenarios were estimated to range from 0.006 to 80 μSv (0.0006 to 8 mrem) to total body and from 0.06 to 800 μSv to bone. The total collective dose (the sum of external dose equivalents and 50-year internal dose commitments) for all individuals involved with distribution, use, or disposal of 10 million smoke detectors was estimated

  3. Study of biosorbents application on the treatment of radioactive liquid wastes with americium-241

    International Nuclear Information System (INIS)

    Borba, Tania Regina de

    2010-01-01

    The use of nuclear energy for many different purposes has been intensified and highlighted by the benefits that it provides. Medical diagnosis and therapy, agriculture, industry and electricity generation are examples of its application. However, nuclear energy generates radioactive wastes that require suitable treatment ensuring life and environmental safety. Biosorption and bioaccumulation represent an emergent alternative for the treatment of radioactive liquid wastes, providing volume reduction and physical state change. This work aimed to study biosorbents for the treatment of radioactive liquid wastes contaminated with americium-241 in order to reduce the volume and change the physical state from liquid to solid. The biosorbents evaluated were Saccharomyces cerevisiae immobilized in calcium alginate beads, inactivated and free cells of Saccharomyces cerevisiae, calcium alginate beads, Bacillus subtilis, Cupriavidus metallidurans and Ochrobactrum anthropi. The results were quite satisfactory, achieving 100% in some cases. The technique presented in this work may be useful and viable for implementing at the Waste Management Laboratory of IPEN - CNEN/SP in short term, since it is an easy and low cost method. (author)

  4. distributions for the thermal neutron induced fission of 234U

    Directory of Open Access Journals (Sweden)

    Al-Adili A.

    2016-01-01

    In addition, the analysis of thermal neutron induced fission of 234U(n,f will be discussed. Currently analysis of data is ongoing, originally taken at the ILL reactor. The experiment is of particular interest since no measurement exist of the mass and energy distributions for this system at thermal energies. One main problem encountered during analysis was the huge background of 235U(nth,f. Despite the negligible isotopic traces in the sample, the cross section difference is enormous. Solution to this parasitic background will be highlighted.

  5. Separation of neptunium, plutonium, americium and curium from uranium with di-(2-ethylhexyl)-phosphoric acid (HDEHP) for radiometric and ICP-MS analysis

    International Nuclear Information System (INIS)

    Ramebaeck, H.; Skaalberg, M.

    1998-01-01

    The possibility of using di-(2-ethylhexyl)-phosphoric acid (HDEHP) in solvent extraction for the separation of neptunium, plutonium, americium and curium from large amounts of uranium was studied. Neptunium, plutonium, americium and curium (as well as uranium) were extracted from HNO 3 , whereafter americium and curium were back-extracted with 5M HNO 3 . Thereafter was neptunium back-extracted in 1M HNO 3 containing hydroxylamine hydronitrate. Finally, plutonium was back-extracted in 3M HCl containing Ti(III). The method separates 238 Pu from 241 Am for α-spectroscopy. For ICP-MS analysis, the interferences from 238 U are eliminated: tailing from 238 U, for analysis of 237 Np, and the interference of 238 UH + for analysis of 239 Pu. The method has been used for the analysis of actinides in samples from a spent nuclear fuel leaching and radionuclide transport experiment. (author)

  6. Use of radioisotopes in the study of tetracycline analytical application. Extraction of compounds formed between tetracycline and neptunium and americium elements

    International Nuclear Information System (INIS)

    Saiki, M.; Lima, F.W. de

    1986-01-01

    The behavior of tetracycline as complexing agent, in solvent extraction studies of neptunium and americium, using benzyl alcohol as the organic phase, is presented. By using radioactive tracers of 239 Np and 2 4 1 Am the extraction percent of these elements were determined as a function of pH in the absence and in the presence of several masking agents. The influence of shaking time and the use of different types of supporting eletrolytes upon the extraction behavior was also studied. The extraction curves obtained using EDTA as masking agent show that tetracycline can be used for neptunium and americium separation. In this condition neptunium is extracted into the organic phase and americium remains in the aqueous phase. (Author) [pt

  7. Transport of plutonium, americium, and curium from soils into plants by roots

    International Nuclear Information System (INIS)

    Pimpl, M.; Schuettelkopf, H.

    1979-12-01

    For assessing the dose from radionuclides in agricultural products by ingestion it is necessary to know the soil to plant transfer factors. The literature was entirely investigated, in order to judge the size of the soil to plant transfer factors. In total, 92 publications - from 1948 to 1978 -have been evaluated. As result, transfer factors from 10 -9 to 10 -3 have been found for Plutonium, and from 10 -6 to 1 for Americium. For Curium only few data are available in literature. The considerable variation of the measured transfer factors is based on the dependence of these transfer factors from the ion exchange capacity of soils, from the amount of organic materials, from the pH-value, and from the mode of contamination. There are, in any case, contradictory data, although there has been detected a dependence of the transfer factors from these parameters. Chelating agenst increase the transfer factors to approximately 1300. As well, fertilizers have an influence on the size of the transfer factors - however, the relationships have been scarcely investigated. The distribution of actinides within the individual parts of plants has been investigated. The highest concentrations are in the roots; in the plant parts above ground the concentration of actinides decreases considerably. The most inferior transfer factors were measured for the respective seed or fruits. The soil to plant transfer factors of actinides are more dependend on the age of the plants within one growing period. At the beginning of the period, the transfer factor is considerably higher than at the end of this period. With respect to plants with a growing period of several years, correlations are unknown. (orig.) [de

  8. Experiments comparing the uptake of americium from chloride media using extraction chromatography

    International Nuclear Information System (INIS)

    FitzPatrick, J.R.; Schake, B.S.; Schulte, L.D.; Martinez, B.T.; Salazar, R.R.

    1995-01-01

    Clean-up of actinide effluent waste steams is of increasing importance at the Los Alamos Plutonium Facility, TA-55, and removing the actinide elements to very low levels allows less radioactivity to go the Los Alamos National Laboratory Water Treatment Facility, TA-50, thus reducing the number of drums of TRU waste. Americium (Am) is a difficult element to remove from chloride media because the +3 state is difficult to oxidize and chelating resins work better with elements such as plutonium which are more readily oxidized to the +4 and/or +6 state. Currently in hydrochloric acid (HC1) media, the acidic liquid waste is neutralized with potassium hydroxide to precipitate the metal hydroxides, before disposal to TA-50. This process is not very efficient. The removal of Am from chloride media was compared using a series of resins, some commercial and some made in our laboratory, using different percentages by weight of octyl(phenyl)-N,N-diiso- butylcarbamoyl-methylphosphine oxide (CMPO ) along with diamyl amylphosphonate (DAAP) or tributyl phosphate (TBP) as diluents. Resins were also made with no added diluent. Early comparisons using small-scale contact studies with 0.5 grams of resin in 0.1M-12M HC1, and subsequent small-scale flow experiments show a trend in which Am uptake is proportional to the amount of CMPO on the resins and the diluent plays a minor role in the uptake of Am from these solutions. Redox chemistry effects were also investigated. From these studies, it is possible to determine the best conditions for the removal of Am from HC1 media thus reducing the gross alpha content of the waste stream by a factor of 10-100 which reduces the number of barrels of waste produced at the Water Treatment Facility

  9. Concentration and vertical distribution of plutonium and americium in Italian mosses and lichens

    International Nuclear Information System (INIS)

    Jia, G.; Desideri, D.; Guerra, F.; Meli, M.A.; Testa, C.

    1997-01-01

    The plutonium and americium concentration and vertical distribution in some Italian mosses and lichens have been determined. The 239,240 Pu, 238 Pu and 241 Am concentration ranges in tree trunk lichens 0.83-1.87, 0.052-0.154 and 0.180-0.770 Bq/kg, respectively. The corresponding values in tree mosses are higher and more scattered ranging from 0.321 to 4.96, from 0.029 to 0.171 and from 0.200 to 1.93 Bq/kg. The mean 238 Pu/ 239,240 Pu and 241 Am/ 239,240 Pu ratios are 0.088±0.037 and 0.38 ± 0.13 in lichens and 0.091±0.072 and 0.54±0.16 in tree mosses. The Pu and Am concentrations are relatively low in terrestrial mosses. The 239,240 Pu, 238 Pu and 241 Am vertical distributions in a terrestrial moss core (Neckera Crispa) collected near Urbino (central Italy) show an exponential decrease with the height. On the contrary the 241 Am vertical distribution in another terrestrial moss core (Sphagnum Compactum) collected in the Alps (northern Italy) shows an interesting peak at 16 cm which corresponds to the deposition of fallout from the nuclear weapon tests in 1960's. The 241 Am movement upward and downward in the moss core is also studied. The results show once again that both mosses and lichens are very effective accumulators of Pu and Am and that they can be used as good biological indicators of the radionuclide airborne pollution from nuclear facilities and nuclear weapon tests. They can play a very important role in cycling naturally or artificially enhanced radionuclides in the atmosphere over long time scales. (author)

  10. Americium/Lanthanide Separations in Alkaline Solutions for Advanced Nuclear Fuel Cycles

    Energy Technology Data Exchange (ETDEWEB)

    Goff, George S. [Los Alamos National Laboratory; Long, Kristy Marie [Los Alamos National Laboratory; Reilly, Sean D. [Los Alamos National Laboratory; Jarvinen, Gordon D. [Los Alamos National Laboratory; Runde, Wolfgang H. [Los Alamos National Laboratory

    2012-06-11

    Project goals: Can used nuclear fuel be partitioned by dissolution in alkaline aqueous solution to give a solution of uranium, neptunium, plutonium, americium and curium and a filterable solid containing nearly all of the lanthanide fission products and certain other fission products? What is the chemistry of Am/Cm/Ln in oxidative carbonate solutions? Can higher oxidation states of Am be stabilized and exploited? Conclusions: Am(VI) is kinetically stable in 0.5-2.0 M carbonate solutions for hours. Aliquat 336 in toluene has been successfully shown to extract U(VI) and Pu(VI) from carbonate solutions. (Stepanov et al 2011). Higher carbonate concentration gives lower D, SF{sub U/Eu} for = 4 in 1 M K{sub 2}CO{sub 3}. Experiments with Am(VI) were unsuccessful due to reduction by the organics. Multiple sources of reducing organics...more optimization. Reduction experiments of Am(VI) in dodecane/octanol/Aliquat 336 show that after 5 minutes of contact, only 30-40% of the Am(VI) has been reduced. Long enough to perform an extraction. Shorter contact times, lower T, and lower Aliquat 336 concentration still did not result in any significant extraction of Am. Anion exchange experiments using a strong base anion exchanger show uptake of U(VI) with minimal uptake of Nd(III). Experiments with Am(VI) indicate Am sorption with a Kd of 9 (10 minute contact) but sorption mechanism is not yet understood. SF{sub U/Nd} for = 7 and SF{sub U/Eu} for = 19 after 24 hours in 1 M K{sub 2}CO{sub 3}.

  11. Determination of americium and curium using ion-exchange in the nitric-acid-methanol medium for environmental analysis

    International Nuclear Information System (INIS)

    Holm, E.; Fukai, R.

    1976-01-01

    While transplutonic elements are only slightly sorbed to anion exchangers from hydrochloric or nitric acid media, the presence of alcohol enhances the anionic exchange of these elements, especially in nitric and sulfuric solutions. In the present work a method has been developed for determining americium and curium in environmental samples, on the basis of the difference between the sorption characteristics to anion exchangers in the acid-methanol system of these transplutonic elements and those of plutonium, polonium and thorium. The method also permits us to perform sequential determination of plutonium, when necessary

  12. Temperature and concentration dependences of the electrical resistivity for alloys of plutonium with americium under normal conditions

    Science.gov (United States)

    Tsiovkin, Yu. Yu.; Povzner, A. A.; Tsiovkina, L. Yu.; Dremov, V. V.; Kabirova, L. R.; Dyachenko, A. A.; Bystrushkin, V. B.; Ryabukhina, M. V.; Lukoyanov, A. V.; Shorikov, A. O.

    2010-01-01

    The temperature and concentration dependences of the electrical resistivity for alloys of americium with plutonium are analyzed in terms of the multiband conductivity model for binary disordered substitution-type alloys. For the case of high temperatures ( T > ΘD, ΘD is the Debye temperature), a system of self-consistent equations of the coherent potential approximation has been derived for the scattering of conduction electrons by impurities and phonons without any constraints on the interaction intensity. The definitions of the shift and broadening operator for a single-electron level are used to show qualitatively and quantitatively that the pattern of the temperature dependence of the electrical resistivity for alloys is determined by the balance between the coherent and incoherent contributions to the electron-phonon scattering and that the interference conduction electron scattering mechanism can be the main cause of the negative temperature coefficient of resistivity observed in some alloys involving actinides. It is shown that the great values of the observed resistivity may be attributable to interband transitions of charge carriers and renormalization of their effective mass through strong s-d band hybridization. The concentration and temperature dependences of the resistivity for alloys of plutonium and americium calculated in terms of the derived conductivity model are compared with the available experimental data.

  13. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Taylor, D.M.

    1988-01-01

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  14. The photoluminescence of crystallophosphors on the base of NaBi(WO4)2 activated by americium, plutonium and neptunium

    International Nuclear Information System (INIS)

    Gliva, V.R.; Novikov, Yu.P.; Myasoedov, B.F.

    1989-01-01

    The luminescence properties of crystallophosphors based on NaBi(WO 4 ) 2 activated by americium, plutonium and neptunium were studied. The synthesis of crystallophosphors is described. Crystallophosphors luminesce in the near infrared region. The excitation and luminescence spectra of crystallophosphors are considered. The dependence of luminescence yield is linear in the wide interval of activator concentration. (author) 3 refs.; 4 figs

  15. 45 CFR 234.11 - Assistance in the form of money payments.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Assistance in the form of money payments. 234.11... FINANCIAL ASSISTANCE TO INDIVIDUALS § 234.11 Assistance in the form of money payments. (a) Federal financial participation is available in money payments made under a State plan under title I, IV-A, X, XIV, or XVI of the...

  16. 20 CFR 234.41 - Persons to whom an RLS is payable.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Persons to whom an RLS is payable. 234.41... LUMP-SUM PAYMENTS Residual Lump-Sum Payment § 234.41 Persons to whom an RLS is payable. After the death of an employee, the RLS is payable, in the following order, to: beneficiaries designated by the...

  17. 20 CFR 234.48 - Computation of the gross RLS amount.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Computation of the gross RLS amount. 234.48... LUMP-SUM PAYMENTS Residual Lump-Sum Payment § 234.48 Computation of the gross RLS amount. The amount of the gross RLS is equal to the percentages of the employee's creditable compensation shown in Table I...

  18. 49 CFR 234.9 - Grade crossing signal system failure reports.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Grade crossing signal system failure reports. 234... PLANS Reports and Plans § 234.9 Grade crossing signal system failure reports. Each railroad shall report... Form No. 6180-83, “Highway-Rail Grade Crossing Warning System Failure Report,” shall be used for this...

  19. 42 CFR 2.34 - Disclosures to prevent multiple enrollments in detoxification and maintenance treatment programs.

    Science.gov (United States)

    2010-10-01

    ... detoxification and maintenance treatment programs. 2.34 Section 2.34 Public Health PUBLIC HEALTH SERVICE... detoxification and maintenance treatment programs. (a) Definitions. For purposes of this section: Central... information about individuals applying for maintenance treatment or detoxification treatment for the purpose...

  20. Peculiar Behavior of (U,Am)O(2-δ) Compounds for High Americium Contents Evidenced by XRD, XAS, and Raman Spectroscopy.

    Science.gov (United States)

    Lebreton, Florent; Horlait, Denis; Caraballo, Richard; Martin, Philippe M; Scheinost, Andreas C; Rossberg, Andre; Jégou, Christophe; Delahaye, Thibaud

    2015-10-19

    In U(1-x)Am(x)O(2±δ) compounds with low americium content (x ≤ 20 atom %) and oxygen-to-metal (O/M) ratios close to 2.0, Am(III+) cations are charge-balanced by an equivalent amount of U(V+) cations while the fluorite structure of pure U(IV+)O2 is maintained. Up to now, it is unknown whether this observation also holds for higher americium contents. In this study, we combined X-ray diffraction with Raman and X-ray absorption spectroscopies to investigate a U(0.5)Am(0.5)O(2±δ) compound. Our results indicate that americium is again only present as Am(III+), while U(V+) remains below the amount required for charge balance. Unlike lower americium contents, this leads to an overall oxygen hypostoichiometry with an average O/M ratio of 1.92(2). The cationic sublattice is only slightly affected by the coexistence of large amounts of reduced (Am(III+)) and oxidized (U(V+)) cations, whereas significant deviations from the fluorite structure are evidenced by both extended X-ray absorption fine structure and Raman spectroscopies in the oxygen sublattice, with the observation of both vacancies and interstitials, the latter being apparently consistent with the insertion of U6O12 cuboctahedral-type clusters (as observed in the U4O9 or U3O7 phases). These results thus highlight the specificities of uranium-americium mixed oxides, which behave more like trivalent lanthanide-doped UO2 than U(1-x)Pu(x)O(2±δ) MOX fuels.

  1. Determining the americium transmutation rate and fission rate by post-irradiation examination within the scope of the ECRIX-H experiment

    Science.gov (United States)

    Lamontagne, J.; Pontillon, Y.; Esbelin, E.; Béjaoui, S.; Pasquet, B.; Bourdot, P.; Bonnerot, J. M.

    2013-09-01

    The ECRIX-H experiment aims to assess the feasibility of transmuting americium micro-dispersed in an inert magnesia matrix under a locally moderated neutron flux in the Phénix reactor. A first set of examinations demonstrated that pellet behaviour was satisfactory with moderate swelling at the end of the irradiation. Additional post-irradiation examinations needed to be conducted to confirm the high transmutation rate so as to definitively conclude on the success of the ECRIX-H experiment. This article presents and discusses the results of these new examinations. They confirm the satisfactory behaviour of the MgO matrix not only during the basic irradiation but also during post-irradiation thermal transients. These examinations also provide additional information on the behaviour of fission products both in the americium-based particles and in the MgO matrix. These results particularly validate the transmutation rate predicted by the calculation codes using several different analytical techniques. The fission rate is also determined. Moderate pellet swelling under irradiation (6.7 vol.%), while only 23% of the produced He and 4% of the fission gases were released from the fuel. No interaction between the pellets and the cladding. Formation of bubbles due to the precipitation of fission gases and He mainly in bubbles located inside the americium-based particles. These bubbles are the main cause of macroscopic swelling in the pellets. Well-crystallised structure of the MgO matrix which shows no amorphisation after irradiation despite the presence of fission products. The absence of any reaction of MgO with the americium-based phase, Formation of a PuO2-type crystalline phase from AmO1.62 particles following the Am transmutation process. A shielded electron probe micro-analyser (EPMA) 'CAMECA' Camebax equipped to collect and exploit the measurements using the 'SAMx' system. A Philips XL30 scanning electron microscope (SEM). Field acquisitions were performed thanks to

  2. Chemical behaviour of trivalent and pentavalent americium in saline NaCl-solutions. Studies of transferability of laboratory data to natural conditions. Interim report. Reported period: 1.2.1993-31.12.1993; Chemisches Verhalten von drei- und fuenfwertigem Americium in Salinen NaCl-Loesungen. Untersuchung der Uebertragbarkeit von Labordaten auf natuerliche Verhaeltnisse. Zwischenbericht. Berichtszeitraum 1.2.1993-31.12.1993

    Energy Technology Data Exchange (ETDEWEB)

    Runde, W.; Kim, J.I.

    1994-09-15

    In order to clarify the chemical behaviour of Americium in saline aqueous systems relevant for final storage this study deals with the chemical reactions of trivalent and pentavalent Americium in NaCl-solutions under the influence of radiolysis from its own alpha radiation. The focus of the study was on investigating the geologically relevant reactions, such as hydrolysis or carbonate- and chloride complexing in solid-liquid equilibriums. Comprehensive measurements on solubility and spectroscopic studies in NaCl-solutions were carried out in a CO{sub 2}-free atmosphere and 10{sup -2} atm CO{sub 2} partial pressure. Identification and characterisation of the AM (III) and AM(V) solid phases were supplemented by structural research with the chemically analogue EU (III) and Np(V) compounds. The alpha-radiation induced radiolysis in saline NaCl solutions and the redox behaviour of Americium which was influenced thereby were spectroscopically quantified. (orig.) [Deutsch] Zur Klaerung des chemischen Verhaltens von Americium in endlagerrelevanten salinen aquatischen Systemen befasst sich die vorliegende Arbeit mit den chemischen Reaktionen des drei- und fuenfwertigen Americiums in NaCl-Loesungen unter dem Einfluss der Radiolyse durch die eigene {alpha}-Strahlung. Der Schwerpunkt dieser Arbeit lag auf der Untersuchung der geologisch relevanten Reaktionen, wie Hydrolyse sowie Carbonat- und Chloridkomplexierung in fest-fluessig Gleichgewichtssystemen. Hierzu wurden umfassende Loeslichkeitsmessungen und spektroskopische Untersuchungen in NaCl-Loesungen, sowohl unter CO{sub 2}-freier Atmosphaere als auch unter 10{sup -2} atm CO{sub 2}-Partialdruck, durchgefuehrt. Die Identifizierung und Charakterisierung der Am(III)- und Am(V)-Festphasen wurde ergaenzt durch strukturelle Untersuchungen mit den chemisch analogen Eu(III)- und Np(V)-Verbindungen. Die von der {alpha}-Strahlung induzierte Radiolyse in salinen NaCl-Loesungen und das dadurch beeinflusste Redoxverhalten von Americium

  3. Sequential separation method for the determination of Plutonium and Americium in fecal samples

    International Nuclear Information System (INIS)

    Raveendran, Nanda; Rao, D.D.; Yadav, J.R.; Baburajan, A.

    2014-01-01

    The estimation of internal contamination due to Plutonium and Americium of radiation workers of Advanced Fuel Fabrication Facility (AFFF) at Tarapur was carried out by the bioassay (Fecal sample) of the workers. Conventionally the separation of 'Pu' and 'Am' was carried out by alkali fusion followed by the anion exchange separation for Pu and cation exchange separation for Am. This paper deals with an alternative method in which initially the entire ash of the sample added with 236 Pu tracer (3-11 mBq) and 243 Am tracer (2.8-14.5 mBq) was acid leached and Pu was separated by anion exchange as per standard analytical procedure and Am by using TRU resin. In this work the extraction chromatography method using TRU resin procured from Eichrom,U.K. which contains N-N-di isobutyl carbanoyl methyl phosphine oxide (CMPO) as extractant, tri-n-butyl phosphate (TBP) as diluent absorbed on inert polymeric support has been used for the separation of Am from fecal sample. The 8N HNO 3 effluent from Pu separation step was dried and the residue was dissolved in 10 ml 1M Al(NO 3 ) 3 in 3M HNO 3 and pinch of Ascorbic acid was added and loaded on a TRU resin column (dia ∼ 4 mm and height 60 mm) preconditioned with 30 ml 1M Al(NO 3 ) 3 in 3 MHNO 3 . The column was washed with 5 ml 3M HNO 3 and 5 ml 2M HNO 3 . The nitrate concentration was lowered using addition of 10 ml 0.05 M HNO 3 . Am was eluted with 3 ml 9M HCl and 20 ml 2M HCl. The elute was dried and electrodeposited on a SS planchet in NH 4 (SO 4 ) 2 solution at pH 2.2 for two hours. Pu and Am activity estimated by counting in passivated ion implanted planner Silicon detector (PIPS) coupled to 8K channel alpha spectrometer. The sample was counted for duration of 3-4 lacs of seconds. In this study the numbers of samples analyzed are 25. The paper gives detail of analytical recoveries of Pu tracer varies from 55-90 % with a mean of 70% and std. deviation 9.9%. The Am tracer recovery was in the range of 20-89.3% with a mean of

  4. Crystallographic and Spectroscopic Characterization of Americium Complexes Containing the Bis[(phosphino)methyl]pyridine-1-oxide (NOPOPO) Ligand Platform

    Energy Technology Data Exchange (ETDEWEB)

    Corbey, Jordan F. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Rapko, Brian M. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Wang, Zheming [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; McNamara, Bruce K. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Surbella, Robert G. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Pellegrini, Kristi L. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States; Schwantes, Jon M. [Pacific Northwest National Laboratory, Richland, Washington 99354, United States

    2018-02-06

    Abstract The crystal structures of americium species containing a common multi-functional phosphine oxide ligand, reported for its ability to extract f elements from acidic solutions, namely 2,6-[Ph2P(O)CH2]2C5H3-NO, L, have finally been determined after over three decades of separations studies involving these species and their surrogates. The molecular compounds Am(L)(NO3)3, Am 1:1, and [Am(L)2(NO3)][NO3]2, Am 2:1, along with their neodymium and europium analogs were synthesized and characterized using single-crystal X-ray crystallography, attenuated total reflectance Fourier transform infrared (ATR) spectroscopy and luminescence spectroscopy to provide a comprehensive comparison with new and known analogous complexes.

  5. Moessbauer spectroscopy of 237Np created by α-decay of 241Am in some compounds of americium

    International Nuclear Information System (INIS)

    Rebizant, Jean.

    1977-01-01

    The Moessbauer emission spectra of 237 Np impurities fed by α decay of 241 Am were measured in the following compounds: Am metal, AmPtsub(x) (x=1, 3, 5), AmAs, AmBi, Am 2 O 3 , AmO 2 , Lisub(x)AmOsub(x+1) (x=1, 2, 3, 4) and Li 6 AmO 6 . The studies concerned the consequences of the recoil and ionization effects, associated with the α-decay of 241 Am in the solid phase; these are analysed in situ and on a time scale of about 100 ns after the α emission; the dependence of these effects on the physico-chemical nature of the host and on the temperature; information about the electronic, magnetic and structural properties and, also, about the vibrational properties of the Np impurity in the investigated solid matrice as far as the previous effects do not hamper such conclusions. The existence itself of the Moessbauer effect shows that the Np ions are stabilized in well-defined lattice locations at the time of emission of the 59.5keV γ quanta (approximately 100ns), once this level is reached after the 241 Am decay. In Am metal and AmPtsub(x) alloys, the observation of a single charge state for neptunium indicates that the electronic effects associated with the α-decay are recovered in less than 100ns. In the americium oxide compounds and the monopnictides AmAs and AmBi, several charge states of neptunium recoil ions are observed; this shows unambiguously the importance of the ionization effects caused by the α-decay. Some informations about magnetic and electronic properties of the americium host matrices were obtained. The vibration modes of 237 Np impurities in the lattice of Am metal are described by means of the Debye model with a characteristic temperature thetasub(D)=115K [fr

  6. Separation of americium by liquid-liquid extraction using diglycol-amides water-soluble complexing agents

    Energy Technology Data Exchange (ETDEWEB)

    Chapron, S.; Marie, C.; Pacary, V.; Duchesne, M.T.; Miguirditchian, M. [CEA, Centre de Marcoule, Nuclear Energy Division, RadioChemistry and Processses Departement, 30207 Bagnols-sur-Ceze (France); Arrachart, G.; Pellet-Rostaing, S. [Institut de Chimie Separative de Marcoule, LTSM, Bat 426, F-30207 Bagnols-sur- Ceze (France)

    2016-07-01

    Recycling americium (Am) alone from spent nuclear fuels is an important option studied for the future nuclear cycle (Generation IV systems) since Am belongs to the main contributors of the long-term radiotoxicity and heat power of final waste. Since 2008, a liquid-liquid extraction process called EXAm has been developed by the CEA to allow the recovery of Am alone from a PUREX raffinate (a dissolution solution already cleared from U, Np and Pu). A mixture of DMDOHEMA (N,N'-dimethyl-N,N'-dioctyl-2-(2-(hexyloxy)ethyl)-malonamide) and HDEHP (di-2-ethylhexylphosphoric acid) in TPH is used as the solvent and the Am/Cm selectivity is improved using TEDGA (N,N,N',N'-tetraethyl-diglycolamide) as a selective complexing agent to maintain Cm and heavier lanthanides in the acidic aqueous phase (5 M HNO{sub 3}). Americium is then stripped selectively from light lanthanides at low acidity (pH=3) with a poly-aminocarboxylic acid. The feasibility of sole Am recovery was already demonstrated during hot tests in ATALANTE facility and the EXAm process was adapted to a concentrated raffinate to optimize the process compactness. The speciation of TEDGA complexes formed in the aqueous phase with Am, Cm and lanthanides was studied to better understand and model the behavior of TEDGA in the process. Some Ln-TEDGA species are extracted into the organic phase and this specific chemistry might play a role in the Am/Cm selectivity improvement. Hence the hydrophilicity-lipophilicity balance of the complexing agent is an important parameter. In this comprehensive study, new analogues of TEDGA were synthesized and tested in the EXAm process conditions to understand the relationship between their structure and selectivity. New derivatives of TEDGA with different N-alkyl chain lengths and ramifications were synthesized. The impact of lipophilicity on ligand partitioning and Am/Cm selectivity was investigated. (authors)

  7. Effectiveness of intragastric administration of 8102 for removal of thorium-234 in rats

    International Nuclear Information System (INIS)

    Luo Meichu; Li Landi; Sun Meizhen; Ye Qian; Liu Yi

    1992-01-01

    8102, a 1,2-dihydroxy-3,6-bismethylamino diacetic derivative, is a new chelating agent for decorporation of radionuclides. The effectiveness of intragastric administration of this drug at different doses (50-1000 mg/kg of body) and at different times before or after giving thorium-234 in rats was reported. The results show that for rats given intragastricly 1000 mg/kg of 8102, the excretion of thorium-234 in urine for first two days is 4.5 times more than that for control rats and accumulations of thorium-234 in liver, skeleton and kidney for these rats were 30%, 62% and 68% as those for control rats, respectively. The effectiveness was reduced with decrease in dosage of 8102. Administration of 8102 at 1 or 2 h before injection of thorium-234 can improve the effectiveness for decorporation of thorium-234: accumulation of thorium-234 in liver was markedly less than that for rats given 8102 immediately after injection of thorium-234. Delayed administration of 9102 resulted in reduction of the effectiveness. The practicality of oral administration of 8102 in clinic for decorporation of radionuclides was discussed

  8. Seawater 234U/238U recorded by modern and fossil corals

    Science.gov (United States)

    Chutcharavan, Peter M.; Dutton, Andrea; Ellwood, Michael J.

    2018-03-01

    U-series dating of corals is a crucial tool for generating absolute chronologies of Late Quaternary sea-level change and calibrating the radiocarbon timescale. Unfortunately, coralline aragonite is susceptible to post-depositional alteration of its primary geochemistry. One screening technique used to identify unaltered corals relies on the back-calculation of initial 234U/238U activity (δ234Ui) at the time of coral growth and implicitly assumes that seawater δ234U has remained constant during the Late Quaternary. Here, we test this assumption using the most comprehensive compilation to date of coral U-series measurements. Unlike previous compilations, this study normalizes U-series measurements to the same decay constants and corrects for offsets in interlaboratory calibrations, thus reducing systematic biases between reported δ234U values. Using this approach, we reassess (a) the value of modern seawater δ234U, and (b) the evolution of seawater δ234U over the last deglaciation. Modern coral δ234U values (145.0 ± 1.5‰) agree with previous measurements of seawater and modern corals only once the data have been normalized. Additionally, fossil corals in the surface ocean display δ234Ui values that are ∼5-7‰ lower during the last glacial maximum regardless of site, taxon, or diagenetic setting. We conclude that physical weathering of U-bearing minerals exposed during ice sheet retreat drives the increase in δ234U observed in the oceans, a mechanism that is consistent with the interpretation of the seawater Pb-isotope signal over the same timescale.

  9. Solubility of neptunium-234 in an artificial rumen and simulated bovine gastrointestinal fluids

    International Nuclear Information System (INIS)

    Barth, J.

    1977-01-01

    The alimentary solubility and behavior of neptunium-234 were studied in an artificial rumen and simulated bovine gastrointestinal fluids. Rumen juice was augmented with citrate-buffered neptunium-234 solution and allowed to incubate for 24 hours. This juice was successively converted, by the addition of bile and enzymes and adjustment of the pH, to simulate the digestive stages of the abomasum, duodenum, jejunum, and lower small intestine. Fluid samples were collected from each of these digestive stages and analyzed for soluble neptunium-234 by gamma spectrometry

  10. High accuracy 234U(n,f cross section in the resonance energy region

    Directory of Open Access Journals (Sweden)

    Leal-Cidoncha E.

    2017-01-01

    Full Text Available New results are presented of the 234U neutron-induced fission cross section, obtained with high accuracy in the resonance region by means of two methods using the 235U(n,f as reference. The recent evaluation of the 235U(n,f obtained with SAMMY by L. C. Leal et al. (these Proceedings, based on previous n_TOF data [1], has been used to calculate the 234U(n,f cross section through the 234U/235U ratio, being here compared with the results obtained by using the n_TOF neutron flux.

  11. Residual β activity of particulate 234Th as a novel proxy for tracking sediment resuspension in the ocean

    Science.gov (United States)

    Lin, Wuhui; Chen, Liqi; Zeng, Shi; Li, Tao; Wang, Yinghui; Yu, Kefu

    2016-06-01

    Sediment resuspension occurs in the global ocean, which greatly affects material exchange between the sediment and the overlying seawater. The behaviours of carbon, nutrients, heavy metals, and other pollutants at the sediment-seawater boundary will further link to climate change, eutrophication, and marine pollution. Residual β activity of particulate 234Th (RAP234) is used as a novel proxy to track sediment resuspension in different marine environments, including the western Arctic Ocean, the South China Sea, and the Southern Ocean. Sediment resuspension identified by high activity of RAP234 is supported by different lines of evidence including seawater turbidity, residence time of total 234Th, Goldschmidt’s classification, and ratio of RAP234 to particulate organic carbon. A conceptual model is proposed to elucidate the mechanism for RAP234 with dominant contributions from 234Th-238U and 212Bi-228Th. The ‘slope assumption’ for RAP234 indicated increasing intensity of sediment resuspension from spring to autumn under the influence of the East Asian monsoon system. RAP234 can shed new light on 234Th-based particle dynamics and should benefit the interpretation of historical 234Th-238U database. RAP234 resembles lithophile elements and has broad implications for investigating particle dynamics in the estuary-shelf-slope-ocean continuum and linkage of the atmosphere-ocean-sediment system.

  12. Disk mini-adsorbers with radial flow for determination of 234Th concentration in seawater

    International Nuclear Information System (INIS)

    Gulin, S.B.; Gorelov, Yu.S.; Sidorov, I.G.; Proskurnin, V.Yu.

    2013-01-01

    A modified method has been developed for measuring the 234 Th concentration in seawater, which is based upon the use of MnO 2 -impregnated disk mini adsorbers with radial flow connected in-line and the direct beta counting of 234 Th and/or its daughter 234m Pa. This allows determining the 234 Th concentration in a relatively small volume of seawater (20-50 L) with the possibility to check the extraction efficiency in every individual sample. The field testing, which was carried out at different areas of Sevastopol Bay during different seasons, has shown applicability of the proposed method to evaluate particle fluxes in marine environments within a wide range of concentrations of suspended matter. (author)

  13. 234Th distributions in coastal and open ocean waters by non-destructive β-counting

    International Nuclear Information System (INIS)

    Miller, L.A.; Svaeren, I.

    2003-01-01

    Non-destructive β-counting analyses of particulate and dissolved 234 Th activities in seawater are simpler but no less precise than traditional radioanalytical methods. The inherent accuracy limitations of the non-destructive β-counting method, particularly in samples likely to be contaminated with anthropogenic nuclides, are alleviated by recounting the samples over several half-lives and fitting the counting data to the 234 Th decay curve. Precision (including accuracy, estimated at an average of 3%) is better than 10% for particulate or 5% for dissolved samples. Thorium-234 distributions in the Skagerrak indicated a vigorous, presumably biological, particle export from the surface waters, and while bottom sediment resuspension was not an effective export mechanism, it did strip thorium from the dissolved phase. In the Greenland and Norwegian Seas, we saw clear evidence of particulate export from the surface waters, but at 75 m, total 234 Th activities were generally in equilibrium with 238 U. (author)

  14. Inspection report of unauthorized possession and use of unsealed americium-241 and subsequent confiscation, J.C. Haynes Company, Newark, Ohio

    International Nuclear Information System (INIS)

    1985-11-01

    This US Nuclear Regulatory Commission report documents the circumstances surrounding the March 26, 1985, confiscation and subsequent decontamination activities related to the use of unauthorized quantities of americium-241 at the John C. Haynes Company (licensee) of Newark, Ohio. It focuses on the period from early February to July 26, 1985. The incident started when NRC Region III recieved information that John C. Haynes possessed unauthorized quantities of americium-241 and was conducting unauthorized activities (diamond irradiation). By July 26, 1985, the decontamination activities at the licensee's laboratory were concluded. The licensee's actions with diamond irradiation resulted in contamination in restricted and unrestricted areas of the facility. The confiscation and decontamination activities required the combined efforts of NRC, Federal Bureau of Investigation, US Department of Energy, Oak Ridge Associated Universities, the State of Ohio, and the US Environmental Protection Agency. The report describes the factual information and significant findings associated with the confiscation and decontamination activities

  15. Experimental study of Americium-241 biokinetics in Homarus Gammarus lobster. Analysis of the accumulation and detoxication mechanisms at the sub-cellular level

    International Nuclear Information System (INIS)

    Paquet, F.

    1991-12-01

    The Americium 241 radioelement accumulation and elimination rate and mechanisms in the lobster organism have been experimentally studied; incorporation and detoxification capacities of each organ are evaluated. The existence of various biological compartments is shown; the major role of the digestive gland in accumulation of the radioelement, its distribution towards the various organs, and its resorption is comprehensively described, with an analysis at the subcellular and molecular levels. 401 p., 65 fig., 43 tab., 428 ref

  16. An experimental study of americium-241 biokinetics in the Lobster Homarus Gammarus. Analysis of the accumulation/storage and detoxification processes at the subcellular level

    International Nuclear Information System (INIS)

    Paquet, F.

    1993-01-01

    An experimental study of americium-241 kinetics has been conducted in the lobster Homarus gammmarus. The investigations were conducted at all the levels from the whole body to the subcellular and molecular levels. The animals were contaminated by a single or chronic ingestion of 241 Am labelled mussels. Assessments of accumulation, elimination and distribution of the radionuclide were established on organisms kept in the laboratory; they made it possible to demonstrate the importance of the digestive gland in the radionuclide transfer pathways. The preliminary results led to structural then ultrastructural investigations of the digestive gland in association with radioautographic studies and cellular extractions methods. Four cellular types were demonstrated, only two of them being implied in the radionuclide retention, the former being responsible for americium intake and the latter for its long-term retention. By means of biochemical techniques, subcellular accumulation was studied and the organelles implied in the nuclide retention were specified. Finally, a method of cellular nuclei dissociation was developed; it made it possible to analyse the molecular nature of americium ligands and to demonstrate the function of the protein nuclear matrix in the nuclide retention

  17. Preliminary results from uranium/americium affinity studies under experimental conditions for cesium removal from NPP ''Kozloduy'' simulated wastes solutions

    International Nuclear Information System (INIS)

    Nikiforova, A.; Kinova, L.; Peneva, C.; Taskaeva, I.; Petrova, P.

    2005-01-01

    We use the approach described by Westinghouse Savannah River Company using ammonium molybdophosphate (AMP) to remove elevated concentrations of radioactive cesium to facilitate handling waste samples from NPP K ozloduy . Preliminary series of tests were carried out to determine the exact conditions for sufficient cesium removal from five simulated waste solutions with concentrations of compounds, whose complexing power complicates any subsequent processing. Simulated wastes solutions contain high concentrations of nitrates, borates, H 2 C 2 O 4 , ethylenediaminetetraacetate (EDTA) and Citric acid, according to the composition of the real waste from the NPP. On this basis a laboratory treatment protocol was created. This experiment is a preparation for the analysis of real waste samples. In this sense the results are preliminary. Unwanted removal of non-cesium radioactive species from simulated waste solutions was studied with gamma spectrometry with the aim to find a compromise between on the one hand the AMP effectiveness and on the other hand unwanted affinity to AMP of Uranium and Americium. Success for the treatment protocol is defined by proving minimal uptake of U and Am, while at the same time demonstrating good removal effectiveness through the use of AMP. Uptake of U and Am were determined as influenced by oxidizing agents at nitric acid concentrations, proposed by Savannah River National laboratory. It was found that AMP does not significantly remove U and Am when concentration of oxidizing agents is more than 0.1M for simulated waste solutions and for contact times inherent in laboratory treatment protocol. Uranium and Americium affinity under experimental conditions for cesium removal were evaluated from gamma spectrometric data. Results are given for the model experiment and an approach for the real waste analysis is chosen. Under our experimental conditions simulated wastes solutions showed minimal affinity to AMP when U and Am are most probably in

  18. Analytical utility of the M series x-ray emission lines applied to uranium, neptunium, plutonium, and americium

    International Nuclear Information System (INIS)

    Miller, A.G.

    1976-01-01

    Secondary emission x-ray analysis for actinide elements has usually meant utilizing the L series x-ray lines. The major disadvantage of these x-ray lines is that they fall in the region of high level Bremsstrahlung radiation, producing a high background and, subsequently, larger error and high detection limits. The utilization of the M series x-ray lines of actinide elements with wavelength dispersive x-ray spectrometers greatly minimizes these problems. Calibration curves for uranium, neptunium, plutonium, and americium were prepared by the ''coprex'' method, and the analytical characteristics of the L and M series compared. The Mα and β x-ray lines, under optimum conditions, are several times more sensitive than their L series counterparts. With the greater sensitivity in addition to the lower background, peak to background ratios for M lines up to 40 times greater than those for L lines were obtained. Detection limits can be lowered from about 0.7 μg using the Lα 1 line to 0.05 μg when M x-ray lines are used. The relative advantages and disadvantages of utilizing the L and M series x-ray lines for secondary emission x-ray analysis are discussed

  19. Use of radioanalytical methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in radioactive wastes

    International Nuclear Information System (INIS)

    Geraldo, Bianca

    2012-01-01

    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)

  20. Vertical transport of particulate-associated plutonium and americium in the upper water column of the Northeast Pacific

    International Nuclear Information System (INIS)

    Fowler, S.W.; Ballestra, S.; La Rosa, J.; Fukai, R.

    1983-01-01

    Concentrations of plutonium (Pu) and americium (Am) were determined in seawater, suspended particulate matter, sediment trap samples, and biogenic material collected at the VERTEX I site in the North Pacific off central California. From a vertical profile taken over the upper 1500 m, the presence of sub-surface maxima of sup(239+240)Pu and 241 Am were identified between 100 to 750 m and 250 to 750 m, respectively. A large fraction (32%) of the filterable sup(239+240)Pu in surface waters was associated with cells during a phytoplankton bloom; Pu:Am activity ratios in surface water and the suspended particles indicated that Pu was concentrated by the cells to a greater degree than Am. However, similar measurements beneath the surface layer showed an overall enrichment of Am over Pu on fine suspended particles with depth. Freshly produced zooplankton fecal pellets and large, fast sinking particles collected in PITS contained relatively high concentrations of Pu and Am. Both transuranic concentrations in trapped particles and transuranic flux tended to increase with depth down to 750 m, suggesting that their scavenging is in the upper water column. Am appeared to be scavenged by sinking biogenic particles to a greater extent than Pu. The results are discussed. (author)

  1. Intake of 210Po, 234U and 238U radionuclides with beer in Poland

    International Nuclear Information System (INIS)

    Skwarzec, B.; Struminska, D.I.; Borylo, A.; Falandysz, J.

    2004-01-01

    238 U, 234 U and 210 Po activity concentrations were determined in beer in Poland by alpha-spectrometry with low-level activity silicon detectors. The results revealed that the mean concentrations of 238 U, 234 U and 210 Po in the analyzed beer samples were 4.63, 4.11 and 4.94 mBq x dm -3 , respectively, the highest in Tyskie (5.71 for 210 Po, 5.06 for 234 U and 6.11 for 238 U) and the lowest in Lech (2.49 for 210 Po). The effective radiation dose due to uranium and polonium ingestions by beer was calculated and were compared to the effective radiation dose from drinking water. (author)

  2. Disequilibrium of dissolved 234U/238U and 210Po/210Pb in Greek rivers

    International Nuclear Information System (INIS)

    For the first time, a radiological study for the dissolved 238 U, 234 U, 210 Pb and 210 Po was held in major Greek rivers across the country. 234 U/ 238 U activity ratios are above one in all samples and 210 Po/ 210 Pb activity ratios are respectively below the unit indicating the disequilibrium in the samples. Quite satisfactory correlations were observed among 234 U and 238 U as well as among 210 Po and 210 Pb values. Uranium isotopes were separated by ion exchange and electroplated on stainless steel plates. 210 Po was spontaneously deposited on nickel plates, while 210 Pb was indirectly determined through the ingrowth of 210 Po. The sources were measured by a-spectrometry. (author)

  3. Neutron measurements of 234U isotopic abundance in UF6 samples

    International Nuclear Information System (INIS)

    Stieff, L.R.; Walton, R.B.; Reilly, T.D.; Fields, L.W.; Walker, R.L.; Mullins, W.T.; Thoms, J.I.

    1975-01-01

    Neutrons produced from the (α,n) reaction on fluorine were used to measure the 234 U isotopic abundance in UF 6 samples. A 4PI detector consisting of 14 3 He counters embedded in a polyethylene anulus was specifically designed to receive standard 1S (high-enriched) and 2S (low-enriched) UF 6 sample cylinders. The 235 U isotopic abundances of the 19 2S and 5 1S samples studied range from 0.30 to 4.0 percent (wt) and 80.0 to 97.7 percent (wt) respectively. A typical net weight for the UF 6 in the 1S cylinders is 800 g and in 2S cylinders is 1700 g. For counting times of 10 3 sec and for 234 U concentrations over a range of 0.001 to 1.0 percent (wt), the neutron method will achieve accuracies better than 2.5 percent (1 sigma) for the depleted and low-enriched UF 6 and approximately 0.5 percent (1 sigma) for the high-enriched UF 6 when compared with the 234 U isotopic abundances obtained using a high precision, two-stage mass spectrometer. Extension of the 234 U neutron assay method to samples containing 232 U is now being investigated. From these preliminary results it appears that the isotope separation plant operator and the safeguards inspector should be able to use this new nondestructive assay technique for precision measurements of the isotopic abundance of 234 U. In addition, the method could be useful as an indirect field method for 235 U assay where gamma techniques give inconclusive results and where the 235 U/ 234 U ratio can be assumed or has been previously established either by measurement or calculation. (U.S.)

  4. Activity disequilibrium between 234U and 238U isotopes in natural environment

    International Nuclear Information System (INIS)

    Alicja Borylo; Bogdan Skwarzec

    2014-01-01

    The aim of this work was to calculate the values of the 234 U/ 238 U activity ratio in natural environment (water, sediments, Baltic organisms and marine birds from various regions of the southern Baltic Sea; river waters (the Vistula and the Oder River); plants and soils collected near phosphogypsum waste heap in Wislinka (Northern Poland) and deer-like animals from Northern Poland. On the basis of the studies it was found that the most important processes of uranium geochemical migration in the southern Baltic Sea ecosystem are the sedimentation of suspended material and the vertical diffusion from the sediments into the bottom water. Considerable values of the 234 U/ 238 U are characterized for the Vistula and Oder Rivers and its tributaries. The values of the 234 U/ 238 U activity ratio in different tissues and organs of the Baltic organisms, sea birds and wild deer are varied. Such a large variation value of obtained activity ratios indicates different behavior of uranium isotopes in the tissues and organisms of sea birds and wild animals. This value shows that uranium isotopes can be disposed at a slower or faster rate. The values of the 234 U/ 238 U activity ratio in the analyzed plants, soils and mosses collected in the vicinity of phosphogypsum dumps in Wislinka are close to one and indicate the phosphogypsum origin of the analyzed nuclides. Uranium isotopes 234 U and 238 U are not present in radioactive equilibrium in the aquatic environment, which indicates that their activities are not equal. The inverse relationship is observed in the terrestrial environment, where the value of the of the 234 U/ 238 U activity ratio really oscillates around unity. (author)

  5. Uranium Age Determination by Measuring the 230Th / 234U Ratio

    International Nuclear Information System (INIS)

    LAMONT, STEPHEN P.

    2004-01-01

    A radiochemical isotope dilution mass spectrometry method has been developed to determine the age of uranium materials. The amount of 230Th activity, the first progeny of 234U, that had grown into a small uranium metal sample was used to determine the elapsed time since the material was last radiochemically purified. To preserve the sample, only a small amount of oxidized uranium was removed from the surface of the sample and dissolved. Aliquots of the dissolved sample were spiked with 233U tracer and radiochemically purified by anion-exchange chromatography. The 234U isotopic concentration was then determined by thermal ionization mass spectrometry. Additional aliquots of the sample were spiked with 229Th tracer, and the thorium was purified using two sequential anion-exchange chromatography separations. The isotopic concentrations of 230Th and 232Th were determined by TIMS. The lack of any 232Th confirmed the assumption that all thorium was removed from the uranium sample at the time of purification. The 230Th and 234U mass concentrations were converted to activities and the 230Th/234U ratio for the sample was calculated. The experimental 230Th/234U ratio showed the uranium in this sample was radiochemically purified in about 1945. Isotope dilution thermal ionization mass spectrometry has sufficient sensitivity to determine the age of 100 samples of uranium. This method could certainly be employed as a nuclear forensic method to determine the age of small quantities of uranium metal or salts. Accurate determination of the ultra-trace 230Th radiochemically separated from the uranium is possible due to the use of 229Th as an isotope dilution tracer. The precision in the experimental age of the uranium could be improved by making additional replicate measurements of the 230Th/234U isotopic ratio or using a larger initial sample

  6. Influence of {sup 231}Th in the activity determination of {sup 234}Th by Cerenkov counting

    Energy Technology Data Exchange (ETDEWEB)

    Blasiyh Nuno, G.A. [Programa Nacional de Gestion de Residuos Radiactivos, Comision Nacional de Energia Atomica, Centro Atomico Ezeiza, Presbitero Juan Gonzalez, y Aragon No. 15, B1802AYA, Partido de Ezeiza, Provincia de Buenos Aires (Argentina)]. E-mail: blasiyh@cae.cnea.gov.ar; Korob, R.O. [Unidad de Actividad Radioquimica y Quimica de las Radiaciones, Comision Nacional de Energia Atomica, Centro Atomico Ezeiza, Presbitero Juan Gonzalez, y Aragon No. 15, B1802AYA, Partido de Ezeiza, Provincia de Buenos Aires (Argentina)

    2007-05-15

    A precise and simple method for the determination of {sup 234}Th activity by Cerenkov counting is described. A calibrated natural uranium solution (having {sup 234m}Pa and {sup 238}U in secular equilibrium) in 0.1 M HNO{sub 3} is used to construct the calibration curve. Because {sup 231}Th (a {beta}-emitting nuclide present in the decay chain of {sup 235}U) contribution to Cerenkov counting is experimentally proved to be negligible only in the case of low enriched uranium samples, simple calculations are needed to accomplish the activity determination.

  7. Double spike methodology for uranium determination by thermal ionisation mass spectrometry: separation and purification of 234U

    International Nuclear Information System (INIS)

    Shah, P.M.; Saxena, M.K.; Sanjai Kumar; Aggarwal, S.K.; Jain, H.C.

    1995-01-01

    With an objective to prepare double spike of 233 U+ 234 U for determination of uranium concentration by Isotopic Dilution Thermal Ionisation Mass Spectrometry (ID-TIMS), 234 U was separated and purified from aged 238 Pu sample (15 years old) using several ion exchange and solvent extraction procedures. Final product containing 95% and 5% alpha activities of 234 and 238 Pu, respectively, which translates into 99.998 atom% of 234 U and 0.002 atom% of 238 Pu was found suitable for double spike. (author). 1 ref

  8. Molten salt extraction (MSE) of americium from plutonium metal in CaCl2-KCl-PuCl3 and CaCl2-PuCl3 salt systems

    International Nuclear Information System (INIS)

    Dodson, K.E.

    1992-01-01

    Molten salt extraction (MSE) of americium-241 from reactor-grade plutonium has been developed using plutonium trichloride salt in stationary furnaces. Batch runs with oxidized and oxide-free metal have been conducted at temperature ranges between 750 and 945C, and plutonium trichloride concentrations from one to one hundred mole percent. Salt-to-metal ratios of 0.10, 0.15, and 0 30 were examined. The solvent salt was either eutectic 74 mole percent CaCl 2 endash 26 mole percent KCl or pure CaCl 2 . Evidence of trivalent product americium, and effects of temperature, salt-to-metal ratio, and oxide contamination on the americium extraction efficiency are given. 24 refs, 20 figs, 13 tabs

  9. Observations on the redistribution of plutonium and americium in the Irish Sea sediments, 1978 to 1996: concentrations and inventories

    International Nuclear Information System (INIS)

    Kershaw, P.J.; Denoon, D.C.; Woodhead, D.S.

    1999-01-01

    The distribution of plutonium and americium in the sub-tidal sediments of the Irish Sea is described following major surveys in 1978, 1983, 1988 and 1995. Concentrations in surface sediments have declined near the source at Sellafield since 1988. Time-series of inter-tidal surface sediment concentrations are presented from 1977 onwards, revealing the importance of sediment reworking and transport in controlling the evolution of the environmental signal. The surface and near-surface sediments, in the eastern Irish Sea 'mud-patch', are generally well mixed with respect to Pu (α) and 241 Am distributions but show increasing variability with depth - up to 4 orders of magnitude in concentration. The inventories of 239,240 Pu and 241 Am in the sub-tidal sediments have been estimated and compared with the reported decay-corrected discharges. These amounted to 360 and 545 TBq respectively, in 1995, about 60% of the total decay-corrected discharge. Part of the unaccounted fraction may be due to unrepresentative sampling of the seabed. It is speculated that some tens of TBq of plutonium and 241 Am reside undetected in the large volumes of coarse-grained, sub-tidal and inter-tidal sediment which characterise much of the Irish Sea. This has been due to the inability of the available corers to penetrate to the base of contamination in these mobile sediments. Further observations are needed to verify and quantify the missing amount. A budget of plutonium-α and 241 Am has been estimated based on published observations in the three main compartments: water column, sub-tidal and inter-tidal sediments. This amounts to 460-540 TBq and 575-586 TBq respectively, or 64-75% and 60-61%, of the decay-corrected reported discharge. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  10. Picomolar traces of americium(III) introduce drastic changes in the structural chemistry of terbium(III). A break in the ''gadolinium break''

    Energy Technology Data Exchange (ETDEWEB)

    Welch, Jan M. [TU Wien, Atominstitut, Vienna (Austria); Mueller, Danny; Knoll, Christian; Wilkovitsch, Martin; Weinberger, Peter [TU Wien, Institute of Applied Synthetic Chemistry, Vienna (Austria); Giester, Gerald [University of Vienna, Institute of Mineralogy and Crystallography, Vienna (Austria); Ofner, Johannes; Lendl, Bernhard [TU Wien, Institute of Chemical Technologies and Analytics, Vienna (Austria); Steinhauser, Georg [Leibniz Universitaet Hannover, Institute of Radioecology and Radiation Protection (Germany)

    2017-10-16

    The crystallization of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] (ZT) in the presence of trace amounts (ca. 50 Bq, ca. 1.6 pmol) of americium results in 1) the accumulation of the americium tracer in the crystalline solid and 2) a material that adopts a different crystal structure to that formed in the absence of americium. Americium-doped [Tb(Am)(H{sub 2}O){sub 7}ZT]{sub 2} ZT.10 H{sub 2}O is isostructural to light lanthanide (Ce-Gd) 5,5{sup '}-azobis[1H-tetrazol-1-ide] compounds, rather than to the heavy lanthanide (Tb-Lu) 5,5{sup '}-azobis[1H-tetrazol-1-ide] (e.g., [Tb(H{sub 2}O){sub 8}]{sub 2}ZT{sub 3}.6 H{sub 2}O) derivatives. Traces of Am seem to force the Tb compound into a structure normally preferred by the lighter lanthanides, despite a 10{sup 8}-fold Tb excess. The americium-doped material was studied by single-crystal X-ray diffraction, vibrational spectroscopy, radiochemical neutron activation analysis, and scanning electron microscopy. In addition, the inclusion properties of terbium 5,5{sup '}-azobis[1H-tetrazol-1-ide] towards americium were quantified, and a model for the crystallization process is proposed. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

  11. Measurement of total alpha activity of neptunium, plutonium, and americium in highly radioactive Hanford waste by iron hydroxide precipitation and 2-heptanone solvent extraction

    International Nuclear Information System (INIS)

    Maiti, T.C.; Kaye, J.H.

    1992-06-01

    An improved method has been developed to concentrate the major alpha-emitting actinide elements neptunium, plutonium, and americium from samples with high salt content such as those resulting from efforts to characterize Hanford storage tank waste. Actinide elements are concentrated by coprecipitation of their hydroxides using iron carrier. The iron is removed by extraction from 8M HCI with 2-heptanone. The actinide elements remain in the aqueous phase free from salts, iron, and long-lived fission products. Recoveries averaged 98 percent

  12. Arabidopsis rad23-4 gene is required for pollen development under ...

    African Journals Online (AJOL)

    Nucleotide excision repair (NER) is a highly conserved DNA repair pathway for correcting DNA lesions that cause distortion of the double helical structure. The protein heterodimer Rad23 is involved in recognition and binding to such lesions. Here, we showed that rad23-4 (AT5g38470) was expressed in the roots, mature ...

  13. New explanation for extreme u-234 u-238 disequilibria in a dolomitic aquifer

    CSIR Research Space (South Africa)

    Kronfeld, J

    1994-05-01

    Full Text Available High U-234/U-238 activity ratios are found in the shallow groundwater of the phreatic Transvaal Dolomite Aquifer. The aquifer is uranium poor, while the waters are oxygen rich and young. Tritium and C-14 are used to show that the disequilibrium...

  14. 18 CFR 367.2340 - Account 234, Accounts payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... payable to associate companies. 367.2340 Section 367.2340 Conservation of Power and Water Resources... Account 234, Accounts payable to associate companies. This account must include all amounts payable to associate companies by the service company within one year, which are not provided for in other accounts. ...

  15. 230Th/234U dating of coral limestones and vertical uplift at Djibouti

    International Nuclear Information System (INIS)

    Faure, Hugues; Hoang, C.T.; Lalou, Claude

    1980-01-01

    Coral limestones sampled from marine terraces along the Afar coast have been dated by the 230 Th/ 234 U method. The ages confirm the stratigraphic unity of these formations and the existence of the paleo sea level dated 124 000 years ago in this region. These results permit to deduce the uplift rates of this littoral [fr

  16. Noise measurement flight test Boeing Vertol 234/CH47-D helicopter : data and analyses

    Science.gov (United States)

    1984-09-30

    This report is the seventh in a series of seven documenting the FAA helicopter noise measurement program conducted at Dulles International Airport during the summer of 1983. The BV234/CH-47D test program involved the acquisition of detailed acoustica...

  17. Isotope shift of 234U, 236U, 238U in U I

    International Nuclear Information System (INIS)

    Gagne, J.M.; Nguyen Van, S.; Saint-Dizier, J.P.; Pianarosa, P.

    1976-01-01

    New and very accurate data of isotope shifts and relative isotope shifts in 234 U, 236 U, 238 U are presented. The invariance of the relative isotope shift, for the transitions we have investigated, supports the hypothesis that the so called specific mass effect is negligible in uranium

  18. 234Th-derived particulate organic carbon export in the Prydz Bay, Antarctica

    International Nuclear Information System (INIS)

    Hao Ma; Zhi Zeng; Jianping Cheng; Zhengbing Han; Wuhui Lin; Shi Zeng

    2014-01-01

    234 Th activities in sea water were measured using Fe(OH) 3 co-precipitation and beta counting at six stations in Prydz Bay in March 2008 during the 24th Chinese National Antarctic Research Expedition. Total 234 Th activities ranged from 0.96 to 2.44 dpm L -1 with an average of 1.61 dpm L -1 , showing an apparent deficit with respect to 238 U due to scavenging and export with particles. With a one-dimensional steady state model, 234 Th export fluxes were converted to particulate organic carbon (POC) export using bottle ratios of POC concentrations to particulate 234 Th activities on suspended particles. POC fluxes at the depth of 100 m varied between 33 and 297 mmol m -2 day -1 , comparable to prior work in the same region and higher than those of some other sea areas in the Southern Ocean, and indicated efficient running of biological pump in Prydz Bay. The results could be helpful to expand the knowledge of carbon cycle in seasonally ice-covered coastal regions around Antarctica. (author)

  19. Identification of Rad23-4 gene required for pollen development in ...

    African Journals Online (AJOL)

    雨林木风

    2012-05-31

    May 31, 2012 ... number of highly conserved DNA repair systems to maintain the integrity of the genome, such as ... then transferred to a phytotron kept under a regime of a 16 h photoperiod (22°C; 70% humidity). Isolation .... the rad23-4 gene, RNA was isolated from roots, mature leaves, floral buds and developing siliques.

  20. The sediment budget of an urban coastal lagoon (Jamaica Bay, NY) determined using 234Th and 210Pb

    Science.gov (United States)

    Renfro, Alisha A.; Cochran, J. Kirk; Hirschberg, David J.; Bokuniewicz, Henry J.; Goodbred, Steven L.

    2016-10-01

    The sediment budget of Jamaica Bay (New York, USA) has been determined using the natural particle-reactive radionuclides 234Th and 210Pb. Inventories of excess thorium-234 (234Thxs, half-life = 24.1 d) were measured in bottom sediments of the Bay during four cruises from September 2004 to July 2006. The mean bay-wide inventory for the four sampling periods ranged from 3.5 to 5.0 dpm cm-2, four to six times that expected from 234Th production in the overlying water column. The presence of dissolved 234Th and a high specific activity of 234Thxs on particles at the bay inlet (∼30 dpm g-1) indicated that both dissolved and particulate 234Th could be imported into the bay from the ocean. Based on these observations, a mass balance of 234Th yields an annual input of ∼39 ± 14 × 1010 g sediment into the bay. Mass accumulation rates determined from profiles of excess 210Pb (half-life = 22.3 y) in sediment cores require annual sediment import of 7.4 ± 4.5 × 1010 g. Both radionuclides indicate that there is considerable marine-derived sediment import to Jamaica Bay, consistent with earlier work using 210Pb. Such sediment input may be important in sustaining longer-term accretion rates of salt marshes in the bay.

  1. 48 CFR 352.234-1 - Notice of earned value management system-pre-award Integrated Baseline Review.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-pre-award Integrated Baseline Review. 352.234-1 Section 352.234-1 Federal Acquisition... provision: Notice of Earned Value Management System—Pre-Award Integrated Baseline Review (October 2008) The...

  2. 48 CFR 352.234-2 - Notice of earned value management system-post-award Integrated Baseline Review.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Notice of earned value management system-post-award Integrated Baseline Review. 352.234-2 Section 352.234-2 Federal Acquisition... provision: Notice of Earned Value Management System—Post-Award Integrated Baseline Review (October 2008) (a...

  3. Synthesis of zirconia sol stabilized by trivalent cations (yttrium and neodymium or americium): a precursor for Am-bearing cubic stabilized zirconia.

    Science.gov (United States)

    Lemonnier, Stephane; Grandjean, Stephane; Robisson, Anne-Charlotte; Jolivet, Jean-Pierre

    2010-03-07

    Recent concepts for nuclear fuel and targets for transmuting long-lived radionuclides (minor actinides) and for the development of innovative Gen-IV nuclear fuel cycles imply fabricating host phases for actinide or mixed actinide compounds. Cubic stabilized zirconia (Zr, Y, Am)O(2-x) is one of the mixed phases tested in transmutation experiments. Wet chemical routes as an alternative to the powder metallurgy are being investigated to obtain the required phases while minimizing the handling of contaminating radioactive powder. Hydrolysis of zirconium, neodymium (a typical surrogate for americium) and yttrium in aqueous media in the presence of acetylacetone was firstly investigated. Progressive hydrolysis of zirconium acetylacetonate and sorption of trivalent cations and acacH on the zirconia particles led to a stable dispersion of nanoparticles (5-7 nm) in the 6-7 pH range. This sol gels with time or with temperature. The application to americium-containing solutions was then successfully tested: a stable sol was synthesized, characterized and used to prepare cubic stabilized zirconia (Zr, Y, Am)O(2-x).

  4. Determining the americium transmutation rate and fission rate by post-irradiation examination within the scope of the ECRIX-H experiment

    Energy Technology Data Exchange (ETDEWEB)

    Lamontagne, J., E-mail: jerome.lamontagne@cea.fr [Commissariat à l’énergie atomique et aux énergies alternatives (CEA), DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Pontillon, Y. [Commissariat à l’énergie atomique et aux énergies alternatives (CEA), DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Esbelin, E. [CEA, DEN, DRCP, Marcoule, F-30207 Bagnols-sur-Cèze (France); Béjaoui, S.; Pasquet, B. [Commissariat à l’énergie atomique et aux énergies alternatives (CEA), DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France); Bourdot, P. [CEA, DEN, DER, Cadarache, F-13108 St. Paul Lez Durance (France); Bonnerot, J.M. [Commissariat à l’énergie atomique et aux énergies alternatives (CEA), DEN, DEC, Cadarache, F-13108 St. Paul Lez Durance (France)

    2013-09-15

    The ECRIX-H experiment aims to assess the feasibility of transmuting americium micro-dispersed in an inert magnesia matrix under a locally moderated neutron flux in the Phénix reactor. A first set of examinations demonstrated that pellet behaviour was satisfactory with moderate swelling at the end of the irradiation. Additional post-irradiation examinations needed to be conducted to confirm the high transmutation rate so as to definitively conclude on the success of the ECRIX-H experiment. This article presents and discusses the results of these new examinations. They confirm the satisfactory behaviour of the MgO matrix not only during the basic irradiation but also during post-irradiation thermal transients. These examinations also provide additional information on the behaviour of fission products both in the americium-based particles and in the MgO matrix. These results particularly validate the transmutation rate predicted by the calculation codes using several different analytical techniques. The fission rate is also determined.

  5. Analytical performance of radiochemical method for americium determination in urine; Desempenho analitico do metodo radioquimico para determinacao de americio em urina

    Energy Technology Data Exchange (ETDEWEB)

    Barreto, Juliana Ferreira; Carneiro, Janete C.G. [Instituto de Pesquisas Energeticas e Nucleares (IPEN), Sao Paulo, SP (Brazil)]. E-mail: ju_barreto@terra.com.br

    2005-07-01

    This paper presents an analytical method developed and adapted for separation and analysis of Plutonium (Pu) isotopes and Americium (Am) in urine samples. The proposed method will attend the demand of internal exposure monitoring program for workers involved mainly with dismantling rods and radioactive smoke detectors. In this experimental procedure four steps are involved as preparation of samples, sequential radiochemical separation, preparation of the source for electroplating and quantification by alpha spectrometry. In the first stage of radiochemical separation, plutonium is conventionally isolated employing the anion exchange technique. Americium isolation is achieved sequentially by chromatographic extraction (Tru.spec column) from the load and rinse solutions coming from the anion exchange column. The {sup 243}Am tracer is added into the sample as chemical yield monitors and to correct the results improving the precision and accuracy. The mean recovery obtained is 60%, and the detection limit for 24h urine sample is 1.0 mBq L{sup -1} in accordance with the literature. Based in the preliminary results, the method is appropriate to be used in monitoring programme of workers with a potential risk of internal contamination. (author)

  6. 20 CFR 234.47 - Election of the RLS by a widow(er) or parent.

    Science.gov (United States)

    2010-04-01

    ... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Election of the RLS by a widow(er) or parent... RETIREMENT ACT LUMP-SUM PAYMENTS Residual Lump-Sum Payment § 234.47 Election of the RLS by a widow(er) or parent. (a) An RLS cannot be paid if it appears that there are immediate or future monthly survivor...

  7. The study of structure in 224–234 thorium nuclei within the framework IBM

    Directory of Open Access Journals (Sweden)

    Lee Su Youn

    2017-01-01

    Full Text Available An investigation has been made of the behaviour of nuclear structure as a function of an increase in neutron number from 224Th to 234Th. Thorium of mass number 234 is a typical rotor nucleus that can be explained by the SU(3 limit of the interacting boson model(IBM in the algebraic nuclear model. Furthermore, 224−232Th lie on the path of the symmetry-breaking phase transition. Moreover, the nuclear structure of 224Th can be explained using X(5 symmetry. However, as 226−230Th nuclei are not fully symmetrical nuclei, they can be represented by adding a perturbed term to express symmetry breaking. Through the following three calculation steps, we identified the tendency of change in nuclear structure. Firstly, the structure of 232Th is described using the matrix elements of the Hamiltonian and the electric quadrupole operator between basis states of the SU(3 limit in IBM. Secondly, the low-lying energy levels and E2 transition ratios corresponding to the observable physical values are calculated by adding a perturbed term with the first-order Casimir operator of the U(5 limit to the SU(3 Hamiltonian in IBM. We compared the results with experimental data of 224−234Th. Lastly, the potential of the Bohr Hamiltonian is represented by a harmonic oscillator, as a result of which the structure of 224−234Th could be expressed in closed form by an approximate separation of variables. The results of these theoretical predictions clarify nuclear structure changes in Thorium nuclei over mass numbers of practical significance.

  8. Phosphorylation of nucleophosmin at threonine 234/237 is associated with HCC metastasis.

    Science.gov (United States)

    Ching, Rachel Hiu Ha; Lau, Eunice Yuen Ting; Ling, Patrick Ming Tat; Lee, Joyce Man Fong; Ma, Mark Kin Fai; Cheng, Bowie Yik Ling; Lo, Regina Cheuk Lam; Ng, Irene Oi Lin; Lee, Terence Kin Wah

    2015-12-22

    Hepatocellular carcinoma (HCC) is frequently complicated by the occurrence of intrahepatic and extrahepatic metastases, leading to poor prognosis. To improve the prognosis for HCC patients, there is an urgent need to understand the molecular mechanisms of metastasis in HCC. Since protein Serine/Threonine phosphorylation emerges to be an important posttranslational modification critical in signaling process associated with cell proliferation, survival and metastasis, we employed a pair of primary tumor-derived and corresponding lung-metastatic counterparts (PLC/PRF/5-PT and PLC/PRF/5-LM) and aimed to identify these changes using CelluSpot Serine/Threonine kinase peptide array. Upon analysis, we found phosphorylated level of nucleophosmin (NPM) at Threonine 234/237 (p-NPM-Thr234/237) had remarkably high level in metastatic HCC cells (PLC-LM) than the corresponding primary HCC cell line (PLC-PT). Similar observation was observed in another match primary and their metastatic counterparts (MHCC-97L and MHCC-97H). By immunohistochemical staining, p-NPM-Thr234/237 was consistently found to be preferentially expressed in metastatic HCCs when compared with primary HCC in 28 HCC cases (p HCC cells, and this effect was mediated by cyclin-dependent kinase 1 (CDK1). Wild-type NPM was found to physically interact with a metastatic gene, ROCK2, and defective in Thr234/237 phosphorylation decreased its binding affinity, resulting in decrease in ROCK2 mediated signaling pathway. Identification of CDK1/p-NPM/ROCK2 signaling pathway provides a novel target for molecular therapy against HCC metastasis.

  9. The inflow of 234U and 238U from the River Odra drainage basin to the Baltic Sea

    Directory of Open Access Journals (Sweden)

    Bogdan Skwarzec

    2010-12-01

    Full Text Available In this study the activity of uranium isotopes 234U and 238U in Odra river water samples, collected from October 2003 to July2004, was measured using alpha spectrometry. The uranium concentrations were different in each of the seasons analysed; the lowest values were recorded in summer. In all seasons, uranium concentrations were the highest in Bystrzyca river waters (from 27.81 ± 0.29Bq m-3 of 234U and 17.82 ± 0.23 Bq m-3 of 238U in spring to 194.76 ± 3.43 Bq m-3 of 234U and 134.88 ± 2.85 Bq m-3 of 238U in summer. The lowest concentrations were noted in the Mała Panew (from 1.33 ± 0.02 Bq m-3 of 234U and 1.06 ± 0.02 Bq m-3 of 238U in spring to 3.52 ± 0.05 Bq m-3 of 234U and 2.59± 0.04 Bq m-3 of 238U in autumn. The uranium radionuclides 234U and 238U in the water samples were not in radioactive equilibrium. The 234U / 238U activity ratios were the highest in Odra water samples collected at Głogów (1.84 in autumn, and the lowest in water from the Noteć (1.03 in winter and spring. The 234U / 238U activity ratio decreases along the main stream of the Odra, owing to changes in the salinity of the river's waters. Annually, 8.19 tons of uranium (126.29 G Bq of 234U and 100.80 G Bq of 238U flow into the Szczecin Lagoon with Odra river waters.

  10. Inhaled americium dioxide

    International Nuclear Information System (INIS)

    Park, J.F.

    1982-01-01

    This project includes experiments to determine the effects of Zn-DTPA therapy on the retention, translocation and biological effects of inhaled 241 AmO 2 . Beagle dogs that received inhalation exposure to 241 AmO 2 developed leukopenia, clincial chemistry changes associated with hepatocellular damage, and were euthanized due to respiratory insufficiency caused by radiation pneumonitis 120 to 131 days after pulmonary deposition of 22 to 65 μCi 241 Am. Another group of dogs that received inhalation exposure to 241 AmO 2 and were treated daily with Zn-DTPA had initial pulmonary deposition of 19 to 26 μCi 241 Am. These dogs did not develop respiratory insufficiency, and hematologic and clinical chemistry changes were less severe than in the non-DTPA-treated dogs

  11. sup(234) Th scavenging and particle export fluxes from the upper 100 m of the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Sarin, M.M.; Rengarajan, R.; Ramaswamy, V.

    profiles reveal close similarities in the dissolved sup(234) Th: sup(238) U disequilibria, suggesting that the rates of particle-associated scavenging processes are generally uniform in the central Arabian Sea. The observed disequilibrium integrated...

  12. Artificial radionuclides in the Northern European Marine Environment. Distribution of radiocaesium, plutonium and americium in sea water and sediments in 1995

    International Nuclear Information System (INIS)

    Groettheim, Siri

    2000-01-01

    This study considers the distribution of radiocaesium, plutonium and americium in the northern marine environment. The highest radiocaesium activity in sea water was observed in Skagerrak, 26 Bq/m 3 , and in surface sediments in the Norwegian Sea, 60 Bq/kg. These enhanced levels were related to Chernobyl. The highest 239,240Pu activity in surface water was measured in the western North Sea, 66 mBq/m 3 . In sea water, sub-surface maxima were observed at several locations with an 239,240Pu activity up to 160 mBq/m 3 , and were related to Sellafield. With the exception to the North Sea, surface sediments reflected Pu from global fallout from weapons tests only. (author)

  13. Recovery of Americium-241 from lightning rod by the method of chemical treatment; Recuperacion del Americio-241 provenientes de los pararrayos por el metodo de tratamiento quimico

    Energy Technology Data Exchange (ETDEWEB)

    Cruz, W.H., E-mail: wcruz@ipen.gob.pe [Instituto Peruano de Energia Nuclear (GRRA/IPEN), Lima (Peru). Division de Gestion de Residuos Radiactivos

    2013-07-01

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ({sup 241}Am), fewer and Radium 226 ({sup 226}Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of {sup 241}Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The {sup 241}Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel {sup 241}Am technique was used electrodeposition. (author)

  14. Artificial radionuclides in the Northern European Marine Environment. Distribution of radiocaesium, plutonium and americium in sea water and sediments in 1995

    Energy Technology Data Exchange (ETDEWEB)

    Groettheim, Siri

    2000-07-01

    This study considers the distribution of radiocaesium, plutonium and americium in the northern marine environment. The highest radiocaesium activity in sea water was observed in Skagerrak, 26 Bq/m{sub 3}, and in surface sediments in the Norwegian Sea, 60 Bq/kg. These enhanced levels were related to Chernobyl. The highest 239,240Pu activity in surface water was measured in the western North Sea, 66 mBq/m{sub 3}. In sea water, sub-surface maxima were observed at several locations with an 239,240Pu activity up to 160 mBq/m{sub 3}, and were related to Sellafield. With the exception to the North Sea, surface sediments reflected Pu from global fallout from weapons tests only. (author)

  15. Safe handling of kilogram amounts of fuel-grade plutonium and of gram amounts of plutonium-238, americium-241 and curium-244

    International Nuclear Information System (INIS)

    Louwrier, K.P.; Richter, K.

    1976-01-01

    During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239 Pu containing 8-12% 240 Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241 Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241 Am, 243 Am and 244 Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241 Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)

  16. Preliminary application of 241-Americium calcaneus bone mineral density measurement in osteoporosis. Comparison with double X-ray densitometry of the lumber spine

    International Nuclear Information System (INIS)

    Guan Liang; Zhu Chengmo; Li Peiyong; Wang Hui; Pu Mingfang; Qiu Jigao

    2001-01-01

    Bone mineral density (BMD) of calcaneus in 54 normals, 45 Osteoporosis, 25 suspected osteoporosis and 16 other non-osteoporosis patients, a total of 140 cases were measured by HUAKE (HK-1) 241-Americium BMD absorpmetry, among them 43 were compared with that of lumber spine (L2 - L4) measured by Lunar Corporation's Expert-XL absorpmeter. BMD of normal group of calcaneus was (409.8 +- 79.4) mg/cm 2 . The BMD were decreased slowly with the increasing age. The BMD of osteoporosis, suspected osteoporosis and non-osteoporosis group were 230.3 +- 62.3, 395.7 +- 57.4 and 363.3 +- 51.9 mg/cm 2 respectively. The BMD of osteoporosis group was much lower than that of normal group, and also lower than that of the other two groups, among 26 patients (57.78%) had bone fracture, all was in accordance with the clinical diagnosis of osteoporosis. The BMD of suspected osteoporosis and non-osteoporosis had no significant difference with normal group. The coefficient variation (CV) of BMD in repeated measurement in calcaneus of 4 participants was less than 1.2%. The correlative coefficient (r) between BMD of calcaneus and lumber spine (L2 - L4) group was 0.6824. The correlative coefficient of normal young adult-matched percentage and T value in 2 groups were 0.6863 and 0.6755 respectively, whereas aged-matched percentage, Z value were 0.4614 and 0.5009 respectively. In conclusion 241-Americium calcaneus BMD absorpmetry has the advantage of low price, easy to operate, reliable and valuable in diagnosis osteoporosis. The correlations of calcaneus and lumber spine BMD, normal young adult-matched percentage and T value were rather good

  17. Correction factor K calculation for Americium-Beryllium neutron sources measured in a manganese sulfate bath; Calculo do fator de correcao K para fontes de neutrons de Americio-Berilio medida no banho de sulfato de manganes do LNMRI/IRD

    Energy Technology Data Exchange (ETDEWEB)

    Leite, Sandro P.; Fonseca, Evaldo S. da; Patrao, Karla C.S.; Goncalves, Marcello G. [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. de Neutrons; Pereira, Walsan W. [Instituto de Radioprotecao e Dosimetria (IRD/CNEN-RJ), Rio de Janeiro, RJ (Brazil). Lab. Nacional de Metrologia das Radiacoes Ionizantes (LNMRI)

    2005-03-15

    This paper simulates a manganese sulfate bath at the Ionizing Radiation Metrology National Laboratory for the calculation of K correction factor for the neutro emission ratio in some Americium-Beryllium sources.

  18. Investigation of 234U(n,f) as a Function of Incident Neutron Energy

    Science.gov (United States)

    Al-Adili, A.; Hambsch, F.-J.; Oberstedt, S.; Pomp, S.

    2011-10-01

    Measurements of the reaction 234U(n,f) have been performed at incident neutron energies from 0.2 MeV to 5 MeV at the 7 MV Van De Graaf accelerator at IRMM. A twin Frisch-grid ionization chamber was used for fission-fragment detection. Parallel digital and analogue data acquisitions were applied in order to compare the two techniques. First results on the angular anisotropy and preliminary mass distributions are presented along with a first comparison between the two techniques.

  19. Study of 234U(n,f) Resonances Measured at the CERN n_TOF Facility

    CERN Document Server

    Leal-Cidoncha, E; Paradela, C; Tarrío, D; Leong, L S; Audouin, L; Tassan-Got, L; Praena, J; Berthier, B; Ferrant, L; Isaev, S; Le Naour, C; Stephan, C; Trubert, D; Abbondanno, U; Aerts, G; Álvarez, H; Álvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Badurek, G; Baumann, P; Bečvář, F; Berthoumieux, E; Calviño, F; Calviani, M; Cano-Ott, D; Capote, R; Carrapiço, C; Cennini, P.; Chepel, V; Chiaveri, E.; Colonna, N; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S.; Dillmann, I; Domingo-Pardo, C; Dridi, W; Eleftheriadis, C; Embid-Segura, M; Ferrari, A.; Ferreira-Marques, R; Fujii, K; Furman, W; Gonçalves, I; González-Romero, E; Gramegna, F; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A.; Igashira, M; Jericha, E; Kadi, Y.; Käppeler, F; Karadimos, D; Kerveno, M; Koehler, P; Kossionides, E; Krtička, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martínez, T; Massimi, C; Mastinu, P; Mengoni, A; Milazzo, P M; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O'Brien, S; Oshima, M; Pancin, J; Papadopoulos, C; Pavlik, A; Pavlopoulos, P.; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Pretel, C; Quesada, J; Rauscher, T.; Reifarth, R; Rubbia, C.; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L.; Savvidis, I; Tagliente, G; Tain, J L; Tavora, L; Terlizzi, R; Vannini, G; Vaz, P; Ventura, A.; Villamarin, D; Vincente, M C; Vlachoudis, V.; Vlastou, R; Voss, F; Walter, S; Wiescher, M; Wisshak, K

    2014-01-01

    We present the analysis of the resolved resonance region for the U-234(n,f) cross section data measured at the CERN n\\_TOF facility. The resonance parameters in the energy range from 1 eV to 1500 eV have been obtained with the SAMMY code by using as initial parameters for the fit the resonance parameters of the JENDL-3.3 evaluation. In addition, the statistical analysis has been accomplished, partly with the SAMDIST code, in order to study the level spacing and the Mehta-Dyson correlation.

  20. Activity disequilibrium between 234U and 238U isotopes in natural environment

    OpenAIRE

    Bory?o, Alicja; Skwarzec, Bogdan

    2014-01-01

    The aim of this work was to calculate the values of the 234U/238U activity ratio in natural environment (water, sediments, Baltic organisms and marine birds from various regions of the southern Baltic Sea; river waters (the Vistula and the Oder River); plants and soils collected near phosphogypsum waste heap in Wi?linka (Northern Poland) and deer-like animals from Northern Poland. On the basis of the studies it was found that the most important processes of uranium geochemical migration in th...

  1. Measurements of 234U, 238U and 230Th in excreta of uranium-mill crushermen

    International Nuclear Information System (INIS)

    Fisher, D.R.; Jackson, P.O.; Brodacynski, G.G.; Scherpelz, R.I.

    1982-07-01

    Uranium and thorium levels in excreta of uranium mill crushermen who are routinely exposed to airborne uranium ore dust were measured. The purpose was to determine whether 230 Th was preferentially retained over either 234 U or 238 U in the body. Urine and fecal samples were obtained from fourteen active crushermen with long histories of exposure to uranium ore dust, plus four retired crushermen and three control individuals for comparison. Radiochemical procedures were used to separate out the uranium and thorium fractions, which were then electroplated on stainless steel discs and assayed by alpha spectrometry. Significantly greater activity levels of 234 U and 238 U were measured in both urine and fecal samples obtained from uranium mill crushermen, indicating that uranium in the inhaled ore dust was cleared from the body with a shorter biological half-time than the daughter product 230 Th. The measurements also indicated that uranium and thorium separate in vivo and have distinctly different metabolic pathways and transfer rates in the body. The appropriateness of current ICRP retention and clearance parameters for 230 Th in ore dust is questioned

  2. Crustal subsidence rate off Hawaii determined from 234U/238U ages of drowned coral reefs

    Science.gov (United States)

    Ludwig, K. R.; Szabo, B. J.; Moore, J.G.; Simmons, K.R.

    1991-01-01

    A series of submerged coral reefs off northwestern Hawaii was formed during (largely glacial) intervals when the rate of local sea-level rise was less than the maximum upward growth rate of the reefs. Mass-spectrometric 234U/238U ages for samples from six such reefs range from 17 to 475 ka and indicate that this part of the Hawaiian Ridge has been subsiding at a roughly uniform rate of 2.6 mm/yr for the past 475 ka. The 234U/238U ages are in general agreement with model ages of reef drowning (based on estimates of paleo-sea-level stands derived from oxygen-isotope ratios of deep-sea sediments), but there are disagreements in detail. The high attainable precision (??10 ka or better on samples younger than ~800 ka), large applicable age range, relative robustness against open-system behavior, and ease of analysis for this technique hold great promise for future applications of dating of 50-1000 ka coral. -Authors

  3. 232Th, 233Pa, and 234U capture cross-section measurements in moderated neutron flux

    Science.gov (United States)

    Bringer, O.; Isnard, H.; AlMahamid, I.; Chartier, F.; Letourneau, A.

    2008-07-01

    The Th-U cycle was studied through the evolution of a 100 μg 232Th sample irradiated in a moderated neutron flux of 8.010 14 n/cm 2/s, intensity close to that of a thermal molten salt reactor. After 43 days of irradiation and 6 months of cooling, a precise mass spectrometric analysis, using both TIMS and MC-ICP-MS techniques, was performed, according to a rigorous methodology. The measured thorium and uranium isotopic ratios in the final irradiated sample were then compared with integral simulations based on evaluated data; an overall good agreement was seen. Four important thermal neutron-capture cross-sections were also extracted from the measurements, 232Th (7.34±0.21 b), 233Pa (38.34±1.78 b), 234U (106.12±3.34 b), and 235U (98.15±11.24 b). Our 232Th and 235U results confirmed existing values whereas the cross-sections of 233Pa and 234U (both key parameters) have been redefined.

  4. 230Th-234U Model-Ages of Some Uranium Standard Reference Materials

    International Nuclear Information System (INIS)

    Williams, R.W.; Gaffney, A.M.; Kristo, M.J.; Hutcheon, I.D.

    2009-01-01

    The 'age' of a sample of uranium is an important aspect of a nuclear forensic investigation and of the attribution of the material to its source. To the extent that the sample obeys the standard rules of radiochronometry, then the production ages of even very recent material can be determined using the 230 Th- 234 U chronometer. These standard rules may be summarized as (a) the daughter/parent ratio at time=zero must be known, and (b) there has been no daughter/parent fractionation since production. For most samples of uranium, the 'ages' determined using this chronometer are semantically 'model-ages' because (a) some assumption of the initial 230 Th content in the sample is required and (b) closed-system behavior is assumed. The uranium standard reference materials originally prepared and distributed by the former US National Bureau of Standards and now distributed by New Brunswick Laboratory as certified reference materials (NBS SRM = NBL CRM) are good candidates for samples where both rules are met. The U isotopic standards have known purification and production dates, and closed-system behavior in the solid form (U 3 O 8 ) may be assumed with confidence. We present here 230 Th- 234 U model-ages for several of these standards, determined by isotope dilution mass spectrometry using a multicollector ICP-MS, and compare these ages with their known production history

  5. An Optimization Model for Design of Asphalt Pavements Based on IHAP Code Number 234

    Directory of Open Access Journals (Sweden)

    Ali Reza Ghanizadeh

    2016-01-01

    Full Text Available Pavement construction is one of the most costly parts of transportation infrastructures. Incommensurate design and construction of pavements, in addition to the loss of the initial investment, would impose indirect costs to the road users and reduce road safety. This paper aims to propose an optimization model to determine the optimal configuration as well as the optimum thickness of different pavement layers based on the Iran Highway Asphalt Paving Code Number 234 (IHAP Code 234. After developing the optimization model, the optimum thickness of pavement layers for secondary rural roads, major rural roads, and freeways was determined based on the recommended prices in “Basic Price List for Road, Runway and Railway” of Iran in 2015 and several charts were developed to determine the optimum thickness of pavement layers including asphalt concrete, granular base, and granular subbase with respect to road classification, design traffic, and resilient modulus of subgrade. Design charts confirm that in the current situation (material prices in 2015, application of asphalt treated layer in pavement structure is not cost effective. Also it was shown that, with increasing the strength of subgrade soil, the subbase layer may be removed from the optimum structure of pavement.

  6. Fluxes of 234Th, 210Po and 210Pb determined by sediment trap experiments in pelagic oceans

    International Nuclear Information System (INIS)

    Harada, Koh; Tsunogai, Shizuo

    1986-01-01

    Sediment trap experiments were carried out in two oceans, the eastern Pacific Ocean and the Antarctic Ocean, which have very different biological productivities. The natural radionuclides, 234 Th, 210 Po and 210 Pb were used as tracers of reactive metals. Larger particulate fluxes of these radionuclides were found in the seas where total mass fluxes were larger, although the concentrations of these radionuclides in the settling particles were somewhat smaller. The concentrations of 234 Th in the settling particles varied widely and irregularly with depth, whereas the concentrations of 210 Po and 210 Pb in the settling particles steadily increased with increasing water depth. The ratios of 210 Po/ 210 Pb in the settling particulates were larger than unity which the ratio of 234 Th/excess 210 Po as larger than 234 Th/ 210 Po in the deep water. These results suggest that, when the particles sink through the water column, these radionuclides are being absorbed by settling particles in the order 234 Th > 210 Po > 210 Pb. The observed particulate fluxes of 210 Pb are about one eighth of those calculated from the disequilibria between 226 Ra and 210 Pb at the stations in the subtropical eastern Pacific, although the observed fluxes are the same as the calculated ones in the northern North Pacific and the Antarctic Ocean. Thus, there must be a horizontal flow carrying these reactive metals from the oligotorophic ocean to the biologically productive ocean where the metals are removed by settling particles even in deep water. (author)

  7. Actinide Oxidation State and O/M Ratio in Hypostoichiometric Uranium-Plutonium-Americium U0.750Pu0.246Am0.004O2-x Mixed Oxides.

    Science.gov (United States)

    Vauchy, Romain; Belin, Renaud C; Robisson, Anne-Charlotte; Lebreton, Florent; Aufore, Laurence; Scheinost, Andreas C; Martin, Philippe M

    2016-03-07

    Innovative americium-bearing uranium-plutonium mixed oxides U1-yPuyO2-x are envisioned as nuclear fuel for sodium-cooled fast neutron reactors (SFRs). The oxygen-to-metal (O/M) ratio, directly related to the oxidation state of cations, affects many of the fuel properties. Thus, a thorough knowledge of its variation with the sintering conditions is essential. The aim of this work is to follow the oxidation state of uranium, plutonium, and americium, and so the O/M ratio, in U0.750Pu0.246Am0.004O2-x samples sintered for 4 h at 2023 K in various Ar + 5% H2 + z vpm H2O (z = ∼ 15, ∼ 90, and ∼ 200) gas mixtures. The O/M ratios were determined by gravimetry, XAS, and XRD and evidenced a partial oxidation of the samples at room temperature. Finally, by comparing XANES and EXAFS results to that of a previous study, we demonstrate that the presence of uranium does not influence the interactions between americium and plutonium and that the differences in the O/M ratio between the investigated conditions is controlled by the reduction of plutonium. We also discuss the role of the homogeneity of cation distribution, as determined by EPMA, on the mechanisms involved in the reduction process.

  8. Effect of the addition of ultraviolet absorber (Tinuvin 234) on the quality of soybean oil packaged in polyethylene terephthalate (PET)

    International Nuclear Information System (INIS)

    Oliveira Alves, M.A. de; Arruda, C.S.; Ogliari, P.J.; Meinert, E.M.; Teixeira, E.; Barrera-Arellano, D.; Block, J.M.

    2005-01-01

    In this work, the effect of the addition of the UV absorber Tinuvin 234 on the quality of soybean oil packaged in PET bottles stored at ambient temperature for 6 months under fluorescent light (634 lux). Along this period determinations were made of: peroxide value (PV), free fatty acids (FFA), specific extinction at 232 and 270 nm (EE) and sensorial evaluation (SE). The analysis of variance and resistance between the linear coefficients of each treatment indicates that significant difference does not exist (p0.0001) during the storage in relation to all determinations (PV, FFA, EE and SE). The results indicate that the addition of the absorbent Tinuvin 234 to PET bottles in the concentrations of 0.12% and 0.22% was not efficient in slowing down the deterioration of the oil exposed to the fluorescent light, when compared with soybean oil in PET bottles without addition of Tinuvin 234. (author) [es

  9. Americium, plutonium and uranium contamination and speciation in well waters, streams and atomic lakes in the Sarzhal region of the Semipalatinsk Nuclear Test Site, Kazakhstan.

    Science.gov (United States)

    León Vintró, L; Mitchell, P I; Omarova, A; Burkitbayev, M; Jiménez Nápoles, H; Priest, N D

    2009-04-01

    New data are reported on the concentrations, isotopic composition and speciation of americium, plutonium and uranium in surface and ground waters in the Sarzhal region of the Semipalatinsk Test Site, and an adjacent area including the settlement of Sarzhal. The data relate to filtered water and suspended particulate from (a) streams originating in the Degelen Mountains, (b) the Tel'kem 1 and Tel'kem 2 atomic craters, and (c) wells on farms located within the study area and at Sarzhal. The measurements show that (241)Am, (239,240)Pu and (238)U concentrations in well waters within the study area are in the range 0.04-87mBq dm(-3), 0.7-99mBq dm(-3), and 74-213mBq dm(-3), respectively, and for (241)Am and (239,240)Pu are elevated above the levels expected solely on the basis of global fallout. Concentrations in streams sourced in the Degelen Mountains are similar, while concentrations in the two water-filled atomic craters are somewhat higher. Suspended particulate concentrations in well waters vary considerably, though median values are very low, at 0.01mBq dm(-3), 0.08mBq dm(-3) and 0.32mBq dm(-3) for (241)Am, (239,240)Pu and (238)U, respectively. The (235)U/(238)U isotopic ratio in almost all well and stream waters is slightly elevated above the 'best estimate' value for natural uranium worldwide, suggesting that some of the uranium in these waters is of test-site provenance. Redox analysis shows that on average most of the plutonium present in the microfiltered fraction of these waters is in a chemically reduced form (mean 69%; 95% confidence interval 53-85%). In the case of the atomic craters, the proportion is even higher. As expected, all of the americium present appears to be in a reduced form. Calculations suggest that annual committed effective doses to individual adults arising from the daily ingestion of these well waters are in the range 11-42microSv (mean 21microSv). Presently, the ground water feeding these wells would not appear to be contaminated with

  10. Americium, plutonium and uranium contamination and speciation in well waters, streams and atomic lakes in the Sarzhal region of the Semipalatinsk Nuclear Test Site, Kazakhstan

    Energy Technology Data Exchange (ETDEWEB)

    Leon Vintro, L. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland)], E-mail: luis.leon@ucd.ie; Mitchell, P.I.; Omarova, A. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Burkitbayev, M. [Department of Inorganic Chemistry, Al-Faraby Kazakh National University, Almaty (Kazakhstan); Jimenez Napoles, H. [School of Physics, University College Dublin, Belfield, Dublin 4 (Ireland); Priest, N.D. [School of Health and Social Sciences, Middlesex University, Enfield, EN3 4SA (United Kingdom)

    2009-04-15

    New data are reported on the concentrations, isotopic composition and speciation of americium, plutonium and uranium in surface and ground waters in the Sarzhal region of the Semipalatinsk Test Site, and an adjacent area including the settlement of Sarzhal. The data relate to filtered water and suspended particulate from (a) streams originating in the Degelen Mountains, (b) the Tel'kem 1 and Tel'kem 2 atomic craters, and (c) wells on farms located within the study area and at Sarzhal. The measurements show that {sup 241}Am, {sup 239,240}Pu and {sup 238}U concentrations in well waters within the study area are in the range 0.04-87 mBq dm{sup -3}, 0.7-99 mBq dm{sup -3}, and 74-213 mBq dm{sup -3}, respectively, and for {sup 241}Am and {sup 239,240}Pu are elevated above the levels expected solely on the basis of global fallout. Concentrations in streams sourced in the Degelen Mountains are similar, while concentrations in the two water-filled atomic craters are somewhat higher. Suspended particulate concentrations in well waters vary considerably, though median values are very low, at 0.01 mBq dm{sup -3}, 0.08 mBq dm{sup -3} and 0.32 mBq dm{sup -3} for {sup 241}Am, {sup 239,240}Pu and {sup 238}U, respectively. The {sup 235}U/{sup 238}U isotopic ratio in almost all well and stream waters is slightly elevated above the 'best estimate' value for natural uranium worldwide, suggesting that some of the uranium in these waters is of test-site provenance. Redox analysis shows that on average most of the plutonium present in the microfiltered fraction of these waters is in a chemically reduced form (mean 69%; 95% confidence interval 53-85%). In the case of the atomic craters, the proportion is even higher. As expected, all of the americium present appears to be in a reduced form. Calculations suggest that annual committed effective doses to individual adults arising from the daily ingestion of these well waters are in the range 11-42 {mu}Sv (mean 21 {mu

  11. The 234U neutron capture cross section measurement at the n TOF facility

    International Nuclear Information System (INIS)

    Lampoudis, C.; Abbondanno, U.; Aerts, G.; A lvarez, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, O.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Calvino, F.; Calviani, M.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Martinez, T.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O'Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K.

    2008-01-01

    The neutron capture cross-section of 234 U has been measured for energies from thermal up to the keV region in the neutron time-of-flight facility n-TOF, based on a spallation source located at CERN. A 4π BaF 2 array composed of 40 crystals, placed at a distance of 184.9 m from the neutron source, was employed as a total absorption calorimeter (TAC) for detection of the prompt γ-ray cascade from capture events in the sample. This text describes the experimental setup, all necessary steps followed during the data analysis procedure. Results are presented in the form of R-matrix resonance parameters from fits with the SAMMY code and compared to the evaluated data of Endf in the relevant energy region, indicating the good performance of the n-TOF facility and the TAC. (authors)

  12. Application of natural Ra isotopes and 234Th as tracers of organic carbon export in Bransfield Strait, Antarctica

    International Nuclear Information System (INIS)

    Vieira, Lucia Helena

    2011-01-01

    The Southern Ocean is the largest of several high-nutrient, low-chlorophyll (HNLC) regions in the world's oceans. This region plays a major role in regulating the global net transfer of carbon dioxide between the ocean and the atmosphere, in part because the annual photosynthetic uptake of CO 2 by phytoplankton and resulting export of particulate organic carbon (POC) to the deep ocean. The element thorium has multiple radioisotopes that have emerged collectively as a powerful set of tracers for particle associated processes in the oceans. Of all the Th isotopes, 234 Th (half-life 24.1 d) has been the focus of increasing attention and application in the past years. The production of 234 Th from 238 U, coupled with the conservative behavior of 238 U in seawater, makes the source of 234 Th easy to characterize. Moreover, the half-life of 234 Th is sufficiently short to make it sensitive to the short-term (e.g. seasonal) changes that occur in the upper water column of the open ocean or in sediments or water column in coastal areas. Because of its very particle reactive behavior, 234 Th is removed from a parcel of water in only two ways, through decay and through particle flux. Therefore, a steady-state 1D activity balance can be used to calculate its flux. Natural Ra isotopes have been also widely used in marine studies to trace water masses and to quantify mixing processes. This work presents results of a collaborative research on organic carbon fluxes distribution in the Bransfield Strait in order to evaluate its influence in the CO 2 drawdown. Macro-nutrients, micro-nutrients and chlorophyll-a distributions were used to examine the pathway sources. Natural radium isotopes were applied as tracers to study the movement of shelf water, while 234 Th was used as a tracer of particle flux in the upper ocean, since POC export via sinking particles is the primary mechanism of carbon sequestration in the Southern Ocean. Sea water samples for total 234 Th and natural Ra

  13. Assessment of uranium exposure from total activity and 234U:238U activity ratios in urine

    International Nuclear Information System (INIS)

    Nicholas, T.; Bingham, D.

    2011-01-01

    Radiation workers at Atomic Weapons Establishment (AWE) are monitored for uranium exposure by routine bioassay sampling (primarily urine sampling). However, the interpretation of uranium in urine and faecal results in terms of occupational intakes is difficult because of the presence of uranium due to intakes from environmental (dietary) sources. For uranium in urine data obtained using current analytical techniques at AWE, the mean, median and standard deviation of excreted uranium concentrations were 0.006, 0.002 and 0.012 μg per g creatinine, respectively. These values are consistent with what might be expected from local dietary intakes and the knowledge that occupational exposures at AWE are likely to be very low. However, some samples do exceed derived investigation levels (DILs), which have been set up taking account of the likely contribution from environmental sources. We investigate how the activity and isotopic composition of uranium in the diet affects the sensitivity of uranium in urine monitoring for occupational exposures. We conclude that DILs based on both total uranium in urine activity and also 234 U: 238 U ratios are useful given the likely variation in dietary contribution for AWE workers. Assuming a background excretion rate and that the enrichment of the likely exposure is known, it is possible to assess exposures using 234 U: 238 U ratios and/or total uranium activity. The health implications of internalised uranium, enriched to 235 U, centre on its nephrotoxicity; the DILs for bioassay samples at AWE are an order of magnitude below the conservative recommendations made by the literature. (authors)

  14. Indication of anisotropic TKE and mass emission in 234U(n,f)

    Science.gov (United States)

    Al-Adili, A.; Hambsch, F.-J.; Pomp, S.; Oberstedt, S.

    The neutron-induced fission of 234U has been studied for neutron energies ranging from 200 keV to 5 MeV. Special focus was put around the prominent vibrational resonance in the sub-barrier region around 800 keV incident neutron energy. The aim was to investigate the fission fragment (FF) characteristics and search for fluctuations in energy and mass distributions. The strong angular anisotropy in the case of 234U(n,f) was verified and correlations with changes in energy and mass distributions were found. The TKE around the resonance increases contrary to earlier literature data. Furthermore, the TKE and mass distribution were found to be dependent on emission angle. At the resonance, the TKE was smallest near the 0° emission of the FF. This effect was consistent and coherent with a change in the mass distribution around the resonance. The mass distribution was observed to be less asymmetric near 0° emission. From a fitting analysis based on the Multi-Modal Random Neck-Rupture (MMRNR) model, we found the yield of the standard-1 mode increasing around the resonance. Because the TKE is increasing at larger angles and the mass distribution becomes more symmetric also at larger angles, we conclude that this behavior is due to an increase of the standard-1 mode at these larger angles. Based on the formalism of MMRNR, such difference in angular distribution may be an indication of a different outer barrier height for the standard-1 and standard-2 modes.

  15. Theoretical and experimental study of the bio-geochemical behaviour of americium 241 in simplified rhizosphere conditions. Application to a calcareous agricultural soil; Etude theorique et experimentale du comportement biogeochimique de l'americium-241 en conditions rhizospheriques simplifiees. Application dans un sol agricole calcaire

    Energy Technology Data Exchange (ETDEWEB)

    Perrier, T

    2004-06-01

    Americium 241, is one of the most radio-toxic contaminant produced during the nuclear fuel cycle. It can be found in all environmental compartments, in particular the soils. The main goals of this study are to identify, quantify and model the effect of the main factors controlling the mobility of {sup 241}Am in the rhizosphere and the agricultural soils. The physico-chemical parameters of the soil and of the soil solution, the potential role of microorganisms on the sorption-desorption processes, and the speciation of americium in solution have been more particularly studied. {sup 241}Am remobilization has been studied at the laboratory using leaching experiments performed in controlled conditions on reworked calcareous soils artificially contaminated with {sup 241}Am. The soil samples have been washed out in different hydrodynamic conditions by solutions with various compositions. The eluted solution has been analyzed (pH, conductivity, ionic composition, Fe{sub tot}, organic acids, {sup 241}Am) and its bacterial biomass content too. The overall results indicate that {sup 241}Am remobilization is contrasted and strongly linked with the condition under study (pH, ionic strength, glucose and/or citrate concentration). Therefore, a solution in equilibrium with the soil or containing small exudate concentrations (10{sup -4} M) re-mobilizes only a very small part of the americium fixed on the solid phase. The desorption of {sup 241}Am corresponds to a solid/liquid coefficient of partition (K{sub d}) of about 10{sup 5} L.kg{sup -1}. A significant addition of glucose induces an important dissolution of soil carbonates by the indirect action of microorganisms, but does not significantly favor the {sup 241}Am remobilization. On the other hand, the presence of strong citrate concentrations ({>=} 10{sup -2} M) allows 300 to 10000 time greater re-mobilizations by the complexing of {sup 241}Am released after the dissolution of the carrying phases. Finally, the colloidal

  16. Study of biosorbents application on the treatment of radioactive liquid wastes with americium-241; Estudo da aplicacao de biossorventes no tratamento de rejeitos radioativos liquidos contendo americio-241

    Energy Technology Data Exchange (ETDEWEB)

    Borba, Tania Regina de

    2010-07-01

    The use of nuclear energy for many different purposes has been intensified and highlighted by the benefits that it provides. Medical diagnosis and therapy, agriculture, industry and electricity generation are examples of its application. However, nuclear energy generates radioactive wastes that require suitable treatment ensuring life and environmental safety. Biosorption and bioaccumulation represent an emergent alternative for the treatment of radioactive liquid wastes, providing volume reduction and physical state change. This work aimed to study biosorbents for the treatment of radioactive liquid wastes contaminated with americium-241 in order to reduce the volume and change the physical state from liquid to solid. The biosorbents evaluated were Saccharomyces cerevisiae immobilized in calcium alginate beads, inactivated and free cells of Saccharomyces cerevisiae, calcium alginate beads, Bacillus subtilis, Cupriavidus metallidurans and Ochrobactrum anthropi. The results were quite satisfactory, achieving 100% in some cases. The technique presented in this work may be useful and viable for implementing at the Waste Management Laboratory of IPEN - CNEN/SP in short term, since it is an easy and low cost method. (author)

  17. Diluent and extractant effects on the enthalpy of extraction of uranium(VI) and americium(III) nitrates by trialkyl phosphates

    International Nuclear Information System (INIS)

    Srinivasan, T.G.; Vasudeva Rao, P.R.; Sood, D.D.

    1998-01-01

    The effect of various diluents such as n-hexane, n-heptane n-octane, isooctane, n-decane, n-undecane, n-dodecane, n-tetradecane, n-hexadecane, cyclohexane, benzene, toluene, p-xylene, mesitylene and o-dichlorobenzene on the enthalpy of extraction of uranyl nitrate by tri-n-amyl phosphate (TAP) over the temperature range 283 K--333 K has been studied. The results indicate that the enthalpy of extraction does not vary significantly with the diluents studied. Also enthalpies of extraction of uranyl nitrate and americium(III) nitrate by neutral organo phosphorous extractants such as tri-n-butyl phosphate (TBP), tri-n-amyl phosphate (TAP), tri-sec-butyl phosphate (TsBP), tri-isoamyl phosphate (TiAP) and tri-n-hexyl phosphate (THP) have been studied. An attempt has been made to explain the trends, on the basis of the nature of the solvate formed and the different terms which contribute to the overall enthalpy change

  18. Human bones obtained from routine joint replacement surgery as a tool for studies of plutonium, americium and {sup 90}Sr body-burden in general public

    Energy Technology Data Exchange (ETDEWEB)

    Mietelski, Jerzy W., E-mail: jerzy.mietelski@ifj.edu.pl [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Edward B. [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Department of Physical Therapy Basics, Faculty of Physical Therapy, Administration College, Bielsko-Biala (Poland); Tomankiewicz, Ewa [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Joanna [Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Nowak, Sebastian [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Szczygiel, Elzbieta [Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Brudecki, Kamil [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland)

    2011-06-15

    The paper presents a new sampling method for studying in-body radioactive contamination by bone-seeking radionuclides such as {sup 90}Sr, {sup 239+240}Pu, {sup 238}Pu, {sup 241}Am and selected gamma-emitters, in human bones. The presented results were obtained for samples retrieved from routine surgeries, namely knee or hip joints replacements with implants, performed on individuals from Southern Poland. This allowed to collect representative sets of general public samples. The applied analytical radiochemical procedure for bone matrix is described in details. Due to low concentrations of {sup 238}Pu the ratio of Pu isotopes which might be used for Pu source identification is obtained only as upper limits other then global fallout (for example Chernobyl) origin of Pu. Calculated concentrations of radioisotopes are comparable to the existing data from post-mortem studies on human bones retrieved from autopsy or exhumations. Human bones removed during knee or hip joint surgery provide a simple and ethical way for obtaining samples for plutonium, americium and {sup 90}Sr in-body contamination studies in general public. - Highlights: > Surgery for joint replacement as novel sampling method for studying in-body radioactive contamination. > Proposed way of sampling is not causing ethic doubts. > It is a convenient way of collecting human bone samples from global population. > The applied analytical radiochemical procedure for bone matrix is described in details. > The opposite patient age correlations trends were found for 90Sr (negative) and Pu, Am (positive).

  19. Americium-241 integral radiative capture cross section in over-moderated neutron spectrum from pile oscillator measurements in the Minerve reactor

    Directory of Open Access Journals (Sweden)

    Geslot Benoit

    2017-01-01

    Full Text Available An experimental program, called AMSTRAMGRAM, was recently conducted in the Minerve low power reactor operated by CEA Cadarache within the frame of the CHANDA initiative (Solving CHAllenges in Nuclear Data. Its aim was to measure the integral capture cross section of 241Am in the thermal domain. Motivation of this work is driven by large differences in this actinide thermal point reported by major nuclear data libraries. The AMSTRAMGRAM experiment, that made use of well characterized EC-JRC americium samples, was based on the oscillation technique commonly implemented in the Minerve reactor. First results are presented and discussed in this article. A preliminary calculation scheme was used to compare measured and calculated results. It is shown that this work confirms a bias previously observed with JEFF-3.1.1 (C/E-1 = −10.5 ± 2%. On the opposite, the experiment is in close agreement with 241Am thermal point reported in JEFF-3.2 (C/E-1 = 0.5 ± 2%.

  20. 76 FR 60733 - Safety Zone; Mississippi River, Mile Marker 230 to Mile Marker 234, in the Vicinity of Baton...

    Science.gov (United States)

    2011-09-30

    .... Basis and Purpose The Captain of the Port New Orleans has implemented a safety zone from mile marker 230... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Mississippi River, Mile Marker 230 to Mile Marker 234, in the Vicinity of Baton Rouge, LA AGENCY: Coast Guard, DHS. ACTION: Temporary final rule...

  1. Uranium contents and 234U/238U activity ratios of modern and fossil marine bivalle molluscan shells

    International Nuclear Information System (INIS)

    Mitsuda, Hiroshi

    1984-01-01

    Uranium contents and 234 U/ 238 U activity ratios in modern and fossil marine bivalle molluscan shells were measured by alpha-spectrometry. Uranium contents and 234 U/ 238 U activity ratios in modern shells were averaged to be 0.266 (dpm/g), and 1.18, respectively and those in fossil shells were averaged to be 0.747 (dpm/g), and 1.19, respectivily. Uranium contents in fossil shells were obviously higher than those in modern shells. It can be explained by the addition of uranium to shell during the deposition. In fossil shells, 234 U/ 238 U activity ratio decreases as 238 U content increases the same tendency is not found in modern shells. The author proposed a mechanism of selective loss of 238 U from the fossil shells for the explanation of this tendency. The height activity ratio of 234 U/ 238 U measured on the fossil shells than that measured on the modern shells, also support the selective loss of 238 U from the fossil shells. (author)

  2. 77 FR 32711 - 30-Day Notice of Proposed Information Collection: DS-234, Special Immigrant Visa Biodata Form...

    Science.gov (United States)

    2012-06-01

    ..., Refugees, and Migration, Office of Admissions (PRM/A). Form Number: DS-234. Respondents: Iraqi and Afghan... Population, Refugees and Migration. Dated: May 14, 2012. Kelly A. Gauger, Deputy Director, Office of Admissions, Bureau of Population, Refugees, and Migration, Department of State. [FR Doc. 2012-13343 Filed 5...

  3. @u234@@Th scavenging and particle export fluxes from the upper 100 m of the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Sarin, M.M.; Rengarajan, R.; Ramaswamy, V.

    We have determined the particle scavenging rates, export fluxes of @u234@@Th and settling particles from the upper 100 m of the Arabian Sea as a part of the JGOFS (India) Programme. The spatial and temporal measurements made in the open ocean...

  4. 33 CFR 2.34 - Waters subject to tidal influence; waters subject to the ebb and flow of the tide; mean high water.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Waters subject to tidal influence; waters subject to the ebb and flow of the tide; mean high water. 2.34 Section 2.34 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY GENERAL JURISDICTION Jurisdictional Terms § 2...

  5. 230Th-234U Age-Dating Uranium by Mass Spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Williams, R W; Gaffney, A M

    2012-04-18

    This is the standard operating procedure used by the Isotope Ratio Mass Spectrometry Group of the Chemical Sciences Division at LLNL for the preparation of a sample of uranium oxide or uranium metal for {sup 230}Th-{sup 234}U age-dating. The method described here includes the dissolution of a sample of uranium oxide or uranium metal, preparation of a secondary dilution, spiking of separate aliquots for uranium and thorium isotope dilution measurements, and purification of uranium and thorium aliquots for mass spectrometry. This SOP may be applied to uranium samples of unknown purity as in a nuclear forensic investigation, and also to well-characterized samples such as, for example, U{sub 3}O{sub 8} and U-metal certified reference materials. The sample of uranium is transferred to a quartz or PFA vial, concentrated nitric acid is added and the sample is heated on a hotplate at approximately 100 C for several hours until it dissolves. The sample solution is diluted with water to make the solution approximately 4 M HNO{sub 3} and hydrofluoric acid is added to make it 0.05 M HF. A secondary dilution of the primary uranium solution is prepared. Separate aliquots for uranium and thorium isotope dilution measurements are taken and spiked with {sup 233}U and {sup 229}Th, respectively. The spiked aliquot for uranium isotope dilution analysis is purified using EiChrom UTEVA resin. The spiked aliquot for thorium isotope dilution analysis is purified by, first, a 1.8 mL AG1x8 resin bed in 9 M HCl on which U adsorbs and Th passes through; second, adsorbing Th on a 1 mL AG1x8 resin bed in 8 M HNO{sub 3} and then eluting it with 9 M HCl followed by 0.1 M HCl + 0.005 M HF; and third, by passing the Th through a final 1.0 mL AG1x8 resin bed in 9 M HCl. The mass spectrometry is performed using the procedure 'Th and U Mass Spectrometry for {sup 230}Th-{sup 234}U Age Dating'.

  6. [Clinical analysis of 234 cases with congenital malformations of respiratory system].

    Science.gov (United States)

    Zhang, Wei-xi; Zhang, Hai-lin; Li, Chang-chong; Luo, Yun-chun; Cheng, Jian-min; Huang, Lei; Bai, Guang-hui

    2009-06-01

    To explore clinical characteristics, radiographic findings and diagnostic methods of patients with congenital malformations of respiratory system for enhancing the diagnosis of congenital malformations of respiratory system in children. Totally 234 patients with congenital malformations of respiratory system were chosen from the inpatient department of Yuying Children's Hospital Affiliated to Wenzhou Medical College from July 2003 to June 2008. The clinical presentations and radiographic findings of these children were analyzed. Of the 234 patients with congenital malformations of respiratory system, the age at diagnosis was between the first day and 14 years of age, mean age was 1.12 years. The main symptoms were persistent laryngeal stridor, recurrent wheezing, recurrent respiratory tract infections and dyspnea. Through the use of chest X-ray, spiral CT 3D reconstructions, fiberoptic bronchoscopy and other laboratory techniques, 213 cases were diagnosed as having single malformation and 21 cases were found to have multiple malformations. Of the 213 cases with single malformation, 97 cases had laryngeal malformation (congenital laryngeal stridor in 90 cases, congenital laryngeal webs in 5 cases and congenital laryngeal cyst in 2 cases), 35 cases had tracheal-bronchial malformation (congenital tracheobronchial stenosis in 17 cases, congenital abnormal bronchial origin in 7 cases, tracheobronchomalacia in 10 cases and tracheoesophageal fistula in 1 case), 43 cases had lung malformation (pulmonary sequestration in 5 cases, congenital lung cysts in 22 cases, congenital lobar emphysema in 1 case, agenesis of lung and hypoplasia of lung in 8 cases and congenital cystic adenomatoid malformation in 7 cases), 38 cases had diaphragm malformation, 28 cases had congenital tracheal-bronchial stenosis as confirmed by spiral CT 3D reconstructions and fiberoptic bronchoscopy. Ten cases with congenital abnormal bronchial origin were diagnosed with spiral CT 3D reconstructions

  7. Solubility of plutonium and americium-241 from rumen contents of cattle grazing on plutonium-contaminated desert vegetation in in vitro bovine gastrointestinal fluids - August 1975 to January 1977

    International Nuclear Information System (INIS)

    Barth, J.; Giles, K.R.; Brown, K.W.

    1985-01-01

    The alimentary solubility of plutonium and americium-241 ingested by cattle grazing at Area 13 of the Nevada Test Site and the Clean Slate II site on the Tonopah Test Range in Nevada was studied in a series of experiments. For each experiment, or trial, rumen contents collected from a fistulated steer or a normal animals at the time of sacrifice were incubated in simulated bovine gastrointestinal fluids, and the solubility of plutonium and americium was analyzed following the abomasal, duodenal, jejunal, and lower intestinal digestive states. For Area 13, the peak plutonium-238 solubilities ranged from 1.09 to 9.60 percent for animals grazing in the inner enclosure that surrounds ground zero (GZ); for animals grazing in the outer enclosure, the peaks ranged from 1.86 to 18.46%. The peak plutonium-239 solubilities ranged from 0.71 to 4.81% for animals from the inner enclosure and from 0.71 to 3.61% for animals from the outer enclosure. Plutonium-238 was generally more soluble than plutonium-239. Plutonium ingested by cattle grazing in the outer enclosure was usually more soluble than plutonium ingested by cattle grazing in the inner enclosure. The highest concentrations of plutonium in the rumen contents of cattle grazing in the inner enclosure were found in trials conducted during August and November 1975 and January 1976. These concentrations decreased during the February, May, and July 1976 trials. The decrease was followed by an increase in plutonium concentration during the November 1976 trial. The concentration of americium-241 followed the same trend. 13 references, 13 tables

  8. The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium

    International Nuclear Information System (INIS)

    Ketelaer, Jens

    2010-01-01

    The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium: Nuclear masses are an important quantity to study nuclear structure since they reflect the sum of all nucleonic interactions. Many experimental possibilities exist to precisely measure masses, out of which the Penning trap is the tool to reach the highest precision. Moreover, absolute mass measurements can be performed using carbon, the atomic-mass standard, as a reference. The new double-Penning trap mass spectrometer TRIGA-TRAP has been installed and commissioned within this thesis work, which is the very first experimental setup of this kind located at a nuclear reactor. New technical developments have been carried out such as a reliable non-resonant laser ablation ion source for the production of carbon cluster ions and are still continued, like a non-destructive ion detection technique for single-ion measurements. Neutron-rich fission products will be available by the reactor that are important for nuclear astrophysics, especially the r-process. Prior to the on-line coupling to the reactor, TRIGA-TRAP already performed off-line mass measurements on stable and long-lived isotopes and will continue this program. The main focus within this thesis was on certain rare-earth nuclides in the well-established region of deformation around N ∝ 90. Another field of interest are mass measurements on actinoids to test mass models and to provide direct links to the mass standard. Within this thesis, the mass of 241 Am could be measured directly for the first time. (orig.)

  9. The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium

    Energy Technology Data Exchange (ETDEWEB)

    Ketelaer, Jens

    2010-06-14

    The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium: Nuclear masses are an important quantity to study nuclear structure since they reflect the sum of all nucleonic interactions. Many experimental possibilities exist to precisely measure masses, out of which the Penning trap is the tool to reach the highest precision. Moreover, absolute mass measurements can be performed using carbon, the atomic-mass standard, as a reference. The new double-Penning trap mass spectrometer TRIGA-TRAP has been installed and commissioned within this thesis work, which is the very first experimental setup of this kind located at a nuclear reactor. New technical developments have been carried out such as a reliable non-resonant laser ablation ion source for the production of carbon cluster ions and are still continued, like a non-destructive ion detection technique for single-ion measurements. Neutron-rich fission products will be available by the reactor that are important for nuclear astrophysics, especially the r-process. Prior to the on-line coupling to the reactor, TRIGA-TRAP already performed off-line mass measurements on stable and long-lived isotopes and will continue this program. The main focus within this thesis was on certain rare-earth nuclides in the well-established region of deformation around N {proportional_to} 90. Another field of interest are mass measurements on actinoids to test mass models and to provide direct links to the mass standard. Within this thesis, the mass of {sup 241}Am could be measured directly for the first time. (orig.)

  10. Separation of strontium-90 and yttrium-90 in the presence of thorium-234 by dynamic ion chromatography

    International Nuclear Information System (INIS)

    Borai, E.H.; El-Sofany, E.A.

    2004-01-01

    A relatively rapid ( 90 Sr and 90 Y in the presence of 234 Th. The method joins ion-chromatography and on-line scintillation detection. Experiments were performed to characterize separation of the three radionuclides in an Ion Pac CS5 ion-exchange column under the influence of the following eluents: oxalic acid, diglycolic acid (DGA), α-hydroxy isobuteric acid (HIBA), and a mixture of hydrochloric acid and ammonium sulfate. Ammonium sulfate was the most effective of the eluents tested, yielding a resolution of 2.04 for strontium/yttrium and 1.03 for strontium/thorium. Within the limits of experimental uncertainty, the recoveries were quantitative for 90 Sr and 90 Y in the presence of 17 to 262 Bq x ml of 234 Th. (author)

  11. 234Th-based measurements of particle flux in surface water of the Bransfield Strait, western Antarctica

    International Nuclear Information System (INIS)

    Gulin, S.B.; National Academy of Sciences of Ukraine, Sevastopol, Autonomous Republic of Crimea

    2014-01-01

    Measurements of particulate and dissolved 234 Th were carried out in March 2002 in the Bransfield Strait located between the Antarctic Peninsula and the South Shetland Islands. The 234 Th/ 238 U disequilibrium found in the upper water column has allowed evaluation of downward particle fluxes across a frontal zone, which divides water masses coming from the Bellingshausen Sea and the Weddell Sea. The highest particle flux has been found in this mixing zone, where it was 3-5 times greater than in the adjacent waters. Total mass fluxes in the upper 150-m water column were estimated as about 2.2 g m -2 day -1 in the eastern part of the Strait and 3.1 g m -2 day -1 in the western area. (author)

  12. Study of some modern carbonated marine organisms, using U234/U238 activities and its uranium concentration

    International Nuclear Information System (INIS)

    Pregnolatto, Y.

    1975-01-01

    Several types of alive carbonated organisms of marine fluvial or mixed environment origin were analized in its concentrations of Uranium and about its activity ratio U 234 /U 238 . In the same way measurements were made from the water of these three types of environments. The results indicate that the mollusks shells show a very low concentration compared with corals. Its concentration varies from 0.04 to 0.33 ppm. Inside the limit of errors we can say that the several types of carbonated organisms show the same disequilibrium U 234 /U 238 which was found in associated waters. An analysis of a piece of wood from long time immersed in the sea water was made. The result indicates that there was a marked high in concentration of Uranium due to chelatation with organic matter. (C.D.G.) [pt

  13. The rotationally modulated Zeeman spectrum at nearly 10 to the 9th Gauss of the white dwarf PG 1031 + 234

    Science.gov (United States)

    Latter, William B.; Schmidt, Gary D.; Green, Richard F.

    1987-01-01

    Detailed analyses are performed of high-quality, phase-resolved CCD spectroscopy of the absorption-line spectrum throughout its rotation period of the new white dwarf PG 1031 + 234. The spectral variations are discussed and compared with new theoretical calculations of the behavior of hydrogen in strong magnetic fields. This analysis is then extended through a modeling procedure which produces a synthetic magnetically distorted spectrum for a star of arbitrary field strength and structure. The results confirm that PG 1031 + 234 possesses the strongest field yet detected on a white dwarf, with regions on the surface spanning the range of about 200 to nearly 1000 MG. The spectroscopic data reflect a field pattern containing a slightly offset global component of polar field strength of about 500 MG together with a localized magnetic 'spot' whose central field approaches 2000 MG.

  14. Defense In-Depth Accident Analysis Evaluation of Tritium Facility Bldgs. 232-H, 233-H, and 234-H

    International Nuclear Information System (INIS)

    Blanchard, A.

    1999-01-01

    'The primary purpose of this report is to document a Defense-in-Depth (DID) accident analysis evaluation for Department of Energy (DOE) Savannah River Site (SRS) Tritium Facility Buildings 232-H, 233-H, and 234-H. The purpose of a DID evaluation is to provide a more realistic view of facility radiological risks to the offsite public than the bounding deterministic analysis documented in the Safety Analysis Report, which credits only Safety Class items in the offsite dose evaluation.'

  15. Improved synthetic route to quinoxyfen photometabolite 2-chloro-10-fluorochromeno[2,3,4-de]quinoline.

    Science.gov (United States)

    Johnson, Peter L; Kister, Jeremy; Thornburgh, Scott

    2017-08-01

    Quinoxyfen is a fungicide developed by Dow AgroSciences for the control of powdery mildew. Re-registration studies required gram quantities of 2-chloro-10-fluorochromeno[2,3,4-de]quinoline, a photometabolite of quinoxyfen. The only previous method of preparation of this photometabolite was by photolysis of quinoxyfen in less than 1% yield. Therefore, a new method allowing for the preparation of this photometabolite in gram quantities was required. Several different metal catalyzed intramolecular cyclization approaches were investigated for the synthesis of 2-chloro-10-fluorochromeno[2,3,4-de]quinoline. While most methods failed to provide the desired product from a 2-bromophenyl derivative of quinoxyfen, a novel one-pot two-step synthesis led to the desired material in good yield from quinoxyfen. A short and efficient synthetic route was developed to access 2-chloro-10-fluorochromeno[2,3,4-de]quinoline from readily available (4-fluoro-2-hydroxyphenyl)boronic acid and quinoxyfen and was found to be scalable, which enabled the preparation of the desired photometabolite in gram quantities thus meeting material requirements to complete regulatory studies for the re-registration of quinoxyfen. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  16. 234U/238U evidence for local recharge and patterns of groundwater flow in the vicinity of Yucca Mountain, Nevada, USA

    Science.gov (United States)

    Paces, J.B.; Ludwig, K. R.; Peterman, Z.E.; Neymark, L.A.

    2002-01-01

    Uranium concentrations and 234U/238U ratios in saturated-zone and perched ground water were used to investigate hydrologic flow and downgradient dilution and dispersion in the vicinity of Yucca Mountain, a potential high-level radioactive waste disposal site. The U data were obtained by thermal ionization mass spectrometry on more than 280 samples from the Death Valley regional flow system. Large variations in both U concentrations (commonly 0.6-10 ??g 1-1) and 234U/238U activity ratios (commonly 1.5-6) are present on both local and regional scales; however, ground water with 234U/238U activity ratios from 7 up to 8.06 is restricted largely to samples from Yucca Mountain. Data from ground water in the Tertiary volcanic and Quaternary alluvial aquifers at and adjacent to Yucca Mountain plot in 3 distinct fields of reciprocal U concentration versus 234U/238U activity ratio correlated to different geographic areas. Ground water to the west of Yucca Mountain has large U concentrations and moderate 234U/238U whereas ground water to the east in the Fortymile flow system has similar 234U/238U, but distinctly smaller U concentrations. Ground water beneath the central part of Yucca Mountain has intermediate U concentrations but distinctive 234U/238U activity ratios of about 7-8. Perched water from the lower part of the unsaturated zone at Yucca Mountain has similarly large values of 234U/238U. These U data imply that the Tertiary volcanic aquifer beneath the central part of Yucca Mountain is isolated from north-south regional flow. The similarity of 234U/238U in both saturated- and unsaturated-zone ground water at Yucca Mountain further indicates that saturated-zone ground water beneath Yucca Mountain is dominated by local recharge rather than regional flow. The distinctive 234U/238U signatures also provide a natural tracer of downgradient flow. Elevated 234U/238U in ground water from two water-supply wells east of Yucca Mountain are interpreted as the result of induced

  17. 206Pb-230Th-234U-238U and 207Pb-235U geochronology of Quaternary opal, Yucca Mountain, Nevada

    Science.gov (United States)

    Neymark, Leonid A.; Amelin, Yuri V.; Paces, James B.

    2000-01-01

    U–Th–Pb isotopic systems have been studied in submillimeter-thick outermost layers of Quaternary opal occurring in calcite–silica fracture and cavity coatings within Tertiary tuffs at Yucca Mountain, Nevada, USA. These coatings preserve a record of paleohydrologic conditions at this site, which is being evaluated as a potential high-level nuclear waste repository. The opal precipitated from groundwater is variably enriched in 234U (measured 234U/238U activity ratio 1.124–6.179) and has high U (30–313 ppm), low Th (0.008–3.7 ppm), and low common Pb concentrations (measured 206Pb/204Pb up to 11,370). It has been demonstrated that the laboratory acid treatment used in this study to clean sample surfaces and to remove adherent calcite, did not disturb U–Th–Pb isotopic systems in opal. The opal ages calculated from 206Pb∗/238U and 207Pb∗/235U ratios display strong reverse discordance because of excess radiogenic 206Pb∗ derived from the elevated initial 234U. The data are best interpreted using projections of a new four-dimensional concordia diagram defined by 206Pb∗/238U, 207Pb∗/235U, 234U/238Uactivity, and 230Th/238Uactivity. Ages and initial 234U/238U activity ratios have been calculated using different projections of this diagram and tested for concordance. The data are discordant, that is observed 207Pb∗/235U ages of 170 ± 32 (2σ) to 1772 ± 40 ka are systematically older than 230Th/U ages of 34.1 ± 0.6 to 452 ± 32 ka. The age discordance is not a result of migration of uranium and its decay products under the open system conditions, but a consequence of noninstantaneous growth of opal. Combined U–Pb and 230Th/U ages support the model of slow mineral deposition at the rates of millimeters per million years resulting in layering on a scale too fine for mechanical sampling. In this case, U–Pb ages provide more accurate estimates of the average age for mixed multiage samples than 230Th/U ages, because ages based on shorter

  18. Update of JAEA-TDB. Additional selection of thermodynamic data for solid and gaseous phases on nickel, selenium, zirconium, technetium, thorium, uranium, neptunium plutonium and americium, update of thermodynamic data on iodine, and some modifications

    International Nuclear Information System (INIS)

    Kitamura, Akira; Fujiwara, Kenso; Doi, Reisuke; Yoshida, Yasushi

    2012-07-01

    We additionally selected thermodynamic data for solid and gaseous phases of nickel, selenium, zirconium, technetium, thorium, uranium, neptunium, plutonium and americium to our thermodynamic database JAEA-TDB for geological disposal of radioactive waste of high-level and TRU wastes. We thermodynamically obtained equilibrium constant from addition and subtraction of Gibbs free energy of formation on nickel, selenium, zirconium, technetium, thorium, uranium, neptunium plutonium and americium, which were selected in the Thermochemical Database Project by the Nuclear Energy Agency in the Organisation for Economic Co-operation and Development. Furthermore, we collected and updated thermodynamic data on iodine, changed master species of technetium(IV), and added thermodynamic data on selenium due to improving reliability of the thermodynamic database. We prepared text files of the updated thermodynamic database (JAEA-TDB) for geochemical calculation programs of PHREEQC, EQ3/6 and Geochemist's Workbench. These text files are contained in the attached CD-ROM and will be available on our Website (http://migrationdb.jaea.go.jp/). (author)

  19. Structure of the Cellulose Synthase Complex of Gluconacetobacter hansenii at 23.4 Å Resolution.

    Directory of Open Access Journals (Sweden)

    Juan Du

    Full Text Available Bacterial crystalline cellulose is used in biomedical and industrial applications, but the molecular mechanisms of synthesis are unclear. Unlike most bacteria, which make non-crystalline cellulose, Gluconacetobacter hansenii extrudes profuse amounts of crystalline cellulose. Its cellulose synthase (AcsA exists as a complex with accessory protein AcsB, forming a 'terminal complex' (TC that has been visualized by freeze-fracture TEM at the base of ribbons of crystalline cellulose. The catalytic AcsAB complex is embedded in the cytoplasmic membrane. The C-terminal portion of AcsC is predicted to form a translocation channel in the outer membrane, with the rest of AcsC possibly interacting with AcsD in the periplasm. It is thus believed that synthesis from an organized array of TCs coordinated with extrusion by AcsC and AcsD enable this bacterium to make crystalline cellulose. The only structural data that exist for this system are the above mentioned freeze-fracture TEM images, fluorescence microscopy images revealing that TCs align in a row, a crystal structure of AcsD bound to cellopentaose, and a crystal structure of PilZ domain of AcsA. Here we advance our understanding of the structural basis for crystalline cellulose production by bacterial cellulose synthase by determining a negative stain structure resolved to 23.4 Å for highly purified AcsAB complex that catalyzed incorporation of UDP-glucose into β-1,4-glucan chains, and responded to the presence of allosteric activator cyclic diguanylate. Although the AcsAB complex was functional in vitro, the synthesized cellulose was not visible in TEM. The negative stain structure revealed that AcsAB is very similar to that of the BcsAB synthase of Rhodobacter sphaeroides, a non-crystalline cellulose producing bacterium. The results indicate that the crystalline cellulose producing and non-crystalline cellulose producing bacteria share conserved catalytic and membrane translocation components, and

  20. Corrective Action Investigation Plan for Corrective Action Unit 234: Mud Pits, Cellars, and Mud Spills, Nevada Test Site, Nevada, Revision 0

    International Nuclear Information System (INIS)

    Grant Evenson

    2007-01-01

    Corrective Action Unit 234, Mud Pits, Cellars, and Mud Spills, consists of 12 inactive sites located in the north and northeast section of the NTS. The 12 CAU 234 sites consist of mud pits, mud spills, mud sumps, and an open post-test cellar. The CAU 234 sites were all used to support nuclear testing conducted in the Yucca Flat and Rainier Mesa areas during the 1950s through the 1970s. The CASs in CAU 234 are being investigated because hazardous and/or radioactive constituents may be present in concentrations that could potentially pose a threat to human health and the environment. Existing information on the nature and extent of potential contamination is insufficient to evaluate and recommend corrective action alternatives for the CASs. Additional information will be generated by conducting a CAI before evaluating and selecting appropriate corrective action alternatives

  1. Fabrication of targets for transmutation of americium : synthesis of inertial matrix by sol-gel method. Procedure study on the infiltration of a radioactive solutions

    International Nuclear Information System (INIS)

    Fernandez Carretero, A.

    2002-01-01

    addition a new and unexpected phase formed by the reaction of americium with spinel during the high temperature synthesis process has been identified. This new phase could provide a unique menas to stabilise Am in one particular oxidation state. (Author)

  2. Measurement of the U-234(n,f) cross section with PPAC detectors at the nTOF facility

    International Nuclear Information System (INIS)

    Dobarro, C.P.

    2005-06-01

    The aim of this work was twofold: to measure the 234 U neutron-induced fission cross section in an extended energy range with an unprecedented resolution, and, in the process, to validate the experimental method we used at the new n-TOF-CERN facility. The experiment was designed in order to take advantage of the unique characteristics of the n-TOF facility: the long flight path offers a high energy resolution and the high-intensity, instantaneous neutron flux greatly reduces the background from the sample activities, making it possible to measure highly radioactive samples. The fission detection setup is based on an innovative technique that benefits from the use of very thin targets and detectors. Up to nine targets of high purity fission samples are sandwiched by Parallel Plate Avalanche Counters (PPAC). When a fission event happens, the two complementary fission fragments are detected by the PPACs adjacent to the fissioning target in a narrow time coincidence. Because several targets are simultaneously placed in-beam, relative measurements with respect to reference nuclei can be obtained. In this work, an original data-reduction method has been developed to deal with the particular characteristics of both the n-TOF data acquisition system, which is based on very accurate Flash-ADC digitizers, and the fission detection setup. The data reduction includes the coincidence windows and the signal amplitude requirements that we obtained from preliminary data analysis. The applied coincidence method is very powerful for dealing with the background rejection such as contamination by α activity, which is quite high for 234 U, and the signals produced by highly energetic reactions in the detectors. The data-reduction method also implements the fission event reconstruction using the position information obtained from the stripped cathodes and the delay line readout, which makes it possible to determine the fission fragment angular distributions, and the time-of-flight to

  3. A simple method of uranium extraction from carbonate ground water and its application to 234U/238U disequilibrium studies

    International Nuclear Information System (INIS)

    Gascoyne, M.

    1981-01-01

    Uranium in solution in limestone groundwaters is found to absorb on strongly basic anion exchange resin without requiring preconditioning of the water. Adsorption efficiencies of 50-100 % have been measured in eight field trials, which include seven seepage sites in four North American caves. Generally good agreement is found between 234 U/ 238 U ratios in the seepage water and associated calcite deposit (stalactites and stalagmites). The simplicity and compactness of this method of uranium preconcentration makes it especially suitable for determination of uranium isotopic variations in remote or restricted environments. (Auth.)

  4. Study of the $^{234}$U(n,f) fission fragment angular distribution at the CERN n_TOF facility

    CERN Document Server

    Cidoncha-Leal, E; Paradela, C; Tarrío, D; Leong, L S; Audouin, L; Tassan-Got, L; Altstadt, S; Andrzejewski, J; Barbagallo, M; Bécares, V; Becvár, F; Belloni, F; Berthoumieux, E; Billowes, J; Boccone, V; Bosnar, D; Brugger, M; Calviani, M; Calviño, F; Cano-Ott, D; Carrapiço, C; Cerutti, F; Chiaveri, E; Chin, M; Colonna, N; Cortés, G; Cortés-Giraldo, M A; Diakaki, M; Domingo-Pardo, C; Dressler, R; Dzysiuk, N; Eleftheriadis, C; Ferrari, A; Fraval, K; Ganesan, S; García, A R; Giubrone, G; Gómez-Hornillos, M B; Gonçalves, I F; González-Romero, E; Griesmayer, E; Guerrero, C; Gunsing, F; Gurusamy, P; Hernández-Prieto, A; Jenkins, D G; Jericha, E; Kadi, Y; Käppeler, F; Karadimos, D; Kivel, N; Koehler, P; Kokkoris, M; Krticka, M; Kroll, J; Lampoudis, C; Langer, C; Lederer, C; Leeb, H; Losito, R; Mallick, A; Manousos, A; Marganiec, J; Martínez, T; Massimi, C; Mastinu, P F; Mastromarco, M; Meaze, M; Mendoza, E; Mengoni, A; Milazzo, P M; Mingrone, F; Mirea, M; Mondalaers, W; Pavlik, A; Perkowski, J; Plompen, A; Praena, J; Quesada, J M; Rauscher, T; Reifarth, R; Riego, A; Robles, M S; Roman, F; Rubbia, C; Sabaté-Gilarte, M; Sarmento, R; Saxena, A; Schillebeeckx, P; Schmidt, S; Schumann, D; Tagliente, G; Tain, J L; Tsinganis, A; Valenta, S; Vannini, G; Variale, V; Vaz, P; Ventura, A; Versaci, R; Vermeulen, M J; Vlachoudis, V; Vlastou, R; Wallner, A; Ware, T; Weigand, M; Weiß, C; Wright, T; Zugec, P

    2014-01-01

    The angular distribution of the f ssion fragments (FFAD) produced in neutron- induced reactions of actinides have been measured with a f ssion detection setup based on parallel-plate avalanche counters (PPACs) at the Neutron Time- Of-Flight (n_TOF) facility at CERN. The main features of the setup and pre- liminary results are reported here forthe 234 U(n,f)reaction measurement show- ing a high concordance with previous data, while providing new results up to 100 MeV.

  5. Neutron Capture Cross Sections and Gamma Emission Spectra from Neutron Capture on 234,236,238U Measured with DANCE

    Science.gov (United States)

    Ullmann, J. L.; Mosby, S.; Bredeweg, T. A.; Couture, A. J.; Haight, R. C.; Jandel, M.; Kawano, T.; O'Donnell, J. M.; Rundberg, R. S.; Vieira, D. J.; Wilhelmy, J. B.; Wu, C.-Y.; Becker, J. A.; Chyzh, A.; Baramsai, B.; Mitchell, G. E.; Krticka, M.

    2014-05-01

    A new measurement of the 238U(n, γ) cross section using a thin 48 mg/cm2 target was made using the DANCE detector at LANSCE over the energy range from 10 eV to 500 keV. The results confirm earlier measurements. Measurements of the gamma-ray emission spectra were also made for 238U(n, γ) as well as 234,236U(n, γ). These measurements help to constrain the radiative strength function used in the cross-section calculations.

  6. Americium behaviour in plastic vessels

    Energy Technology Data Exchange (ETDEWEB)

    Legarda, F.; Herranz, M. [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain); Idoeta, R., E-mail: raquel.idoeta@ehu.e [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain); Abelairas, A. [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain)

    2010-07-15

    The adsorption of {sup 241}Am dissolved in water in different plastic storage vessels was determined. Three different plastics were investigated with natural and distilled waters and the retention of {sup 241}Am by these plastics was studied. The same was done by varying vessel agitation time, vessel agitation speed, surface/volume ratio of water in the vessels and water pH. Adsorptions were measured to be between 0% and 70%. The adsorption of {sup 241}Am is minimized with no water agitation, with PET or PVC plastics, and by water acidification.

  7. Americium behaviour in plastic vessels

    International Nuclear Information System (INIS)

    Legarda, F.; Herranz, M.; Idoeta, R.; Abelairas, A.

    2010-01-01

    The adsorption of 241 Am dissolved in water in different plastic storage vessels was determined. Three different plastics were investigated with natural and distilled waters and the retention of 241 Am by these plastics was studied. The same was done by varying vessel agitation time, vessel agitation speed, surface/volume ratio of water in the vessels and water pH. Adsorptions were measured to be between 0% and 70%. The adsorption of 241 Am is minimized with no water agitation, with PET or PVC plastics, and by water acidification.

  8. Early hominid stone tool production and technical skill 2.34 Myr ago in West Turkana, Kenya.

    Science.gov (United States)

    Roche, H; Delagnes, A; Brugal, J P; Feibel, C; Kibunjia, M; Mourre, V; Texier, P J

    1999-05-06

    Well-documented Pliocene archaeological sites are exceptional. At present they are known only in East Africa, in the Hadar and Shungura formations of Ethiopia and in the Nachukui formation of Kenya. Intensive archeological survey and a series of test excavations conducted in the Nachukui formation since 1987 have led to the discovery of more than 25 archaeological sites whose ages range from 2.34 to 0.7 million years before present (Myr), and to the extensive excavation of two 2.34-Myr sites, Lokalalei 1 in 1991 and Lokalalei 2C in 1997. Lokalalei 2C yielded nearly 3,000 archaeological finds from a context of such good preservation that it was possible to reconstitute more than 60 sets of complementary matching stone artefacts. These refits, predating the Koobi Fora refits by 500 Kyr, are the oldest ever studied. Here we describe a technological analysis of the core reduction sequences, based on these refits, which allows unprecedented accuracy in the understanding of flake production processes. We can thus demonstrate greater cognitive capacity and motor skill than previously assumed for early hominids, and highlight the diversity of Pliocene technical behaviour.

  9. 234U and 238U concentration in brine from geopressured aquifers of the northern Gulf of Mexico basin

    Science.gov (United States)

    Kraemer, Thomas F.

    1981-12-01

    The 234U and 238U concentration in brine from six Gulf Coast geopressured aquifers has been determined. The results reveal very low uranium concentrations (from 0.003 to 0.03 μg/l) and uranium activity ratios slightly greater than unity (from 1.06 to 1.62). Reducing conditions within the aquifers are responsible for the low uranium concentrations. The uranium activity ratios observed are well below those calculated using theoretical considerations of alpha-particle recoil effects. This can be explained by interference with alpha-recoil nuclides entering the liquid phase as a result of quartz overgrowths on sand grains and high-temperature re-equilibration that tends to minimize the effects of the alpha-recoil process. The fact that the uranium activity ratios of the brines are slightly greater than unity instead of the equilibrium value of 1.000 indicates that either the alpha particle recoil blocking and re-equlibration effects are not complete or that another process is operative that enriches the fluid in excess 234U by selectively removing uranium from radiation induced damage sites in the mineral (sand grain) matrix.

  10. Metal-Catalyzed Cyclization Reactions of 2,3,4-Trien-1-ols: A Joint Experimental-Computational Study.

    Science.gov (United States)

    Alcaide, Benito; Almendros, Pedro; Cembellín, Sara; Fernández, Israel; Martínez Del Campo, Teresa

    2016-08-08

    Controlled preparation of tri- and tetrasubstituted furans, as well as carbazoles has been achieved through chemo- and regioselective metal-catalyzed cyclization reactions of cumulenic alcohols. The gold- and palladium-catalyzed cycloisomerization reactions of cumulenols, including indole-tethered 2,3,4-trien-1-ols, to trisubstituted furans was effective, due to a 5-endo-dig oxycyclization by attack of the hydroxy group onto the central cumulene double bond. In contrast, palladium-catalyzed heterocyclization/coupling reactions with 3-bromoprop-1-enes furnished tetrasubstituted furans. Also studied was the palladium-catalyzed cyclization/coupling sequence involving protected indole-tethered 2,3,4-trien-1-ols and 3-bromoprop-1-enes that exclusively generated trisubstituted carbazole derivatives. These results could be explained through a selective 6-endo-dig cumulenic hydroarylation, followed by aromatization. DFT calculations were carried out to understand this difference in reactivity. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Origin and geochemical behavior of uranium in marine sediments. Utilization of the 234U/238U ratio in marine geochemistry

    International Nuclear Information System (INIS)

    Organo, Catherine

    1997-01-01

    The first part of this thesis presents the current situation of knowledge of uranium in marine environment. The second part describes the methods of analysis as well as the material support of the study, i.e., the sediments and marine deposits investigated. The third part is dedicated to the study of uranium mobility in marine sediments characterized by detrital terrigenous composition (pelagic clays). This approach allowed quantifying the entering and leaving flux of uranium after the sediment settling and, to discuss, on this basis, the consequences on the uranium oceanic balance. In the third part the origin and behavior of uranium in zones of high surface productivity is studied. The uranium enrichments observed in the hemi-pelagic sediments of the EUMELI (J.G.O.F.S.-France) programme will constitute a material of study adequate for measuring the variations in the 234 U/2 38U ratio in solid phase, in response to the oxido-reducing characteristics of the sediment. Thus establishing the origin of the trapped uranium has been possible. Also, the nature of the sedimentary phases related to uranium in bio-genetic sediments in the Austral Ocean was determined. Thus a relationship between the variations in the 234 U/ 238 and the diagenetic transformations was possible to establish. Finally in the fifth part a study of the behavior of uranium in a polymetallic shell characteristic for deposits of hydrogenized origin

  12. 230Th/234U dating of the quaternary spring travertines in the Arava Rift Valley of Israel and paleoclimatic implications

    International Nuclear Information System (INIS)

    Kronfeld, J.

    1988-07-01

    Springs and lake deposits (travertines) sampled along the western margins of the Arava segment of the Dead Sea Rift Valley, Israel, were studied as a potential source of palaeoclimatic information. The 230 Th/ 234 U disequilibrium method was used to determine the age of the investigated deposits. The radiometric dating was supplemented by detailed petrographic and chemical analyses of the collected samples. Detailed petrographic observations of the analysed travertine samples suggest their deposition under moderately-arid conditions, alternating with arid to extremely arid periods. This evidence is consistent with the preliminary conclusions drawn from palynological studies in the area. Dating by the 230 Th/ 234 U disequilibrium method indicates that most travertine ages correspond to oceanic 18 O stages 5 and 7. The good correspondence between apparent ages as deduced from the position of the travertines in vertical and lateral successions and the radiometric ages, lends credibility to the radiometric ages. The clustering of ages during the warm 18 O stages bears similarity to the temporal distribution of middle to late Pleistocene sapropelic horizons in the Eastern Mediterranean Basin which further leads to suspicion that during insolation maxima monsoonal cells originating in the Indian Ocean have shifted northwards reaching the latitude of the Arava and Negev Highlands. Refs and figs

  13. Uranium concentrations and 234U/238U activity ratios in fault-associated groundwater as possible earthquake precursors

    International Nuclear Information System (INIS)

    Finkel, R.C.

    1981-01-01

    In order to assess the utility of uranium isotopes as fluid phase earthquake precursors, uranium concentrations and 234 U/ 238 U activity ratios have been monitored on a monthly or bimonthly basis in water from 24 wells and springs associated with Southern California fault zones. Uranium concentrations vary from 0.002 ppb at Indian Canyon Springs on the San Jacinto fault to 8.3 ppb at Lake Hughes well on the San Andreas fault in the Palmdale area. 234 U/ 238 U activity ratios vary from 0.88 at Agua Caliente Springs on the Elsinore fault to 5.4 at Niland Slab well on the San Andreas fault in the Imperial Valley. There was one large earthquake in the study area during 1979, the 15 October 1979 M = 6.6 Imperial Valley earthquake. Correlated with this event, uranium concentrations varied by a factor of more than 60 and activity ratios by a factor of 3 at the Niland Slab site, about 70 km from the epicenter. At the other sites monitored, uranium concentrations varied in time, but with no apparent pattern, while uranium activity ratios remained essentially constant throughout the monitoring period

  14. sup 230 Th/ sup 234 U dates of late Pleistocene corals from Kita- and Minami-Diato Island, Okinawa, Japan

    Energy Technology Data Exchange (ETDEWEB)

    Omura, Akio; Iwata, Hideki (Kanazawa Univ. (Japan). Faculty of Science); Ota, Yoko; Koba, Motoharu; Kawana, Toshio

    1991-06-01

    Alpha spectrometric Th-230/U-234 dating was applied to 50 Pleistocene corals from Kita- and Minami-Daito Islands, both have been well known as the noteworthy representatives of raised atolls. The Th-230/U-234 dates ranged from 113{+-}6 to 133{+-}6 ka (123{+-}1 ka on average) in the autochthonous corals from Kita-, and from 111{+-}5 to 159{+-}10 ka (123{+-}1 ka on average) in those from Minami-Daito Island, intimating that the fringing reefs have been developed during the high sea level stand of the last interglacial maximum. These dates are correlative to the oxygen isotope stage 5e. The upper limit of occurrence of the dated autochthonous corals was 8.1 m in Kita- and 11 m in Minami-Daito Island. Besides, the somewhat younger dates corresponding to OIS-5a or 5c were obtained from some allochthonous corals in a detrital limestone unit in Kita-Daito Island. However, hermatypic corals were alive, forming small scale reefs in shallow sea around Kita-Daito Island. The former shoreline was proved by the presence of raised surf bench at some localities, where the dated autochthonous corals were collected. (K.I.).

  15. The estuarine chemistry and isotope systematics of 234,238U in the Amazon and Fly Rivers

    Science.gov (United States)

    Swarzenski, P.; Campbell, P.; Porcelli, D.; McKee, B.

    2004-01-01

    Natural concentrations of 238U and ??234U values were determined in estuarine surface waters and pore waters of the Amazon and Fly (Papua New Guinea) Rivers to investigate U transport phenomena across river-dominated land-sea margins. Discharge from large, tropical rivers is a major source of dissolved and solid materials transported to the oceans, and are important in defining not only oceanic mass budgets, but also terrestrial weathering rates. On the Amazon shelf, salinity-property plots of dissolved organic carbon, pH and total suspended matter revealed two vastly contrasting water masses that were energetically mixed. In this mixing zone, the distribution of uranium was highly non-conservative and exhibited extensive removal from the water column. Uranium removal was most pronounced within a salinity range of 0-16.6, and likely the result of scavenging and flocculation reactions with inorganic (i.e., Fe/Mn oxides) and organic colloids/particles. Removal of uranium may also be closely coupled to exchange and resuspension processes at the sediment/water interface. An inner-shelf pore water profile indicated the following diagenetic processes: extensive (???1 m) zones of Fe(III) - and, to a lesser degree, Mn(IV) - reduction in the absence of significant S(II) concentrations appeared to facilitate the formation of various authigenic minerals (e.g., siderite, rhodocrosite and uraninite). The pore water dissolved 238U profile co-varied closely with Mn(II). Isotopic variations as evidenced in ??234U pore waters values from this site revealed information on the origin and history of particulate uranium. Only after a depth of about 1 m did the ??234U value approach unity (secular equilibrium), denoting a residual lattice bound uranium complex that is likely an upper-drainage basin weathering product. This suggests that the enriched ??234U values represent a riverine surface complexation product that is actively involved in Mn-Fe diagenetic cycles and surface

  16. The estuarine chemistry and isotope systematics of 234,238U in the Amazon and Fly Rivers

    Science.gov (United States)

    Swarzenski, Peter; Campbell, Pamela; Porcelli, Don; McKee, Brent

    2004-12-01

    Natural concentrations of 238U and δ234U values were determined in estuarine surface waters and pore waters of the Amazon and Fly (Papua New Guinea) Rivers to investigate U transport phenomena across river-dominated land-sea margins. Discharge from large, tropical rivers is a major source of dissolved and solid materials transported to the oceans, and are important in defining not only oceanic mass budgets, but also terrestrial weathering rates. On the Amazon shelf, salinity-property plots of dissolved organic carbon, pH and total suspended matter revealed two vastly contrasting water masses that were energetically mixed. In this mixing zone, the distribution of uranium was highly non-conservative and exhibited extensive removal from the water column. Uranium removal was most pronounced within a salinity range of 0-16.6, and likely the result of scavenging and flocculation reactions with inorganic (i.e., Fe/Mn oxides) and organic colloids/particles. Removal of uranium may also be closely coupled to exchange and resuspension processes at the sediment/water interface. An inner-shelf pore water profile indicated the following diagenetic processes: extensive (˜1 m) zones of Fe(III)—and, to a lesser degree, Mn(IV)—reduction in the absence of significant S(II) concentrations appeared to facilitate the formation of various authigenic minerals (e.g., siderite, rhodocrosite and uraninite). The pore water dissolved 238U profile co-varied closely with Mn(II). Isotopic variations as evidenced in δ234U pore waters values from this site revealed information on the origin and history of particulate uranium. Only after a depth of about 1 m did the δ234U value approach unity (secular equilibrium), denoting a residual lattice bound uranium complex that is likely an upper-drainage basin weathering product. This suggests that the enriched δ234U values represent a riverine surface complexation product that is actively involved in Mn-Fe diagenetic cycles and surface

  17. Internal tides and sediment dynamics in the deep sea-Evidence from radioactive Th-234/U-238 disequilibria

    International Nuclear Information System (INIS)

    Turnewitsch, R.; Turnewitsch, R.; Waniek, J.J.; Reyss, J.L.; Nycander, J.; Lampitt, R.S.

    2008-01-01

    Residual flow, baro-tropic tides and internal (baro-clinic) tides interact in a number of ways with kilometer-scale sea floor topography such as abyssal hills and sea mounts. Because of their likely impact on vertical mixing such interactions are potentially important for ocean circulation and the mechanisms and the geometry of these interactions are a matter of ongoing studies. In addition, very little is known about how these interactions are reflected in the sedimentary record. This multi-year study investigates if flow/topography interactions are reflected in distributional patterns of the natural short-lived (half-life: 24.1 d) particulate-matter tracer 234 Th relative to its conservative (non-particle-reactive) and very long-lived parent nuclide 238 U. The sampling sites were downstream of, or surrounded by, fields of short sea mounts and, therefore, very likely to be influenced by nearby flow/topography interactions. At the sampling sites between about 200 and 1000 m above the sea floor recurrent 'fossil' disequilibria were detected. 'Fossil' disequilibria are defined by clearly detectable 234 Th/ 238 U disequilibria (total 234 Th radioactivity ≤ 238 U radioactivity, indicating a history of intense particulate 234 Th scavenging and particulate-matter settling from the sampled parcel of water) and conspicuously low particle-associated 234 Th activities. 'Fossil' disequilibria were centered at levels in the water column that correspond to the average height of the short sea mounts near the sampling sites. This suggests the 'fossil' disequilibria are formed on the sea mount slopes. Moreover, the magnitude of the 'fossil' disequilibria suggests that the slopes of the short sea mounts in the study region are characterized by particularly vigorous fluid dynamics. Since 'fossil' disequilibria already occurred at ∼ O (1-10 km) away from the sea mount slopes it is likely that these vigorous fluid dynamics rapidly decay away from the slopes on scales of O (1-10 km

  18. EURADOS action for determination of americium in skull measures in vivo and Monte Carlo simulation; Accion EURADOS para la determinacion de americio en craneo mediante medidas in-vivo y simulacion Monte Carlo

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Ponte, M. A.; Navarro Amaro, J. F.; Perez Lopez, B.; Navarro Bravo, T.; Nogueira, P.; Vrba, T.

    2013-07-01

    From the Group of WG7 internal dosimetry of the EURADOS Organization (European Radiation Dosimetry group, e.V.) which It coordinates CIEMAT, international action for the vivo measurement of americium has been conducted in three mannequins type skull with detectors of Germanium by gamma spectrometry and simulation by Monte Carlo methods. Such action has been raised as two separate exercises, with the participation of institutions in Europe, America and Asia. Other actions similar precede this vivo intercomparison of measurement and modeling Monte Carlo1. The preliminary results and associated findings are presented in this work. The laboratory of the body radioactivity (CRC) of service counter of dosimetry staff internal (DPI) of the CIEMAT, it has been one of the participants in vivo measures exercise. On the other hand part, the Group of numerical dosimetry of CIEMAT is participant of the Monte Carlo2 simulation exercise. (Author)

  19. Critical and shielding parametric studies with the Monte Carlo code TRIPOLI to identify the key points to take into account during the transportation of blanket assemblies with high ratio of americium

    International Nuclear Information System (INIS)

    Gosmain, Cecile-Aline

    2011-01-01

    In the framework of French research program on Generation IV sodium cooled fast reactor, one possible option consists in burning minor actinides in this kind of Advanced Sodium Technological Reactor. Two types of transmutation mode are studied in the world : the homogeneous mode of transmutation where actinides are scattered with very low enrichment ratio in fissile assemblies and the heterogeneous mode where fissile core is surrounded by blanket assemblies filled with minor actinides with ratio of incorporated actinides up to 20%. Depending on which element is considered to be burnt and on its content, these minor actinides contents imply constraints on assemblies' transportation between Nuclear Power Plants and fuel cycle facilities. In this study, we present some academic studies in order to identify some key constraints linked to the residual power and neutron/gamma load of such kind of blanket assemblies. To simplify the approach, we considered a modeling of a 'model cask' dedicated to the transportation of a unique irradiated blanket assembly loaded with 20% of Americium and basically inspired from an existent cask designed initially for the damaged fissile Superphenix assembly transport. Thermal calculations performed with EDF-SYRTHES code have shown that due to thermal limitations on cladding temperature, the decay time to be considered before transportation is 20 years. This study is based on explicit 3D representations of the cask and the contained blanket assembly with the Monte Carlo code TRIPOLI/JEFF3.1.1 library and concludes that after such a decay time, the transportation of a unique Americium radial blanket is feasible only if the design of our model cask is modified in order to comply with the dose limitation criterion. (author)

  20. Seasonal variations of total 234Th and dissolved 238U concentration activities in surface water of Bransfield Strait, Antarctica, from March to October 2011

    International Nuclear Information System (INIS)

    Lapa, Flavia V.; Oliveira, Joselene de; Costa, Alice M.R.; Braga, Elisabete S.

    2013-01-01

    In this study the naturally occurring radionuclides 234 Th and 238 U were used to investigate the magnitude of upper ocean particulate organic carbon export in Bransfield Strait, Southern Ocean. This region is the largest oceanic high-nitrate low-chlorophyll (HNLC) area in the world and is known to contribute to regulate of the atmospheric CO 2 via the biological pump. Due to its different geochemical behavior in seawater, the resulting U/Th disequilibria can be easily used to constrain the transport rates of particles and reaction processes between solution and particulate phases. Sampling occurred during the summer (March and November) 2011. Total 234 Th activities in surface seawater samples ranged from 1.3 to 3.7 dpm L -1 (station EB 011) during March/11 campaign, while in October/11 total 234 Th activity concentrations varied from 1.4 to 2.9 dpm L -1 . Highest total 234 Th activities were found late in the austral summer season. Activity concentrations of dissolved 238 U in surface seawater varied from 2.1 to 2.4 dpm L -1 . Taking into account all sampling stations established in March and October/11 the relative variability of total 234 Th distribution was 22%. (author)

  1. Seasonal variations of total {sup 234}Th and dissolved {sup 238}U concentration activities in surface water of Bransfield Strait, Antarctica, from March to October 2011

    Energy Technology Data Exchange (ETDEWEB)

    Lapa, Flavia V.; Oliveira, Joselene de; Costa, Alice M.R., E-mail: fvlapa@ipen.br, E-mail: jolivei@ipen.br, E-mail: lice_mrc@hotmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), Sao Paulo, SP (Brazil). Laboratorio de Radiometria Ambiental; Braga, Elisabete S., E-mail: edsbraga@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Inst. Oceanografico. Lab. de Nutrientes, Micronutrientes e Tracos nos Oceanos

    2013-07-01

    In this study the naturally occurring radionuclides {sup 234}Th and {sup 238}U were used to investigate the magnitude of upper ocean particulate organic carbon export in Bransfield Strait, Southern Ocean. This region is the largest oceanic high-nitrate low-chlorophyll (HNLC) area in the world and is known to contribute to regulate of the atmospheric CO{sub 2} via the biological pump. Due to its different geochemical behavior in seawater, the resulting U/Th disequilibria can be easily used to constrain the transport rates of particles and reaction processes between solution and particulate phases. Sampling occurred during the summer (March and November) 2011. Total {sup 234}Th activities in surface seawater samples ranged from 1.3 to 3.7 dpm L{sup -1} (station EB 011) during March/11 campaign, while in October/11 total {sup 234}Th activity concentrations varied from 1.4 to 2.9 dpm L{sup -1}. Highest total {sup 234}Th activities were found late in the austral summer season. Activity concentrations of dissolved {sup 238}U in surface seawater varied from 2.1 to 2.4 dpm L{sup -1}. Taking into account all sampling stations established in March and October/11 the relative variability of total {sup 234}Th distribution was 22%. (author)

  2. Fission Fragment Angular Distributions in the $^{234}$U(n,f) and $^{236}$U(n,f) reactions

    CERN Multimedia

    We propose to measure the fission fragment angular distribution (FFAD) of the $^{234}$U(n,f) and $^{236}$U (n,f) reactions with the PPAC detection setup used in previous n_TOF-14 experiment. This experiment would take advantage of the high resolution of the n_TOF facility to investigate the FFAD behaviour in the pronounced vibrational resonances that have been observed between 0.1 and 2 MeV for the thorium cycle isotopes. In addition, the angular distribution of these isotopes will be measured for the first time beyond 14 MeV. Furthermore, the experiment will also provide the fission cross section with reduced statistical uncertainty, extending the $^{236}$U(n,f) data up to 1 GeV

  3. Strict tropism for CD71+/CD234+human reticulocytes limits the zoonotic potential ofPlasmodium cynomolgi.

    Science.gov (United States)

    Kosaisavee, Varakorn; Suwanarusk, Rossarin; Chua, Adeline C Y; Kyle, Dennis E; Malleret, Benoit; Zhang, Rou; Imwong, Mallika; Imerbsin, Rawiwan; Ubalee, Ratawan; Sámano-Sánchez, Hugo; Yeung, Bryan K S; Ong, Jessica J Y; Lombardini, Eric; Nosten, François; Tan, Kevin S W; Bifani, Pablo; Snounou, Georges; Rénia, Laurent; Russell, Bruce

    2017-09-14

    Two malaria parasites of Southeast Asian macaques, Plasmodium knowlesi and P cynomolgi , can infect humans experimentally. In Malaysia, where both species are common, zoonotic knowlesi malaria has recently become dominant, and cases are recorded throughout the region. By contrast, to date, only a single case of naturally acquired P cynomolgi has been found in humans. In this study, we show that whereas P cynomolgi merozoites invade monkey red blood cells indiscriminately in vitro, in humans, they are restricted to reticulocytes expressing both transferrin receptor 1 (Trf1 or CD71) and the Duffy antigen/chemokine receptor (DARC or CD234). This likely contributes to the paucity of detectable zoonotic cynomolgi malaria. We further describe postinvasion morphologic and rheologic alterations in P cynomolgi -infected human reticulocytes that are strikingly similar to those observed for P vivax These observations stress the value of P cynomolgi as a model in the development of blood stage vaccines against vivax malaria.

  4. The new magnetic white dwarf PG 1031 + 234 - Polarization and field structure at more than 500 milion Gauss

    Science.gov (United States)

    Schmidt, Gary D.; West, Steven C.; Liebert, James; Green, Richard F.; Stockman, H. S.

    1986-01-01

    The discovery and study of a PG white dwarf which shows strong linear and circular polarization modulated with a rotation period of 3 hr 24 min is reported. The new star, PG 1031 + 234, is more highly magnetic than even Grw +70 deg 8247, with absorption components of hydrogen in its optical and UV spectra corresponding to fields from 200 to more than 500 MG. An asymmetric dependence of polarization on rotational phase shows that the surface field structure on the star is more complex than a simple centered dipole. The basic observational features can be well reproduced by a rotating star containing an oblique centered dipole punctuated near its magnetic equator by a high-field spot containing primarily radial field lines.

  5. Particle fluxes from 234Th measurements during the Clivar SR3 cruise in the Southern Ocean (spring 2001, South of Australia)

    Science.gov (United States)

    Savoye, N.; Buesseler, K.; Griffiths, B.; Dehairs, F.; Wrigth, S.; Pike, S.; Trull, T.

    2003-04-01

    Particle export from the ocean surface to the ocean interior represents an important component of the global carbon cycle. At present, one of the most promising ways to estimate export production is to measure the 234Th deficit in surface waters. Here we present 234Th fluxes at 100 m and 150 m from sampling along the CLIVAR SR3 transect (143^oE) in the Southern Ocean (eight stations between Australia and Antarctica) during austral spring (November--December 2001). The latitudinal pattern of the 234Th fluxes were similar, showing a general decrease between 47^oS (580 and 700 dpm m-2 d-1 at 100 m and 150 m, resp.) and 61^oS (ca. 300 and 60 dpm m-2 d-1 at 100 m and 150 m resp.). The 100 m fluxes at 54^o and 57^o were similar to the one at 61^oS. At 64^oS the 234Th fluxes were much higher at 100 m and 150 m (1350 and 1240 dpm m-2 d-1, resp.). Further south, near the continental shelf at 65^oS 234Th fluxes decreased again to ca. 500 dpm m-2 d-1. This latitudinal trend is consistent with the pattern of the primary production generally encountered along this transect but contrasts with the one of the mixed layer depth. The 64^oS and 61^oS stations were re-visited after a delay of 10 and 16 days, respectively. From the first to the second visit, the 100 m and 150 m fluxes at 64^oS slightly increased to reach 1670 and 1950 dpm m-2 d-1, respectively. However, at 61^oS fluxes strongly increased and reached 1410 and 1710 dpm m-2 d-1 at 100 m and 150 m, respectively. Except for the second visits and for the first visit of 64^oS station, 234Th fluxes were rather low (<700 dpm m-2 d-1), indicating early spring conditions in the plankton development. Subsequent increases of 234Th fluxes reflected progress of the growth season and/or changes in the water column stratification. We will also discuss carbon fluxes based on the POC/234Th ratio for sinking particles and for size-fractionated particles from a large volume settling column and from large volume size fractionated

  6. Measurements of the 234U(n,f) Reaction with a Frisch-Grid Ionization Chamber up to En=5 MeV

    OpenAIRE

    Al-Adili, Ali

    2013-01-01

    This study on the neutron-induced fission of 234U was carried out at the 7 MV Van de Graaff accelerator of IRMM in Belgium. A Twin Frisch-Grid Ionization Chamber (TFGIC) was used to study 234U(n,f) between En = 0.2 and 5.0 MeV. The reaction is important for fission modelling of the second-chance fission in 235U(n,f). The fission fragment (FF) angular-, energy and mass distributions were determined using the 2E-method highlighting especially the region of the vibrational resonance at En = 0.77...

  7. A concise route to branched erythrono-gamma-lactones. Synthesis of the leaf-closing substance potassium (+/-)-(2R,3R)-2,3,4-trihydroxy-2-methylbutanoate

    DEFF Research Database (Denmark)

    Pedersen, Daniel Sejer; Robinson, Tony V; Taylor, Dennis K

    2009-01-01

    -94% yield), including the natural plant lactone (+/-)-2-C-d-methylerythrono-1,4-lactone 1. The latter compound was treated with aqueous potassium hydroxide to afford potassium (+/-)-(2R,3R)-2,3,4-trihydroxy-2-methylbutanoate 2, which is a leaf-closing substance of Leucaena leucocephalam....

  8. Direct comparison of 210Po, 234Th and POC particle-size distributions and export fluxes at the Bermuda Atlantic Time-series Study (BATS) site.

    Science.gov (United States)

    Stewart, Gillian; Moran, S Bradley; Lomas, Michael W; Kelly, Roger P

    2011-05-01

    Particle-reactive, naturally occurring radionuclides are useful tracers of the sinking flux of organic matter from the surface to the deep ocean. Since the Joint Global Ocean Flux Study (JGOFS) began in 1987, the disequilibrium between (234)Th and its parent (238)U has become widely used as a technique to measure particle export fluxes from surface ocean waters. Another radionuclide pair, (210)Po and (210)Pb, can be used for the same purpose but has not been as widely adopted due to difficulty with accurately constraining the (210)Po/(210)Pb radiochemical balance in the ocean and because of the more time-consuming radiochemical procedures. Direct comparison of particle flux estimated in different ocean regions using these short-lived radionuclides is important in evaluating their utility and accuracy as tracers of particle flux. In this paper, we present paired (234)Th/(238)U and (210)Po/(210)Pb data from oligotrophic surface waters of the subtropical Northwest Atlantic and discuss their advantages and limitations. Vertical profiles of total and particle size-fractionated (210)Po and (234)Th activities, together with particulate organic carbon (POC) concentrations, were measured during three seasons at the Bermuda Atlantic Time-series Study (BATS) site. Both (210)Po and (234)Th reasonably predict sinking POC flux caught in sediment traps, and each tracer provides unique information about the magnitude and efficiency of the ocean's biological pump. Copyright © 2010 Elsevier Ltd. All rights reserved.

  9. Seasonal changes of 234Th scavenging in surface water across the western Black Sea: an implication of the cyclonic circulation patterns

    International Nuclear Information System (INIS)

    Gulin, S.B.

    2000-01-01

    Two seasonal surveys of 234 Th activity in surface water were carried out in November 1998 and June 1999 along the transect Sevastopol (Ukraine) - Istanbul (Turkey) crossing the entire western Black Sea between the SW Crimean Peninsula and the Bosphorus Strait entry. A steady-state model of 234 Th/ 238 U equilibrium in seawater was used to calculate the net removal flux of 234 Th by particles. The results obtained from central stations of the transect were in good agreement with those observed seasonally in 1992-1994 within the western cyclonic gyre of the abyssal Black Sea, showing that in June 1999 the sampling was conducted during the peak summer bloom of coccolithophorids, while in November 1998 the samples were collected three weeks after the autumn phytoplankton bloom. The 234 Th scavenging rates and the total mass fluxes were thus much higher in the June sampling period than in November at the stations located in the western cyclonic gyre and at the northern margin of the abyssal Black Sea basin. In contrast, the considerable seasonal differences were not found at the location near the Bosphorus Strait entry, suggesting a larger lateral input of particulate matter transported to this area from the western and northwestern shelf due to cyclonic circulation of the surface waters

  10. Seasonal changes of {sup 234}Th scavenging in surface water across the western Black Sea: an implication of the cyclonic circulation patterns

    Energy Technology Data Exchange (ETDEWEB)

    Gulin, S.B. E-mail: sergei@gulin.sebastopol.ua

    2000-12-01

    Two seasonal surveys of {sup 234}Th activity in surface water were carried out in November 1998 and June 1999 along the transect Sevastopol (Ukraine) - Istanbul (Turkey) crossing the entire western Black Sea between the SW Crimean Peninsula and the Bosphorus Strait entry. A steady-state model of {sup 234}Th/{sup 238}U equilibrium in seawater was used to calculate the net removal flux of {sup 234}Th by particles. The results obtained from central stations of the transect were in good agreement with those observed seasonally in 1992-1994 within the western cyclonic gyre of the abyssal Black Sea, showing that in June 1999 the sampling was conducted during the peak summer bloom of coccolithophorids, while in November 1998 the samples were collected three weeks after the autumn phytoplankton bloom. The {sup 234}Th scavenging rates and the total mass fluxes were thus much higher in the June sampling period than in November at the stations located in the western cyclonic gyre and at the northern margin of the abyssal Black Sea basin. In contrast, the considerable seasonal differences were not found at the location near the Bosphorus Strait entry, suggesting a larger lateral input of particulate matter transported to this area from the western and northwestern shelf due to cyclonic circulation of the surface waters.

  11. Determination of 234U and 238U activity concentrations in groundwaters from three deep wells drilled in Itu Intrusive Suite (SP)

    International Nuclear Information System (INIS)

    Souza, Francisca de

    2006-01-01

    Activity concentrations of ( 234 U) and ( 238 U) were determined in groundwaters drawn from three deep wells drilled in rocks from Itu Intrusive Suite (SP), two located in Salto town (S and SY wells) and the other one in Itu (I well). Sampling was done from September, 2004 to December, 2005, and twelve samples of each well were collected monthly. For those determinations alpha spectrometry technique was used, providing high precision results, as shown by the very good agreement of the data obtained in the analyses of 23 duplicates. The waters from the three wells presented a considerable enrichment of 234 U in relation to 238 U, indicating an important radioactive disequilibrium of these isotopes. In well I, the activity concentrations of ( 238 U) varied from (1,06 +- 0,03) to (2,1+- 0,2) mBq/L and those of ( 234 U) spanned from (3,1 +- 0,2) to (6,0 +- 0,4) mBq/L, whereas ( 234 U/ 238 U) activity ratios did not present significant variation, during the sampling time interval, presenting an average of 2,8 +- 0,1. The S waters showed the lowest uranium concentrations and the largest diversity of ( 238 U) and ( 234 U) activity concentrations, which varied from (0,26 +- 0,02) to (1,07+- 0,08) mBq/L and from (1,8 +- 0,1) to (7,0 +- 0,5) mBq/L, respectively, and also presented variable ( 234 U/ 238 U) activity ratios, spanning from (2,79 +- 0,07) to (8,1+- 0,3). In SY well, ( 238 U) activities varied between (0,8 +- 0,1) and (4,2 +- 0,3) mBq/L and those ones of ( 234 U) from (14 +- 1) to (53 +- 4) mBq/L, whereas ( 234 U/ 238 U) ratios fell in the interval from 12,6 +- 0,3 to 18,3 +- 0,4, with the highest activities of both radioisotopes registered during the dry season and the lowest ones in the rainy time period. The ( 234 U/ 238 U) activity ratios, which were invariable during sampling period of well I, indicated the contribution of rainfall to recharge the aquifer. The observed correlation between those ratios and uranium concentrations, for S and SY wells, showed

  12. Testing the FOODBANCS hypothesis: Seasonal variations in near-bottom particle flux, bioturbation intensity, and deposit feeding based on 234Th measurements

    Science.gov (United States)

    McClintic, Mark A.; DeMaster, David J.; Thomas, Carrie J.; Smith, Craig R.

    2008-11-01

    Naturally occurring 234Th (24-d half-life) was used on the West Antarctic continental shelf to evaluate temporal variations in the flux of particulate material reaching the seabed, bioturbation intensity, the seasonal continuity of feeding by benthic fauna, and trends in particle selection during ingestion for six common detritivores (four surface deposit feeders and two subsurface deposit feeders). These measurements were made at three stations during the five FOODBANCS cruises (December 1999, March, June, and October 2000, and March 2001) to assess the nature of pelagic-benthic coupling on the shelf and to evaluate the seabed as a potential food bank for deposit feeders when surface primary production is minimal. Two summer regimes were sampled (March 2000 and March 2001) with the latter exhibiting a distinct 1-2-cm-thick phytodetritus layer in nearly all sediment core samples. At site B, the 234Th fluxes into the near-bottom (150/170 mab) sediment traps were indistinguishable for the December-March 2000, March-June 2000, and June-October 2000 sampling intervals (fluxes ranging from 170 to 280 dpm m -2 d -1). However, the sediment-trap 234Th flux measured for the October 2000-March 2001 interval (1000 dpm m -2 d -1) was ˜5-fold greater than during the other three sampling periods, consistent with the deposition of a phytodetritus layer. The steady-state 234Th fluxes derived from seabed inventories at site B were 2.4-2.7 times greater than the sediment-trap 234Th fluxes, indicating substantial scavenging of this particle-reactive radiotracer in the bottom 150 m of the water column and/or lateral transport near the seabed. The seabed 234Th inventories at the three stations showed no variation during the first four cruises, but were significantly greater during cruise FB-V (March 2001), when the phytodetritus layer occurred. Based on 234Th distributions in the seabed, bioturbation intensities (quantified using the diffusive mixing coefficient, Db) varied from 0

  13. The behavior of particle-reactive tracers in a high turbidity environment: 234Th and 210Pb on the Amazon continental shelf

    International Nuclear Information System (INIS)

    Smoak, J.M.; DeMaster, D.J.; Pope, R.H.; Kuehl, S.A.; McKee, B.A.

    1996-01-01

    Excess 234 Th and 210 Pb seabed inventories were measured in cores collected from the Amazon continental shelf to examine particle scavenging and seabed dynamics. Typical excess 210 Pb inventories range from 100 to 300 dpm cm -2 , and the total excess 210 Pb inventory for the Amazon shelf was determined to be 2.7 x 10 17 dpm. The 210 Pb measurements indicate that particle-reactive species are scavenged not only form the Amazon River but also from the lateral advection of offshore water. In order to sustain the 210 Pb inventories, the volume of water supplied by the lateral advection from offshore must be approximately five to ten times the water discharge of the Amazon River. This lateral advection supplies about 67% of the total excess 210 Pb to the Amazon continental shelf with relatively small contributions from riverine input (31%), atmospheric fallout (2.3%), and in-situ production (0.1%). The 234 Th inventories were measured on four cruises, which occurred during periods of differing river discharge, wind stress, and flow rates of the North Brazil Current. The 234 Th excess seabed inventories show large spatial and seasonal variability, with a range from 0 to 22 dpm cm -2 . This approach indicates that for most of the shelf, the inventories of the shorter-term tracer ( 234 Th) are less than predicted by the inventories of the longer-term tracer ( 210 Pb). There are two explanations for this trend. The first is that a larger portion of the 234 Th inventory occurs in the fluid muds or the water column relative to 210 Pb. The second is that the supply of offshore water, scavenging efficiency, and/or deposition have been lower over the two year study period relative to the last one hundred years. 38 refs., 7 figs

  14. 230Th and 234Th as coupled tracers of particle cycling in the ocean: A maximum likelihood approach

    Science.gov (United States)

    Wang, Wei-Lei; Armstrong, Robert A.; Cochran, J. Kirk; Heilbrun, Christina

    2016-05-01

    We applied maximum likelihood estimation to measurements of Th isotopes (234,230Th) in Mediterranean Sea sediment traps that separated particles according to settling velocity. This study contains two unique aspects. First, it relies on settling velocities that were measured using sediment traps, rather than on measured particle sizes and an assumed relationship between particle size and sinking velocity. Second, because of the labor and expense involved in obtaining these data, they were obtained at only a few depths, and their analysis required constructing a new type of box-like model, which we refer to as a "two-layer" model, that we then analyzed using likelihood techniques. Likelihood techniques were developed in the 1930s by statisticians, and form the computational core of both Bayesian and non-Bayesian statistics. Their use has recently become very popular in ecology, but they are relatively unknown in geochemistry. Our model was formulated by assuming steady state and first-order reaction kinetics for thorium adsorption and desorption, and for particle aggregation, disaggregation, and remineralization. We adopted a cutoff settling velocity (49 m/d) from Armstrong et al. (2009) to separate particles into fast- and slow-sinking classes. A unique set of parameters with no dependence on prior values was obtained. Adsorption rate constants for both slow- and fast-sinking particles are slightly higher in the upper layer than in the lower layer. Slow-sinking particles have higher adsorption rate constants than fast-sinking particles. Desorption rate constants are higher in the lower layer (slow-sinking particles: 13.17 ± 1.61, fast-sinking particles: 13.96 ± 0.48) than in the upper layer (slow-sinking particles: 7.87 ± 0.60 y-1, fast-sinking particles: 1.81 ± 0.44 y-1). Aggregation rate constants were higher, 1.88 ± 0.04, in the upper layer and just 0.07 ± 0.01 y-1 in the lower layer. Disaggregation rate constants were just 0.30 ± 0.10 y-1 in the upper

  15. Selectivity of bis-triazinyl bipyridine ligands for americium(III) in Am/Eu separation by solvent extraction. Part 1. Quantum mechanical study on the structures of BTBP complexes and on the energy of the separation.

    Science.gov (United States)

    Narbutt, Jerzy; Oziminski, Wojciech P

    2012-12-21

    Theoretical studies were carried out on two pairs of americium and europium complexes formed by tetra-N-dentate lipophilic BTBP ligands, neutral [ML(NO(3))(3)] and cationic [ML(2)](3+) where M = Am(III) or Eu(III), and L = 6,6'-bis-(5,6-diethyl-1,2,4-triazin-3-yl)-2,2'-bipyridine (C2-BTBP). Molecular structures of the complexes have been optimized at the B3LYP/6-31G(d) level and total energies of the complexes in various media were estimated using single point calculations performed at the B3LYP/6-311G(d,p) and MP2/6-311G(d,p) levels of theory. In the calculations americium and europium ions were treated using pseudo-relativistic Stuttgart-Dresden effective core potentials and the accompanying basis sets. Selectivity in solvent extraction separation of two metal ions is a co-operative function of contributions from all extractable metal complexes, which depend on physico-chemical properties of each individual complex and on its relative amount in the system. Semi-quantitative analysis of BTBP selectivity in the Am/Eu separation process, based on the contributions from the two pairs of Am(III) and Eu(III) complexes, has been carried out. To calculate the energy of Am/Eu separation, a model of the extraction process was used, consisting of complex formation in water and transfer of the formed complex to the organic phase. Under the assumptions discussed in the paper, this simple two-step model results in reliable values of the calculated differences in the energy changes for each pair of the Am/Eu complexes in both steps of the process. The greater thermodynamic stability (in water) of the Am-BTBP complexes, as compared with the analogous Eu species, caused by greater covalency of the Am-N than Eu-N bonds, is most likely the main reason for BTBP selectivity in the separation of the two metal ions. The other potential reason, i.e. differences in lipophilic properties of the analogous complexes of Am and Eu, is less important with regard to this selectivity.

  16. Behaviour of {sup 238}U, {sup 234}U, {sup 228}Ra and {sup 226}Ra in rock alterations: study of Morungaba granitoids, SP-Brazil and ground water in its fractures; Comportamento de {sup 238}U, {sup 234}U, {sup 228}Ra e {sup 226}Ra na alteracao de rochas: estudo dos granitoides de Morungaba (SP) e aguas subterraneas de suas fraturas

    Energy Technology Data Exchange (ETDEWEB)

    Santos, Rosana N. dos [Pontificia Univ. Catolica de Sao Paulo, SP (Brazil). Dept. de Fisica]. E-mail: rosana@pucsp.br; Marques, Leila S. [Sao Paulo Univ., SP (Brazil). Inst. de Astronomia, Geofisica e Ciencias Atmosfericas. Dept. de Geofisica]. E-mail: leila@iag.usp.br

    2005-07-01

    This work presents the first results obtained on the investigation of the behavior of uranium and radium radioisotopes in the processes of weathering and rock-water interaction of Morungaba granitoids belonging to Meridional Pluton (Valinhos Town-SP-Brazil). Specific activities of {sup 238}U, {sup 234}U, {sup 228}Ra and {sup 226}Ra were determined in non altered granitoids (Group A), as well as in those affected by different degrees of weathering (Groups B, C and D). The uranium specific activities were determined by alpha spectrometry method, whereas for the determination of radium isotopes high resolution gamma-ray spectrometry technique was employed. The data indicate that {sup 238}U and {sup 234}U are in radioactive equilibrium in the fresh analyzed granitoids, but show a slight depletion of {sup 234}U in relation to {sup 238}U in the weathered rocks. The ({sup 226}Ra/{sup 238}U) and ({sup 226}Ra/{sup 234}U) activity ratios of all investigated rocks are similar, showing a significant {sup 226}Ra depletion, which is probably caused by its preferential leaching. These results indicate that even samples macroscopically classified as fresh rocks, their systems have been opened for some geochemical changes. The high ({sup 234}U/{sup 238}U) activity ratios of groundwaters which are found in the fractures of these granitoids suggest their prolonged residence times in the aquifer and/or their percolation by other rocks presenting different geochemical properties. (author)

  17. The Effect of Irrigation Solutions on Recurrence of Chronic Subdural Hematoma: A Consecutive Cohort Study of 234 Patients.

    Science.gov (United States)

    Kuwabara, Masashi; Sadatomo, Takashi; Yuki, Kiyoshi; Migita, Keisuke; Imada, Yasutaka; Shimizu, Kiyoharu; Hara, Takeshi; Oba, Hideo; Kurisu, Kaoru

    2017-05-15

    Chronic subdural hematomas (CSDHs) occur often in elderly persons and can occur with mild head trauma. With burr-hole irrigation as standard treatment, symptoms usually improve and can be cured, and outcomes are good, but postoperative recurrences are a common problem. This study investigated the effectiveness and recurrence rates when using artificial cerebrospinal fluid (ACF) instead of normal saline (NS) as an irrigation solution for burr-hole irrigation in patients with CSDH. This prospective study included 234 consecutive patients who underwent initial surgical treatment by burr-hole irrigation for a CSDH between April 2008 and June 2015. The irrigation solution used was changed from NS to ACF in June 2011. Factors examined with regard to recurrence included age, sex, unilateral or bilateral surgery, computed tomography (CT) findings, antiplatelet or anticoagulant drug use, past history, and irrigation solution (NS or ACF). These were analyzed by univariate and multivariate analyses. Univariate analyses (chi-square test) with a significance level irrigation for CSDH, the use of ACF instead of NS as an irrigation solution significantly reduces recurrence rates.

  18. Determination of distribution coefficients for 134 Cs, 60 Co and 234 Th radionuclides in Pinheiro river sediment

    International Nuclear Information System (INIS)

    Lima, M.F.

    1992-01-01

    The distribution coefficients (K α) were determined in order to foresee the fate of the radionuclides discharged to the environment. Based upon the source-term released by IPEN's facilities in Pinheiros River during the year of 1988, three radionuclides were chosen as being the more critical, according to the radiation protection standards: 137 Cs, 60 Co and 232 Th. Their K α were determined experimentally in laboratory by using the corresponding radioactive tracers 134 Cs, 60 Co and 234 Th. Three different experimental methodologies were used: the static method, the shaken method and the dynamic method. The parameters studied were the effects of pH, aerobic condition and time of contact. The results obtained experimentally for the Kds confirm the predictions that: the cesium is slowly retained by the sediment along the Pinheiros River, the cobalt is an unstable element, therefore its retention by the sediment is affected by variations in the pH values, and finally, the thorium is almost completely retained in the vicinity of the discharge point. (author)

  19. Prognosis of 234 rosacea patients according to clinical subtype: The significance of central facial erythema in the prognosis of rosacea.

    Science.gov (United States)

    Lee, Woo Jin; Lee, Ye Jin; Lee, Mi Hye; Won, Chong Hyun; Chang, Sung Eun; Choi, Jee Ho; Lee, Mi Woo

    2016-05-01

    Rosacea has a wide spectrum of clinical features, which include persistent facial redness, flushing, telangiectasia, inflammatory papules/pustules, hypertrophy and/or ocular features. The prognosis of rosacea according to clinical subtype has not been evaluated. We analyzed the prognosis of rosacea in 234 patients, which included 120 patients with mixed subtype, 75 with the erythematotelangiectatic rosacea subtype and 39 with the papulopustular rosacea (PPR) subtype. The prognosis of rosacea was classified as: (i) no improvement; (ii) partial remission; and (iii) complete remission. The frequencies of complete remission, time to complete remission and 1-year complete remission rate were compared between subtypes. Follow-up periods ranged 2-72 months (median follow-up, 17.5). Aggravation of the disease was found in 50.4% of patients during follow up. Partial or complete remission was noted in 61.5% and 20.9% of patients, respectively. The median time to complete remission was 56.0 months. The prognosis of disease was more favorable for patients with the PPR subtype than for patients with other subtypes with respect to the frequency of complete remission, median time to complete remission and the 2-year complete remission rate. In conclusion, papulopustular rosacea without remarkable centrofacial erythema showed a more favorable prognosis than other subtypes. Erythematotelangiectatic lesions in rosacea patients present a challenge for the treatment of rosacea. © 2015 Japanese Dermatological Association.

  20. Gamma-Ray Emission Spectra as a Constraint on Calculations of 234 , 236 , 238U Neutron-Capture Cross Sections

    Science.gov (United States)

    Ullmann, J. L.; Krticka, M.; Kawano, T.; Bredeweg, T. A.; Baramsai, B.; Couture, A.; Haight, R. C.; Jandel, M.; Mosby, S.; O'Donnell, J. M.; Rundberg, R. S.; Vieira, D. J.; Wilhelmy, J. B.; Becker, J. A.; Wu, C. Y.; Chyzh, A.

    2015-10-01

    Calculations of the neutron-capture cross section at low neutron energies (10 eV through 100's of keV) are very sensitive to the nuclear level density and radiative strength function. These quantities are often poorly known, especially for radioactive targets, and actual measurements of the capture cross section are usually required. An additional constraint on the calculation of the capture cross section is provided by measurements of the cascade gamma spectrum following neutron capture. Recent measurements of 234 , 236 , 238U(n, γ) emission spectra made using the DANCE 4 π BaF2 array at the Los Alamos Neutron Science Center will be presented. Calculations of gamma-ray spectra made using the DICEBOX code and of the capture cross section made using the CoH3 code will also be presented. These techniques may be also useful for calculations of more unstable nuclides. This work was performed with the support of the U.S. Department of Energy, National Nuclear Security Administration by Los Alamos National Security, LLC (Contract DE-AC52-06NA25396) and Lawrence Livermore National Security, LLC (Contract DE-AC52-07NA2734).

  1. Application of natural Ra isotopes and {sup 234}Th as tracers of organic carbon export in Bransfield Strait, Antarctica; Aplicacao dos isotopos naturais de Ra e do Th-234 como tracadores do carbono organico exportado para o Estreito de Bransfield, Antartica

    Energy Technology Data Exchange (ETDEWEB)

    Vieira, Lucia Helena

    2011-07-01

    The Southern Ocean is the largest of several high-nutrient, low-chlorophyll (HNLC) regions in the world's oceans. This region plays a major role in regulating the global net transfer of carbon dioxide between the ocean and the atmosphere, in part because the annual photosynthetic uptake of CO{sub 2} by phytoplankton and resulting export of particulate organic carbon (POC) to the deep ocean. The element thorium has multiple radioisotopes that have emerged collectively as a powerful set of tracers for particle associated processes in the oceans. Of all the Th isotopes, {sup 234}Th (half-life 24.1 d) has been the focus of increasing attention and application in the past years. The production of {sup 234}Th from {sup 238}U, coupled with the conservative behavior of {sup 238}U in seawater, makes the source of {sup 234}Th easy to characterize. Moreover, the half-life of {sup 234}Th is sufficiently short to make it sensitive to the short-term (e.g. seasonal) changes that occur in the upper water column of the open ocean or in sediments or water column in coastal areas. Because of its very particle reactive behavior, {sup 234}Th is removed from a parcel of water in only two ways, through decay and through particle flux. Therefore, a steady-state 1D activity balance can be used to calculate its flux. Natural Ra isotopes have been also widely used in marine studies to trace water masses and to quantify mixing processes. This work presents results of a collaborative research on organic carbon fluxes distribution in the Bransfield Strait in order to evaluate its influence in the CO{sub 2} drawdown. Macro-nutrients, micro-nutrients and chlorophyll-a distributions were used to examine the pathway sources. Natural radium isotopes were applied as tracers to study the movement of shelf water, while {sup 234}Th was used as a tracer of particle flux in the upper ocean, since POC export via sinking particles is the primary mechanism of carbon sequestration in the Southern Ocean

  2. Bioaccumulation of polonium (210Po, uranium (234U, 238U isotopes and trace metals in mosses from Sobieszewo Island, northern Poland

    Directory of Open Access Journals (Sweden)

    Boryło A.

    2013-04-01

    Full Text Available The objective of this study was determination of the polonium (210Po, uranium (234U and 238U radionuclides and trace metals (Pb, Fe, Zn, Cu, Ni, Cd, Hg concentrations in mosses samples from Sobieszewo Island near the phosphogypsum waste dump in Wiślinka (northern Poland. The obtained results revealed that the concentrations of 210Po, 234U, and 238U in the two analyzed kinds of mosses: Pleurozium schreberi and Dicranum scoparium were similar. Among the analyzed trace metals the highest concentration in mosses was recorded for iron, while the lowest for nickel, cadmium and mercury. The obtained studies showed that the sources of polonium and uranium isotopes, as well as trace metals in analyzed mosses are air city contaminations transported from Gdańsk and from existing in the vicinity the phosphogypsum waste heap in Wiślinka (near Gdańsk.

  3. Biogeochemical responses to late-winter storms in the Sargasso Sea, III—Estimates of export production using 234Th: 238U disequilibria and sediment traps

    Science.gov (United States)

    Maiti, Kanchan; Benitez-Nelson, Claudia R.; Lomas, Michael W.; Krause, Jeffrey W.

    2009-06-01

    Direct measurements of new production and carbon export in the subtropical North Atlantic Ocean appear to be too low when compared to geochemical-based estimates. It has been hypothesized that episodic inputs of new nutrients into surface water via the passage of mesoscale eddies or winter storms may resolve at least some of this discrepancy. Here, we investigated particulate organic carbon (POC), particulate organic nitrogen (PON), and biogenic silica (BSiO 2) export using a combination of water column 234Th: 238U disequilibria and free-floating sediment traps during and immediately following two weather systems encountered in February and March 2004. While these storms resulted in a 2-4-fold increase in mixed layer NO 3 inventories, total chlorophyll a and an increase in diatom biomass, the systems were dominated by generally low 234Th: 238U disequilibria, suggesting limited particle export. Several 234Th models were tested, with only those including non-steady state and vertical upwelling processes able to describe the observed 234Th activities. Although upwelling velocities were not measured directly in this study, the 234Th model suggests reasonable rates of 2.2-3.7 m d -1. Given the uncertainties associated with 234Th derived particle export rates and sediment traps, both were used to provide a range in sinking particle fluxes from the upper ocean during the study. 234Th particle fluxes were determined applying the more commonly used steady state, one-dimensional model with element/ 234Th ratios measured in sediment traps. Export fluxes at 200 m ranged from 1.91±0.20 to 4.92±1.22 mmol C m -2 d -1, 0.25±0.08 to 0.54±0.09 mmol N m -2 d -1, and 0.22±0.04 to 0.50±0.06 mmol Si m -2 d -1. POC export efficiencies (Primary Production/Export) were not significantly different from the annual average or from time periods without storms, although absolute POC fluxes were elevated by 1-11%. This increase was not sufficient, however, to resolve the discrepancy

  4. Catalytic and kinetic spectrophotometric method for determination of vanadium(V by 2,3,4-trihydroxyacetophenonephenylhydrazone

    Directory of Open Access Journals (Sweden)

    P.V. Chalapathi

    2014-12-01

    Full Text Available A new catalytic and kinetic spectrophotometric method for the determination of vanadium(V was studied using 2,3,4-trihydroxyacetophenonephenylhydrazone (THAPPH as an analytical reagent. The present method was developed on the catalytic effect of vanadium on oxidation of THAPPH by hydrogen peroxide in hydrochloric acid–potassium chloride buffer (pH = 2.8 at the 20th minute. The metal ion has formed 1:2 (M:L complex with THAPPH. Beer’s law was obeyed in the range 20–120 ng/mL of V(V at λmax 390 nm. The sensitivity of the method was calculated in terms of molar absorptivity (1.999 × 105 L mol−1cm−1 and Sandell’s sensitivity (0.000254 μg cm−2, shows that this method is more sensitive. The standard deviation (0.0022, relative standard deviation (0.56%, confidence limit (±0.0015 and standard error (0.0007 revealed that the developed method has more precision and accuracy. The stability constant was calculated with the help of Asmu’s (9.411 × 10−11 and Edmond’s & Birnbaum’s (9.504 × 10−11 methods at room temperature. The interfering effect of various cations and anions was also studied. The present method was successfully applied for the determination of vanadium(V in environmental and alloy samples. The method’s validity was checked by comparing the results obtained with atomic-absorption spectrophotometry and also by evaluation of results using F-test.

  5. Time dependent phase associations of iron and other trace elements elucidated by 234Th/238U inventories in tropical coastal waters

    International Nuclear Information System (INIS)

    Szymczak, R.; Zaw, M.

    1999-01-01

    In this study samples were collected in the Gulf of Papua region of PNG, on board the research vessel Franklin as apart of a multidisciplinary study of factors influencing the fate of terrestrial material entering the tropical coastal ocean. Samples for 234 Th were collected using a in situ large volume pump device (Challenger Oceanic) passing seawater (1000-2000 litres) through a series of cartridge filters in polycarbonate housings

  6. Application of 234U/238U isotope ratio data for the study of geochemical problems associated with local water sources from Aguas da Prata (SP, Brazil)

    International Nuclear Information System (INIS)

    Bonotto, D.M.

    1982-01-01

    The uranium-238, uranium-234 and radon content of spring waters of Aguas da Prata (SP) - Platina, Paiol, Villela, Sao Bento, Prata-Radioativa, Prata-Nova, Boi, Vitoria and Prata-Antiga - was found; the activity ratio AR ( 234 U/ 238 U) was applied to the geochemistry of local water sources. The uranium analysis procedure consisted of the following steps: adition of 232 U- 228 Th spike to the samples, coprecipitation with iron, iron extraction with organic solvent, separation on anion-exchange resin, extraction with TTA, deposition on stainless steel disc and determination of uranium content by alpha spectrometry. The uranium-238 content changed from 0,10 to 11,56 ppb (average value = 2,3 ppb). The higher values were observed for the waters circulating through sandstones and the lower through volcanic rocks. The inverse correlation (r sub(s) =-0,76) between pH and uranium-238 content confirmed the contribution of this factor on its solubility. The significative correlation r sub(s) = 0,76 between dissolved oxygen and uranium-238 content also confirmed the higher uranium on the more oxidizing zones. The AR changed from 2,84 to 11,68 (average value = 6). These values defined the regional aquifer systems as mineralized in uranium. The higher AR were observed for the deep groundwaters and the lower for the shallow one. Because the 238 U→ 234 Th decay, the 234 Th ejection to the solution was confirmed as the most important factor responsible for the extreme observed isotopic fractionation. (Author) [pt

  7. Temporal evolution of natural radionuclides distributions 238U, 234Th, 226Ra, 228Ra, 210Pb and 210Po in the Bransfield strait, Antarctica peninsula

    International Nuclear Information System (INIS)

    Lapa, Flavia Valverde

    2013-01-01

    Research on the distribution of natural radionuclides in Antarctica is rare and thus, there is great interest in to know their occurrence and factors related to its mobilization, transference and accumulation in this extremely fragile environment. Natural radionuclides have been used intensively as tracers in the ocean, helping to better understand processes as sinking and particle resuspension, water masses mixture and oceanic circulation. 234 Th (t½ = 24.1 days) is a particle-reactive radionuclide produced continuously in seawater by the decay of its soluble precursor conservative with salinity 238 U (t½ = 4.5 10 9 years). Since 234 Th presents relatively short half-life, it is used to quantify processes that occur in temporal scale varying from days to weeks. The disequilibrium 234 Th/ 238 U in the surface ocean has been applied to estimate carbon fluxes exported via sinking material. The flux of particles biologically productive out of the euphotic zone in the Southern Ocean has special attention due to its importance in the control of CO 2 atmospheric concentrations. The radionuclides 210 Pb (t½ = 22.3 years) and 210 Po (t½ = 138 days) are also particle-reactive. The disequilibrium 210 Po/ 210 Pb has been used to estimate fluxes of particles exported in the ocean in the time scale of weeks. The long-lived Ra isotopes, 226 Ra (t½ = 1,600 years) and 228 Ra (t½ = 5.75 years) are soluble in seawater, presenting unique properties that make them excellent tracers of water masses. This research work had the aim to study the distributions of natural radionuclides 238 U, 234 Th, 22 '6Ra, 22 '8Ra, 210 Pb and 210 Po in the Bransfield Strait during 2 samplings carried out in the 2011 Austral Summer (OPERANTAR XXIX and XXX). (author)

  8. NAD(P)+-malic enzyme mutants of Sinorhizobium sp. strain NGR234, but not Azorhizobium caulinodans ORS571, maintain symbiotic N2 fixation capabilities.

    Science.gov (United States)

    Zhang, Ye; Aono, Toshihiro; Poole, Phillip; Finan, Turlough M

    2012-04-01

    C(4)-dicarboxylic acids appear to be metabolized via the tricarboxylic acid (TCA) cycle in N(2)-fixing bacteria (bacteroids) within legume nodules. In Sinorhizobium meliloti bacteroids from alfalfa, NAD(+)-malic enzyme (DME) is required for N(2) fixation, and this activity is thought to be required for the anaplerotic synthesis of pyruvate. In contrast, in the pea symbiont Rhizobium leguminosarum, pyruvate synthesis occurs via either DME or a pathway catalyzed by phosphoenolpyruvate carboxykinase (PCK) and pyruvate kinase (PYK). Here we report that dme mutants of the broad-host-range Sinorhizobium sp. strain NGR234 formed nodules whose level of N(2) fixation varied from 27 to 83% (plant dry weight) of the wild-type level, depending on the host plant inoculated. NGR234 bacteroids had significant PCK activity, and while single pckA and single dme mutants fixed N(2) at reduced rates, a pckA dme double mutant had no N(2)-fixing activity (Fix(-)). Thus, NGR234 bacteroids appear to synthesize pyruvate from TCA cycle intermediates via DME or PCK pathways. These NGR234 data, together with other reports, suggested that the completely Fix(-) phenotype of S. meliloti dme mutants may be specific to the alfalfa-S. meliloti symbiosis. We therefore examined the ME-like genes azc3656 and azc0119 from Azorhizobium caulinodans, as azc3656 mutants were previously shown to form Fix(-) nodules on the tropical legume Sesbania rostrata. We found that purified AZC3656 protein is an NAD(P)(+)-malic enzyme whose activity is inhibited by acetyl-coenzyme A (acetyl-CoA) and stimulated by succinate and fumarate. Thus, whereas DME is required for symbiotic N(2) fixation in A. caulinodans and S. meliloti, in other rhizobia this activity can be bypassed via another pathway(s).

  9. Uranium ((234)U, (235)U and (238)U) contamination of the environment surrounding phosphogypsum waste heap in Wiślinka (northern Poland).

    Science.gov (United States)

    Olszewski, Grzegorz; Boryło, Alicja; Skwarzec, Bogdan

    2015-08-01

    The aim of this work was to determine the uranium concentration ((234)U, (235)U and (238)U) and values of the activity ratio (234)U/(238)U in soil samples collected near phosphogypsum waste heap in Wiślinka (northern Poland). On the basis of the studies it was found that the values of the (234)U/(238)U activity ratio in the analyzed soils collected in the vicinity of phosphogypsum dump in Wiślinka are in most cases close to one and indicate the phosphogypsum origin of the analyzed nuclides. The obtained results of uranium concentrations are however much lower than in previous years before closing of the phosphogypsum stockpile. After this process and covering the phosphogypsum stockpile in Wiślinka with sewage sludge, phosphogypsum particles are successfully immobilized. In the light of the results the use of phosphate fertilizers seems to be a major problem. Prolonged and heavy rains can cause leaching accumulated uranium isotopes in the phosphogypsum stockpile, which will be washed into the Martwa Wisła and on the fields in the immediate vicinity of this storage. Copyright © 2015 Elsevier Ltd. All rights reserved.

  10. In vitro and in vivo effects of kisspeptin antagonists p234, p271, p354, and p356 on GPR54 activation.

    Directory of Open Access Journals (Sweden)

    C H J Albers-Wolthers

    Full Text Available Kisspeptins (KPs and their receptor (GPR54 or KiSS1R play a key-role in regulation of the hypothalamic-pituitary-gonadal axis and are therefore interesting targets for therapeutic interventions in the field of reproductive endocrinology. As dogs show a rapid and robust LH response after the administration of KP10, they can serve as a good animal model for research concerning KP signaling. The aims of the present study were to test the antagonistic properties of KP analogs p234, p271, p354, and p356 in vitro, by determining the intracellular Ca2+ response of CHEM1 cells that stably express human GPR54, and to study the in vivo effects of these peptides on basal plasma LH concentration and the KP10-induced LH response in female dogs. Exposure of the CHEM1 cells to KP-10 resulted in a clear Ca2+ response. P234, p271, p354, and p356 did not prevent or lower the KP10-induced Ca2+ response. Moreover, the in vivo studies in the dogs showed that none of these supposed antagonists lowered the basal plasma LH concentration and none of the peptides lowered the KP10-induced LH response. In conclusion, p234, p271, p354, and p356 had no antagonistic effects in vitro nor any effect on basal and kisspeptin-stimulated plasma LH concentration in female dogs.

  11. Transcriptional and cellular effects of benzotriazole UV stabilizers UV-234 and UV-328 in the freshwater invertebrates Chlamydomonas reinhardtii and Daphnia magna.

    Science.gov (United States)

    Giraudo, Maeva; Cottin, Guillaume; Esperanza, Marta; Gagnon, Pierre; Silva, Amila O De; Houde, Magali

    2017-12-01

    Benzotriazole ultra violet stabilizers (BZT-UVs) are compounds used in many applications and products to prevent photochemical degradation. Despite their widespread presence in aquatic ecosystems and persistence in the environment, there are very limited data on their effects and toxicity, and their modes of action remain largely unknown. The objectives of the present study were to evaluate the chronic effects of 2 BZT-UVs, 2-(2H-benzotriazol-2-yl)-4,6-bis(1-methyl-1-phenylethyl)phenol (UV-234) and 2-(2H-benzotriazol-2-yl)-4,6-di-tert-pentylphenol (UV-328), on the freshwater green algae Chlamydomonas reinhardtii and the freshwater crustacean Daphnia magna. Organisms were exposed to 0.01 and 10 μg/L of UV-234, UV-328, as well as a mixture of the 2 compounds. Life-history endpoints (viability, reproduction, and growth) and oxidative stress-related biomarkers (gene transcription, reactive oxygen species [ROS] production, and lipid peroxidation) were measured. Daphnia magna growth, reproduction, and gene transcription were not impacted by 21-d individual or mixed exposure. After 96-h of exposure, no differences were observed on the cellular viability of C. reinhardtii for either of the 2 BZT-UVs. In the algae, results showed increased ROS production in response to UV-328 and lipid peroxidation following exposure to UV-234. Synergistic effects of the 2 BZT-UVs were evident at the transcriptional level with 2 to 6 times up-regulation of glutathione peroxidase (gp x ) in response to the mixture for all treatment conditions. The transcription of superoxide dismutase (sod), catalase (cat), and ascorbic peroxidase (apx) was also regulated by UV-234 and UV-328 in the green algae, most likely as a result of ROS production and lipid peroxidation. Results from the present study suggest potential impacts of UV-234 and UV-328 exposure on the antioxidant defense system in C. reinhardtii. Environ Toxicol Chem 2017;36:3333-3342. © 2017 Crown in the Right of Canada. Published by

  12. Determination of {sup 234}U and {sup 238}U activity concentrations in groundwaters from three deep wells drilled in Itu Intrusive Suite (SP); Determinacao das concentracoes de atividade de {sup 234}U e {sup 238}U em aguas subterraneas de tres pocos perfurados em rochas da Suite Intrusiva de Itu (SP)

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Francisca de

    2006-07-01

    Activity concentrations of ({sup 234}U) and ({sup 238}U) were determined in groundwaters drawn from three deep wells drilled in rocks from Itu Intrusive Suite (SP), two located in Salto town (S and SY wells) and the other one in Itu (I well). Sampling was done from September, 2004 to December, 2005, and twelve samples of each well were collected monthly. For those determinations alpha spectrometry technique was used, providing high precision results, as shown by the very good agreement of the data obtained in the analyses of 23 duplicates. The waters from the three wells presented a considerable enrichment of {sup 234}U in relation to {sup 238}U, indicating an important radioactive disequilibrium of these isotopes. In well I, the activity concentrations of ({sup 238}U) varied from (1,06 +- 0,03) to (2,1+- 0,2) mBq/L and those of ({sup 234}U) spanned from (3,1 +- 0,2) to (6,0 +- 0,4) mBq/L, whereas ({sup 234}U/{sup 238}U) activity ratios did not present significant variation, during the sampling time interval, presenting an average of 2,8 +- 0,1. The S waters showed the lowest uranium concentrations and the largest diversity of ({sup 238}U) and ({sup 234}U) activity concentrations, which varied from (0,26 +- 0,02) to (1,07+- 0,08) mBq/L and from (1,8 +- 0,1) to (7,0 +- 0,5) mBq/L, respectively, and also presented variable ({sup 234}U/{sup 238}U) activity ratios, spanning from (2,79 +- 0,07) to (8,1+- 0,3). In SY well, ({sup 238}U) activities varied between (0,8 +- 0,1) and (4,2 +- 0,3) mBq/L and those ones of ({sup 234}U) from (14 +- 1) to (53 +- 4) mBq/L, whereas ({sup 234}U/{sup 238}U) ratios fell in the interval from 12,6 +- 0,3 to 18,3 +- 0,4, with the highest activities of both radioisotopes registered during the dry season and the lowest ones in the rainy time period. The ({sup 234}U/{sup 238}U) activity ratios, which were invariable during sampling period of well I, indicated the contribution of rainfall to recharge the aquifer. The observed correlation

  13. Coulex fission of 234U, 235U, 237Np, and 238Np studied within the SOFIA experimental program

    International Nuclear Information System (INIS)

    Martin, Julie-Fiona

    2014-01-01

    SOFIA (Studies On FIssion with Aladin) is an experimental project which aims at systematically measuring the fission fragments' isotopic yields as well as their total kinetic energy, for a wide variety of fissioning nuclei. The PhD work presented in this dissertation takes part in the SOFIA project, and covers the fission of nuclei in the region of the actinides: 234 U, 235 U, 237 Np and 238 Np. The experiment is led at the heavy-ion accelerator GSI in Darmstadt, Germany. This facility provides intense relativistic primary beam of 238 U. A fragmentation reaction of the primary beam permits to create a secondary beam of radioactive ions, some of which the fission is studied. The ions of the secondary beam are sorted and identified through the FR-S (Fragment Separator), a high resolution recoil spectrometer which is tuned to select the ions of interest.The selected - fissile - ions then fly further to Cave-C, an experimental area where the fission experiment itself takes place. At the entrance of the cave, the secondary beam is excited by Coulomb interaction when flying through an target; the de-excitation process involves low-energy fission. Both fission fragments fly forward in the laboratory frame, due to the relativistic boost inferred from the fissioning nucleus.A complete recoil spectrometer has been designed and built by the SOFIA collaboration in the path of the fission fragments, around the existing ALADIN magnet. The identification of the fragments is performed by means of energy loss, time of flight and deviation in the magnet measurements. Both fission fragments are fully (in mass and charge) and simultaneously identified.This document reports on the analysis performed for (1) the identification of the fissioning system, (2) the identification of both fission fragments, on an event-by-event basis, and (3) the extraction of fission observables: yields, TKE, total prompt neutron multiplicity. These results, concerning the actinides, are discussed, and

  14. Neutron emission effects on final fragments mass and kinetic energy distribution from low energy fission of {sup 234}U

    Energy Technology Data Exchange (ETDEWEB)

    Montoya, M.; Rojas, J. [Instituto Peruano de Energia Nuclear, Av. Canada 1470, Lima 41 (Peru); Lobato, I. [Facultad de Ciencias, Universidad Nacional de Ingenieria, Av. Tupac Amaru 210, Apartado Postal 31-139, Lima (Peru)]. e-mail: mmontoya@ipen.gob.pe

    2008-07-01

    The standard deviation of the final kinetic energy distribution ({sigma}{sub e}) as a function of mass of final fragments (m) from low energy fission of {sup 234}U, measured with the Lohengrin spectrometer by Belhafaf et al., presents a peak around m = 109 and another around m = 122. The authors attribute the first peak to the evaporation of a large number of neutrons around the corresponding mass number, i.e. there is no peak on the standard deviation of the primary kinetic energy distribution ({sigma}{sub E}) as a function of primary fragment mass (A). The second peak is attributed to a real peak on {sigma}{sub E}(A). However, theoretical calculations related to primary distributions made by H.R. Faust and Z. Bao do not suggest any peak on {sigma}{sub E}(A). In order to clarify this apparent controversy, we have made a numerical experiment in which the masses and the kinetic energy of final fragments are calculated, assuming an initial distribution of the kinetic energy without structures on the standard deviation as function of fragment mass. As a result we obtain a pronounced peak on {sigma}{sub e} (m) curve around m = 109, a depletion from m = 121 to m = 129, and an small peak around m = 122, which is not as great as that measured by Belhafaf et al. Our simulation also reproduces the experimental results on the yield of the final mass Y(m), the average number of emitted neutrons as a function of the provisional mass (calculated from the values of the final kinetic energy of the complementary fragments) and the average value of fragment kinetic energy as a function of the final mass. From our results we conclude that there are no peaks on the {sigma}{sub E} (A) curve, and the observed peaks on {sigma}{sub e} (m) are due to the emitted neutron multiplicity and the variation of the average fragment kinetic energy as a function of primary fragment mass. (Author)

  15. Biological availability of 238U, 234U and 226Ra for wild berries and meadow grasses in natural ecosystems of Belarus

    International Nuclear Information System (INIS)

    Sokolik, G.A.; Ovsiannikova, S.V.; Voinikava, K.V.; Ivanova, T.G.; Papenia, M.V.

    2014-01-01

    This work is devoted to investigation of behavior of 234 U, 238 U and 226 Ra by determining the soil to plant transfer under different natural conditions such as forest or swamped areas and meadow lands with different soil types. The paper summarizes the data on investigation of uranium and radium uptake by wild berries and natural meadow grasses in the typical conditions of Belarus. Parameters characterizing the biological availability of 234 U, 238 U and 226 Ra for bilberry (Vaccinium myrtillus), lingonberry (Vaccinium viti-idaea), blueberry (Vaccinium iliginosum) and cranberry (Vaccinium oxycoccus palustris) as well as for widely occurring mixed meadow vegetation, which belongs to the sedge-grass or grass-sedge associations and forbs, have been established. In the sites under investigation, the deposition levels of 238+239+240 Pu were less than 0.37 kBq m −2 and 137 Cs deposition ranged between less than 0.37 and 37 kBq m −2 . It was found that activity concentrations of radionuclides in berries varied in the ranges of 0.037–0.11 for 234 U, 0.036–0.10 for 238 U and 0.11–0.43 Bq kg −1 for 226 Ra, but in the mixed meadow grasses they were 0.32–4.4, 0.24–3.9 and 0.14–6.9 Bq kg −1 accordingly. The 234 U/ 238 U activity ratios were 1.02 ± 0.01 for wild berries, 1.20 ± 0.09 for underground meadow grasses and 1.02 ± 0.02 for proper soils. The concentration ratios (CRs, dry weight basis) of 234 U and 238 U for mixed meadow grasses were 0.036–0.42 and 0.041–0.46 respectively. The correspondent geometric means (GM) were 0.13 and 0.15 with geometric standard deviations (GSD) of 2.4. The CRs of 226 Ra for meadow grasses were 0.031–1.0 with GM 0.20 and GSD 2.6. The CRs of 234 U, 238 U and 226 Ra for wild berries ranged within 0.0018–0.008 (GM is 0.0034, GSD is 1.8), 0.0018–0.008 (GM is 0.0035, GSD is 1.8) and 0.005–0.033 (GM is 0.016, GSD is 2.1) accordingly. The highest CR values of uranium for mixed meadow grasses were found in the sites

  16. 90Sr, 238U, 234U, 137Cs, 40K and 239/240Pu in Emmental type cheese produced in different regions of Western Europe.

    Science.gov (United States)

    Froidevaux, P; Geering, J-J; Pillonel, L; Bosset, J-O; Valley, J-F

    2004-01-01

    A method is presented for the determination of (90)Sr and uranium in Emmental type cheese collected in dairy plants from different European countries. Results display a significant correlation (r = 0.708 Student t-test = 6.02) between the (90)Sr content of the cheese and the altitude of grazing. The highest (90)Sr activity is 1.13 Bq kg(-1) of cheese and the lowest is 0.29 Bq kg(-1). Uranium activity is very low with a highest (238)U value of 27 mBq kg(-1). In addition, (234)U/(238)U ratio shows a large enrichment in (234)U for every location. Without any significant indication of the geographic origin of the cheese, this enrichment is believed to be due to the geological features of the pasture, soil and underground water. These results tend to prove that the contamination of milk by uranium originates principally from the water that the cows drink instead of the forage. This finding may have a great importance in models dealing with dairy food contamination by radionuclides following a nuclear accident. Also, the (90)Sr content and to a lesser extent the (234)U/(238)U ratio could be used to trace the authenticity of the origin of the cheese. (137)Cs activity is lower than the detection limit of 0.1 Bq kg(-1) in all the samples collected (n = 20). Based on natural (40)K activity in cheese (15-21 Bq kg(-1)), the decontamination factor for the alkaline cations from milk to cheese is about 20. Plutonium activity stays below the detection limit of 0.3 mBq kg(-1).

  17. 90Sr, 238U, 234U, 137Cs, 40K and 239/240Pu in Emmental type cheese produced in different regions of Western Europe

    International Nuclear Information System (INIS)

    Froidevaux, P.; Geering, J.-J.; Pillonel, L.; Bosset, J.-O.; Valley, J.-F.

    2004-01-01

    A method is presented for the determination of 90 Sr and uranium in Emmental type cheese collected in dairy plants from different European countries. Results display a significant correlation (r=0.708, Student t-test=6.02) between the 90 Sr content of the cheese and the altitude of grazing. The highest 90 Sr activity is 1.13 Bq kg -1 of cheese and the lowest is 0.29 Bq kg -1 . Uranium activity is very low with a highest 238 U value of 27 mBq kg -1 . In addition, 234 U/ 238 U ratio shows a large enrichment in 234 U for every location. Without any significant indication of the geographic origin of the cheese, this enrichment is believed to be due to the geological features of the pasture, soil and underground water. These results tend to prove that the contamination of milk by uranium originates principally from the water that the cows drink instead of the forage. This finding may have a great importance in models dealing with dairy food contamination by radionuclides following a nuclear accident. Also, the 90 Sr content and to a lesser extent the 234 U/ 238 U ratio could be used to trace the authenticity of the origin of the cheese. 137 Cs activity is lower than the detection limit of 0.1 Bq kg -1 in all the samples collected (n=20). Based on natural 40 K activity in cheese (15-21 Bq kg -1 ), the decontamination factor for the alkaline cations from milk to cheese is about 20. Plutonium activity stays below the detection limit of 0.3 mBq kg -1

  18. Characterizing seasonal contribution of particles from the surface ocean to the mesopelagic food web through amino acid compound specific isotopic analysis and 234Thorium measurements

    Science.gov (United States)

    Grabb, K. C.; benitez-Nelson, C. R.; Drazen, J.; Close, H. G.; Hannides, C. C.; Ka'apu-Lyons, C. A.; Umhau, B.; Popp, B. N.

    2016-02-01

    The mesopelagic food web is a major contributor to the biological carbon pump but is largely unconstrained mainly due to inadequate sampling of the deep ocean. Recent results of amino acid compound specific nitrogen isotope analyses (AA-CSIA) indicate the possibility of refractory suspended particles contributing to the mesopelagic food community in addition to more labile rapidly sinking particles from the surface oceans. Here we combine amino acid concentrations and AA-CSIA with 234Thorium (234Th) measurements to constrain seasonal differences in the downward flux of particles from the surface ocean at station ALOHA in the subtropical North Pacific Ocean. We determined the concentrations and isotopic composition of specific amino acids as well as the 234Th-normalized flux of C, N and amino acids throughout the upper 400m of the water column during winter and summer of 2014. Results exhibit distinct seasonal profiles. The amino acid flux was 10 times greater in the summer, indicating increased primary production and export from the surface oceans to the deep. In contrast, the fraction of each specific amino acid compared to the total amount of amino acids remained reasonably constant between seasons and depths. Throughout the water column δ15N values of small particles (1-53µm) increased with depth, consistent with previous results from deeper samples (up to 750 meters) and indicating microbial degradation. The large particles (>53µm) have differing isotopic composition, allowing the contribution of small and large particles to be distinguishable within the mesopelagic food web. This study highlights the dependence of the deep ocean on the strength of the biological pump and our results potentially can be used to interpret the seasonal dietary composition of higher trophic level mesopelagic organisms.

  19. Determination of the isotopic ratio 234 U/238 U and 235 U/238 U in uranium commercial reagents by alpha spectroscopy

    International Nuclear Information System (INIS)

    Iturbe G, J.L.

    1990-02-01

    In this work the determination of the isotope ratio 234 U/ 238 U and 235 U/ 238 U obtained by means of the alpha spectroscopy technique in uranium reagents of commercial marks is presented. The analyzed uranium reagents were: UO 2 (*) nuclear purity, UO 3 (*) poly-science, metallic uranium, uranyl nitrate and uranyl acetate Merck, uranyl acetate and uranyl nitrate Baker, uranyl nitrate (*) of the Refinement and Conversion Department of the ININ, uranyl acetate (*) Medi-Lab Sigma of Mexico and uranyl nitrate Em Science. The obtained results show that the reagents that are suitable with asterisk (*) are in radioactive balance among the one 234 U/ 238 U, since the obtained value went near to the unit. In the case of the isotope ratio 235 U/ 238 U the near value was also obtained the one that marks the literature that is to say 0.04347, what indicates that these reagents contain the isotope of 235 U in the percentage found in the nature of 0.71%. The other reagents are in radioactive imbalance among the 234 U/ 238 U, the found values fluctuated between 0.4187 and 0.1677, and for the quotient of activities 235 U/ 238 U its were of 0.0226, and the lowest of 0.01084. Also in these reagents it was at the 236 U as impurity. The isotope of 236 U is an isotope produced artificially, for what is supposed that the reagents that are in radioactive imbalance were synthesized starting from irradiated fuel. (Author)

  20. Determination of the distribution coefficients for the radionuclides 134Cs, 60Co and 234Th in the Pinheiros river sediment

    International Nuclear Information System (INIS)

    Lima, Marina Ferreira

    1992-01-01

    The distribution coefficients (Kd) were determined in order to foresee the fate of the radionuclides discharged to the environment. Based upon the source-term released by IPEN's facilities in Pinheiros River during the year of 1988, three radionuclides were chosen as being the more critical, according to the radiation protection standards: 137 Cs, 60 Co and 232 Th. Their Kd were determined experimentally in laboratory by using the corresponding radioactive tracers 134 Cs, 60 Co and 234 Th. Three different experimental methodologies were used: the static method. the shaken method and the dynamic method. The parameters studied were the effects of pH, aerobic condition and time of contact. No considerable changes were observed for the cesium Kd with the variation of pH and aerobic condition, the kd extreme values being 20 ml/g and 30 ml/g for the pH range between 4 and 8. The study of the time of contact showed that the equilibrium between the cesium concentration in the water and sediment was achieved in a few days. For the cobalt, the pH effect was considerable, since the Kd increased from 46 ml/g for pH 4 to 2,25x10 3 ml/g for pH 8. The Kd observed with the agitation with air was around 420 ml/g, rising to 670 ml/g with the agitation with N 2 . The results obtained in the study of the time of contact effect showed that the equilibrium between the cobalt concentration in the water and sediment was not achieved even after 15 days of contact. For the thorium, also, the pH effect was considerable, since the Kd increased fram 1,40 x 10 5 ml/g for pH 4 to 2,55 x 10 6 ml/g for pH 8. No effect was observed, on the other hand, for the kd values obtained in the experiment carried out with air agitation or N 2 agitation, around 2,75 x 10 6 ml/g. The results obtained in the study of the time of contact effect showed that the equilibrium between the thorium concentration in the water and sediment was achieved after just one hour of contact. The results obtained can be

  1. A study on possible use of Urtica dioica (common nettle) plants as uranium (234U, 238U) contamination bioindicator near phosphogypsum stockpile

    International Nuclear Information System (INIS)

    Olszewski, Grzegorz; Borylo, Alicja; Skwarzec, Bogdan

    2016-01-01

    The aim of this study was to determine uranium concentrations in common nettle (Urtica dioica) plants and corresponding soils samples which were collected from the area of phosphogypsum stockpile in Wislinka (northern Poland). The uranium concentrations in roots depended on its concentrations in soils. Calculated BCF and TF values showed that soils characteristics and air deposition affect uranium absorption and that different uranium species have different affinities to U. dioica plants. The values of 234 U/ 238 U activity ratio indicate natural origin of these radioisotopes in analyzed plants. Uranium concentration in plants roots is negatively weakly correlated with distance from phosphogypsum stockpile. (author)

  2. A study on possible use of Urtica dioica (common nettle) plants as uranium (234U, 238U) contamination bioindicator near phosphogypsum stockpile.

    Science.gov (United States)

    Olszewski, Grzegorz; Boryło, Alicja; Skwarzec, Bogdan

    The aim of this study was to determine uranium concentrations in common nettle ( Urtica dioica ) plants and corresponding soils samples which were collected from the area of phosphogypsum stockpile in Wiślinka (northern Poland). The uranium concentrations in roots depended on its concentrations in soils. Calculated BCF and TF values showed that soils characteristics and air deposition affect uranium absorption and that different uranium species have different affinities to U . dioica plants. The values of 234 U/ 238 U activity ratio indicate natural origin of these radioisotopes in analyzed plants. Uranium concentration in plants roots is negatively weakly correlated with distance from phosphogypsum stockpile.

  3. Accurate measurements of fission-fragment yields in 234,235,236,238U(γ,f) with the SOFIA set-up

    International Nuclear Information System (INIS)

    Chatillon, A.; Taieb, J.; Martin, J.F.; Pellereau, E.; Boutoux, G.; Gorbinet, T.; Grente, L.; Belier, G.; Laurent, B.; Alvarez-Pol, H.; Ayyad, Y.; Benlliure, J.; Caamano, M.; Cortina-Gil, D.; Fernandez-Dominguez, B.; Paradela, C.; Ramos, D.; Rodriguez-Sanchez, J.L.; Vargas, J.; Audouin, L.; Tassan-Got, L.; Yan, Y.; Casarejos, E.; Farget, F.; Rodriguez-Tajes, C.; Heinz, A.; Lindberg, S.; Jurado, B.; Kelic-Heil, A.; Kurz, N.; Loeher, B.; Nociforo, C.; Pietri, S.; Rossi, D.; Schmidt, K.H.; Simon, H.; Voss, B.; Weick, H.; Toernqvist, H.

    2016-01-01

    SOFIA (Studies On Fission with Aladin) is a new experimental set-up dedicated to accurate measurement of fission-fragments isotopic yields. It is located at GSI, the only place to use inverse kinematics at relativistic energies in order to study the (γ,f) electromagnetic-induced fission. The SOFIA set-up is a large-acceptance magnetic spectrometer, which allows to fully identify both fission fragments in coincidence on the whole fission-fragment range. This paper will report on fission yields obtained in 234,235,236,238 U(γ,f) reactions. (authors)

  4. Study on the radioactivity and soil-to-plant transfer factor of (226)Ra, (234)U and (238)U radionuclides in irrigated farms from the northwestern Saudi Arabia.

    Science.gov (United States)

    Al-Hamarneh, Ibrahim F; Alkhomashi, N; Almasoud, Fahad I

    2016-08-01

    The present study addresses the soil-to-plant transfer factors (TFs) of (226)Ra, (234)U and (238)U for 13 types of vegetables and agricultural crops planted under semi-arid environment in the northwestern part of Saudi Arabia. Crop plants along with plant-growing soils were collected from selected farms, which are irrigated from the non-renewable Saq aquifer, and investigated for their radioactivity content by means of alpha spectrometry after applying a radiochemical separation procedure. Hence, TF data for plant roots, green parts (stem and leaves) and fruits were calculated and contrasted to those reported in the literature. Substantial differences were observed in the TFs of Ra and U radioisotopes among plant species. In crop fruits, eggplant exhibited the highest uptake of (226)Ra (TF value of 0.11), while beans (0.16) have the highest TF for (234)U and (238)U. The geometric mean TF values indicated that the crop roots tend to accumulate Ra and U about four to six-folds higher than fruits. The relation between TF values and soil concentrations showed a weak correlation. Activity ratios between radionuclides in crop plants indicated the preferential translocation of U in fruits than Ra even though Ra is more available for root uptake. The fruit/root (F/R) ratios obtained for the investigated plants shown that pepper had the smallest F/R ratios (0.07 ± 0.01, 0.12 ± 0.02 and 0.11 ± 0.02 for (226)Ra, (234)U and (238)U, respectively), while the highest F/R ratios were observed in potatoes (0.71 ± 0.15, 0.44 ± 0.10 and 0.40 ± 0.08 for (226)Ra, (234)U and (238)U, respectively). The TF and F/R ratios data of natural radionuclides in the study region can hopefully improve the scientific knowledge for future studies. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Study on the radioactivity and soil-to-plant transfer factor of 226Ra, 234U and 238U radionuclides in irrigated farms from the northwestern Saudi Arabia

    International Nuclear Information System (INIS)

    Al-Hamarneh, Ibrahim F.; Alkhomashi, N.; Almasoud, Fahad I.

    2016-01-01

    The present study addresses the soil-to-plant transfer factors (TFs) of 226 Ra, 234 U and 238 U for 13 types of vegetables and agricultural crops planted under semi-arid environment in the northwestern part of Saudi Arabia. Crop plants along with plant-growing soils were collected from selected farms, which are irrigated from the non-renewable Saq aquifer, and investigated for their radioactivity content by means of alpha spectrometry after applying a radiochemical separation procedure. Hence, TF data for plant roots, green parts (stem and leaves) and fruits were calculated and contrasted to those reported in the literature. Substantial differences were observed in the TFs of Ra and U radioisotopes among plant species. In crop fruits, eggplant exhibited the highest uptake of 226 Ra (TF value of 0.11), while beans (0.16) have the highest TF for 234 U and 238 U. The geometric mean TF values indicated that the crop roots tend to accumulate Ra and U about four to six-folds higher than fruits. The relation between TF values and soil concentrations showed a weak correlation. Activity ratios between radionuclides in crop plants indicated the preferential translocation of U in fruits than Ra even though Ra is more available for root uptake. The fruit/root (F/R) ratios obtained for the investigated plants shown that pepper had the smallest F/R ratios (0.07 ± 0.01, 0.12 ± 0.02 and 0.11 ± 0.02 for 226 Ra, 234 U and 238 U, respectively), while the highest F/R ratios were observed in potatoes (0.71 ± 0.15, 0.44 ± 0.10 and 0.40 ± 0.08 for 226 Ra, 234 U and 238 U, respectively). The TF and F/R ratios data of natural radionuclides in the study region can hopefully improve the scientific knowledge for future studies. - Highlights: • Ra and U isotopes were measured in soils and plant crops in farms in Saudi Arabia. • Ra and U activities in plant roots (R) slightly exceeded that in their fruits (F). • Ra/U activity ratios showed preferential translocation of U

  6. Simple method of uranium extraction from carbonate ground water and its application to /sup 234/U//sup 238/U disequilibrium studies

    Energy Technology Data Exchange (ETDEWEB)

    Gascoyne, M. (McMaster Univ., Hamilton, Ontario (Canada). Dept. of Geology)

    1981-05-01

    Uranium in solution in limestone groundwaters is found to absorb on strongly basic anion exchange resin without requiring preconditioning of the water. Adsorption efficiencies of 50-100 % have been measured in eight field trials, which include seven seepage sites in four North American caves. Generally good agreement is found between /sup 234/U//sup 238/U ratios in the seepage water and associated calcite deposit (stalactites and stalagmites). The simplicity and compactness of this method of uranium preconcentration makes it especially suitable for determination of uranium isotopic variations in remote or restricted environments.

  7. Bioaccumulation of polonium ({sup 210}Po) and uranium ({sup 234}U, {sup 238}U) in plants around phosphogypsum waste heap in Wislinka (northern Poland)

    Energy Technology Data Exchange (ETDEWEB)

    Borylo, A.; Skwarzec, B. [Gdansk Univ. (Poland). Faculty of Chemistry

    2011-07-01

    In the study the activities of polonium {sup 210}Po and uranium {sup 234}U, {sup 238}U in plants, collected near phosphogypsum waste heap in Wis'linka (northern Poland), were determined by using the alpha spectrometry. The obtained results revealed that the concentrations of {sup 210}Po, {sup 234}U, and {sup 238}U in the analyzed plants were differentiated. In the analyzed flora organisms the highest amounts of polonium and uranium were found in ruderal plant samples as well as willow samples (Salix viminalis) from protection zone of phosphogypsum waste heap. The concentrations of {sup 210}Po, {sup 234}U and {sup 238}U in the analyzed plants were higher in roots than in green parts of plants. The higher concentrations of {sup 210}Po and {sup 238}U radionuclides were estimated for hydrophyte (common sedge Carex nigra Reichard), the favourite habitat of which is particularly wet meadow and for plants collected in the vicinity of phosphogypsum waste heap. The major source of polonium and uranium in analyzed plants is root system. The values of {sup 234}U/ {sup 238}U activity ratio in all analyzed plants are closed to one, what indicated that source of uranium in analyzed plants is phosphogypsum. The highest uranium and polonium concentrations were characterized for plants, which are covered with tomentose. The comparability polonium and uranium contents were confirmed in edible plants, but higher accumulation was determined in ripe species than immature species of vegetables. The higher polonium and uranium concentrations were noticed in green parts of plant, the lower in roots. Polonium concentration in cultivated plants samples was not species diverse. Therefore, the significant source of polonium and uranium in analyzed plants is wet and dry atmospheric falls gathering the soil and air dust from phosphogypsum waste dump. The maximum {sup 210}Po and {sup 238}U radionuclides concentrations were found in green parts of red beet (Beta vulgaris esculenta), the

  8. Residence time of suspended particles in the Garonne River (SW France): indications derived from Th-234, Be-7 and Pb-210

    Science.gov (United States)

    Schmidt, Sabine; Saari, Hanna-Kaïsa

    2013-04-01

    Particulates that enter the ocean from rivers are the products of integrated basin-wide processes (soil erosion, sediment transport and deposition in watersheds). The fate of sediments in river is therefore challenging and generally analysed using hydrodynamics models. An alternative method relies on the use of fallout radioactive tracers to identify sediment source regions and/or to estimate suspended sediment age or the fraction of the suspended sediment recently eroded from the landscape. This work presents the application of naturally occurring radionuclides: Pb-210 (T1/2 = 22.3 years) and Be-7 (T1/2 = 53 days), both delivered by atmospheric fallout, and Th-234 (T1/2 = 24.1 days), to investigate residence times of particles in the lower Garonne River (South-West France). Th-234, produced continuously by decay of U-238, is widely used in marine sciences for studying particle dynamic on time-scales of days to weeks, but a major limitation to extend its application from the ocean to river is the activity (level, variability) of its parent, U-238, in contrast with the high and rather constant levels of oceanic uranium. The Garonne River has a watershed of 55 000 km2 with a mean discharge of 650 m3 s-1 (range: 12500 m3 s-1). It flows westward about 647 km from the Spanish Pyrenees, ending into the Gironde, its common estuary with the Dordogne River. To investigate suspended particle dynamic of the lower Garonne River, monthly samplings were performed from January 2006 to December 2007 at selected sites along this river system, including a site in its estuarine section. Dissolved and particulate activities of radionuclides were determined using a low-background, well-shaped gamma spectrometer. Additional data (river discharge, rain rate, suspended particulate concentrations) were also collected to better interpret radionuclide data. Whereas dissolved fractions are always negligible, particulate Th-234, Be-7 and Pb-210 activities present marked spatio

  9. Analysis of prompt fission neutrons in 235U(nth,f) and fission fragment distributions for the thermal neutron induced fission of 234U

    Science.gov (United States)

    Al-Adili, A.; Tarrío, D.; Hambsch, F.-J.; Göök, A.; Jansson, K.; Solders, A.; Rakopoulos, V.; Gustafsson, C.; Lantz, M.; Mattera, A.; Oberstedt, S.; Prokofiev, A. V.; Vidali, M.; Österlund, M.; Pomp, S.

    2016-06-01

    This paper presents the ongoing analysis of two fission experiments. Both projects are part of the collaboration between the nuclear reactions group at Uppsala and the JRC-IRMM. The first experiment deals with the prompt fission neutron multiplicity in the thermal neutron induced fission of 235U(n,f). The second, on the fission fragment properties in the thermal fission of 234U(n,f). The prompt fission neutron multiplicity has been measured at the JRC-IRMM using two liquid scintillators in coincidence with an ionization chamber. The first experimental campaign focused on 235U(nth,f) whereas a second experimental campaign is foreseen later for the same reaction at 5.5 MeV. The goal is to investigate how the so-called sawtooth shape changes as a function of fragment mass and excitation energy. Some harsh experimental conditions were experienced due to the large radiation background. The solution to this will be discussed along with preliminary results. In addition, the analysis of thermal neutron induced fission of 234U(n,f) will be discussed. Currently analysis of data is ongoing, originally taken at the ILL reactor. The experiment is of particular interest since no measurement exist of the mass and energy distributions for this system at thermal energies. One main problem encountered during analysis was the huge background of 235U(nth,f). Despite the negligible isotopic traces in the sample, the cross section difference is enormous. Solution to this parasitic background will be highlighted.

  10. Measurement of the neutron capture cross section of U234 in n-TOF at CERN for Generation IV nuclear reactors

    International Nuclear Information System (INIS)

    Dridi, W.

    2006-11-01

    Accurate and reliable neutron capture cross sections are needed in many research areas, including stellar nucleosynthesis, advanced nuclear fuel cycles, waste transmutation, and other applied programs. In particular, the accurate knowledge of U 234 (n,γ) reaction cross section is required for the design and realization of nuclear power plants based on the thorium fuel cycle. We have measured the neutron capture cross section of U 234 , with a 4π BaF 2 Total Absorption Calorimeter, at the recently constructed neutron time-of-flight facility n-TOF at CERN in the energy range from 0.03 eV to 1 MeV. Monte-Carlo simulations with GEANT4 and MCNPX of the detector response have been performed. After the background subtraction and correction with dead time and pile-up, the capture yield from 0.03 eV up to 1.5 keV was derived. The analysis of the capture yield in terms of R-matrix resonance parameters is discussed. We have identified 123 resonances and measured the resonance parameters in the energy range from 0.03 eV to 1.5 keV. The mean radiative width γ > is found to be (38.2 ± 1.5) meV and the mean spacing parameter 0 > is (11.0 ± 0.2) eV, both values agree well with recommended values

  11. High-resolution transcriptomic analyses of Sinorhizobium sp. NGR234 bacteroids in determinate nodules of Vigna unguiculata and indeterminate nodules of Leucaena leucocephala.

    Science.gov (United States)

    Li, Yan; Tian, Chang Fu; Chen, Wen Feng; Wang, Lei; Sui, Xin Hua; Chen, Wen Xin

    2013-01-01

    The rhizobium-legume symbiosis is a model system for studying mutualistic interactions between bacteria and eukaryotes. Sinorhizobium sp. NGR234 is distinguished by its ability to form either indeterminate nodules or determinate nodules with diverse legumes. Here, we presented a high-resolution RNA-seq transcriptomic analysis of NGR234 bacteroids in indeterminate nodules of Leucaena leucocephala and determinate nodules of Vigna unguiculata. In contrast to exponentially growing free-living bacteria, non-growing bacteroids from both legumes recruited several common cellular functions such as cbb3 oxidase, thiamine biosynthesis, nitrate reduction pathway (NO-producing), succinate metabolism, PHB (poly-3-hydroxybutyrate) biosynthesis and phosphate/phosphonate transporters. However, different transcription profiles between bacteroids from two legumes were also uncovered for genes involved in the biosynthesis of exopolysaccharides, lipopolysaccharides, T3SS (type three secretion system) and effector proteins, cytochrome bd ubiquinol oxidase, PQQ (pyrroloquinoline quinone), cytochrome c550, pseudoazurin, biotin, phasins and glycolate oxidase, and in the metabolism of glutamate and phenylalanine. Noteworthy were the distinct expression patterns of genes encoding phasins, which are thought to be involved in regulating the surface/volume ratio of PHB granules. These patterns are in good agreement with the observed granule size difference between bacteroids from L. leucocephala and V. unguiculata.

  12. High-resolution transcriptomic analyses of Sinorhizobium sp. NGR234 bacteroids in determinate nodules of Vigna unguiculata and indeterminate nodules of Leucaena leucocephala.

    Directory of Open Access Journals (Sweden)

    Yan Li

    Full Text Available The rhizobium-legume symbiosis is a model system for studying mutualistic interactions between bacteria and eukaryotes. Sinorhizobium sp. NGR234 is distinguished by its ability to form either indeterminate nodules or determinate nodules with diverse legumes. Here, we presented a high-resolution RNA-seq transcriptomic analysis of NGR234 bacteroids in indeterminate nodules of Leucaena leucocephala and determinate nodules of Vigna unguiculata. In contrast to exponentially growing free-living bacteria, non-growing bacteroids from both legumes recruited several common cellular functions such as cbb3 oxidase, thiamine biosynthesis, nitrate reduction pathway (NO-producing, succinate metabolism, PHB (poly-3-hydroxybutyrate biosynthesis and phosphate/phosphonate transporters. However, different transcription profiles between bacteroids from two legumes were also uncovered for genes involved in the biosynthesis of exopolysaccharides, lipopolysaccharides, T3SS (type three secretion system and effector proteins, cytochrome bd ubiquinol oxidase, PQQ (pyrroloquinoline quinone, cytochrome c550, pseudoazurin, biotin, phasins and glycolate oxidase, and in the metabolism of glutamate and phenylalanine. Noteworthy were the distinct expression patterns of genes encoding phasins, which are thought to be involved in regulating the surface/volume ratio of PHB granules. These patterns are in good agreement with the observed granule size difference between bacteroids from L. leucocephala and V. unguiculata.

  13. First report on isolation of 2,3,4-trihydroxy-5-methylacetophenone from palmyra palm (Borassus flabellifer Linn.) syrup, its antioxidant and antimicrobial properties.

    Science.gov (United States)

    Reshma, M V; Jacob, Jubi; Syamnath, V L; Habeeba, V P; Dileep Kumar, B S; Lankalapalli, Ravi S

    2017-08-01

    The first report on isolation and characterization of 2,3,4-trihydroxy-5-methylacetophenone (1), nicotinamide (2), and uracil (3) from palmyra palm syrup is described. Total phenolic content (TPC) and Total flavonoid content (TFC) of palm syrup were 244.70±5.77(mggallic acid/kg of syrup) and 658.45±27.86(mg quercetin/kg of syrup), respectively. Compound 1 exhibited DPPH radical scavenging activity with an IC 50 value of 20.02±0.14μM which was better than ascorbic acid (IC 50 =22.59±0.30μM). Compound 1 also showed broad spectrum antibacterial activity against Escherichia coli, Mycobacterium smegmatis, Staphylococcus aureus and Staphylococcus simulans. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. A search for nonnucleonic degrees of freedom by means of πXe interactions at 2.34 and 3.5 GeV/c

    International Nuclear Information System (INIS)

    Slowinski, B.

    1999-01-01

    The experimental data concerning the peripheral interactions of π mesons with xenon nuclei at 2.34 and 3.5 GeV/c [1] are reanalysed in order to search for a nonnucleonic intranuclear target, which may appear in these interactions. Since such interactions are predominantly one-step intranuclear collisions (or, otherwise, the so-called quasi-free collisions) only, therefore a possible correlation between the measured emission angles θ π and total energies E π of π mesons produced in these interactions, and, in particular, in quasi-two-body channels, may give information about the intranuclear target's mass [1]. Our results presented in the form of two-dimensional scatter plots (θ π vs. E π ) show a clear concentration of experimental points around the kinetic curve corresponding to the intranuclear target of pion's rest mass [2]. Background effects, which may simulate the observed correlation, are also discussed

  15. Combined bending-torsion fatigue reliability of AISI 4340 steel shafting with K sub t = 2.34. [stress concentration factor

    Science.gov (United States)

    Kececioglu, D.; Chester, L. B.; Dodge, T. M.

    1974-01-01

    Results generated by three, unique fatigue reliability research machines which can apply reversed bending loads combined with steady torque are presented. Six-inch long, AISI 4340 steel, grooved specimens with a stress concentration factor of 2.34 and R sub C 35/40 hardness were subjected to various combinations of these loads and cycled to failure. The generated cycles-to-failure and stress-to-failure data are statistically analyzed to develop distributional S-N and Goodman diagrams. Various failure theories are investigated to determine which one represents the data best. The effect of the groove and of the various combined bending-torsion loads on the S-N and Goodman diagrams are determined. Three design applications are presented. The third one illustrates the weight savings that may be achieved by designing for reliability.

  16. Fission cross section ratios for sup 233,234,236 U relative to sup 235 U from 0. 5 to 400 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J. (Los Alamos National Lab., NM (USA)); Carlson, A.D.; Wasson, O.A. (National Inst. of Standards and Technology, Gaithersburg, MD (USA)); Hill, N.W. (Oak Ridge National Lab., TN (USA))

    1991-01-01

    Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of {sup 233, 234, 236}U relative to {sup 235}U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the {sup 235}U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for {sup 235}U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for {sup 235}U(n,f). 6 refs., 1 fig.

  17. Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1991-01-01

    Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233, 234, 236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n,f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n,f) at 14.1 MeV to allow us to obtain cross section section values from the ratio data and our values for 235 U(n,f). 6 refs., 1 fig

  18. Fission cross section ratios for 233,234,236U relative to 235U from 0.5 to 400 MeV

    International Nuclear Information System (INIS)

    Lisowski, P.W.; Gavron, A.; Parker, W.E.; Balestrini, S.J.; Carlson, A.D.; Wasson, O.A.; Hill, N.W.

    1992-01-01

    Neutron-induced fission cross section ratios from 0.5 to 400 MeV for samples of 233,234,236 U relative to 235 U have been measured at the WNR neutron Source at Los Alamos. The fission reaction rate was determined using a fast parallel plate ionization chamber at a 20-m flight path. Cross sections over most of the energy range were also extracted using the neutron fluence determined with three different proton telescope arrangements. Those data provided the shape of the 235 U(n, f) cross section relative to the hydrogen scattering cross section. That shape was then normalized to the very accurately known value for 235 U(n, f) at 14.1 MeV which will allow us to obtain cross section values from the ratio data and our values for 235 U(n, f). (orig.)

  19. Preliminary preformulation studies of a 2-(3,4-dimethoxyphenyl)ethylamine derivative for oral administration at an exploratory stage of new drug development.

    Science.gov (United States)

    Morita, M; Hosokami, T; Konno, T; Kinuno, K; Mafune, E; Takasugi, N

    1995-03-01

    Preliminary preformulation studies of a 2-(3,4-dimethoxyphenyl)ethylamine derivative were investigated. The hydrochloride form showed incompatibility with the excipients used for oral dosage forms. There were several crystal forms of the free base, namely, alpha-anhydrate, beta-anhydrate, monohydrate, and trihydrate. The trihydrate form was unstable. The degree of crystallinity of the beta-anhydrate form was difficult to control. The monohydrate form was difficult to manufacture with constant quality. The serum levels of the compounds in rats were almost related to the dissolution rates in the JP 1st disintegration medium from the discs. The serum level of alpha-anhydrate was the lowest. However, the dissolution rates from the formulations of alpha-anhydrate were improved. After oral administration of the improved formulation, the serum level of alpha-anhydrate in beagle dogs was almost triple that after the oral administration of the capsule of the hydrochloride form.

  20. Widely tunable and monochromatic terahertz difference frequency generation with organic crystal 2-(3-(4-hydroxystyryl)-5,5-dime-thylcyclohex-2-enylidene) malononitrile

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Pengxiang [The Institute of Laser and Optoelectronics, College of Precision Instruments and Opto-electronics Engineering, Tianjin University, Tianjin 300072 (China); The Key Laboratory of Weak-Light Nonlinear Photonics, Ministry of Education, School of Physics and TEDA Applied Physics Institute, Nankai University, Tianjin 300071 (China); Zhang, Xinyuan [Beijing Center for Crystal Research and Development, Key Laboratory of Functional Crystals and Laser Technology, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); University of Chinese Academy of Sciences, Beijing 100049 (China); Yan, Chao; Xu, Degang, E-mail: xudegang@tju.edu.cn; Shi, Wei; Yao, Jianquan [The Institute of Laser and Optoelectronics, College of Precision Instruments and Opto-electronics Engineering, Tianjin University, Tianjin 300072 (China); Li, Yin; Zhang, Guochun; Wu, Yicheng [Beijing Center for Crystal Research and Development, Key Laboratory of Functional Crystals and Laser Technology, Technical Institute of Physics and Chemistry, Chinese Academy of Sciences, Beijing 100190 (China); Zhang, Xinzheng [The Key Laboratory of Weak-Light Nonlinear Photonics, Ministry of Education, School of Physics and TEDA Applied Physics Institute, Nankai University, Tianjin 300071 (China)

    2016-01-04

    We report an experimental study on widely tunable terahertz (THz) wave difference frequency generation (DFG) with hydrogen-bonded crystals 2-(3-(4-hydroxystyryl)-5,5-dime-thylcyclohex-2-enylidene) malononitrile (OH1). The organic crystals were pumped by a ∼1.3 μm double-pass KTiOPO{sub 4} optical parametric oscillator. A tuning range of 0.02–20 THz was achieved. OH1 crystals offer a long effective interaction length (also high output) for the generation below 3 THz, owing to the low absorption and favorable phase-matching. The highest energy of 507 nJ/pulse was generated at 1.92 THz with a 1.89-mm-thick crystal. Comprehensive explanations were provided, on the basis of theoretical calculations. Cascading phenomenon during the DFG process was demonstrated. The photon conversion efficiency could reach 2.9%.

  1. Ground water contamination with (238)U, (234)U, (235)U, (226)Ra and (210)Pb from past uranium mining: cove wash, Arizona.

    Science.gov (United States)

    Dias da Cunha, Kenya Moore; Henderson, Helenes; Thomson, Bruce M; Hecht, Adam A

    2014-06-01

    The objectives of the study are to present a critical review of the (238)U, (234)U, (235)U, (226)Ra and (210)Pb levels in water samples from the EPA studies (U.S. EPA in Abandoned uranium mines and the Navajo Nation: Red Valley chapter screening assessment report. Region 9 Superfund Program, San Francisco, 2004, Abandoned uranium mines and the Navajo Nation: Northern aum region screening assessment report. Region 9 Superfund Program, San Francisco, 2006, Health and environmental impacts of uranium contamination, 5-year plan. Region 9 Superfund Program, San Franciso, 2008) and the dose assessment for the population due to ingestion of water containing (238)U and (234)U. The water quality data were taken from Sect. "Data analysis" of the published report, titled Abandoned Uranium Mines Project Arizona, New Mexico, Utah-Navajo Lands 1994-2000, Project Atlas. Total uranium concentration was above the maximum concentration level for drinking water (7.410-1 Bq/L) in 19 % of the water samples, while (238)U and (234)U concentrations were above in 14 and 17 % of the water samples, respectively. (226)Ra and (210)Pb concentrations in water samples were in the range of 3.7 × 10(-1) to 5.55 × 102 Bq/L and 1.11 to 4.33 × 102 Bq/L, respectively. For only two samples, the (226)Ra concentrations exceeded the MCL for total Ra for drinking water (0.185 Bq/L). However, the (210)Pb/(226)Ra ratios varied from 0.11 to 47.00, and ratios above 1.00 were observed in 71 % of the samples. Secular equilibrium of the natural uranium series was not observed in the data record for most of the water samples. Moreover, the (235)U/(total)U mass ratios ranged from 0.06 to 5.9 %, and the natural mass ratio of (235)U to (total)U (0.72 %) was observed in only 16 % of the water samples, ratios above or below the natural ratio could not be explained based on data reported by U.S. EPA. In addition, statistical evaluations showed no correlations among the distribution of the radionuclide concentrations

  2. Theoretical and experimental investigation of (E)-2-([3,4-dimethylphenyl)imino]methyl)-3-methoxyphenol: Enol-keto tautomerism, spectroscopic properties, NLO, NBO and NPA analysis

    Science.gov (United States)

    Demircioğlu, Zeynep; Albayrak, Çiğdem; Büyükgüngör, Orhan

    2014-05-01

    The molecular structure and spectroscopic properties of (E)-2-([3,4-dimethylphenyl)imino]methyl)-3-methoxyphenol were investigated by X-ray diffraction, FT-IR and UV-vis spectroscopy. The vibrational frequencies calculatedusing DFT/B3LYP/6-31G(d,p) method. Results showed better agreement with the experimental values. The electronic properties was studied and the most prominent transition corresponds to π → π* and n → π*. Two types of intramolecular hydrogen bonds are strong OH⋯N interactions in enol-imine form and NH⋯O interactions in keto-amine form are compared by using density functional theory (DFT) method with B3LYP applying 6-31G(d,p) basis set. Both enol-keto tautomers engender six-membered ring due to intramolecular hydrogen bonded interactions.

  3. Structure-activity relationships for flavone interactions with amyloid β reveal a novel anti-aggregatory and neuroprotective effect of 2',3',4'-trihydroxyflavone (2-D08).

    Science.gov (United States)

    Marsh, Dylan T; Das, Sukanya; Ridell, Jessica; Smid, Scott D

    2017-07-15

    Naturally-occurring flavonoids have well documented anti-aggregatory and neuroprotective properties against the hallmark toxic protein in Alzheimer's disease, amyloid β (Aβ). However the extensive diversity of flavonoids has limited the insight into the precise structure-activity relationships that confer such bioactive properties against the Aβ protein. In the present study we have characterised the Aβ binding properties, anti-aggregatory and neuroprotective effects of a discreet set of flavones, including the recently described novel protein sumoylation inhibitor 2',3',4'-trihydroxyflavone (2-D08). Quercetin, transilitin, jaceosidin, nobiletin and 2-D08 were incubated with human Aβ 1-42 for 48h in vitro and effects on Aβ fibrillisation kinetics and morphology measured using Thioflavin T (ThT) and electron microscopy respectively, in addition to effects on neuronal PC12 cell viability. Of the flavones studied, only quercetin, transilitin and 2-D08 significantly inhibited Aβ 1-42 aggregation and toxicity in PC12 cells. Of those, 2-D08 was the most effective inhibitor. The strong anti-amyloid activity of 2-D08 indicates that extensive hydroxylation in the B ring is the most important determinant of activity against β amyloid within the flavone scaffold. The lack of efficacy of jaceosidin and nobiletin indicate that extension of B ring hydroxylation with methoxyl groups result in an incremental loss of anti-fibrillar and neuroprotective activity, highlighting the constraint to vicinal hydroxyl groups in the B ring for effective inhibition of aggregation. These findings reveal further structural insights into anti-amyloid bioactivity of flavonoids in addition to a novel and efficacious anti-aggregatory and neuroprotective effect of the semi-synthetic flavone and sumoylation inhibitor 2',3',4'-trihydroxyflavone (2-D08). Such modified flavones may facilitate drug development targeting multiple pathways in neurodegenerative disease. Crown Copyright © 2017

  4. Spatial variability of upper ocean POC export in the Bay of Bengal and the Indian Ocean determined using particle-reactive 234Th

    Science.gov (United States)

    Subha Anand, S.; Rengarajan, R.; Sarma, V. V. S. S.; Sudheer, A. K.; Bhushan, R.; Singh, S. K.

    2017-05-01

    The northern Indian Ocean is globally significant for its seasonally reversing winds, upwelled nutrients, high biological production, and expanding oxygen minimum zones. The region acts as sink and source for atmospheric CO2. However, the efficiency of the biological carbon pump to sequester atmospheric CO2 and export particulate organic carbon from the surface is not well known. To quantify the upper ocean carbon export flux and to estimate the efficiency of biological carbon pump in the Bay of Bengal and the Indian Ocean, seawater profiles of total 234Th were measured from surface to 300 m depth at 13 stations from 19.9°N to 25.3°S in a transect along 87°E, during spring intermonsoon period (March-April 2014). Results showed enhanced in situ primary production in the equatorial Indian Ocean and the central Bay of Bengal and varied from 13.2 to 173.8 mmol C m-2 d-1. POC export flux in this region varied from 0 to 7.7 mmol C m-2 d-1. Though high carbon export flux was found in the equatorial region, remineralization of organic carbon in the surface and subsurface waters considerably reduced organic carbon export in the Bay of Bengal. Annually recurring anticyclonic eddies enhanced organic carbon utilization and heterotrophy. Oxygen minimum zone developed due to stratification and poor ventilation was intensified by subsurface remineralization. 234Th-based carbon export fluxes were not comparable with empirical statistical model estimates based on primary production and temperature. Region-specific refinement of model parameters is required to accurately predict POC export fluxes.

  5. Functional analysis of NopM, a novel E3 ubiquitin ligase (NEL domain effector of Rhizobium sp. strain NGR234.

    Directory of Open Access Journals (Sweden)

    Da-Wei Xin

    Full Text Available Type 3 effector proteins secreted via the bacterial type 3 secretion system (T3SS are not only virulence factors of pathogenic bacteria, but also influence symbiotic interactions between nitrogen-fixing nodule bacteria (rhizobia and leguminous host plants. In this study, we characterized NopM (nodulation outer protein M of Rhizobium sp. strain NGR234, which shows sequence similarities with novel E3 ubiquitin ligase (NEL domain effectors from the human pathogens Shigella flexneri and Salomonella enterica. NopM expressed in Escherichia coli, but not the non-functional mutant protein NopM-C338A, showed E3 ubiquitin ligase activity in vitro. In vivo, NopM, but not inactive NopM-C338A, promoted nodulation of the host plant Lablab purpureus by NGR234. When NopM was expressed in yeast, it inhibited mating pheromone signaling, a mitogen-activated protein (MAP kinase pathway. When expressed in the plant Nicotiana benthamiana, NopM inhibited one part of the plant's defense response, as shown by a reduced production of reactive oxygen species (ROS in response to the flagellin peptide flg22, whereas it stimulated another part, namely the induction of defense genes. In summary, our data indicate the potential for NopM as a functional NEL domain E3 ubiquitin ligase. Our findings that NopM dampened the flg22-induced ROS burst in N. benthamiana but promoted defense gene induction are consistent with the concept that pattern-triggered immunity is split in two separate signaling branches, one leading to ROS production and the other to defense gene induction.

  6. Application of (234)U/(238)U activity ratios to investigations of subterranean groundwater discharge in the Cádiz coastal area (SW Spain).

    Science.gov (United States)

    Rodrigo, J F; Casas-Ruiz, M; Vidal, J; Barbero, L; Baskaran, M; Ketterer, M E

    2014-04-01

    The activity ratios of (234)U/(238)U were used to investigate processes of subterranean groundwater discharge into coastal marine waters in a study location at Bay of Cádiz (southwest Spain). Marine waters in the bay and surrounding open ocean exhibited U concentrations of 3.4 ± 0.1 μg/L and activity ratios of 1.15 ± 0.01, in agreement with the expected composition of seawater ((234)U/(238)U activity ratio = 1.148 ± 0.002). Three water samples obtained from the discharge zone of the Guadalete River exhibited activity ratios of 1.17-1.22 along with slightly lower U concentrations compared to seawater, which is likely due to mixing between seawater and a groundwater end-member. One possible source of groundwater was characterized by sampling and analyzing a well water sample collected in the neighboring village of El Puerto de Santa María; this water sample exhibited an activity ratio of 1.34 ± 0.03 and a U concentration of 1.22 μg/L. Water from the Guadelete River estuarine zone can be explained to result from a two-component mixture of seawater and groundwater from the El Puerto de Santa María well; however, if there are several groundwater reservoirs with different U activity ratios that discharge to the coastal water, then, it may be difficult and more studies are being conducted to address this issue. Copyright © 2014 Elsevier Ltd. All rights reserved.

  7. Evaluation of neutron data for americium-241

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M.; Sukhovitskij, E.Sh.; Porodzinskij, Yu.V.; Klepatskij, A.B.; Morogovskij, G.B. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The evaluation of neutron data for {sup 241}Am is made in the energy region from 10{sup -5} eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Y. Kikuchi (JAERI). (author). 60 refs.

  8. The proliferation potential of neptunium and americium

    International Nuclear Information System (INIS)

    An, J. S.; Shin, J. S.; Kim, J. S.; Kwack, E. H.; Kim, B. K.

    2000-05-01

    It is recognized that some trans-uranic elements other than plutonium, in particular Np and Am, if will be available in sufficient quantities, could be used for nuclear explosive devices. The spent fuel has been accumulating in number of nuclear power plant and operation of large scale commercial reprocessing plants. However, these materials are not covered by the definition of special fissionable material in the Agency Statute. At the time when the Statute was adopted, the availability of meaningful quantities of separated Np and Am was remote and they were not included in the definition of special fissionable material. Then, IAEA Board decided a measure for control of Np and Am on September 1999. This report contains the control method and the characteristic of Np and Am for using domestic nuclear industries, and it can be useful for understanding how to report and account of Np and Am. (author)

  9. Analysis procedure for americium in environmental samples

    International Nuclear Information System (INIS)

    Holloway, R.W.; Hayes, D.W.

    1982-01-01

    Several methods for the analysis of 241 Am in environmental samples were evaluated and a preferred method was selected. This method was modified and used to determine the 241 Am content in sediments, biota, and water. The advantages and limitations of the method are discussed. The method is also suitable for 244 Cm analysis

  10. Experiments of pyrochemical process with americium

    International Nuclear Information System (INIS)

    Hayashi, Hirokazu; Minato, Kazuo

    2004-01-01

    Experiments of pyrochemical process of minor actinide nitrides are scheduled. Experimental procedures of electrochemical study of the molten salts containing minor actinides (10-100mg) were established. Preliminary study with a rare earth element used as a surrogate was carried out in the hot cells using master-slave manipulators. (author)

  11. 1976 Hanford Americium exposure incident: hematologic effects

    International Nuclear Information System (INIS)

    Ragan, H.A.; Mahaffey, J.A.; Breitenstein, B.D.

    1982-05-01

    Hematologic evaluation of an individual with an initial systemic body burden of approx. 200 μCi 241 Am revealed a significant (P < 0.01) reduction of total leukocytes, neutrophils, and lymphocytes. This effect on total leukocytes and neutrophils was evident approx. 30 days after exposure, appeared to stabilize at about 3 months after exposure, and remained at this lower level thorugh a 52-months observation period. The effect on lymphocytes was apparent by 3 days after exposure, stabilizing at approx. 50% of pre-exposure values for about 7 months, with a return to pre-exposure levels in the following 4 y. There was a progressive and significant (P < 0.001) decline in platelet counts during the 52-months postexposure period. The pattern of response in erythrocyte parameters was complex. Immediately after the accident, these values were less than the pre-exposure mean level; they gradually increased (P < 0.001) for approx. 2 y and then began a progressive decline (P < 0.001)

  12. Temporal evolution of natural radionuclides distributions {sup 238}U, {sup 234}Th, {sup 226}Ra, {sup 228}Ra, {sup 210}Pb and {sup 210}Po in the Bransfield strait, Antarctica peninsula; Evolucao temporal das distribuicoes dos radionuclideos naturais {sup 238}U, {sup 234}Th, {sup 226}Ra, {sup 228}Ra, {sup 210}Pb and {sup 210}Po no estreito de Bransfiel, peninsula Antartica

    Energy Technology Data Exchange (ETDEWEB)

    Lapa, Flavia Valverde

    2013-07-01

    Research on the distribution of natural radionuclides in Antarctica is rare and thus, there is great interest in to know their occurrence and factors related to its mobilization, transference and accumulation in this extremely fragile environment. Natural radionuclides have been used intensively as tracers in the ocean, helping to better understand processes as sinking and particle resuspension, water masses mixture and oceanic circulation. {sup 234}Th (t½ = 24.1 days) is a particle-reactive radionuclide produced continuously in seawater by the decay of its soluble precursor conservative with salinity {sup 238}U (t½ = 4.5 10{sup 9} years). Since {sup 234}Th presents relatively short half-life, it is used to quantify processes that occur in temporal scale varying from days to weeks. The disequilibrium {sup 234}Th/{sup 238}U in the surface ocean has been applied to estimate carbon fluxes exported via sinking material. The flux of particles biologically productive out of the euphotic zone in the Southern Ocean has special attention due to its importance in the control of CO{sub 2} atmospheric concentrations. The radionuclides {sup 210}Pb (t½ = 22.3 years) and {sup 210}Po (t½ = 138 days) are also particle-reactive. The disequilibrium {sup 210}Po/{sup 210}Pb has been used to estimate fluxes of particles exported in the ocean in the time scale of weeks. The long-lived Ra isotopes, {sup 226}Ra (t½ = 1,600 years) and {sup 228}Ra (t½ = 5.75 years) are soluble in seawater, presenting unique properties that make them excellent tracers of water masses. This research work had the aim to study the distributions of natural radionuclides {sup 238}U, {sup 234}Th, {sup 22}'6Ra, {sup 22}'8Ra, {sup 210}Pb and {sup 210}Po in the Bransfield Strait during 2 samplings carried out in the 2011 Austral Summer (OPERANTAR XXIX and XXX). (author)

  13. Measurement of the neutron capture cross section of U{sup 234} in n-TOF at CERN for Generation IV nuclear reactors; Mesure de la section efficace de capture neutronique de l'{sup 234}U a n-TOF au CERN pour les reacteurs nucleaires de generation 4

    Energy Technology Data Exchange (ETDEWEB)

    Dridi, W

    2006-11-15

    Accurate and reliable neutron capture cross sections are needed in many research areas, including stellar nucleosynthesis, advanced nuclear fuel cycles, waste transmutation, and other applied programs. In particular, the accurate knowledge of U{sup 234}(n,{gamma}) reaction cross section is required for the design and realization of nuclear power plants based on the thorium fuel cycle. We have measured the neutron capture cross section of U{sup 234}, with a 4{pi} BaF{sub 2} Total Absorption Calorimeter, at the recently constructed neutron time-of-flight facility n-TOF at CERN in the energy range from 0.03 eV to 1 MeV. Monte-Carlo simulations with GEANT4 and MCNPX of the detector response have been performed. After the background subtraction and correction with dead time and pile-up, the capture yield from 0.03 eV up to 1.5 keV was derived. The analysis of the capture yield in terms of R-matrix resonance parameters is discussed. We have identified 123 resonances and measured the resonance parameters in the energy range from 0.03 eV to 1.5 keV. The mean radiative width <{gamma}{sub {gamma}}> is found to be (38.2 {+-} 1.5) meV and the mean spacing parameter is (11.0 {+-} 0.2) eV, both values agree well with recommended values.

  14. Origin and geochemical behavior of uranium in marine sediments. Utilization of the {sup 234}U/{sup 238}U ratio in marine geochemistry; Origine et comportement geochimique de l`uranium dans les sediments marins. Utilisation du rapport ({sup 234}U/{sup 238}U) en geochimie marine

    Energy Technology Data Exchange (ETDEWEB)

    Organo, Catherine [Paris-11 Univ., 91 - Orsay (France)

    1997-01-20

    The first part of this thesis presents the current situation of knowledge of uranium in marine environment. The second part describes the methods of analysis as well as the material support of the study, i.e., the sediments and marine deposits investigated. The third part is dedicated to the study of uranium mobility in marine sediments characterized by detrital terrigenous composition (pelagic clays). This approach allowed quantifying the entering and leaving flux of uranium after the sediment settling and, to discuss, on this basis, the consequences on the uranium oceanic balance. In the third part the origin and behavior of uranium in zones of high surface productivity is studied. The uranium enrichments observed in the hemi-pelagic sediments of the EUMELI (J.G.O.F.S.-France) programme will constitute a material of study adequate for measuring the variations in the {sup 234}U/2{sup 38U} ratio in solid phase, in response to the oxido-reducing characteristics of the sediment. Thus establishing the origin of the trapped uranium has been possible. Also, the nature of the sedimentary phases related to uranium in bio-genetic sediments in the Austral Ocean was determined. Thus a relationship between the variations in the {sup 234}U/{sup 238} and the diagenetic transformations was possible to establish. Finally in the fifth part a study of the behavior of uranium in a polymetallic shell characteristic for deposits of hydrogenized origin 146 refs., 57 figs., 23 tabs.

  15. Particle sinking dynamics and POC fluxes in the Eastern Tropical South Pacific based on 234Th budgets and sediment trap deployments

    Science.gov (United States)

    Haskell, William Z., II; Berelson, William M.; Hammond, Douglas E.; Capone, Douglas G.

    2013-11-01

    Assuming steady-state over seasonal to annual timescales, and limited horizontal export of dissolved nutrients, the vertical fluxes of limiting nutrients into the euphotic zone should be balanced by particle export. Sediment traps and 234Th budgets have both been used extensively throughout the oceans as a means to measure this particulate flux from the upper ocean. One main goal of these efforts has been to determine the amount of CO2 fixed by primary producers in the surface ocean that is exported as particulate organic carbon (POC) and conversely, the decrease of particle flux with depth has been used to estimate remineralization rates of nutrients. Although disagreement between trap-derived and 234Th-derived fluxes has often been noted, the possible reasons for the imbalance are numerous, and thus often it is difficult to assign causes. Here, we examine many commonly implicated contributors to the disagreement, allowing us to assess data from a recent 2-year study in the ETSP that shows systematic disagreement between the two methods. Averaging results from both years, sediment traps collected 0.2-1.5 mmol C m-2 d-1 (mean: 0.74 mmol C m-2 d-1) of POC, while the thorium-based method estimated an average POC flux of 1.5-14 mmol C m- d-1 (mean: 6.2 mmol C m-2 d-1). The study area spans regions of differing ecological structure, as inferred from trap mineralogy, and the flux disagreement coincides with this ecological range. We interpret the difference as undercollection of poorly ballasted, slowly sinking particles by the sediment traps. Using both methods simultaneously offers insight into ecosystem structure and resulting particle flux dynamics. The thorium deficit-based flux is 5-10% of previously published estimates of primary productivity based on 14C incubations (Pennington et al., 2006), and 8-20% of concurrent estimates based on 14C incubations and oxygen supersaturation (Capone et al., personal communication; Prokopenko et al., personal communication).

  16. 234U/238U and δ87Sr in peat as tracers of paleosalinity in the Sacramento-San Joaquin Delta of California, USA

    Science.gov (United States)

    Drexler, Judith Z.; Paces, James B.; Alpers, Charles N.; Windham-Myers, Lisamarie; Neymark, Leonid; Bullen, Thomas D.; Taylor, Howard E.

    2013-01-01

    The purpose of this study was to determine the history of paleosalinity over the past 6000+ years in the Sacramento-San Joaquin Delta (the Delta), which is the innermost part of the San Francisco Estuary. We used a combination of Sr and U concentrations, d87Sr values, and 234U/238U activity ratios (AR) in peat as proxies for tracking paleosalinity. Peat cores were collected in marshes on Browns Island, Franks Wetland, and Bacon Channel Island in the Delta. Cores were dated using 137Cs, the onset of Pb and Hg contamination from hydraulic gold mining, and 14C. A proof of concept study showed that the dominant emergent macrophyte and major component of peat in the Delta, Schoenoplectus spp., incorporates Sr and U and that the isotopic composition of these elements tracks the ambient water salinity across the Estuary. Concentrations and isotopic compositions of Sr and U in the three main water sources contributing to the Delta (seawater, Sacramento River water, and San Joaquin River water) were used to construct a three-end-member mixing model. Delta paleosalinity was determined by examining variations in the distribution of peat samples through time within the area delineated by the mixing model. The Delta has long been considered a tidal freshwater marsh region, but only peat samples from Franks Wetland and Bacon Channel Island have shown a consistently fresh signal (Browns Island) has alternated between fresh and oligohaline (0.5-5 ppt).

  17. Sub-barrier resonance fission and its effects on fission fragment properties, exemplified on 234,238U(n,f

    Directory of Open Access Journals (Sweden)

    Oberstedt S.

    2013-03-01

    Full Text Available The correlation between the sub-barrier resonant behaviour of fission crosssection of non-fissile actinides (pre-scission stage and the visible fluctuations of their fission fragment and prompt neutron data (post-scission stage around the incident energies of sub-barrier resonances is outlined and supported by quantitative results for two fissioning systems 234,238U(n,f. These quantitative results refer to both stages of the fission process: a The pre-scission stage including the calculation of neutron induced cross-sections with focus on fission. Calculations are done in the frame of the refined statistical model for fission with sub-barrier effects also extended to take into account the multi-modal fission. b The post-scission stage including the prompt neutron emission treated in the frame of the Point-by-Point model. Total quantities characterizing the fission fragments and the prompt neutrons obtained by averaging the Point-by-Point results as a function of fragment over the fission fragment distributions reveal variations around the energies of sub-barrier resonances in the fission crosssection.

  18. [Comparison and clinical significance of different imageological methods in the detection of transitional carcinoma of upper urinary tract: analysis of 234 cases].

    Science.gov (United States)

    Zhang, Qian; Wang, Bing-dong; Wang, Jie-ping; Zhao, Ya-yuan; Sun, Xiao-wei; Hao, Jin-rui; He, Zhi-song

    2009-12-18

    To determine the diagnostic value of multislice CT urography (MSCTU) in patients with transitional cell carcinoma (TCC) of upper urinary tract by comparing other imageology methods used. Two hundred and thirty four cases of transitional cell carcinoma of upper urinary tract, in which 82 cases were diagnosed pathologically with pelvic carcinoma and 152 cases with ureteral carcinoma, between June 2004 and September 2006 in our institute were enrolled in a retrospective study. Most of them underwent urological ultrasound, intravenous urogram (IVU), retrograde pyelography and MSCTU. We compared the positive rate (PR) and diagnostic rate (DR) of these methods used by chi-square test. Among the 234 cases, 215 patients underwent urologic ultrasound, in which 152 cases were detected to be abnormal, with the PR of 70.7%; Meanwhile, 58 cased were diagnosed by this examination, with the DR of 27.0%. IVU was performed in 193 patients and 132 cases were found to be abnormal, and the PR was 68.4%, 65 cases were diagnosed by IVU and the DR was 33.7%. And 132 patients underwent retrograde pyelography, by which 115 cases of lesion were detected, with the PR of 87.1%; In the meantime, 93 cases were diagnosed, with the DR of 70.5%. MSCTU was performed in 226 cases and 220 cases were found to be abnormal, and the PR was 97.3%; 214 cases were diagnosed by MSCTU, with the DR of 94.7%. The DR of detecting TCC of retrograde pyelography had statistically significant difference with that of ultrasound and IVU (P<0.001). As compared with retrograde pyelography, MSCTU had statistically significant superiority (P<0.001). To shorten the diagnosis time and mitigate the sufferings, patients with hematuria supposed to be TCC of upper urinary tract should be recommended to undergo MSCTU first.

  19. Interaction of Cu(II)-meso-tetrakis(n-N-methylpyridiniumyl)porphyrin (n = 2,3,4) with Native and Synthetic Polynucleotides Probed by Polarized Spectroscopy

    International Nuclear Information System (INIS)

    Lee, Mi Jin; Kim, Seog K.; Kim, Jong Moon; Lee, Dong Jin; Lee, Gil Jun

    2005-01-01

    The interactions of Cu(II)-meso-Tetrakis(n-N-methylpyridiniumyl)porphyrin (n = 2,3,4), respectively referred to as o-, m- and p-CuTMPyP, and DNA, poly[d(A-T) 2 ] and poly[d(G-C) 2 ] were investigated by circular and linear dichroism (CD and LD). In the o-CuTMPyP case, in which the rotation of the pyridinium ring is prevented, the shape of the CD spectrum when associated to DNA and poly[d(A-T) 2 ] resembles and is characterized by a positive band at a low drug to DNA concentration ratio (R ratio) and is bisignate at a high R ratio. The former CD spectrum shape has been attributed to porphyrin that is bound monomerically outside of DNA while the latter can be attributed to those that are stacked. When o-CuTMPyP is bound to poly[d(G-C) 2 ], the excitonic CD appeared at a relatively high R ratio. In contrast, a characteristic negative CD band in the Soret region was apparent for both m- and p-CuTMPyP when bound to DNA and poly[d(G-C) 2 ] at the low R ratios, indicating that the porphyrin molecule intercalates. However, the DNA is bent near the intercalation site and the plane of the porphyrin molecule tilts relative to the DNA helix axis, as judged by the magnitude of the reduced LD. Various stacking patterns were identified by the shape of the CD spectrum for m- and p-CuTMPyP when bound to poly[d(A-T) 2 ]. Three species for the former complex and two for the latter complex were found which may reflect the extent of the stacking

  20. Analysis of 3',5'-dichloro-2,3,4-trihydroxy-2-methylbutylanilide (DTMBA) as a new potential biomarker of exposure to vinclozolin in urine.

    Science.gov (United States)

    Cruz-Hurtado, Marycarmen; López-González, Ma de Lourdes; Escobar-Wilches, Derly Constanza; Sierra-Santoyo, Adolfo

    2018-05-01

    Vinclozolin (V) is a fungicide with anti-androgenic properties whose metabolism is not fully understood, and data on urinary elimination of either V or its metabolites are limited. Therefore the kinetics of urinary elimination of V and its metabolites, after an oral dose in adult male rats were investigated. A single oral dose of V (100 mg/kg) suspended in corn oil was administered to male adult Wistar rats, and urine was collected at different times after dosing. V and its metabolites were extracted from urine, then enzymatically hydrolyzed using β-glucuronidase/sulfatase of H. pomatia, and analyzed by HPLC/DAD. Urinary pharmacokinetic parameters were calculated using the analyte concentrations adjusted by creatinine levels. V and its metabolites 3',5'-dichloro-2,3,4-trihydroxy-2-methylbutylanilide (DTMBA, formerly denoted as M5), 2-[[(3,5-dichlorophenyl)-carbamoyl]oxy]-2-methyl-3-butenoic acid (M1), 3,5-dichloroaniline (M3), and 3',5'-dichloro-2-hydroxy-2-methylbut-3-enanilide (M2) were efficiently detected. The mean urine concentrations of V and M1 metabolite were fitted to a two-compartmental model for pharmacokinetic analysis. DTMBA approximately represented 88% of the total excreted metabolites, it was easily detected up to 168 h after dosing and its half-lives were 21.5 and 74.1 h, respectively. M1 was the second most abundant metabolite and was detected up to 144 h after being void. V and M3 were detected before 48 h, and M2 exhibited the lowest levels during the first 8 h after dosing. DTMBA, the most abundant V metabolite is quickly eliminated by urine, it is chemically stable, specific and could represent a useful alternative to be used as a biomarker of exposure to V. Copyright © 2018 Elsevier Inc. All rights reserved.

  1. Evolution of groundwater chemistry in coastal aquifers of the south-eastern White Sea area (NW Russia) using14C and234U-238U dating.

    Science.gov (United States)

    Malov, A I

    2018-03-01

    The specific objectives of the study are to clarify the sources and characteristics of groundwater in the aquifers along the coast of the White Sea in northwestern Russia, and on this basis to perform a broad 14 C and 234 U/ 238 U dating of all their types, taking into account the mixing processes. Investigation of an evolution of the groundwater chemistry revealed that the main evolutionary trends are the following: (1) Mixing Late Pleistocene brackish water end member (brackish1) and Mikulino seawater end member with strongly brackish and salty water in the Vpd aquifer (salty Vpd) formation. Groundwater dating showed the "brackish1" residence time in the aquifer of 32.96±2.3ka. Recharge of "brackish1" could have occurred in MIS 3. (2) Mixing Late Pleistocene freshwater end member (fresh LP) and "salty Vpd" end member with brackish water (brackish2) formation. Groundwater dating showed the "brackish2" residence time in the aquifer from 25.1±0.7 to 39.2±6.3ka. Recharge of "fresh LP" could have occurred ~ in MIS 3 also. (3) Mixing Middle Pleistocene-Holocene freshwater of melting glaciers (fresh MP-H) end member and brine end member with the strongly brackish and salty water in Vmz aquifer (salty Vmz) formation. Recharge of "fresh MP-H" could have occurred in Middle Pleistocene-Holocene during MIS 12-MIS 1. As a result of intensive and rapid recharge after the glacial melting, glacial fluids have penetrated at depth to >200m. The results of this study provide a better understanding of the interrelationship of various groundwater flows near the coasts and contribute to a more justified and efficient use of them for drinking water supply in large cities, balneological treatment and industrial extraction of iodine waters. They also allow assessment of the risks of dumping saline drainage water into the environment. Copyright © 2017 Elsevier B.V. All rights reserved.

  2. Development of sequential analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-226 and Ra-228 and its application in mineral waters

    International Nuclear Information System (INIS)

    Costa Lauria, D. da.

    1986-01-01

    A sequential analytical method for the determination of U-238, U-234, Th-232, Th-230, Th-228, Ra-226 and Ra-228 in environmental samples and applied to the analysis of mineral waters is studied. Thorium isotopes are coprecipitated with lanthanium fluoride before counting in alpha spectrometer, the uranium isotopes are determined by alpha spectrometry following extraction with TOPO onto a polymenic membrane. Radium-226 is determined with the radom emanation technique. (M.J.C.) [pt

  3. A study of 15N- 15N and 15N- 13C spin couplings in some 15N labeled mesoionic 1-oxa and 1-thia-2,3,4-triazoles

    Science.gov (United States)

    Jaźwiński, J.; Staszewska, O.; Stefaniak, L.; Webb, G. A.

    1996-03-01

    15N- 15N and 15N- 13C spin-spin couplings are reported for seven 15N labeled 1-oxa and 1-thia-2,3,4-triazoles and three sydnonimines. For the former class of compounds the spin-spin coupling data show a close similarity between the N2N3 and N3N4 bonds which had not previously been suspected from chemical shift measurements.

  4. Americium-curium separation by means of selective extraction of hexavalent americium using a centrifugal contactor

    International Nuclear Information System (INIS)

    Musikas, C.; Germain, M.; Bathellier, A.

    1979-01-01

    This paper deals with Am (VI) - Cm (III) separation in nitrate media. The kinetics of oxidation of Am (III) by sodium persulfate in the presence of Ag + ions were reinvestigated by studying the effect of additions of small amounts of reagents which do not drastically change the distribution coefficients of Am (VI) or Cm (III) ions. Organo phosphorus solvents were selected because they are radiation resistant, possess weak reductant properties and that their affinity for hexavalent ion is high. The operating procedure was selected by consideration of the results of the two previous investigations. This can be done by using a centrifugal contactor enabling in to set organic-aqueous phase contact time in accordance with the kinetics of extraction of Am (VI), oxidation of Am (III) in aqueous phase, and reduction of Am (VI) in organic phase

  5. CREATING THE KULTUK POLYGON FOR EARTHQUAKE PREDICTION: VARIATIONS OF (234U/238U AND 87SR/86SR IN GROUNDWATER FROM ACTIVE FAULTS AT THE WESTERN SHORE OF LAKE BAIKAL

    Directory of Open Access Journals (Sweden)

    S. V. Rasskazov

    2015-01-01

    Full Text Available Introduction. Determinations of (234U/238U in groundwater samples are used for monitoring current deformations in active faults (parentheses denote activity ratio units. The cyclic equilibrium of activity ratio 234U/238U≈≈(234U/238U≈γ≈1 corresponds to the atomic ratio ≈5.47×10–5. This parameter may vary due to higher contents of 234U nuclide in groundwater as a result of rock deformation. This effect discovered by P.I. Chalov and V.V. Cherdyntsev was described in [Cherdyntsev, 1969, 1973; Chalov, 1975; Chalov et al., 1990; Faure, 1989]. In 1970s and 1980s, only quite laborious methods were available for measuring uranium isotopic ratios. Today it is possible to determine concentrations and isotopic ration of uranium by express analytical techniques using inductively coupled plasma mass spectrometry (ICP‐MS [Halicz et al., 2000; Shen et al., 2002; Cizdziel et al., 2005; Chebykin et al., 2007]. Sets of samples canbe efficiently analysed by ICP‐MS, and regularly collected uranium isotope values can be systematized at a new quality level for the purposes of earthquake prediction. In this study of (234U/238U in groundwater at the Kultuk polygon, we selected stations of the highest sensitivity, which can ensure proper monitoring of the tectonic activity of the Obruchev and Main Sayan faults. These two faults that limit the Sharyzhalgai block of the crystalline basement of the Siberian craton in the south are conjugated in the territory of the Kultuk polygon (Fig 1. Forty sets of samples taken from 27 June 2012 to 28 January 2014 were analysed, and data on 170 samples are discussed in this paper.Methods. Isotope compositions of uranium and strontium were determined by methods described in [Chebykin et al., 2007; Pin et al., 1992] with modifications. Analyses of uranium by ISP‐MS technique were performed using an Agilent 7500ce quadrapole mass spectrometer of the Ultramicroanalysis Collective Use Centre; analyses of

  6. Fragment mass-, kinetic energy- and angular distributions for 234U(n, f) at incident neutron energies from En = 0.2 to 5.0 MeV

    OpenAIRE

    Al-Adili, Ali; Hambsch, Franz-Josef; Stephan, Pomp; Stephan, Oberstedt; Vidali, M.

    2016-01-01

    This work investigates the neutron-induced fission of 234U and the fission-fragment properties for neutron energies between n = 0.2 MeV and 5.0 MeV with a special highlight on the prominent vibrational resonance at n = 0.77 MeV. Angular-, energy- and mass distributions were determined based on the double-energy (2E) technique by means of a Twin Frisch-Grid Ionization Chamber. The experimental data are parametrized in terms of fission modes based on the Multi-Modal Random Neck-Rupture model...

  7. Energy spectra of protons emitted in the p+Xe→p+... interactions at 2.34 GeV/c and π-+Xe→p+... at 9 GeV/c

    International Nuclear Information System (INIS)

    Slovinskij, B.; Mulas, Eh.

    1981-01-01

    The energy spectra of protons (ESP) emitted in reactions p+Xe→kp+... at 2.34 GeV/c (k=1-9) and π - +Xe→kp+... at 9 GeV/c (k=1-17) have been studied. An evidence has been obtained for a unified description of those spectra by an exponential dependence of the invariant cross sections upon the kinetic energy independently of the proton emission angle. It is found that the ESP temperature becomes independent of the proton emission frequency when the energy of the interaction induced hadron is greater than approximately 3 GeV [ru

  8. Insignificant enhancement of export flux in the highly productive subtropical front, east of New Zealand: a high resolution study of particle export fluxes based on 234Th: 238U disequilibria

    Directory of Open Access Journals (Sweden)

    J. A. Hall

    2012-03-01

    Full Text Available We evaluated the export fluxes of Particulate Organic Carbon (POC in the Subtropical Frontal zone (STF of the SW Pacific sector of the Southern Ocean. The site is characterized by enhanced primary productivity, which has been suggested to be stimulated through so-called natural iron fertilization processes where iron-depleted subantarctic water (SAW mixes with mesotrophic, iron-replete subtropical water (STW. We adopted the small-volume 234Th method to achieve the highest possible spatial sampling resolution in austral late autumn-early winter, May–June, 2008. Inventories of chlorophyll-a, particulate 234Th and POC observed in the upper 100 m were all elevated in the mid-salinity water type (34.5 34.8 salinity waters which were of STW origin with low macronutrients. However, Steady-State 234Th fluxes were similar across the salinity gradient being, 25 ± 0.78 ((1.5 ± 0.047 × 103 in the mid-salinity, and 29 ± 0.53 ((1.8 ± 0.032 × 103 and 22 ± 1.1 Bq m−2 d−1 ((1.3 ± 0.066 × 103 dpm m−2 d–1 in the high and low salinity waters respectively. Bottle POC/Th ratios at the depth of 100 m were used to convert 234Th fluxes into POC export fluxes. The derived POC flux did not appear to be enhanced in mid-salinity waters where the primary productivity was inferred to be the highest at the time of sampling, with a flux of 11 ± 0.45 mmol C m−2 d−1, compared to 14 ± 0.39 mmol C m−2 d−1 in high salinity waters and 8.5 ± 0.66 mmol C m−2 d−1 in low salinity waters. This study thus implied that natural iron fertilization does not necessarily lead to an enhancement of POC export in STF regions.

  9. Determination of the concentration of 238U, 234U, 232Th, 228Th, 228Ra, 226Ra and 210Pb in the feces of workers from a mining company of niobium and their families

    International Nuclear Information System (INIS)

    Oliveira, Roges de; Lopes, Ricardo T.; Melo, Dunstana R.; Juliao, Ligia M.Q.C.

    2005-01-01

    The object of this study consists of an open mine from which Niobium ore (pyrochlore) is extracted and a metallurgy company, where Fe-Nb alloys are produced for export. For geological reasons, the main ore is associated to natural radionuclides U and Th, and its decay products. The concentration of 234 U, 238 U, 232 Th, 226 Ra and 228 Ra, 228 Th, including 210 Pb in fecal excretion of 12:0 am, 29 workers and 13 family members were determined. The technique employed for the determination of the elements was the sequential method of radiochemical separation, followed by alpha spectrometry and counting α and β in proportional detector. Statistically significant difference was observed in the concentration of 234 U and 238 U, in feces samples, among the group of mining workers and family members; as well as for 232 Th in the feces of workers of crushing and metallurgy groups when compared with the Family Group. No statistically significant difference was detected at a concentration of 226 Ra, 228 Ra and 210 Pb, in feces of any group of workers of the installation in relation to the family group

  10. Fragment-mass, kinetic energy, and angular distributions for 234U(n ,f ) at incident neutron energies from En=0.2 MeV to 5.0 MeV

    Science.gov (United States)

    Al-Adili, A.; Hambsch, F.-J.; Pomp, S.; Oberstedt, S.; Vidali, M.

    2016-03-01

    This work investigates the neutron-induced fission of 234U and the fission-fragment properties for neutron energies between En=0.2 and 5.0 MeV with a special highlight on the prominent vibrational resonance at En=0.77 MeV. Angular, energy, and mass distributions were determined based on the double-energy technique by means of a twin Frisch-grid ionization chamber. The experimental data are parametrized in terms of fission modes based on the multimodal random neck-rupture model. The main results are a verified strong angular anisotropy and fluctuations in the energy release as a function of incident-neutron energy.

  11. Tracing of natural radionuclides mobility in deep sedimentary environment using radioactive (234U/238U) disequilibria: application to the Mesozoic formations of the Eastern part of the Paris Basin

    International Nuclear Information System (INIS)

    Deschamps, P.

    2003-11-01

    This thesis forms part of the geological investigations undertaken by the French agency for nuclear waste management, ANDRA, around the Meuse/Haute-Marne Underground Research Laboratory (URL) located in the Eastern part of the Paris Basin in order to evaluate the feasibility of high-level radioactive waste repository in deep argilite formations. The aim of the study is to examine the radionuclide migration in the deep Callovo-Oxfordian target argilite layer and its surrounding low- permeability Bathonian and Oxfordian limestone formations in order to assess the long term confining capacities of the sedimentary series. This study is based on measurement of radioactive disequilibria within U-series by Multiple- Collector Inductively Coupled Plasma Mass Spectrometry (MC-ICP-MS). The high precision and accuracy achieved allowed to demonstrate the 234 U/ 238 U radioactive equilibrium in the Callovo-Oxfordian argilites. This result shows the uranium immobility in the target formation and provides a strong evidence for the current chemical stability and closure of the system for uranium and most probably for the other actinides. This is a fundamental result with respect to the problematic of disposal of high level radioactive waste in deep geological formation since it provides a in situ indication of the confining capacities of the clayey target formation in the current settings. Conversely, ( 234 U/ 238 U) disequilibria are systematically observed within zones, located in the surrounding carbonate formations, that are characterized by pressure dissolution structures (stylolites or dissolution seams). These disequilibria provide evidence for a discrete uranium relocation during the last two million years in the vicinity of stylolitic structures. This is a surprising result since it is generally supposed that these deep, low permeability, compact formations behave as closed system at the time scale of the U-series. (author)

  12. Highly pathogenic avian influenza H5N1 clade 2.3.2.1 and clade 2.3.4 viruses do not induce a clade-specific phenotype in mallard ducks.

    Science.gov (United States)

    Ducatez, Mariette; Sonnberg, Stephanie; Crumpton, Jeri Carol; Rubrum, Adam; Phommachanh, Phouvong; Douangngeun, Bounlom; Peiris, Malik; Guan, Yi; Webster, Robert; Webby, Richard

    2017-06-01

    Among the diverse clades of highly pathogenic avian influenza (HPAI) H5N1 viruses of the goose/Guangdong lineage, only a few have been able to spread across continents: clade 2.2 viruses spread from China to Europe and into Africa in 2005-2006, clade 2.3.2.1 viruses spread from China to Eastern Europe in 2009-2010 and clade 2.3.4.4 viruses of the H5Nx subtype spread from China to Europe and North America in 2014/2015. While the poultry trade and wild-bird migration have been implicated in the spread of HPAI H5N1 viruses, it has been proposed that robust virus-shedding by wild ducks in the absence of overt clinical signs may have contributed to the wider dissemination of the clade 2.2, 2.3.2.1 and 2.3.4.4 viruses. Here we determined the phenotype of two divergent viruses from clade 2.3.2.1, a clade that spread widely, and two divergent viruses from clade 2.3.4, a clade that was constrained to Southeast Asia, in young (ducklings) and adult (juvenile) mallard ducks. We found that the virus-shedding magnitude and duration, transmission pattern and pathogenicity of the viruses in young and adult mallard ducks were largely independent of the virus clade. A clade-specific pattern could only be detected in terms of cumulative virus shedding, which was higher with clade 2.3.2.1 than with clade 2.3.4 viruses in juvenile mallards, but not in ducklings. The ability of clade 2.3.2.1c A/common buzzard/Bulgaria/38 WB/2010-like viruses to spread cross-continentally may, therefore, have been strain-specific or independent of phenotype in wild ducks.

  13. Multi-Institution Prospective Trial of Reduced-Dose Craniospinal Irradiation (23.4 Gy) Followed by Conformal Posterior Fossa (36 Gy) and Primary Site Irradiation (55.8 Gy) and Dose-Intensive Chemotherapy for Average-Risk Medulloblastoma

    International Nuclear Information System (INIS)

    Merchant, Thomas E.; Kun, Larry E.; Krasin, Matthew J.; Wallace, Dana; Chintagumpala, Murali M.; Woo, Shiao Y.; Ashley, David M.; Sexton, Maree; Kellie, Stewart J.; Ahern, Verity M.B.B.S.; Gajjar, Amar

    2008-01-01

    Purpose: Limiting the neurocognitive sequelae of radiotherapy (RT) has been an objective in the treatment of medulloblastoma. Conformal RT to less than the entire posterior fossa (PF) after craniospinal irradiation might reduce neurocognitive sequelae and requires evaluation. Methods and Materials: Between October 1996 and August 2003, 86 patients, 3-21 years of age, with newly diagnosed, average-risk medulloblastoma were treated in a prospective, institutional review board-approved, multi-institution trial of risk-adapted RT and dose-intensive chemotherapy. RT began within 28 days of definitive surgery and consisted of craniospinal irradiation (23.4 Gy), conformal PF RT (36.0 Gy), and primary site RT (55.8 Gy). The planning target volume for the primary site included the postoperative tumor bed surrounded by an anatomically confined margin of 2 cm that was then expanded with a geometric margin of 0.3-0.5 cm. Chemotherapy was initiated 6 weeks after RT and included four cycles of high-dose cyclophosphamide, cisplatin, and vincristine. Results: At a median follow-up of 61.2 months (range, 5.2-115.0 months), the estimated 5-year event-free survival and cumulative incidence of PF failure rate was 83.0% ± 5.3% and 4.9% ± 2.4% (± standard error), respectively. The targeting guidelines used in this study resulted in a mean reduction of 13% in the volume of the PF receiving doses >55 Gy compared with conventionally planned RT. The reductions in the dose to the temporal lobes, cochleae, and hypothalamus were statistically significant. Conclusion: This prospective trial has demonstrated that irradiation of less than the entire PF after 23.4 Gy craniospinal irradiation for average-risk medulloblastoma results in disease control comparable to that after treatment of the entire PF

  14. Measurements of specific activities of uranium (U-234, U-238), of radium (Ra-226, Ra-228) in drinking water samples and indoor radon-222 in some dwellings in Morocco

    International Nuclear Information System (INIS)

    Hakam, O.; Choukri, A.; Moutia, Z.; Reyss, J.

    2001-01-01

    We have determined from the same intake of water, the radioisotopes specific activities of uranium (234-U, 238-U) with alpha spectrometry and radium (226-Ra, 228-Ra) with gamma spectrometry in some drinking water samples from different sources ( tap water, mineral water and wells water ). In air, we have determined the volumic activity of radon-222 in dwellings of some towns with solid state nuclear track detector.The obtained results show that the specific activities vary between 2.4 and 169.2 mBq/l for 234-U; 0.59 and 308.4 mBq/l for 238-U; 0.46 and 1248 mBq/l for 226-Ra and between 0.39 and 66.5 mBq/l for 228-Ra. The measured volumic activities of indoor radon-222 vary from 31 Bq/m sup 3 in Berchid to 136 Bq/ m sup 3 in Youssoufia. The variation of uranium and radium content in natural water depend on temperature, redox state and ph of the medium. The uranium specific activities are relatively high in the well waters and those of radium are relatively high in the thermal spring waters. In dwellings, the highest values of Ra-222 volumic activities have been found at Youssoufia and Khouribga situated on the most important plateau of phosphates in Morocco. The calculation of equivalent doses to the measured activities in drinking water and in indoor air show that these activities are inferior to the Maximum Contaminant Levels and don't present any risk for public health in Morocco. These measurements come within a general study of natural radioactivity repartition in Morocco environment. 4 figs., 3 tabs.,18 refs. (au)

  15. Development and validation of a fast combined analysis method for the determination of the natural radioisotopes Pb-210, Po-210, Ra-226, Ra, 228, U-234 and U-238 in drinking water

    International Nuclear Information System (INIS)

    Schuster, Martina

    2015-01-01

    The guiding value of the effective dose for the consumption of drinking water is 0.1 mSv per calendar year. For the purpose of dose assessment the intake of all relevant radio nuclides via drinking water has to be determined. Some analysis methods for the determination of relevant natural occurring radio nuclides are published but they need complete different and time consuming analysis methods for each radionuclide. This study shows an analysis method which is able to determine the radio nuclides 210 Pb, 210 Po, 226 Ra, 228 Ra, 238 U and 234 U quantitatively within a justifiable time scale. It is based on a chromatography method which has been validated for determination of 90 Sr and 89 Sr in milk, vegetable food and human and animal bones respectively. Applying this method the elution ranges for lead and polonium are so different from uranium and radium that a combined separation with high chemical yield is possible, even by miniaturization the chromatography column which means significant time saving. The activity concentration of 228 Ra and 226 Ra is determined applying gamma-spectrometry and that of 210 Pb, 210 Po, 234 U and 238 U by LSC. The chemical yield of 210 Pb is calculated with a stable lead applying AAS and that of the radium isotopes with 223 Ra. Therefor 223 Ra is separated of a 227 Ac standard solution. The method is validated by a interlaboratory test for the determination of natural radio nuclides in drinking water which was released by the Bundesamt fuer Strahlenschutz. For the analysis only about four litres of drinking water are necessary to realize the required limit of detection. The method is very efficient, enough specific and allows the determination of dose relevant radio nuclides.

  16. Fabrication of targets for transmutation of americium : synthesis of inertial matrix by sol-gel method. Procedure study on the infiltration of a radioactive solutions; Fabricacion de blancos para la transmutacion de americio: sintesis de matrices inertes por el metodo sol-gel. Estudio del procedimiento de infiltracion de disoluciones radiactivas

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez Carretero, A. [Universidad Complutense de Madrid (Spain)

    2002-07-01

    made. In addition a new and unexpected phase formed by the reaction of americium with spinel during the high temperature synthesis process has been identified. This new phase could provide a unique menas to stabilise Am in one particular oxidation state. (Author)

  17. Study of the electrochemical oxidation of Am with lacunary heteropolyanions and silver nitrate; Etude de l'oxydation electrochimique de l'americium en presence d'heteropolyanions lacunaires et de nitrate d'argent en milieu aqueux acide

    Energy Technology Data Exchange (ETDEWEB)

    Chartier, D

    1999-07-01

    Electrochemical oxidation of Am(III) with certain lacunary heteropolyanions (LHPA {alpha}{sub 2}-P{sub 2}W{sub 17}O{sub 61}{sup 10-} or {alpha}SiW{sub 11}O{sub 39}{sup 8-}) and silver nitrate is an efficient way to prepare Am(VI). This document presents bibliographic data and an experimental study of the process. Thus, it has been established that Am(IV) is an intermediate species in the reaction and occurs in 1:1 (Amt{sup IV}LHPA) or 1:2 (Am {sup IV}(LHAP){sub 2}) complexes with the relevant LHPA. These 1:1 complexes of Am(IV) have been identified and isolated in this work whereas 1:2 complexes were known from previous studies. The reactivity of these complexes in oxidation shows that 1:1 complexes of Am(IV) are oxidised much more quickly than 1:2 complexes. Apparent stability constants of Am(III) and Am(IV) complexes with the relevant LHPA have been measured for a 1 M nitric acid medium. Thermodynamic data of the reaction are then assessed: redox potentials of Am pairs are computed for a 1 M nitric acid medium containing various amount of LHPA ligands. Those results show that the role of LHPA is to stabilize the intermediate species Am(IV) by lowering the Am(IV)/Am(III) pair potential of about 1 Volt. Nevertheless, if this stabilisation is too strong (i.e. of tungsto-silicate), the oxidation of Am(IV) requires high anodic potential (more than 2 V/ENH). Then, the faradic yield of the oxidation of americium is poor because of water oxidation. This study has also shown that the main role of silver is to catalyze the electrochemical oxidation of Am{sup IV}(LHPA){sub X} complexes. Indeed, these oxidations without silver are extremely slow. An oxygen tracer experiment has been performed during the oxidation of Am(III) in Am(VI). It has been shown that the oxygen atoms of Am(VI) (AMO{sub 2}{sup 2+}) come from water molecules of the solvent and not from the complexing oxygen atoms of the ligands. (author)

  18. Tracing of natural radionuclides mobility in deep sedimentary environment using radioactive ({sup 234}U/{sup 238}U) disequilibria: application to the Mesozoic formations of the Eastern part of the Paris Basin; Tracage de la mobilite des radionucleides naturels en milieu sedimentaire profond a l'aide des desequilibres radioactifs ({sup 234}U/{sup 238}U): application aux formations mesozoiques de l'est du Bassin de Paris

    Energy Technology Data Exchange (ETDEWEB)

    Deschamps, P

    2003-11-01

    This thesis forms part of the geological investigations undertaken by the French agency for nuclear waste management, ANDRA, around the Meuse/Haute-Marne Underground Research Laboratory (URL) located in the Eastern part of the Paris Basin in order to evaluate the feasibility of high-level radioactive waste repository in deep argilite formations. The aim of the study is to examine the radionuclide migration in the deep Callovo-Oxfordian target argilite layer and its surrounding low- permeability Bathonian and Oxfordian limestone formations in order to assess the long term confining capacities of the sedimentary series. This study is based on measurement of radioactive disequilibria within U-series by Multiple- Collector Inductively Coupled Plasma Mass Spectrometry (MC-ICP-MS). The high precision and accuracy achieved allowed to demonstrate the {sup 234}U/{sup 238}U radioactive equilibrium in the Callovo-Oxfordian argilites. This result shows the uranium immobility in the target formation and provides a strong evidence for the current chemical stability and closure of the system for uranium and most probably for the other actinides. This is a fundamental result with respect to the problematic of disposal of high level radioactive waste in deep geological formation since it provides a in situ indication of the confining capacities of the clayey target formation in the current settings. Conversely, ({sup 234}U/{sup 238}U) disequilibria are systematically observed within zones, located in the surrounding carbonate formations, that are characterized by pressure dissolution structures (stylolites or dissolution seams). These disequilibria provide evidence for a discrete uranium relocation during the last two million years in the vicinity of stylolitic structures. This is a surprising result since it is generally supposed that these deep, low permeability, compact formations behave as closed system at the time scale of the U-series. (author)

  19. Potential Human Health Risk by Metal(loid)s, 234,238U and 210Po due to Consumption of Fish from the “Luis L. Leon” Reservoir (Northern México)

    Science.gov (United States)

    Luna-Porres, Mayra Y.; Rodríguez-Villa, Marco A.; Herrera-Peraza, Eduardo F.; Renteria-Villalobos, Marusia; Montero-Cabrera, María E.

    2014-01-01

    Concentrations of As, Cu, Fe, Hg, Pb and Zn and activity concentrations from 234,238U and 210Po in water, fillet, liver and gills were determined in three stocked fish species from the Luis L. Leon reservoir, located in Northern Mexico. The considered species were Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus. 238U and 234U activity concentration (AC) in fillet samples showed values of 0.007–0.014 and 0.01–0.02 Bq∙kg−1 wet weight (ww), respectively. Liver samples for L. cyanellus, C. carpio and I. furcatus present 210Po AC of 1.16–3.26, 0.70–1.13 and 0.93–1.37 Bq∙kg−1 ww. Arsenic, mercury and lead concentration intervals in fillet samples were 0.13–0.39, 0.005–0.126 and 0.009–0.08 mg∙kg−1 ww, respectively, while in gill samples they were 0.11–0.43, 0.002–0.039 and 0.02–0.26 mg∙kg−1 ww. The elemental Bioaccumulation Factor (BAF) for fish tissues with respect to their concentrations in water was determined. L. cyanellus showed the highest BAF values for As and total U, being BAFAs = 37 and 40 L∙kg−1 in fillet and gills, respectively, and BAFU total = 1.5 L∙kg−1 in fillet. I. furcatus showed the highest BAF values for Hg and Pb, being BAFHg = 40 and 13 L∙kg−1 in fillet and gills, and BAFPb = 6.5 and 22 L∙kg−1 in fillet and gills, respectively. Some metal(loid) concentrations are slightly higher than European regulations for fish fillets. The difference in concentrations of metal(loid)s in fillet among the studied species is probably due to their differences in diet and habitat. PMID:24968208

  20. Potential Human Health Risk by Metal(loids, 234,238U and 210Po due to Consumption of Fish from the “Luis L. Leon” Reservoir (Northern México

    Directory of Open Access Journals (Sweden)

    Mayra Y. Luna-Porres

    2014-06-01

    Full Text Available Concentrations of As, Cu, Fe, Hg, Pb and Zn and activity concentrations from 234,238U and 210Po in water, fillet, liver and gills were determined in three stocked fish species from the Luis L. Leon reservoir, located in Northern Mexico. The considered species were Lepomis cyanellus, Cyprinus carpio and Ictalurus furcatus. 238U and 234U activity concentration (AC in fillet samples showed values of 0.007–0.014 and 0.01–0.02 Bq∙kg−1 wet weight (ww, respectively. Liver samples for L. cyanellus, C. carpio and I. furcatus present 210Po AC of 1.16–3.26, 0.70–1.13 and 0.93–1.37 Bq∙kg−1 ww. Arsenic, mercury and lead concentration intervals in fillet samples were 0.13–0.39, 0.005–0.126 and 0.009–0.08 mg∙kg−1 ww, respectively, while in gill samples they were 0.11–0.43, 0.002–0.039 and 0.02–0.26 mg∙kg−1 ww. The elemental Bioaccumulation Factor (BAF for fish tissues with respect to their concentrations in water was determined. L. cyanellus showed the highest BAF values for As and total U, being BAFAs = 37 and 40 L∙kg−1 in fillet and gills, respectively, and BAFU total = 1.5 L∙kg−1 in fillet. I. furcatus showed the highest BAF values for Hg and Pb, being BAFHg = 40 and 13 L∙kg−1 in fillet and gills, and BAFPb = 6.5 and 22 L∙kg−1 in fillet and gills, respectively. Some metal(loid concentrations are slightly higher than European regulations for fish fillets. The difference in concentrations of metal(loids in fillet among the studied species is probably due to their differences in diet and habitat.

  1. Plutonium and americium behavior in coral atoll environments

    International Nuclear Information System (INIS)

    Noshkin, V.E.; Wong, K.M.; Jokela, T.A.; Brunk, J.L.; Eagle, R.J.

    1984-01-01

    Inventories of 239+240 Pu and 241 Am greatly in excess of global fallout levels persist in the benthic environments of Bikini and Enewetak Atolls. Quantities of 239+240 Pu and lesser amounts of 241 Am are continuously mobilizing from these sedimentary reservoirs. The amount of 239+240 Pu mobilized to solution at any time represents 0.08 to 0.09% of the sediment inventories to a depth of 16 cm. The mobilized 239+240 Pu has solute-like characteristics and different valence states coexist in solution - the largest fraction of the soluble plutonium is in an oxidized form (+V,VI). The adsorption of plutonium to sediments is not completely reversible because of changes that occur in the relative amounts of the mixed oxidation states in solution with time. Further, any characteristics of 239+240 Pu described at one location may not necessarily be relevant in describing its behavior elsewhere following mobilization and migration. The relative amounts of 241 Am to 239+240 Pu in the sedimentary deposits at Enewetak and Bikini may be altered in future years because of mobilization and radiological decay. Mobilization of 239+240 Pu is not a process unique to these atolls, and quantities in solution derived from sedimentary deposits can be found at other global sites. These studies in the equatorial Pacific have significance in assessing the long-term behavior of the transuranics in any marine environment. 22 references, 1 figure, 13 tables

  2. Gastrointestinal absorption of americium in rats: effect of citrate concentration

    International Nuclear Information System (INIS)

    Inaba, J.; Ishigure, N.; Oghiso, Y.; Sato, H.

    1994-01-01

    The gastrointestinal absorption of 241 Am was studied in relation to the amount of sodium citrate administered with it. Fasted Wistar strain female rats received 241 Am orally in sodium citrate solution of various concentrations and 5 days after administration animals were sacrificed and the retention and distribution of 241 Am was studied. The results indicated that the f 1 value was very high at about 10% of administered activity when 241 Am was given to fasted rats with a large amount of sodium citrate. (author)

  3. Further Studies of Plutonium and Americium at Thule, Greenland

    DEFF Research Database (Denmark)

    Aarkrog, Asker; Dahlgaard, Henning; Nilsson, Karen Kristina

    1984-01-01

    further away from the impact point and at some locations the vertical distribution indicated a downward displacement of Pu in the sediment column since 1974. Seawater and seaplants showed no evidence of the presence of Pu from sources other than fallout; but Pu in benthos varied nearly proportionally...

  4. Uptake of plutonium and americium by plants from soils

    International Nuclear Information System (INIS)

    Schulz, R.K.; Tompkins, G.A.; Babcock, K.L.

    1975-01-01

    Plant uptake of 239 , 240 Pu and 241 Am was studied on two soil samples collected on the Nevada Test Site. These soils had each been previously contaminated with the radionuclides by high explosive detonation of devices containing plutonium. The 239 PuO 2 equivalent diameters of plutonium bearing particles present in the soil samples were determined and found to be log-normal in the range of 0.2 to 0.7 μm. Particles were examined by electronmicroscopy and found to be 2 to 3 times larger than the 239 PuO 2 equivalent diameter. Electron microprobe analysis showed that these particles consisted primarily of Pu, U, and O, with Al, Si, Fe and Mg present in much smaller amounts. The plutonium distribution ratio (D. R. = nuclide concentration in plant/nuclide concentration in soil) was in the order of 10 -5 for barley plant vegetation and was 20 to 100 times lower for barley grain. The D. R. for 241 Am was in the order of 10 -4 for vegetative growth and 25-75 times lower for the grain. In other uptake experiments three different soils were utilized: slightly acid forest soil, neutral valley soil, and calcareous alkaline soil. The 239 240 Pu and 241 Am were added to the soil as nitrate or chloride solution to facilitate the addition of Pu to soil in different oxidation states. Where Pu in the higher oxidation states (nitrate) was added to the alkaline calcareous soil, the highest plant uptake was observed. In uptake experiments with wheat the plutonium distribution ratio of the grain ranged from about 4 x 10 -8 to 4 x 10 -6 . The 241 Am D. R.'s ranged from 3 x 10 -7 to 3 x 10 -5 . (U.S.)

  5. Biosorption of americium-241 by immobilized Rhizopus arrihizus

    International Nuclear Information System (INIS)

    Liao Jiali; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji

    2004-01-01

    Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove 241 Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting 241 Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb 241 Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of 241 Am was removed from 241 Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of 241 Am. At this time, the total adsorption of 241 Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed 241 Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO 3

  6. Further Studies of Plutonium and Americium at Thule, Greenland

    DEFF Research Database (Denmark)

    Aarkrog, Asker; Dahlgaard, Henning; Nilsson, Karen Kristina

    1984-01-01

    Eleven years after the accidental loss of nuclear weapons in 1968, the fourth scientific expedition to Thule occurred. The estimated inventory of 1 TBq 239,240Pu in the marine sediments was unchanged when compared with the estimate based on the 1974 data. Plutonium from the accident had moved...

  7. Europium (III) and americium (III) stability constants with humic acid

    International Nuclear Information System (INIS)

    Torres, R.A.; Choppin, G.R.

    1984-01-01

    The stability constants for tracer concentrations of Eu(III) and Am(III) complexes with a humic acid extracted from a lake-bottom sediment were measured using a solvent extraction system. The organic extractant was di(2-ethylhexyl)-phosphoric acid in toluene while the humate aqueous phase had a constant ionic strength of 0.1 M (NaClO 4 ). Aqueous humic acid concentrations were monitored by measuring uv-visible absorbances at approx.= 380 nm. The total carboxylate capacity of the humic acid was determined by direct potentiometric titration to be 3.86 +- 0.03 meq/g. The humic acid displayed typical characteristics of a polyelectrolyte - the apparent pKsub(a), as well as the calculated metal ion stability constants increased as the degree of ionization (α) increased. The binding data required a fit of two stability constants, β 1 and β 2 , such that for Eu, log β 1 = 8.86 α + 4.39, log β 2 = 3.55 α + 11.06 while for Am, log β 1 = 10.58 α + 3.84, log β 2 = 5.32 α + 10.42. With hydroxide, carbonate, and humate as competing ligands, the humate complex associated with the β 1 constant is calculated to be the dominant species for the trivalent actinides and lanthanides under conditions present in natural waters. (orig.)

  8. Ecological behavior of plutonium and americium in a freshwater pond

    International Nuclear Information System (INIS)

    Emery, R.M.; Klopfer, D.C.; Garland, T.R.; Weimer, W.C.

    1975-03-01

    A Pu processing waste pond on the Hanford Reservation has been studied since mid-1973 to characterize the pond's limnology and determine the ecological behavior in this ecosystem. About 8.1 kg of Pu was reported to have been discharged into waste trenches leading to the pond. Mean ratios of isotopes in the sediments are 0.85 for 238 Pu to 239 240 Pu, 0.61 for 241 Am to 238 Pu, and 0.49 for 241 Am to 239 240 Pu. Levels of Pu and Am in the interstitial water range from 0.5 to 13 pCi/g (dry wt. of sediment). For 238 Pu in pond water the mean concentration is 0.007 pCi/l, for 239 240 Pu it is 0.002 pCi/l, and for 241 Am it is 1.08 pCi/l. The remaining biota had Pu and Am levels which were generally well below those of the sediments. (U.S.)

  9. A bioassay method for americium and curium in feces

    International Nuclear Information System (INIS)

    Alexandre Gagne; Dominic Lariviere; Joel Surette; Sheila Kramer-Tremblay; Xiongxin Dai; Candice Didychuk

    2013-01-01

    Fecal radiobioassay is an essential and sensitive tool to estimate the internal intake of actinides after a radiological incident. A new fecal analysis method, based on lithium metaborate fusion of fecal ash for complete sample dissolution followed by sequential column chromatography separation of actinides, has been developed for the determination of low-level Am and Cm in a large size sample. Spiked synthetic fecal samples were analyzed to evaluate method performance against the acceptance criteria for radiobioassay as defined by ANSI N13.30; both satisfactory accuracy and repeatability were achieved. This method is a promising candidate for reliable dose assessment of low level actinide exposure to meet the regulatory requirements of routine radiobioassay for nuclear workers and the public. (author)

  10. Biosorption of americium-241 by immobilized Rhizopus arrihizus

    Energy Technology Data Exchange (ETDEWEB)

    Liao Jiali E-mail: liaojiali@163.com; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji

    2004-01-01

    Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove {sup 241}Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting {sup 241}Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb {sup 241}Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of {sup 241}Am was removed from {sup 241}Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of {sup 241}Am. At this time, the total adsorption of {sup 241}Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed {sup 241}Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO{sub 3}.

  11. Measurement of the 234U(n, f ) cross-section with quasi-monoenergetic beams in the keV and MeV range using a Micromegas detector assembly

    Science.gov (United States)

    Stamatopoulos, A.; Kanellakopoulos, A.; Kalamara, A.; Diakaki, M.; Tsinganis, A.; Kokkoris, M.; Michalopoulou, V.; Axiotis, M.; Lagoyiannis, A.; Vlastou, R.

    2018-01-01

    The 234U neutron-induced fission cross-section has been measured at incident neutron energies of 452, 550, 651 keV and 7.5, 8.7, 10 MeV using the 7Li ( p, n) and the 2H( d, n) reactions, respectively, relative to the 235U( n, f ) and 238U( n, f ) reference reactions. The measurement was performed at the neutron beam facility of the National Center for Scientific Research "Demokritos", using a set-up based on Micromegas detectors. The active mass of the actinide samples and the corresponding impurities were determined via α-spectroscopy using a surface barrier silicon detector. The neutron spectra intercepted by the actinide samples have been thoroughly studied by coupling the NeuSDesc and MCNP5 codes, taking into account the energy and angular straggling of the primary ion beams in the neutron source targets in addition to contributions from competing reactions ( e.g. deuteron break-up) and neutron scattering in the surrounding materials. Auxiliary Monte Carlo simulations were performed making combined use of the FLUKA and GEF codes, focusing particularly on the determination of the fission fragment detection efficiency. The developed methodology and the final results are presented.

  12. Association between ε2/3/4, promoter polymorphism (-491A/T, -427T/C, and -219T/G) at the apolipoprotein E gene, and mental retardation in children from an iodine deficiency area, China.

    Science.gov (United States)

    Li, Jun; Zhang, Fuchang; Wang, Yunliang; Wang, Yan; Qin, Wei; Xing, Qinghe; Qian, Xueqing; Guo, Tingwei; Gao, Xiaocai; He, Lin; Gao, Jianjun

    2014-01-01

    Several common single-nucleotide polymorphisms (SNPs) at apolipoprotein E (ApoE) have been linked with late onset sporadic Alzheimer's disease and declining normative cognitive ability in elder people, but we are unclear about their relationship with cognition in children. We studied -491A/T, -427T/C, and -219G/T promoter polymorphisms and ε2/ε3/ε4 at ApoE among children with mental retardation (MR, n = 130), borderline MR (n = 124), and controls (n = 334) from an iodine deficiency area in China. The allelic and genotypic distribution of individual locus did not significantly differ among three groups with Mantel-Haenszel χ (2) test (P > 0.05). However, frequencies of haplotype of -491A/-427T/-219T/ε4 were distributed as MR > borderline MR > controls (P uncorrected = 0.004), indicating that the presence of this haplotype may increase the risk of disease. In this large population-based study in children, we did not find any significant association between single locus of the four common ApoE polymorphisms (-491A/T, -427T/C, -219T/G, and ε2/3/4) and MR or borderline MR. However, we found that the presence of ATTε4 haplotype was associated with an increased risk of MR and borderline MR. Our present work may help enlarge our knowledge of the cognitive role of ApoE across the lifespan and the mechanisms of human cognition.

  13. Luminescence properties of a single-component Na0.34Ca0.66Al1.66Si2.34O8:Ce3+, Sm3+ phosphor with tunable color tone for UV-pumped LEDs

    Science.gov (United States)

    Wang, Lei; Dong, Jie; Cui, Cai'e.; Tian, Yue; Huang, Ping

    2015-08-01

    A series of single-phase Na0.34Ca0.66Al1.66Si2.34O8:Ce3+, Sm3+ (NCASO) phosphors have been synthesized via a high temperature solid-state reaction method. The samples were studied based on photoluminescence (PL), photoluminescence excitation (PLE) spectra and fluorescence decay patterns. The obtained PLE exhibited a strong excitation band in the UV region between 250 and 380 nm. Under 340 nm excitation, NCASO:Ce3+, Sm3+ phosphor showed a broad emission band at 414 nm of Ce3+ and four emission bands from 550 nm to 725 nm of Sm3+. Spectra demonstrate nonradiative energy transfers (ET) occur from Ce3+-Sm3+. The analysis based on Inokuti-Hirayama model indicates that the ET is governed by electric dipole-dipole interaction. Moreover, the emitting colors can be adjusting from blue to white by proper tuning of the relative composition of Ce3+/Sm3+. These results show that NCASO:Ce3+, Sm3+ phosphors can be used as a potential single-phased white-emitting candidate for UV WLEDs.

  14. Solvothermal synthesis, crystal structure, and second-order nonlinear optical properties of a new noncentrosymmetric gallium-organic framework material, [N(C3H7)4]3Ga3[C6H3(CO2)3]4

    Science.gov (United States)

    Lee, Dong Woo; Jo, Vinna; Ok, Kang Min

    2012-10-01

    A novel noncentrosymmetric (NCS) gallium-organic framework material, [N(C3H7)4]3Ga3[C6H3(CO2)3]4 (CAUMOF-11) has been synthesized by a solvothermal reaction using Ga(NO3)3·xH2O, 1,3,5-C6H3(CO2H)3, N(C3H7)4Cl, HNO3, and HCON(CH3)2 at 180 °C. The structure of the reported material has been determined by single-crystal X-ray diffraction. CAUMOF-11 has an anionic three-dimensional framework with aligned four-coordinate GaO4 tetrahedra and 1,3,5-benzenetricarboxylate groups. Tetrapropylammonim cations reside within the channel and maintain the charge balance. Detailed structural analyses with full characterization including infrared spectroscopy, thermogravimetric analysis, elemental analysis, ion-exchange reactions, topotactic decomposition, and gas adsorption experiments are reported. Powder second-harmonic generating (SHG) measurements on CAUMOF-11, using 1064 nm radiation, exhibit SHG efficiency of 15 times that of α-SiO2 and the material is phase-matchable (type-1).

  15. High-Resolution Measurements of Neutron Energy Spectra from Americium-Beryllium and Americium-Boron Neutron Sources

    Science.gov (United States)

    Marsh, James W.

    Available from UMI in association with The British Library. A Helium-3 sandwich spectrometer incorporating two semiconductor detectors was designed and constructed to enable the measurement of high resolution neutron energy spectra in the energy range from 100 keV to 15 MeV. The instrument is novel in respect of the inclusion of an anode wire which enables the gas chamber to function as a gas proportional counter. Few similar instruments have been constructed and no similar instrument is known to be currently (1990) in use in the UK. The efficiency of the spectrometer was determined experimentally, using a Californium-252 spontaneous fission source, in the low-scatter facility of the National physical Laboratory. A Monte Carlo code has been written to determine the absolute efficiency over an energy range from 81 keV to 20 MeV. The calculated values were used to extrapolate the measured efficiency to higher energies. Furthermore the Monte Carlo code was used to determine certain operating parameters to optimise the efficiency of the spectrometer. The neutron energy spectra from two different size standard Am-Be neutron sources and a standard Am-B neutron source available at NPL were measured. Although these types of neutron sources have been subject to energy spectra measurements elsewhere, the present work improves considerably on the previous poorer energy resolution and energy range. The new data indicates for the three neutron sources studied that the ambient dose equivalent, H*(10) per unit fluence, for each, were identical, being within 2% of 3.70 E-10 Sv cm^2.

  16. BDML Metadata: 234 [SSBD[Archive

    Lifescience Database Archive (English)

    Full Text Available 9a-06cf-4f99-a337-01b1f9166310 0.105 x 0.105 x 0.5 (micrometer), 40 (second) http://ssbd.qbic.riken.jp/data/...source/Ce_KK_P002/RNAi_T26G10.1_070920_01/ http://ssbd.qbic.riken.jp/data/bdml/Ce..._KK_P002/RNAi_T26G10.1_070920_01.bdml0.15.xml http://ssbd.qbic.riken.jp/data/pdpml/Ce_KK_P002.pdpml0.05.xml ...http://ssbd.qbic.riken.jp/search/24115f9a-06cf-4f99-a337-01b1f9166310/ http://ssbd.qbic.riken.jp/omero/webclient/?show=dataset-167 ...

  17. Publications | Page 234 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    IDRC works with developing-country researchers and institutions to build local capacity through funding, knowledge sharing, and training. Through books ... In the MENA region, gender and work is an important topic that has attracted a great deal of attention in both research and policy circles in recent years. However ...

  18. Publications | Page 234 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    COMANAGEMENT OF NATURAL RESOURCES: Executive Summary. THE ISSUE. Estimates of the number of poor people living in marginal, environmentally fragile areas of the developing world range from 600 to 900 million. Their survival depends heavily on access to the natural... GROWING BETTER CITIES: Executive ...

  19. 49 CFR Appendix B to Part 234 - Alternate Methods of Protection Under 49 CFR 234.105(c), 234.106, and 234.107(c)

    Science.gov (United States)

    2010-10-01

    ... pair of lights designed to flash alternatively, one light does not work (and back-lights from other... that portion had held a gate arm flashing light. **Activitation failure includes—if more than 50% of the flashing lights on any approach lane not functioning; or if an approach lane has two or more pairs...

  20. 49 CFR 234.3 - Application.

    Science.gov (United States)

    2010-10-01

    ... if one or more of the following exists on its line: (1) A public highway-rail crossing that is in use; (2) An at-grade rail crossing that is in use; (3) A bridge over a public road or waters used for commercial navigation; or (4) A common corridor with a railroad, i.e., its operations are within 30 feet of...

  1. 36 CFR 2.34 - Disorderly conduct.

    Science.gov (United States)

    2010-07-01

    ... conduct when, with intent to cause public alarm, nuisance, jeopardy or violence, or knowingly or... likely to inflict injury or incite an immediate breach of the peace. (3) Makes noise that is unreasonable...

  2. 32 CFR 234.7 - Disorderly conduct.

    Science.gov (United States)

    2010-07-01

    ..., with intent to cause public alarm, nuisance, jeopardy, or violence, or knowingly or recklessly creating... injury or incite an immediate breach of the peace. (c) Makes noise that is unreasonable, considering the...

  3. 49 CFR 234.263 - Relays.

    Science.gov (United States)

    2010-10-01

    .... (b)(1) Alternating current vane type relays, direct current polar type relays, and relays with soft iron magnetic structure shall be tested at least once every two years. (2) Alternating current...

  4. 14 CFR 234.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... published schedule for a flight from A to B to C. If the carrier were to actually fly an A to C operation... from any airport within the contiguous 48 states that accounts for at least 1 percent of domestic... under 49 U.S.C. 41102 that accounted for at least 1 percent of domestic scheduled-passenger revenues in...

  5. Energy Magazine. V. 23(4)

    International Nuclear Information System (INIS)

    1999-01-01

    The present issue contains a summary on energetic interconnections and regional integration schemes in Latin America and the Caribbean. A section is dedicated to Guyana and the impulse that it carries out in its energy sector considered as one of the fundamental pillars of its economic development. It also includes an article on the programs of energetic efficiency that OLADE executes. Besides it includes an article on the regulation of the environmental area linked to reform process of the energetic sector

  6. Gender | Page 234 | IDRC - International Development Research ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Language French. IDRC has supported poor women in developing countries in their efforts to learn, to earn, and to take part in local decision-making. University degrees and decent jobs make it easier for women to speak up and demand their rights as full citizens. Download the Lasting Impacts Brief of this issue. (PDF ...

  7. Publications | Page 234 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    (restricted access). The assumption that manufacturing value-added share of gross domestic product (GDP) propels economic growth is often used as a justification for protectionist measures such as tariffs and subsidies, which cause costly economic distortions. However, the protectionist assumption that manufacturing.

  8. 49 CFR 234.5 - Definitions.

    Science.gov (United States)

    2010-10-01

    ... yellow green or fluorescent versions of these colors or other generally accepted high visibility colors... Administration's Manual on Uniform Traffic Control Devices addresses standards and guides for flaggers and flagging equipment for highway traffic control, FRA recommends that railroads be aware of the standards and...

  9. 32 CFR 234.1 - Definitions.

    Science.gov (United States)

    2010-07-01

    ... operates, drives, controls, otherwise has charge of, or is in actual physical control of a mechanical mode.... Possession. Exercising direct physical control or dominion, with or without ownership, over property. State..., by compressed gas, or by spring power; any bow and arrow, crossbow, blowgun, spear gun, hand-thrown...

  10. TMFunction data: 234 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  11. Neutron-induced fission cross-section measurement of 234U with quasi-monoenergetic beams in the keV and MeV range using micromegas detectors

    Science.gov (United States)

    Tsinganis, A.; Kokkoris, M.; Vlastou, R.; Kalamara, A.; Stamatopoulos, A.; Kanellakopoulos, A.; Lagoyannis, A.; Axiotis, M.

    2017-09-01

    Accurate data on neutron-induced fission cross-sections of actinides are essential for the design of advanced nuclear reactors based either on fast neutron spectra or alternative fuel cycles, as well as for the reduction of safety margins of existing and future conventional facilities. The fission cross-section of 234U was measured at incident neutron energies of 560 and 660 keV and 7.5 MeV with a setup based on `microbulk' Micromegas detectors and the same samples previously used for the measurement performed at the CERN n_TOF facility (Karadimos et al., 2014). The 235U fission cross-section was used as reference. The (quasi-)monoenergetic neutron beams were produced via the 7Li(p,n) and the 2H(d,n) reactions at the neutron beam facility of the Institute of Nuclear and Particle Physics at the `Demokritos' National Centre for Scientific Research. A detailed study of the neutron spectra produced in the targets and intercepted by the samples was performed coupling the NeuSDesc and MCNPX codes, taking into account the energy spread, energy loss and angular straggling of the beam ions in the target assemblies, as well as contributions from competing reactions and neutron scattering in the experimental setup. Auxiliary Monte-Carlo simulations were performed with the FLUKA code to study the behaviour of the detectors, focusing particularly on the reproduction of the pulse height spectra of α-particles and fission fragments (using distributions produced with the GEF code) for the evaluation of the detector efficiency. An overview of the developed methodology and preliminary results are presented.

  12. Neutron-induced fission cross-section measurement of 234U with quasi-monoenergetic beams in the keV and MeV range using micromegas detectors

    Directory of Open Access Journals (Sweden)

    Tsinganis A.

    2017-01-01

    Full Text Available Accurate data on neutron-induced fission cross-sections of actinides are essential for the design of advanced nuclear reactors based either on fast neutron spectra or alternative fuel cycles, as well as for the reduction of safety margins of existing and future conventional facilities. The fission cross-section of 234U was measured at incident neutron energies of 560 and 660 keV and 7.5 MeV with a setup based on ‘microbulk’ Micromegas detectors and the same samples previously used for the measurement performed at the CERN n_TOF facility (Karadimos et al., 2014. The 235U fission cross-section was used as reference. The (quasi-monoenergetic neutron beams were produced via the 7Li(p,n and the 2H(d,n reactions at the neutron beam facility of the Institute of Nuclear and Particle Physics at the ‘Demokritos’ National Centre for Scientific Research. A detailed study of the neutron spectra produced in the targets and intercepted by the samples was performed coupling the NeuSDesc and MCNPX codes, taking into account the energy spread, energy loss and angular straggling of the beam ions in the target assemblies, as well as contributions from competing reactions and neutron scattering in the experimental setup. Auxiliary Monte-Carlo simulations were performed with the FLUKA code to study the behaviour of the detectors, focusing particularly on the reproduction of the pulse height spectra of α-particles and fission fragments (using distributions produced with the GEF code for the evaluation of the detector efficiency. An overview of the developed methodology and preliminary results are presented.

  13. Overexpression of the catalytically impaired Taspase1 T234V or Taspase1 D233A variants does not have a dominant negative effect in T(4;11 leukemia cells.

    Directory of Open Access Journals (Sweden)

    Carolin Bier

    Full Text Available BACKGROUND: The chromosomal translocation t(4;11(q21;q23 is associated with high-risk acute lymphoblastic leukemia of infants. The resulting AF4•MLL oncoprotein becomes activated by Taspase1 hydrolysis and is considered to promote oncogenic transcriptional activation. Hence, Taspase1's proteolytic activity is a critical step in AF4•MLL pathophysiology. The Taspase1 proenzyme is autoproteolytically processed in its subunits and is assumed to assemble into an αββα-heterodimer, the active protease. Therefore, we investigated here whether overexpression of catalytically inactive Taspase1 variants are able to interfere with the proteolytic activity of the wild type enzyme in AF4•MLL model systems. METHODOLOGY/FINDINGS: The consequences of overexpressing the catalytically dead Taspase1 mutant, Taspase1(T234V, or the highly attenuated variant, Taspase1(D233A, on Taspase1's processing of AF4•MLL and of other Taspase1 targets was analyzed in living cancer cells employing an optimized cell-based assay. Notably, even a nine-fold overexpression of the respective Taspase1 mutants neither inhibited Taspase1's cis- nor trans-cleavage activity in vivo. Likewise, enforced expression of the α- or β-subunits showed no trans-dominant effect against the ectopically or endogenously expressed enzyme. Notably, co-expression of the individual α- and β-subunits did not result in their assembly into an enzymatically active protease complex. Probing Taspase1 multimerization in living cells by a translocation-based protein interaction assay as well as by biochemical methods indicated that the inactive Taspase1 failed to assemble into stable heterocomplexes with the wild type enzyme. CONCLUSIONS: Collectively, our results demonstrate that inefficient heterodimerization appears to be the mechanism by which inactive Taspase1 variants fail to inhibit wild type Taspase1's activity in trans. Our work favours strategies targeting Taspase1's catalytic activity

  14. Synthesis of ceramic powders of La{sub 9,56} (SiO{sub 4}){sub 6}O{sub 2,34} and La{sub 9,8}Si{sub 5,7}Mg{sub O,3}O{sub 26,}4 by modified sol-gel process; Sintese de pos ceramicos de La{sub 9,56} (SiO{sub 4}){sub 6}O{sub 2,34} e La{sub 9,8}Si{sub 5,7}Mg{sub O,3}O{sub 26,}4 por processo sol-gel modificado

    Energy Technology Data Exchange (ETDEWEB)

    Lira, Sabrina Lopes; Paiva, Mayara Rafaela Soares; Misso, Agatha Matos; Elias, Daniel Ricco; Yamagata, Chieko, E-mail: yamagata@ipen.br [Instituto de Pesquisas Energeticas e Nucleares (CCTM/IPEN/CNEN-SP), Sao Paulo, SP (Brazil). Centro de Ciencia e Tecnologia de Materiais

    2012-07-01

    Lanthanum silicate oxyapatite materials are promising for application as electrolyte in solid oxide fuel cells because of high ionic conductivity at temperatures between 600 deg C and 800 deg C. In this work, oxyapatites with the composition La{sub 9,56}(SiO{sub 4}){sub 6}O{sub 2,34}, and La{sub 9,8}Si{sub 5,7}Mg{sub 0,3}O{sub 26,4} were synthesized by using the sol-gel method, followed by precipitation. Initially, the gel of silica was synthesized from sodium silicate solution, by acid catalysis using lanthanum and magnesium chloride solution. Then, the La and Mg hydroxides were precipitated with NaOH in the gel. The powders were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and measurements of specific surface area. The crystalline oxyapatite phase of La{sub 9,56}(SiO{sub 4}){sub 6}O{sub 2,34}, and was La{sub 9,8}Si{sub 5,7}Mg{sub 0,3}O{sub 26,4} obtained by calcination at 900 deg C for 2 and 1h respectively (author)

  15. Quantification of {sup 232}Th, {sup 234}U, {sup 235}U and {sup 238}U in river mollusks by magnetic sector mass spectrometry with inductively coupled plasma source (Icp-SFMS); Cuantificacion de {sup 232}Th, {sup 234}U, {sup 235}U y {sup 238}U en moluscos de rios por espectrometria de masas de sector magnetico con fuente de plasma acoplado inductivamente (ICP-SFMS)

    Energy Technology Data Exchange (ETDEWEB)

    Arevalo R, D. L.; Hernandez M, H.; Romero G, E. T.; Lara A, N. [ININ, Carretera Mexico-Toluca s/n, 52750 Ocoyoacac, Estado de Mexico (Mexico); Alfaro de la T, M. C., E-mail: arevalo0591@hotmail.com [Universidad Autonoma de San Luis Potosi, Dr. Salvador Nava s/n, Zona Universitaria, 78290 San Luis Potosi, SLP (Mexico)

    2016-09-15

    The present work deals with the methodology established for the quantification of {sup 232}Th, {sup 234}U, {sup 238}U and {sup 235}U in the shell of gastropod mollusks collected in the rivers Valles, Coy and Axtla of San Luis Potosi, Mexico, which belong to the Panuco River basin; these rivers have as main source of pollution the discharge of municipal sewage, waste from small industries, agricultural and cattle residues and from natural sources. Conventional methods for measuring radio-nuclides are confronted with certain conditions related to the requirement in measurement, basically in the characterization that is related to the concepts of precision and accuracy. The analysis of the gastropod mollusk shell was performed by the Icp-SFMS technique; the main advantages of this technique lie in the isotope quantification capacity, the high precision and the low limits of detection, in this study are very important because these elements are in concentrations between ppb and ppt. This technique allowed the analysis of the samples having a complex matrix by the presence CaCO{sub 3} minimizing the interferences thanks to the ionization efficiency of the Ar plasma. For the species Pachychilus monachus were found concentrations of {sup 232}Th of 0.16-5.37 μg/g and of total U of 0.101-4.081 μg/g being this species where the highest values of total U were found. For Thiara (melanoids) tuberculata the lowest values were found among the different species ({sup 232}Th 0.61-3.61 μg/g and total U 0.006-0.042 μg/g), for Pachychilus suturalis, values of {sup 232}Th of 0.58-6.4 μg/g and for Pachychilus sp. were found between 0.26-7.62 μg/g and for total U values between 0.28-3.33 μg/g. The method offers several advantages: speed, good precision, low values of quantification limits and high sensitivity in the measurement of radio-nuclides and heavy metals. (Author)

  16. The particulate {sup 7}Be/{sup 210}Pb{sub xs} and {sup 234}Th/{sup 210}Pb{sub xs} activity ratios as tracers for tidal-to-seasonal particle dynamics in the Gironde estuary (France): Implications for the budget of particle-associated contaminants

    Energy Technology Data Exchange (ETDEWEB)

    Saari, Hanna-Kaisa [Universite de Bordeaux, UMR5805 EPOC, F-33405 Talence Cedex (France); Schmidt, Sabine, E-mail: s.schmidt@epoc.u-bordeaux1.fr [CNRS, UMR5805 EPOC, F-33405 Talence Cedex (France); Castaing, Patrice; Blanc, Gerard [Universite de Bordeaux, UMR5805 EPOC, F-33405 Talence Cedex (France); Sautour, Benoit [Universite de Bordeaux, UMR5805 EPOC, Station Marine d' Arcachon, F-33120 Arcachon (France); Masson, Olivier [IRSN, BP 3, 13115 Saint Paul Lez Durance (France); Cochran, J. Kirk [Marine Sciences Research Center, School of Marine and Atmospheric Sciences, Stony Brook University, Stony Brook, New York 11794-5000 (United States)

    2010-09-15

    The short-lived natural radionuclides {sup 7}Be (T{sub 1/2} = 53 days), {sup 234}Th{sub xs} (T{sub 1/2} = 24.1 days) and {sup 210}Pb{sub xs} (T{sub 1/2} = 22.3 years), i.e. {sup 234}Th and {sup 210}Pb in excesses of that supported within particles by the decay of their parent isotopes, were analysed in suspended particulate matter (SPM) to study the particle dynamics in the Gironde fluvial estuarine system (France), strongly impacted by heavy metal pollution. From surveys of this land-ocean interface in 2006 and 2007, we established a times series of these radioisotopes and of their activity ratios ({sup 7}Be/{sup 210}Pb{sub xs} and {sup 234}Th/{sup 210}Pb{sub xs} ARs) in particles sampled under different hydrological conditions. The particulate {sup 7}Be/{sup 210}Pb{sub xs} AR varies along the fluvial estuarine system mainly due to variations in {sup 7}Be activities, controlled by riverine, oceanic and atmospheric inputs and by resuspension of old {sup 7}Be-deficient sediments. These processes vary with river discharge, tidal cycle and season. Therefore, seasonal particle transport processes can be described using variations of the SPM {sup 7}Be/{sup 210}Pb{sub xs} ARs. During high river discharge, the SPM {sup 7}Be/{sup 210}Pb{sub x} ARs decrease from river to the ocean. The turbidity maximum zone (TMZ) is dispersed and the particles, and the associated contaminants, are rapidly transported from river to coastal waters, without significant retention within the TMZ. During low river discharge, the TMZ intrudes into the fluvial estuary, and the lowest {sup 7}Be/{sup 210}Pb{sub x} ARs are observed there due to resuspension of {sup 7}Be-deficient sediments. Away from the TMZ, from the middle to lower estuary, SPM {sup 7}Be/{sup 210}Pb{sub x} ARs increase, indicating that the particles have been recently tagged with {sup 7}Be. We explain this trend as being caused by marine input of dissolved radionuclides, as traced by SPM {sup 234}Th/{sup 210}Pb{sub xs} ARs

  17. Two-electron capture into autoionising configurations N/sup 4 +/(1snln'l') with n = 2,3,4 and n' >= n, observed by electron spectrometry in collisions of N/sup 6 +/(1s) with He and H/sub 2/, at 4. 2 keV amu/sup -1/

    Energy Technology Data Exchange (ETDEWEB)

    Bordenave-Montesquieu, A.; Benoit-Cattin, P.; Gleizes, A.; Marrakchi, A.I.; Dousson, S.; Hitz, D.

    1984-04-14

    Double electron transfer into autoionising states N/sup 4 +/(1snln'l'), with n = 2,3,4 and n' >= n has been observed in a collision between a one-electron highly charged N/sup 6 +/(1s) ion and a two-electron target (He or H/sub 2/), by electron spectrometry. The same configurations are excited in the two collisional systems but with very different probabilities. Electron capture mainly occurs into 1s2ln'l' in He-systems whereas transfer into 1s3ln'l' is stronger in H/sub 2/ systems.

  18. Synthesis of ceramic powders of La9,56 (SiO4)6O2,34 and La9,8Si5,7MgO,3O26,4 by modified sol-gel process

    International Nuclear Information System (INIS)

    Lira, Sabrina Lopes; Paiva, Mayara Rafaela Soares; Misso, Agatha Matos; Elias, Daniel Ricco; Yamagata, Chieko

    2012-01-01

    Lanthanum silicate oxyapatite materials are promising for application as electrolyte in solid oxide fuel cells because of high ionic conductivity at temperatures between 600 deg C and 800 deg C. In this work, oxyapatites with the composition La 9,56 (SiO 4 ) 6 O 2,34 , and La 9,8 Si 5,7 Mg 0,3 O 26,4 were synthesized by using the sol-gel method, followed by precipitation. Initially, the gel of silica was synthesized from sodium silicate solution, by acid catalysis using lanthanum and magnesium chloride solution. Then, the La and Mg hydroxides were precipitated with NaOH in the gel. The powders were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and measurements of specific surface area. The crystalline oxyapatite phase of La 9,56 (SiO 4 ) 6 O 2,34 , and was La 9,8 Si 5,7 Mg 0,3 O 26,4 obtained by calcination at 900 deg C for 2 and 1h respectively (author)

  19. Investigation of the retention and distribution of americium-241 in the baboon and the enhanced removal of americium-241 from the body by diethylenetriaminepentaacetic acid (DTPA)

    International Nuclear Information System (INIS)

    Guilmette, R.A.; Cohen, N.; Wrenn, M.E.

    1975-01-01

    Experiments were performed to study the metabolism and distribution of intravenously administered 241 Am in the adult and juvenile baboon; in addition, decorporation therapy using Na 3 -CaDTPA was performed on selected baboons to assess the efficacy of this drug in removing systemic burdens of 241 Am from this primate species. Determination of the kinetics of 241 Am was accomplished principally by in vivo methodologies and by radiochemical analysis of 241 Am activity of biological material. The use of Na 3 -CaDTPA as a therapeutic agent for the removal of 241 Am from the body proved to be an effective form of treatment in the case of early administration. (U.S.)

  20. Autoionisation of N/sup 5 +/ (nln'l') with n = 2,3,4 and n' >= n measured by electron spectrometry in collisions of N/sup 7 +/ with He and H/sub 2/, at 4. 9 keV amu/sup -1/

    Energy Technology Data Exchange (ETDEWEB)

    Bordenave-Montesquieu, A.; Benoit-Cattin, P.; Gleizes, A.; Marrakchi, A.I.; Dousson, S.; Hitz, D. (CEA Centre d' Etudes Nucleaires de Grenoble, 38 (France))

    1984-03-14

    a spectroscopic investigation of electrons coming from autoionising states N/sup 5 +/(nln'l'), with n=2,3,4 and n' >= n, of the fast ion has been made at 11.6/sup 0/ and 4.9 keV amu/sup -1/. Only exothermic reactions are observed. It is shown that the ionisation potential of the target has a strong influence on the more probable values of n and n'. In N/sup 7 +/-He collisions, the n=3, n'=3 configurations are the more excited. In N/sup 7 +/-H/sub 2/, the capture process is less selective since n=3, n' > 3 and also n=4, n' >= 4 configurations are strongly populated. In all these cases, the residual N/sup 6 +/ ion is left in an excited state (n=2 or 3). The n=2, n' > 2 excitation probability is found to be much smaller for the two collisional systems.

  1. AIMSsim Version 2.3.4 - User Manual

    Science.gov (United States)

    2008-01-01

    charge l’examen empirique d’une interface utilisateur simulée d’un système perfectionné de surveillance multi- capteurs intégré (AIMS) (anciennement...pour évaluer les principes de conception. La dernière phase de développement consistait à ajouter des options de contrôleur des capteurs et une...en charge l’examen empirique d’une interface utilisateur simulée d’un système perfectionné de surveillance multi- capteurs intégré (AIMS

  2. AIMSsim Version 2.3.4 - System Manual

    Science.gov (United States)

    2008-01-01

    l’examen empirique d’une interface utilisateur simulée d’un système perfectionné de surveillance multi- capteurs intégré (AIMS) (anciennement appelé...les principes de conception. La dernière phase de développement consistait à ajouter des options de contrôleur des capteurs et une interface...surveillance multi- capteurs intégré (AIMS) (anciennement appelé Système perfectionné de surveillance à intensification de lumière visible et à infrarouge ou

  3. NO REWARD BUT HONOUR? 23/4 7993

    African Journals Online (AJOL)

    Pyramids and Poppies takes on a rather emotional tone at times, specifically the appendices dealing with the question of World War. One Battle Honours. A complicated process at best, the writer has oversim- plified the matter by attempting to draw a comparison between South Af- rica and other Commonwealth coun- tries.

  4. 32 CFR 234.13 - Soliciting, vending, and debt collection.

    Science.gov (United States)

    2010-07-01

    ..., advertising to sell or rent property of Pentagon Reservation employees or their immediate families. (c... Service Reform Act of 1978. (d) Licensees, or their agents and employees, with respect to space licensed for their use. (e) Solicitations conducted by organizations composed of civilian employees of the...

  5. Radiochemical separation of thorium 234 from uranile acetylacetonate

    Energy Technology Data Exchange (ETDEWEB)

    Garcia-Rendon, R.M.; Solache, R.M.; Tenorio, D. (Instituto Nacional de Investigaciones Nucleares, Mexico City)

    1984-03-15

    The optimum conditions for the chemical separation of thorium compounds obtained by the chemical effects of ..cap alpha.. decay of uranium 238, in uranile acetylacetonate were established. The separation technique used was solvent extraction; the retention value obtained was 9.8+-2.1%.

  6. Dicty_cDB: CFH234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available hwmimvtvtk*HPLNKLSFTNSKLNSTHGITLGFDPQYDTA YPDENGLGWDILASFYNMDINAPSFNIEK--- ---VGXGIXIPAKEGYXLXKXGXXKTWVKKY*rlsli*ixkaxqxmaexxxkxrf...psig*lwlq*qsntr*tsspspiqnsiqlmg*psvlihsmill iqmkmvwdgislhlfiiwismlhllilkk--- ---VGXGIXIPAKEGYXLXKXGXXKTWVKKY*rlsli*ixkaxqxmaexxxkxrf

  7. Publications | Page 234 | CRDI - Centre de recherches pour le ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Le CRDI collabore avec les chercheurs et les établissements des pays en développement au renforcement des capacités locales par le truchement du financement, de la mise en commun des connaissances et de la formation. Avec nos livres, nos articles, nos publications de recherche et nos études, nous visons à ...

  8. 49 CFR 234.275 - Processor-based systems.

    Science.gov (United States)

    2010-10-01

    ...) Applicable definitions. The definitions in § 236.903 of this chapter shall apply to this section, where applicable. (b) Use of performance standard authorized or required. (1) In lieu of compliance with the... are satisfied using alternative means. Deviation from those particular requirements is authorized if...

  9. Dicty_cDB: CHE234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CAGCTGCATCATCAGCTGCAAG sequence update 2002. 9.10 Translated Amino Acid sequence ---XLEVXQXVLKQGPPVPPPHCSTCAEXSS...SSAASSSAPSSASSSAPSSASSSAPSSSASSSAASSAA Translated Amino Acid sequence (All Frames) Frame A: ---XLEVXQXVLKQGPPVPPPHCSTCAEXSS...iism*srwndlysstkqlyqy*ipmlpxssnl yssinyccfnhcnncincrnynlcnycrynnwwnynwwfnf***ccflsr**rcllitik qccfkcrfk*tik*

  10. Dicty_cDB: VHD234 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available IFHDISSYAQSHYRPAALSLS HPLLPMFTTTQQSSNDWNSQYQGVYSPLTSASPLPNGLKIQTLQWLDNQDNTILLRIENI YQIDGQDSQDPQTITLDLSTIFSTITITSATEMNLTGVQKLSNXSS...lsfqqlqsllqlk*i*lvfknyqixqvxxmpkllxvkxmx hxsss Frame B: ---sryxnakennqlssimefxrgstnqw*lctcecyclhsrs*siitihhc...DLSTIFSTITITSATEMNLTGVQKLSNXSSXXNAKTVXGKXYVS XIII Homology vs CSM-cDNA Score E Se

  11. 48 CFR 52.234-4 - Earned Value Management System.

    Science.gov (United States)

    2010-10-01

    ... ANSI/EIA Standard - 748 (current version at the time of award) to manage this contract. If the... with EVMS guidelines or the Contractor does not have an existing cost/schedule control system that is compliant with the guidelines in ANSI/EIA Standard - 748 (current version at time of award), the Contractor...

  12. 48 CFR 1852.234-2 - Earned Value Management System.

    Science.gov (United States)

    2010-10-01

    .../schedule control system that is compliant with the guidelines in the ANSI/EIA-748 Standard (current version... Management Systems (current version at the time of award) to manage this contract; and (2) Earned Value... guidelines, or the Contractor does not have an existing cost/schedule control system that is compliant with...

  13. 40 CFR 408.234 - Pretreatment standards for existing sources.

    Science.gov (United States)

    2010-07-01

    ... source subject to this subpart that introduces process wastewater pollutants into a publicly owned... subpart. Pollutant or pollutant property Pretreatment standard BOD5 No limitation. TSS Do. pH Do. Oil and grease Do. [40 FR 55790, Dec. 1, 1975, as amended at 60 FR 33946, June 29, 1995] ...

  14. 234 Fruiting Efficiency of Pentaclethra Macraphylla Benth: A Case ...

    African Journals Online (AJOL)

    Nekky Umera

    macrophylla was investigated in Ekpoma and Onne between 2004 and. 2007. Ten sample trees of P. macrophylla were randomly selected in a traditional agroforestry plantation in Ekpoma. Similarly, another ten sample trees were randomly ...

  15. Airline Service Quality Performance 234 (On-Time performance data).

    Science.gov (United States)

    2011-07-01

    This CD presents data reported by U.S. certificated air carriers so that information on the air carriers' quality of service can be made available to consumers of air transportation. Carriers within 1% or more of the total domestic scheduled service ...

  16. 32 CFR 234.17 - Vehicles and traffic safety.

    Science.gov (United States)

    2010-07-01

    ... beverage that is open or has been opened, or whose seal is broken, or the contents of which have been... container stored in the living quarters of a motor home or camper. (4) For the purpose of paragraph (a)(3)(i...

  17. 16 CFR 23.4 - Misrepresentation as to gold content.

    Science.gov (United States)

    2010-01-01

    ... unfair or deceptive to misrepresent the presence of gold or gold alloy in an industry product, or the... abbreviation to describe all or part of an industry product composed throughout of an alloy of gold, unless a... designation of the karat fineness of the alloy that is of at least equal conspicuousness as the term used. (6...

  18. 50 CFR 216.234 - Mitigation, monitoring and reporting.

    Science.gov (United States)

    2010-10-01

    ... ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS REGULATIONS GOVERNING THE TAKING AND... occupied pinniped sites on Ugak Island unless indications of human presence or activity warrant closer... NMFS Alaska Assistant Regional Administrator for Protected Resources and to the NMFS Division of...

  19. All projects related to | Page 234 | IDRC - International Development ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Fostering Entrepreneurship and Sustainable Livelihoods in Sub-Saharan Africa: A Multi-country Policy Research and Capacity- Building Initiative. Project. Support for entrepreneurship and small and medium enterprises is vital to stimulate jobs and to encourage self-employment in developing countries where labour ...

  20. Association between ε2/3/4, Promoter Polymorphism (−491A/T, −427T/C, and −219T/G) at the Apolipoprotein E Gene, and Mental Retardation in Children from an Iodine Deficiency Area, China

    Science.gov (United States)

    Zhang, Fuchang; Wang, Yunliang; Wang, Yan; Qin, Wei; Xing, Qinghe; Qian, Xueqing; Guo, Tingwei; Gao, Xiaocai; He, Lin; Gao, Jianjun

    2014-01-01

    Background. Several common single-nucleotide polymorphisms (SNPs) at apolipoprotein E (ApoE) have been linked with late onset sporadic Alzheimer's disease and declining normative cognitive ability in elder people, but we are unclear about their relationship with cognition in children. Results. We studied −491A/T, −427T/C, and −219G/T promoter polymorphisms and ε2/ε3/ε4 at ApoE among children with mental retardation (MR, n = 130), borderline MR (n = 124), and controls (n = 334) from an iodine deficiency area in China. The allelic and genotypic distribution of individual locus did not significantly differ among three groups with Mantel-Haenszel χ 2 test (P > 0.05). However, frequencies of haplotype of −491A/−427T/−219T/ε4 were distributed as MR > borderline MR > controls (P uncorrected = 0.004), indicating that the presence of this haplotype may increase the risk of disease. Conclusions. In this large population-based study in children, we did not find any significant association between single locus of the four common ApoE polymorphisms (−491A/T, −427T/C, −219T/G, and ε2/3/4) and MR or borderline MR. However, we found that the presence of ATTε4 haplotype was associated with an increased risk of MR and borderline MR. Our present work may help enlarge our knowledge of the cognitive role of ApoE across the lifespan and the mechanisms of human cognition. PMID:24790992

  1. Rapid selective separation of americium/curium from simulated nuclear forensic matrices using triazine ligands

    Energy Technology Data Exchange (ETDEWEB)

    Higginson, Matthew A.; Livens, Francis R.; Heath, Sarah L. [Manchester Univ. (United Kingdom). Centre for Radiochemistry Research; Thompson, Paul; Marsden, Olivia J. [AWE, Aldermaston, Reading (United Kingdom); Harwood, Laurence M.; Hudson, Michael J. [Reading Univ. (United Kingdom). Dept. of Chemistry; Lewis, Frank W. [Reading Univ. (United Kingdom). Dept. of Chemistry; Northumbria Univ., Newcastle upon Tyne (United Kingdom). Dept. of Chemical and Forensic Sciences

    2015-07-01

    In analysis of complex nuclear forensic samples containing lanthanides, actinides and matrix elements, rapid selective extraction of Am/Cm for quantification is challenging, in particular due the difficult separation of Am/Cm from lanthanides. Here we present a separation process for Am/Cm(III) which is achieved using a combination of AG1-X8 chromatography followed by Am/Cm extraction with a triazine ligand. The ligands tested in our process were CyMe{sub 4}-BTPhen, CyMe{sub 4}-BTBP, CA-BTP and CA-BTPhen. Our process allows for purification and quantification of Am and Cm (recoveries 80% - 100%) and other major actinides in < 2 d without the use of multiple columns or thiocyanate. The process is unaffected by high level Ca(II)/Fe(III)/Al(III) (10 mg mL{sup -1}) and thus requires little pre-treatment of samples.

  2. Criteria Considered in Selecting Feed Items for Americium-241 Oxide Production Operations

    Energy Technology Data Exchange (ETDEWEB)

    Schulte, Louis D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-01-30

    The analysis in this document serves the purpose of defining a number of attributes in selection of feed items to be utilized in recovery/recycle of Pu and also production operations of 241AmO2 material intended to meet specification requirements. This document was written in response to a specific request on the part of the 2014 annual program review which took place over the dates of October 28-29, 2014. A number of feed attributes are noted including: (1) Non-interference with existing Pu recovery operations; (2) Content of sufficient 241Am to allow process efficiency in recovery operations; (3) Absence of indications that 243Am might be mixed in with the Pu/241Am material; (4) Absence of indications that Cm might be mixed in with the Pu/241Am material; (5) Absence of indications of other chemical elements that would present difficulty in chemical separation from 241Am; (6) Feed material not expected to present difficulty in dissolution; (7) Dose issues; (8) Process efficiency; (9) Size; (10) Hazard associated with items and package configuration in the vault; (11) Within existing NEPA documentation. The analysis in this document provides a baseline of attributes considered for feed materials, but does not presume to replace the need for technical expertise and judgment on the part of individuals responsible for selecting the material feed to be processed. This document is not comprehensive as regards all attributes that could prove to be important. The value of placing a formal QA hold point on accepting feed items versus more informal management of feed items is discussed in the summation of this analysis. The existing planned QA hold points on 241AmO2 products produced and packaged may be adequate as the entire project is based on QA of the product rather than QA of the process. The probability of introduction of items that would inherently cause the241AmO2 products produced to be outside of specification requirements appears to be rather small.

  3. Role of americium interference in analysis of samples containing rare earths

    International Nuclear Information System (INIS)

    Mohapatra, P.K.; Adya, V.C.; Thulasidas, S.K.; Bhattacharyya, A.; Kumar, Mithlesh; Godbole, S.V.; Manchanda, V.K.

    2007-01-01

    Quality control of nuclear fuel samples requires precise estimation of rare earths which have high neutron absorption cross sections and act as neutron poisons. Am is generated by nuclear decay where as lanthanides may be present as impurities picked up during reprocessing/fuel fabrication. Precise estimation of the rare earths by ICP-AES method in presence of 241 Am is a challenging task due to the likelihood of spectral interference of the latter. Rare earths impurities in the purified Am sample were estimated by ICP-AES method. Known amounts of the rare earths viz. Sm, Eu, Dy and Gd were used as synthetic sample and the interference due to Am was investigated. (author)

  4. Extraction of Americium and Europium by Diphosphine Dioxides and Their Mixtures with Chlorinated Cobalt Dicarbollide

    International Nuclear Information System (INIS)

    R. Scott Herbst; Dean R. Peterman; Terry A. Todd

    2005-01-01

    Extraction of Am and Eu using mixtures of diphosphine dioxides (DPDO, e.g., (R1)2P(O)(CH2)nP(O)(R2)2 where R1, R2 = Ph, Bu; n = 1,2), with and without chlorinated cobalt dicarbollide (CCD) in the polar diluents 1,2-dichloroethane (DCE), meta-nitrobenzotrifluoride (F-3), bis-tetrafluoropropyl ether of diethylene glycol (F-8) and phenyltrifluoromethyl sulfone (FS-13) from HNO3, HClO4, LiNO3 and LiClO4 solutions has been investigated. The anomalous aryl strengthening (AAS) effect, i.e. the anomalous increase of extraction ability of methylene bridged diphosphine dioxides due to substitution of aromatic (i.e., phenyl) for alkyl (e.g., butyl or octyl) moieties (DAm increases by three to four orders of magnitude), is only observed during the extraction of Am and Eu from acidic media. In salt media the AAS effect is weakly observed, and is practically absent in such diluents as F-3 and FS-13. The extraction isotherm in the case of DPDO with an observed AAS effect indicates the distribution coefficients of Eu decrease by a factor of two to three, even at the concentration ratio of DPDO:Eu = 50:1; however, these values decrease only by 10% for the DPDO that do not indicate an observed AAS effect. It is proposed that the presence of water in the diluent is necessary for manifestation of the AAS effect. The synergistic effects of adding chlorinated cobalt dicarbollide (CCD) with the DPDO that has been reported for other systems was also found to prevail in several of the systems investigated in this study. On addition of CCD with the DPDO, a considerable synergistic effect is observed (DAm increases by three to four orders of magnitude) during Am and Eu extraction from nitrate media. In perchlorate media the synergistic effect is absent. The most probable reason for synergism in the presence of CCD is the higher hydrophobicity of the CCD anion as compared to the nitrate anion. The results of this work will be of utility in understanding existing and developing new extraction systems designed for the simultaneous removal of multiple radionuclides from acidic streams

  5. Multi-recycling of plutonium and incineration of americium, curium, and technetium in PWRs

    International Nuclear Information System (INIS)

    Golfier, H.; Bergeron, J.; Puill, A.; Rohart, M.

    2000-01-01

    The future of nuclear power requires a clear strategy for radwaste and Plutonium management. Pressurized water reactors (PWR) and the associated fuel cycle installations represent the largest part of the French power plants (and are partly paid off). The reactors in service produce an annual 10 tons of Pu, 1.4 tons of minor actinides (MA), and 3.8 tons of long-lived fission products (LLFP). The spent fuel is reprocessed in La Hague plant to recover the energetic elements U and Pu. The latter was initially dedicated to power Fast Breeder Reactors that converted the depleted and reprocessed, thus ensuring a significant part of the French national energy resources. The shut-down of Super-Phenix, the postponement of building of Fast Breeder Reactors (FBR) and the relaxed need for stretching natural U resources raise the issue of Pu management. In fact, the Pu mono-recycling practiced in France since 1987 (St Laurent B1) only slows down the Pu accumulation in spent nuclear fuel, yet it is unable to stabilize the Pu inventory. Beyond the cooperation with its industrial partners, CEA investigates solutions for short and medium term Pu management thus contributing to research required for keeping nuclear power as an energy option. The range of these investigations shall cover both adaptations for light water reactors to facilitate Pu recycling and more innovative solutions concerning reactors, fuel and fuel cycle. The aim of using Pu more efficiently in PWR has led, not only for economic and non-proliferation reasons, but also for considerations related to the optimization of Pu and MA management. The mastery of Pu inventory is a requirement for all long-lived radwaste management methods. In this context, the potential of innovative PWRs has been investigated to control the Pu fluxes and to make them a milestone on the way to clean nuclear power. This paper presents the most recent results related to Pu utilization and MA and LLFP incineration like (Am+Cm) and Tc. To determine the influence of the Pu fluxes, a 1450 MWe PWR with one standard and one innovative concept (code named APA for Advanced Plutonium fuel Assembly) have been performed. A multi-recycling scenario is simulated with a 400 TWhe power plant park. (authors)

  6. Fundamental chemistry and materials science of americium in selected immobilization glasses

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G. [Oak Ridge National Lab., TN (United States); Stump, N.A. [Winston-Salem State Univ., NC (United States). Dept. of Physical Sciences

    1996-12-01

    We have pursued some of the fundamental chemistry and materials science of Am in 3 glass matrices, two being high-temperature (850 and 1400 C mp) silicate-based glasses and the third a sol-gel glass. Optical spectroscopy was the principal tool. One aspect of this work was to determine the oxidation state exhibited by Am in these matrices, as well as factors that control or may alter this state. A correlation was noted between the oxidation state of the f-elements in the two high-temperature glasses with their high-temperature oxide chemistries. One exception was Am: although AmO{sub 2} is the stable oxide encountered in air, when this dioxide was incorporated into the high-temperature glasses, only trivalent Am was found in the products. When Am(III) was used to prepare the sol-gel glasses at ambient temperature, and after these products were heated in air to 800 C, only Am(III) was observed. Potential explanations for the unexpected Am behavior is offered in the context of its basic chemistry. Experimental spectra, spectroscopic assignments, etc. are discussed.

  7. Plutonium, americium and 90Sr in bones of the some wild animals living in Poland

    International Nuclear Information System (INIS)

    Mietelski, J.W.; Kitowski, I.; Tomankiewicz, E.; Gaca, P.; Blazej, S.

    2006-01-01

    Bones of the wild foxes (Vulpes vulpes), roe deer (Capreolus capreolus), deer (Cervus elaphus), wild boars (Sus scorf), mooses (Alces alces), as well as of certain kinds of rodents and insectivorous animals were ashed and milled prior to the radioactivity measurement in the γ-spectrometer. 238 Pu, 239,240 Pu, 241 Am and 90 Sr contents were determined. The results are presented in terms of the kind and origin of the animals. North-east, central-east and south-est parts of Poland were taken into an account

  8. Kinetics of the oxidation-reduction reactions of uranium, neptunium, plutonium, and americium in aqueous solutions

    International Nuclear Information System (INIS)

    Newton, T.W.

    1975-01-01

    This is a review with about 250 references. Data for 240 reactions are cataloged and quantitative activation parameters are tabulated for 79 of these. Some empirical correlations are given. Twelve typical reactions are discussed in detail, along with the effects of self-irradiation and ionic strength. (U.S.)

  9. Treatment of selected primary gynecologic and pelvic malignancies with 241Americium

    International Nuclear Information System (INIS)

    Chung, Joyce Y.; Peschel, Richard E.; Kacinski, Barry; Nath, Ravinder; Pourang, Rauman; Roberts, Kenneth; Fischer, Diana; Chambers, Joseph; Schwartz, Peter E.; Wilson, Lynn

    1995-01-01

    Purpose: To evaluate the efficacy of encapsulated 241 Am in the treatment of primary gynecological malignancies and in previously irradiated patients with recurrent disease in the pelvis. Materials and Methods: Encapsulated 241 Am primarily emits 60keV photons which are effectively shielded by thin layers of high atomic number materials. Dose distributions in water are similar to those produced by Cs-137 photons but with a half-value layer that is considerably less. Cases of 28 patients (12-primary, 16-recurrent) who have been treated with 241 Am at the Yale University School of Medicine since 1986 were retrospectively reviewed. Data concerning dosimetry, disease site, prior treatment, recurrence, disease-free survival, overall survival, and complications were evaluated. Results: Median follow up for the 12 patients with primary gynecological tumors was 19 months (7mo-51mo). There were 6 vulvar, 3 vaginal, 2 cervical and 1 endometrial carcinomas. Median surface dose of 241 Am was 42.2 Gy (23.3Gy-106.6Gy). As part of their initial therapy 11 received pelvic external beam radiation therapy, 6 underwent surgery and 2 received other forms of intracavitary brachytherapy. Of these 12 patients, 11 achieved a complete response (CR) with the duration of CR ranging from 7 to 51 months. Actuarial disease-free survival at 3 years was 66% (S.E.=.16) and actuarial overall survival at 3 years was 91% (S.E.=.08). Median follow up for the 16 patients with recurrent pelvic malignancies was 72 months (20mo-99mo). There were 9 cases of endometrial, 3 vulvar, 3 colorectal, and 1 cervical carinomas. Fifteen of 16 received some form of surgery and radiotherapy prior to their treatment with 241 Am. Median surface dose of 241 Am was 40.3 (17.6Gy-141.7Gy). Of these 16 patients, 10 achieved a CR with the duration of CR ranging from 3 to 88 months. Actuarial disease-free survival at 5 years was 51% (S.E.=.16) and actuarial overall survival at 5 years was 43% (S.E.=.14). Complications were observed in 1 primarily treated patient (soft tissue necrosis) and in 3 patients with recurrent disease (colonic obstruction, rectal fissure, and GI bleed, respectively). Conclusion: The unique dosimetric characteristics of 241 Am allow effective and safe treatment of selected primary gynecological malignancies and in previously irradiated patients with recurrent pelvic malignancies

  10. Fabrication of uranium-americium mixed oxide fuels: thermodynamical modeling and materials properties

    International Nuclear Information System (INIS)

    Prieur, D.

    2011-01-01

    Fuel irradiation in pressurized water reactors lead to the formation of fission products and minor actinides (Np, Am, Cm) which can be transmuted in fast neutrons reactors. In this context, the aim of this work was to study the fabrication conditions of the U 1-y Am y O 2+x fuels which exhibit particular thermodynamical properties requiring an accurate monitoring of the oxygen potential during the sintering step. For this reason, a thermodynamical model was developed to assess the optimum sintering conditions for these materials. From these calculations, U 1-y Am y O 2+x (y=0.10; 0.15; 0.20; 0.30) were sintered in two range of atmosphere. In hyper-stoichiometric conditions at low temperature, porous and multiphasic compounds are obtained whereas in reducing conditions at high temperature materials are dense and monophasic. XAFS analyses were performed in order to obtain additional experimental data for the thermodynamical modeling refinement. These characterizations also showed the reduction of Am(+IV) to Am(+III) and the partial oxidation of U(+IV) to U(+V) due to a charge compensation mechanism occurring during the sintering. Finally, taking into account the high - activity of Am, self-irradiation effects were studied for two types of microstructures and two Am contents (10 and 15%). For each composition, a lattice parameter increase was observed without structural change coupled with a macroscopic swelling of the pellet diameter up to 1.2% for the dense compounds and 0.6% for the tailored porosity materials. (author) [fr

  11. Thermochemistry of selected trivalent lanthanide and americium compounds: orthorhombic and hexagonal hydroxycarbonates

    International Nuclear Information System (INIS)

    Rorif, F.; Fuger, J.; Desreux, J.F.

    2005-01-01

    The molar enthalpies of dissolution of a number of well-characterized hexagonal hydroxycarbonates Ln(OH)CO 3 (hex) (Ln = La, Nd, Sm, Eu) in 6.00 mol dm -3 HCl were measured at 298.15K. A new sealed solution micro-calorimeter was developed for this purpose. It was made of an 18-carat gold alloy in order to improve the performances of a calorimeter previously built in our laboratory. The following standard molar enthalpies of formation, Δ f H m [Ln(OH)CO 3 , hex], in kJ mol -1 , were calculated: -(1627.8±1.6), -(1614.8±1.9), -(1613.4±1.6), and -(1523.0±3.0), for the La, Nd, Sm, and Eu compounds, respectively. These results allowed an extrapolation to Δ f H m [Eu(OH)CO 3 .0.5H 2 O, orth] = -(1653.4±3.6) kJ mol -1 and to Δ f H m [Am(OH)CO 3 , hex] = -(1552.5±3.3) kJ mol -1 . Using auxiliary data and estimated entropies, the solubility products of the hexagonal hydroxycarbonates were calculated. They are compared here with values deduced from solubility and calorimetric measurements for the corresponding orthorhombic hydroxycarbonates. Our approach generally leads to values similar to those deduced from solubility studies. The orthorhombic form is found to be metastable with respect to the hexagonal form. (orig.)

  12. Distribution of plutonium and americium in whole bodies donated to the United States Transuranium Registry

    International Nuclear Information System (INIS)

    McInroy, J.F.; Kathren, R.L.; Swint, M.J.

    1989-01-01

    Radiochemical analysis of whole body donations from six former nuclear industry workers 30 or more years post-exposure revealed about 45% of the total body deposition of 239 Pu and 35% of the 241 Am in the respiratory tract of the four cases with inhalation exposure. These proportions are greater than predicted by the current ICRP lung model. Exclusive of the respiratory tract, the mean fractional systemic deposition of 239 Pu in the tissues of five whole bodies was: liver 35.4% ± 12.5%; skeleton 53.7% ± 12.5%; striated muscle 6.5% ± 1.8% and all other organs and tissues 4.4% ± 1.7%. For 241 Am, the comparable values in four cases were liver 6.5% ± 4.8%; skeleton 73.5% ± 12.4%; muscle 14.3% ± 7.6%; and all other tissues and organs 6.65% ± 4.2%. The systemic distribution of 239 Pu was generally consistent with ICRP Publication 30. A significant fraction of both nuclides was retained in the muscle and other soft tissues which serve as long-term storage depots. Initial fractionation of 241 Am between skeleton and liver is consistent with the 50:30 ratio proposed in ICRP Publication 48 assuming an effective clearance half-time from the liver of about 2 y. Estimates of 239 Pu deposition made on the basis of urinalysis results in vivo were typically greater than the observed deposition measured in the tissues of the whole body after death. (author)

  13. Controlling Hexavalent Americium – A Centerpiece to a Compact Nuclear Fuel Cycle

    Energy Technology Data Exchange (ETDEWEB)

    Shafer/Braley, Jenifer; Nash, Kenneth L; Lumetta, Gregg; McCann, Kevin; Sinkov, Sergey I

    2014-10-01

    Closing the nuclear fuel cycle could be simplified by recovering the actinides U through Am as a group. This could be achieved by converting U, Np, Pu and Am to the hexavalent state. Uranium, Np and Pu are readily oxidized to the hexavalent state. Generation of hexavalent Am in acidic solutions is more difficult, as the standard reduction potential of the Am(VI) /Am(III) couple (+1.68 V in 1 M HClO4) is well outside of the electrochemical stability window of water. While the oxidation and separation of Am has been demonstrated under laboratory conditions, several issues could plague scale up and implementation of this separation with used fuel. Two primary concerns are considered. The first issue concerns the stability of the oxidized Am. The second involves the undesirable co-extraction of tetravalent f-elements with the hexavalent actinides. To address the first concern regarding Am redox instability, Am reduction will be monitored under a variety of different conditions to establish the means of improving the stability of Am(VI) in the organic phase. Identifying the components contributing most significantly to its reduction will allow thoughtful modification of the process. To address the second concern, we propose to apply branched chain extractants to separate hexavalent actinides from tetravalent f-elements. Both branched monoamide and organophosphorus extractants have demonstrated significant selectivity for UO22+ versus Th4+, with separation factors generally on the order of 100. The efforts of this two-pronged research program should represent a significant step forward in the development of aqueous separations approaches designed to recover the U-Am actinides based on the availability of the hexavalent oxidation state. For the purposes of this proposal, separations based on this approach will be called SAn(VI) separations, indicating the Separation of An(VI).

  14. Separation of americium from lanthanides in nitric acid medium by DPTP in octanol-dodecane

    International Nuclear Information System (INIS)

    Tang Hongbin; Ye Guoan; Cheng Qifu; Ye Yuxing; Jiang Dexiang; Zhu Wenbin; Chen Hui; Zhang Hu; He Hui; Li Gaoliang

    2008-01-01

    Considering the good solubility of 2,6-bis(5,6-di-n-propyl-1,2,4-triazin-3-yl)- pyridine (DPTP) and avoiding the third phase formation, octanol-dodecane (ODOD) with a volume fraction of 30% was selected as the diluent. The distribution ratios of Am(III) and Eu(III) were studied as a function of a number of parameters such as con- tact time, nitrate ion and the nitric acid concentration in aqueous phase, the concentration of DPTP in the organic phase. A counter-current cascade (10 mL glass tube with plug) extraction experiment was carried out with 0.04 mol/L DPTP/ODOD. In the experiments, the flow rate ratios are as following: F:X:S=1:0.63:0.25, BF:BX=1:1; the feed solution, Eu(III) + Am(III) in 1.0 mol/L HNO 3 solution; scrubbing solution, 1.0 mol/L HNO 3 solution; stripping reagent, 0.01 mol/L HNO 3 . The results show that the recovery of Am is 98.42%, only containing Am/Eu is 45, SF Eu/Am is more than 10 3 . (authors)

  15. A consistent set of thermodynamic constants for americium (III) species with hydroxyl and carbonate

    International Nuclear Information System (INIS)

    Kerrisk, J.F.; Silva, R.J.

    1986-01-01

    A consistent set of thermodynamic constants for aqueous species, and compounds of Am(III) with hydroxyl and carbonate ligands has been developed. The procedure used to develop these constants involved establishing a value for one formation constant at a time in a sequential order, starting with the hydrolysis products and hydroxide solids, and then proceeding to carbonate species. The EQ3NR chemical-equilibrium model was used to test the constants developed. These constants are consistent with most of the experimental data that form their basis; however, considerable uncertainty still exists in some aspects of the Am(III) data

  16. Optimization of TRPO process parameters for americium extraction from high level waste

    International Nuclear Information System (INIS)

    Chen Jing; Wang Jianchen; Song Chongli

    2001-01-01

    The numerical calculations for Am multistage fractional extraction by trialkyl phosphine oxide (TRPO) were verified by a hot test. 1750L/t-U high level waste (HLW) was used as the feed to the TRPO process. The analysis used the simple objective function to minimize the total waste content in the TRPO process streams. Some process parameters were optimized after other parameters were selected. The optimal process parameters for Am extraction by TRPO are: 10 stages for extraction and 2 stages for scrubbing; a flow rate ratio of 0.931 for extraction and 4.42 for scrubbing; nitric acid concentration of 1.35 mol/L for the feed and 0.5 mol/L for the scrubbing solution. Finally, the nitric acid and Am concentration profiles in the optimal TRPO extraction process are given

  17. Separation of americium (III) and strontium (II) using TEHDGA and 18-crown-6

    Energy Technology Data Exchange (ETDEWEB)

    Sinharoy, Prithwish; Khan, Pasupati Nath; Nair, Deepika; Jagasia, Poonam; Dhami, P.S.; Kaushik, C.P.; Banerjee, Kalyan [Bhabha Atomic Research Centre, Mumbai (India). Nuclear Recycle Group; Anitha, M. [Bhabha Atomic Research Centre, Mumbai (India). Rare Earth Development Section; Sharma, J.N. [Bhabha Atomic Research Centre, Mumbai (India). Process Development Div.

    2017-06-01

    This work describes extraction of Am(III) and Sr(II) together with tetra(2-ethylhexyl) diglycolamide (TEHDGA) and selective back-extraction of strontium with a strontium complexant, 18-crown-6, leading to their separation from each other. 0.3 M TEHDGA+5% isodecyl alcohol/n-dodecane was used to extract Am(III) and Sr(II) from 4 M nitric acid into organic phase with very high D (D{sub Am}=1000, D{sub Sr}=22) and 0.1 M 18-crown-6 dissolved in 4 M nitric acid is used for selective stripping of Sr(II) from loaded extract phase. Am(III) left in the extract phase was then stripped with 0.01 M nitric acid. Stripping of Sr(II) was found to increase with increase in 18-crown-6 concentration, at 0.1 M 18-crown-6 dissolved in 4 M nitric acid, 83% of the loaded strontium (D{sub Sr}=0.20) was back-extracted in a single contact while loss of Am(III) was 0.8% (D{sub Am}=122.45). Stoichiometry limit of 1:1 was observed between strontium and 18-crown-6. Strontium was precipitated and separated from the complexant by Na{sub 2}SO{sub 4} or Na{sub 2}CO{sub 3}. This process was tested with simulated solution of high level waste and found suitable for quantitative recovery of strontium with high purity.

  18. Fundamental chemistry and materials science of americium in selected immobilization glasses

    International Nuclear Information System (INIS)

    Haire, R.G.; Stump, N.A.

    1996-01-01

    We have pursued some of the fundamental chemistry and materials science of Am in 3 glass matrices, two being high-temperature (850 and 1400 C mp) silicate-based glasses and the third a sol-gel glass. Optical spectroscopy was the principal tool. One aspect of this work was to determine the oxidation state exhibited by Am in these matrices, as well as factors that control or may alter this state. A correlation was noted between the oxidation state of the f-elements in the two high-temperature glasses with their high-temperature oxide chemistries. One exception was Am: although AmO 2 is the stable oxide encountered in air, when this dioxide was incorporated into the high-temperature glasses, only trivalent Am was found in the products. When Am(III) was used to prepare the sol-gel glasses at ambient temperature, and after these products were heated in air to 800 C, only Am(III) was observed. Potential explanations for the unexpected Am behavior is offered in the context of its basic chemistry. Experimental spectra, spectroscopic assignments, etc. are discussed

  19. Standard test method for the radiochemical determination of americium-241 in soil by alpha spectrometry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2007-01-01

    1.1 This method covers the determination of americium–241 in soil by means of chemical separations and alpha spectrometry. It is designed to analyze up to ten grams of soil or other sample matrices that contain up to 30 mg of combined rare earths. This method allows the determination of americium–241 concentrations from ambient levels to applicable standards. The values stated in SI units are to be regarded as standard. 1.2 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use. For specific precaution statements, see Section 10.

  20. Photochemical oxidation of americium(3) in bicarbonate-carbonate solutions saturated with N2O

    International Nuclear Information System (INIS)

    Shilov, V.P.; Yusov, A.B.

    1993-01-01

    The influence of UV radiation on 1.1x10 -4 mol/l Am(3) in bicarbonate-carbonate solutions of sodium and potassium saturated with N 2 O was studied by spectrographic method. In all the cases Am(4) was formed as a primary product. Initial rate of Am(4) accumulation remains stable in solutions up to HCO 3 - or HCO 3 - +CO 3 2- concentration of approximately 1.5 mol/l, but it decreases in case of their higher concentration. In solutions with pH 8.4-10 Am(4) disproportionates at a slow rate and the method suggested permits attaining practically 100% yield of it