WorldWideScience

Sample records for americium 233

  1. Chemistry of americium

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.

    1976-01-01

    Essential features of the descriptive chemistry of americium are reviewed. Chapter titles are: discovery, atomic and nuclear properties, collateral reading, production and uses, chemistry in aqueous solution, metal, alloys, and compounds, and, recovery, separation, purification. Author and subject indexes are included. (JCB)

  2. The Biokinetic Model of Americium

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    To improve in vivo measurements for detecting internal exposure from transuranium radio nuclides, such as neptunium, plutonium, americium, the bioknetic model was studied. According to ICRP report (1993, 1995, 1997) and other research, the

  3. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-22

    Acqueous Chloride mission is to recover plutonium and americium from pyrochemical residues (undesirable form for utilization and storage) and generate plutonium oxide and americium oxide. Plutonium oxide is recycled into Pu metal production flowsheet. It is suitable for storage. Americium oxide is a valuable product, sold through the DOE-OS isotope sales program.

  4. 5f-Electron Delocalization in Americium

    DEFF Research Database (Denmark)

    Skriver, Hans Lomholt; Andersen, O. K.; Johansson, B.

    1980-01-01

    The pressure-volume relation for americium has been obtained without adjustable parameters from self-consistent, spin-polarized band calculations. Around 100 kbar we find a first-order transition to a state with low volume and no spin. This is consistent with preliminary high-pressure measurements....

  5. The relative physiological and toxicological properties of americium and plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Carter, R.E.; Busch, E.; Johnson, O. [and others

    1951-11-15

    The relative physiological and toxicological properties of americium and plutonium have been studied following their intravenous administration to rats. The urinary and fecal excretion of americium was similar to that of plutonium administered as Pu(N0{sub 3}){sub 4}. The deposition of americium the tissues and organs of the rat was also similar to that observed for plutonium. The liver and the skeleton were the major sites of deposition. Zirconium citrate administered 15 minutes after injection of americium increased the urinary excretion of americium and decreased the amount found in the liver and the skeleton at 4 and 16 days. LD{sub 30}{sup 50} studies showed americium was slightly less toxic when given in the acute toxic range than was plutonium. The difference was, however, too slight to be important in establishing a larger tolerance does for americium. Survival studies, hematological observations, bone marrow observations, comparison of tumor incidence and the incidence of skeletal abnormalities indicated that americium and plutonium have essentially the same chronic toxicity when given on an equal {mu}c. basis. These studies support the conclusion that the tolerance values for americium should be essentially the same as those for Plutonium.

  6. Surface complexation modeling of americium sorption onto volcanic tuff.

    Science.gov (United States)

    Ding, M; Kelkar, S; Meijer, A

    2014-10-01

    Results of a surface complexation model (SCM) for americium sorption on volcanic rocks (devitrified and zeolitic tuff) are presented. The model was developed using PHREEQC and based on laboratory data for americium sorption on quartz. Available data for sorption of americium on quartz as a function of pH in dilute groundwater can be modeled with two surface reactions involving an americium sulfate and an americium carbonate complex. It was assumed in applying the model to volcanic rocks from Yucca Mountain, that the surface properties of volcanic rocks can be represented by a quartz surface. Using groundwaters compositionally representative of Yucca Mountain, americium sorption distribution coefficient (Kd, L/Kg) values were calculated as function of pH. These Kd values are close to the experimentally determined Kd values for americium sorption on volcanic rocks, decreasing with increasing pH in the pH range from 7 to 9. The surface complexation constants, derived in this study, allow prediction of sorption of americium in a natural complex system, taking into account the inherent uncertainty associated with geochemical conditions that occur along transport pathways.

  7. Excited levels of Pa-233; Niveles excitados del Pa-233

    Energy Technology Data Exchange (ETDEWEB)

    Vara Cuadrado, J. M.

    1969-07-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T{sub 1}) detectors. (Author) 54 refs.

  8. Self-irradiation and oxidation effects on americium sesquioxide and Raman spectroscopy studies of americium oxides

    Energy Technology Data Exchange (ETDEWEB)

    Horlait, Denis [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France); Caraballo, Richard [CEA, DEN, DTCD/SECM/LMPA, F-30207 Bagnols-sur-Cèze Cedex (France); Lebreton, Florent [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France); Jégou, Christophe [CEA, DEN, DTCD/SECM/LMPA, F-30207 Bagnols-sur-Cèze Cedex (France); Roussel, Pascal [Unité de Catalyse et Chimie du Solide, UMR 8012 CNRS, Ecole Nationale Supérieure de Chimie de Lille BP 90108, 59652 Villeneuve d’Ascq Cedex (France); Delahaye, Thibaud, E-mail: thibaud.delahaye@cea.fr [CEA, DEN, DTEC/SDTC/LEMA, F-30207 Bagnols-sur-Cèze Cedex (France)

    2014-09-15

    Americium oxides samples were characterized by X-ray diffraction (XRD) and Raman spectroscopy, with an emphasis on their structural behavior under oxidation and self-irradiation. Raman spectra of americium dioxide (AmO{sub 2}) and sesquioxide (Am{sub 2}O{sub 3}) were obtained for the first time. With the help of literature data on isostructural oxides, Raman signatures of Ia-3 C-type Am{sub 2}O{sub 3} and P-3m1 A-type Am{sub 2}O{sub 3} are identified. For AmO{sub 2,} a clear band is noted at 390 cm{sup −1}. Its nature is compared to that of the other actinide dioxides. Am{sub 2}O{sub 3} evolution under ambient conditions and against {sup 241}Am α self-irradiation was monitored by powder XRD. The sample, initially composed of A-type Am{sub 2}O{sub 3} as major phase as well as C2/m B-type and C-type structures as minor phases, progressively oxidizes to Fm-3m AmO{sub 2−δ} over a few months. On the basis of diffractogram refinements, evolutions of unit cell volumes caused by self-irradiation are also determined and discussed. - Graphical abstract: The evolution of americium oxide under ambient conditions was monitored using XRD (X-ray diffraction) and Raman spectroscopy. After a thermal treatment under reducing conditions, a polyphasic sample mainly composed of A- and C-type americium sesquioxides is evidenced by XRD and Raman spectroscopy. The sample then evolves through two processes: oxidation and self-irradiation. The first one provokes the progressive appearance of F-type americium dioxide while the initial phases disappear, whereas the main effect of the second is a structural swelling with time. - Highlights: • The first Raman spectroscopy measurements on americium oxides were performed. • Observed Am{sub 2}O{sub 3} Raman bands were identified thanks to data on analogue compounds. • AmO{sub 2} assumed T{sub 2g} band presents a shift compared to the actinide dioxide series. • Am{sub 2}O{sub 3} evolution under self-irradiation and oxidation was also

  9. Plutonium and Americium Geochemistry at Hanford: A Site Wide Review

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Felmy, Andrew R.

    2012-08-23

    This report was produced to provide a systematic review of the state-of-knowledge of plutonium and americium geochemistry at the Hanford Site. The report integrates existing knowledge of the subsurface migration behavior of plutonium and americium at the Hanford Site with available information in the scientific literature regarding the geochemistry of plutonium and americium in systems that are environmentally relevant to the Hanford Site. As a part of the report, key research needs are identified and prioritized, with the ultimate goal of developing a science-based capability to quantitatively assess risk at sites contaminated with plutonium and americium at the Hanford Site and the impact of remediation technologies and closure strategies.

  10. Americium/Curium Disposition Life Cycle Planning Study

    Energy Technology Data Exchange (ETDEWEB)

    Jackson, W.N. [Westinghouse Savannah River Company, AIKEN, SC (United States); Krupa, J.; Stutts, P.; Nester, S.; Raimesch, R.

    1998-04-30

    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS).

  11. Higher Americium Oxidation State Research Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    Mincher, Bruce J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Law, Jack D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Goff, George S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Moyer, Bruce A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Lumetta, Gregg J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shehee, Thomas C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hobbs, David T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-12-18

    The partitioning of hexavalent Am from dissolved nuclear fuel requires the ability to efficiently oxidize Am(III) to Am(VI) and to maintain that oxidation state for a length of time sufficient to perform the separation. Several oxidants have been, or are being developed. Chemical oxidants include Ag-catalyzed ozone, Ag-catalyzed peroxydisulfate, Cu(III) periodate, and sodium bismuthate. Hexavalent americium has also now successfully been prepared by electrolysis, using functionalized electrodes. So-called auto-reduction rates of Am(VI) are sufficiently slow to allow for separations. However, for separations based on solvent extraction or ion exchange using organic resins, the high valence state must be maintained under the reducing conditions of the organic phase contact, and a holding oxidant is probably necessary. Until now, only Cu(III) periodate and sodium bismuthate oxidation have been successfully combined with solvent extraction separations. Bismuthate oxidation provided the higher DAm, since it acts as its own holding oxidant, and a successful hot test using centrifugal contactors was performed. For the other oxidants, Ag-catalyzed peroxydisulfate will not oxidize americium in nitric acid concentrations above 0.3 M, and it is not being further investigated. Peroxydisulfate in the absence of Ag catalysis is being used to prepare Am(V) in ion exchange work, discussed below. Preliminary work with Ag-catalyzed ozone has been unsuccessful for extractions of Am(VI) from 6.5 M HNO3, and only one attempt at extraction, also from 6.5 M HNO3, using the electrolytic oxidation has been attempted. However, this high acid concentration was based on the highest Am extraction efficiency using the bismuthate oxidant; which is only sparingly soluble, and thus the oxidation yield is based on bismuthate solubility. Lower acid concentrations may be sufficient with alternative oxidants and work with Ag-ozone, Cu(III) and electrolysis is on-going. Two non

  12. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Gardner, Kyle Shelton [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-09-28

    These are a set of slides intended for an information session as part of recruiting activities at Brigham Young University. It gives an overview of aqueous chloride operations, specifically on plutonium and americium purification/recovery. This presentation details the steps taken perform these processes, from plutonium size reduction, dissolution, solvent extraction, oxalate precipitation, to calcination. For americium recovery, it details the CLEAR (chloride extraction and actinide recovery) Line, oxalate precipitation and calcination.

  13. Pyrochemical investigations into recovering plutonium from americium extraction salt residues

    Energy Technology Data Exchange (ETDEWEB)

    Fife, K.W.; West, M.H.

    1987-05-01

    Progress into developing a pyrochemical technique for separating and recovering plutonium from spent americium extraction waste salts has concentrated on selective chemical reduction with lanthanum metal and calcium metal and on the solvent extraction of americium with calcium metal. Both techniques are effective for recovering plutonium from the waste salt, although neither appears suitable as a separation technique for recycling a plutonium stream back to mainline purification processes. 17 refs., 13 figs., 2 tabs.

  14. 12 CFR 23.3 - Lease requirements.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Lease requirements. 23.3 Section 23.3 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY LEASING General Provisions § 23.3 Lease... connection with leasing that property, and may engage in activities incidental thereto, if the...

  15. 7 CFR 58.233 - Skim milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Skim milk. 58.233 Section 58.233 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... Materials § 58.233 Skim milk. The skim milk shall be separated from whole milk meeting the requirements...

  16. 15 CFR 23.3 - Plan.

    Science.gov (United States)

    2010-01-01

    ... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Plan. 23.3 Section 23.3 Commerce and... MISSING CHILDREN § 23.3 Plan. (a) The Department of Commerce will supplement and expand the national... biannual meetings of departmental representatives to discuss the current plan and recommendations...

  17. 33 CFR 136.233 - Proof.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Proof. 136.233 Section 136.233 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) MARINE POLLUTION... SOURCE; AND ADVERTISEMENT Procedures for Particular Claims § 136.233 Proof. In addition to...

  18. 7 CFR 23.3 - Coordination.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Coordination. 23.3 Section 23.3 Agriculture Office of the Secretary of Agriculture STATE AND REGIONAL ANNUAL PLANS OF WORK State Program § 23.3 Coordination... designate an official who will be responsible for the overall coordination of the authorized programs...

  19. 22 CFR 23.3 - Refunds.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Refunds. 23.3 Section 23.3 Foreign Relations DEPARTMENT OF STATE FEES AND FUNDS FINANCE AND ACCOUNTING § 23.3 Refunds. (a) Rectifications and readjustments. See § 22.6 of this chapter for outline of circumstances under which fees which have...

  20. 45 CFR 233.39 - Age.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Age. 233.39 Section 233.39 Public Welfare... FINANCIAL ASSISTANCE PROGRAMS § 233.39 Age. (a) Condition for plan approval. A State plan under title I or XVI of the Social Security Act may not impose any age requirement of more than 65 years. (b)...

  1. Electrodeposition of americium and physicochemical behaviour of the solution

    Energy Technology Data Exchange (ETDEWEB)

    Becerril-Vilchis, A. (Inst. Nacional de Investigaciones Nucleares, CMRI-LPR, Mexico City (Mexico)); Meas, Y. (CIDETEQ, Queretaro (Mexico)); Rojas-Hernandez, A. (Univ. Autonoma Metropolitana Iztapalapa, Area de Electroquimica, Mexico City (Mexico))

    1994-01-01

    A new method based on concepts of generalized species and equilibria, was applied to represent the thermodynamic distribution of americium species (including condensed phases) in an electrochemical system. Diagrams of the predominance-zone, Existence-predominance and Pourbaix-type for the americium/support electrolyte/water system were constructed. On the basis of these diagrams, the initial distribution of the species in the electrolyte and the deposition conditions were predicted when a current density was applied to a rotating disc electrode in steady-state. These results were related with the Hansen model for actinide electrodeposition. (orig.)

  2. Supercritical Fluid Extraction of Plutonium and Americium from Soil

    Energy Technology Data Exchange (ETDEWEB)

    Fox, R.V.; Mincher, B.J.

    2002-05-23

    Supercritical fluid extraction (SFE) of plutonium and americium from soil was successfully demonstrated using supercritical fluid carbon dioxide solvent augmented with organophosphorus and beta-diketone complexants. Spiked Idaho soils were chemically and radiologically characterized, then extracted with supercritical fluid carbon dioxide at 2,900 psi and 65 C containing varying concentrations of tributyl phosphate (TBP) and thenoyltrifluoroacetone (TTA). A single 45 minute SFE with 2.7 mol% TBP and 3.2 mol% TTA provided as much as 88% {+-} 6.0 extraction of americium and 69% {+-} 5.0 extraction of plutonium. Use of 5.3 mol% TBP with 6.8 mol% of the more acidic beta-diketone hexafluoroacetylacetone (HFA) provided 95% {+-} 3.0 extraction of americium and 83% {+-} 5.0 extraction of plutonium in a single 45 minute SFE at 3,750 psi and 95 C. Sequential chemical extraction techniques were used to chemically characterize soil partitioning of plutonium and americium in pre-SFE soil samples. Sequential chemical extraction techniques demonstrated that spiked plutonium resides primarily (76.6%) in the sesquioxide fraction with minor amounts being absorbed by the oxidizable fraction (10.6%) and residual fractions (12.8%). Post-SFE soils subjected to sequential chemical extraction characterization demonstrated that 97% of the oxidizable, 78% of the sesquioxide and 80% of the residual plutonium could be removed using SFE. These preliminary results show that SFE may be an effective solvent extraction technique for removal of actinide contaminants from soil.

  3. Thermodynamic systematics of oxides of americium, curium, and neighboring elements

    Energy Technology Data Exchange (ETDEWEB)

    Morss, L.R.

    1984-01-01

    Recently-obtained calorimetric data on the sesquioxides and dioxides of americium and curium are summarized. These data are combined with other properties of the actinide elements to elucidate the stability relationships among these oxides and to predict the behavior of neighboring actinide oxides. 45 references, 4 figures, 5 tables.

  4. Reduction Rates for Higher Americium Oxidation States in Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Grimes, Travis Shane [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mincher, Bruce Jay [Idaho National Lab. (INL), Idaho Falls, ID (United States); Schmitt, Nicholas C [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-30

    The stability of hexavalent americium was measured using multiple americium concentrations and nitric acid concentrations after contact with the strong oxidant sodium bismuthate. Contrary to our hypotheses Am(VI) was not reduced faster at higher americium concentrations, and the reduction was only zero-order at short time scales. Attempts to model the reduction kinetics using zero order kinetic models showed Am(VI) reduction in nitric acid is more complex than the autoreduction processes reported by others in perchloric acid. The classical zero-order reduction of Am(VI) was found here only for short times on the order of a few hours. We did show that the rate of Am(V) production was less than the rate of Am(VI) reduction, indicating that some Am(VI) undergoes two electron-reduction to Am(IV). We also monitored the Am(VI) reduction in contact with the organic diluent dodecane. A direct comparison of these results with those in the absence of the organic diluent showed the reduction rates for Am(VI) were not statistically different for both systems. Additional americium oxidations conducted in the presence of Ce(IV)/Ce(III) ions showed that Am(VI) is reduced without the typical growth of Am(V) observed in the systems sans Ce ion. This was an interesting result which suggests a potential new reduction/oxidation pathway for Am in the presence of Ce; however, these results were very preliminary, and will require additional experiments to understand the mechanism by which this occurs. Overall, these studies have shown that hexavalent americium is fundamentally stable enough in nitric acid to run a separations process. However, the complicated nature of the reduction pathways based on the system components is far from being rigorously understood.

  5. Dicty_cDB: SFK233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available TVTQLQFV VWAKQVSALVVSLEHRYYGASFVTEDLSLENLQWLNSAQALADNAVFRNFVAQQYNVPKE SKWISFGG--- Frame B: fffsf*hykh*kk*tnq...SF (Link to library) SFK233 (Link to dictyBase) - - - Contig-U16602-1 SFK233F (Link to Original site) SF...K233F 565 - - - - - - Show SFK233 Library SF (Link to library) Clone ID SFK233 (Link to...ycdb.biol.tsukuba.ac.jp/CSM/SF/SFK2-B/SFK233Q.Seq.d/ Representative seq. ID SFK23...3F (Link to Original site) Representative DNA sequence >SFK233 (SFK233Q) /CSM/SF/SFK2-B/SFK233Q.Seq.d/ ATTTT

  6. Research program on development of advanced treatment technology for americium-containing aqueous waste in NUCEF

    Energy Technology Data Exchange (ETDEWEB)

    Mineo, Hideaki; Matsumura, Tatsuro; Tsubata, Yasuhiro [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

    1996-10-01

    A research program was prepared on the development of an advanced treatment process for the americium-containing concentrated aqueous waste in NUCEF, than allows americium recovery for the reuse and the reduction of TRU waste generation. A preliminary analysis was conducted on the separation requirements based on the components estimated for the waste. An R and D strategy was proposed from the view to reduce TRU waste generated in the processing that the highest priority is given on the control of TRU leakage such as americium into the effluent stream after americium recovery and the minimization of salt used in the separation over the decontamination of impurities from americium. The extraction chromatographic method was selected as a candidate technology for americium separation under the principle to use reagents that are functional in acidic conditions such as bidentate extractants of DHEDECMP, CMPO or diamides, considering the larger flexibilities in process modification and possible multi-component separation with compact equipment and the past achievements on the recovery of kg quantities of americium. Major R and D items extracted are screening and evaluation of extractants for americium and plutonium, optimization of separation conditions, selection of denitration method, equipment developments and development of solidification methods of discarded americium after reuse and of various kinds of separation residues. In order to cope these items, four steps of R and D program were proposed, i.e., fundamental experiment in beaker-scale on screening and evaluation of extractants, flowsheet study in bench-scale using simulated and small amount of americium aqueous waste solution to evaluate candidate process, americium recovery test in iron-shielded cell to be installed in NUCEF. It is objected to make recovery of 100g orders of americium used for research on fundamental TRU fuel properties. (J.P.N.)

  7. 25 CFR 23.3 - Policy.

    Science.gov (United States)

    2010-04-01

    ... 25 Indians 1 2010-04-01 2010-04-01 false Policy. 23.3 Section 23.3 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR HUMAN SERVICES INDIAN CHILD WELFARE ACT Purpose, Definitions, and... unique values of Indian culture and promote the stability and security of Indian children,...

  8. Supercritical Fluid Extraction of Plutonium and Americium from Soil

    Energy Technology Data Exchange (ETDEWEB)

    Fox, Robert Vincent; Mincher, Bruce Jay

    2002-08-01

    Supercritical fluid extraction (SFE) of plutonium and americium from soil was successfully demonstrated using supercritical fluid carbon dioxide solvent augmented with organophosphorus and beta-diketone complexants. Spiked Idaho soils were chemically and radiologically characterized, then extracted with supercritical fluid carbon dioxide at 2,900 psi and 65°C containing varying concentrations of tributyl phosphate (TBP) and thenoyltrifluoroacetone (TTA). A single 45 minute SFE with 2.7 mol% TBP and 3.2 mol% TTA provided as much as 88% ± 6.0 extraction of americium and 69% ± 5.0 extraction of plutonium. Use of 5.3 mol% TBP with 6.8 mol% of the more acidic beta-diketone hexafluoroacetylacetone (HFA) provided 95% ± 3.0 extraction of americium and 83% ± 5.0 extraction of plutonium in a single 45 minute SFE at 3,750 psi and 95°C. Sequential chemical extraction techniques were used to chemically characterize soil partitioning of plutonium and americium in pre-SFE soil samples. Sequential chemical extraction techniques demonstrated that spiked plutonium resides primarily (76.6%) in the sesquioxide fraction with minor amounts being absorbed by the oxidizable fraction (10.6%) and residual fractions (12.8%). Post-SFE soils subjected to sequential chemical extraction characterization demonstrated that 97% of the oxidizable, 78% of the sesquioxide and 80% of the residual plutonium could be removed using SFE. These preliminary results show that SFE may be an effective solvent extraction technique for removal of actinide contaminants from soil.

  9. Dicty_cDB: SLB233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB233 (Link to dictyBase) slb233 - - Contig-U16290-1 SLB233P ...(Link to Original site) SLB233F 697 SLB233Z 631 SLB233P 1328 - - Show SLB233 Library SL (Link to library) Clone ID SLB...233 (Link to dictyBase) Atlas ID slb233 NBRP ID - dictyBase ID - Link to Contig Contig-U16290-1 Or...iginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB2-B/SLB233Q.Seq.d/ R...epresentative seq. ID SLB233P (Link to Original site) Representative DNA sequence >SLB233 (SLB233Q) /CSM/SL/SLB2-B/SLB

  10. Dicty_cDB: SLC233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLC233 (Link to dictyBase) slc233 - - Contig-U12870-1 SLC233P ...(Link to Original site) SLC233F 733 SLC233Z 707 SLC233P 1440 - - Show SLC233 Library SL (Link to library) Clone ID SLC2...33 (Link to dictyBase) Atlas ID slc233 NBRP ID - dictyBase ID - Link to Contig Contig-U12870-1 Or...iginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLC2-B/SLC233Q.Seq.d/ R...epresentative seq. ID SLC233P (Link to Original site) Representative DNA sequence >SLC233 (SLC233Q) /CSM/SL/SLC2-B/SLC2

  11. Isolation of americium (5) oxalate compounds from solutions

    Energy Technology Data Exchange (ETDEWEB)

    Zubarev, V.G.; Krot, N.N.

    1982-01-01

    Certain conditions of americium (5) isolation with solutions of ammonia and KOH are studied as well as the attitude of hydroxide obtained to heating. Like neptunium (5) hydroxide americium (5) hydroxide probably has the formula AmO/sub 2/OHxxH/sub 2/O, where x is approximately equal to 2.3. It is established that during heating in the air up to 120 deg C hydroxide transforms into AmO/sub 2/. It is shown that in solutions with a high concentration of oxalate-ion americium stability in oxidation state +5 depends greatly on the pH of solution. Complex salts KAmO/sub 2/C/sub 2/O/sub 4/xxH/sub 2/O and CsAmO/sub 2/C/sub 2/O/sub 4/xxH/sub 2/O are synthesized. The identification is made according to the method of preparation and results of analysis of C/sub 2/O/sub 4//sup 2 -/: AmO/sub 2//sup +/ ratio. It is found that the salts are non-isomorphous to similar salts of pentavalent neptunium. CsAmO/sub 2/C/sub 2/O/sub 4/xxH/sub 2/O is identified in cubic crystal system with the lattice constant a=1.25 nm.

  12. Separation of americium and curium from complex chemical and radiochemical mixtures

    Energy Technology Data Exchange (ETDEWEB)

    Bochkarev, V.A.; Martynov, N.P.; Slivin, V.G.; Trikanov, A.E.; Fedyaeva, N.V.

    1988-11-01

    This work describes a method for separation and radiochemical purification of nanogram levels of americium and curium from complex chemical and radiochemical mixtures containing tens of milligrams of elements such as aluminum, iron, magnesium, calcium, barium, titanium, potassium, and others, microgram levels of uranium, neptunium, and plutonium, and fission products. Extraction coefficients of americium and curium from these elements are measured. The separation from the macrocomponents was carried out by extraction of americium and curium with butyric acid in the presence of sulfosalicylic acid. Uranium, neptunium, and plutonium were separated from hydrochloric acid solutions, while the rare earth elements were separated from lithium chloride solutions using a column of anion exchange resin AV-17. Alpha measurements were carried out on americium and curium deposited electrolytically on tantalum cathodes. The chemical yield of americium and curium was identical of greater than or equal to 94%, separation time approx. 8 h.

  13. Uncertainty analysis of doses from ingestion of plutonium and americium.

    Science.gov (United States)

    Puncher, M; Harrison, J D

    2012-02-01

    Uncertainty analyses have been performed on the biokinetic model for americium currently used by the International Commission on Radiological Protection (ICRP), and the model for plutonium recently derived by Leggett, considering acute intakes by ingestion by adult members of the public. The analyses calculated distributions of doses per unit intake. Those parameters having the greatest impact on prospective doses were identified by sensitivity analysis; the most important were the fraction absorbed from the alimentary tract, f(1), and rates of uptake from blood to bone surfaces. Probability distributions were selected based on the observed distribution of plutonium and americium in human subjects where possible; the distributions for f(1) reflected uncertainty on the average value of this parameter for non-specified plutonium and americium compounds ingested by adult members of the public. The calculated distributions of effective doses for ingested (239)Pu and (241)Am were well described by log-normal distributions, with doses varying by around a factor of 3 above and below the central values; the distributions contain the current ICRP Publication 67 dose coefficients for ingestion of (239)Pu and (241)Am by adult members of the public. Uncertainty on f(1) values had the greatest impact on doses, particularly effective dose. It is concluded that: (1) more precise data on f(1) values would have a greater effect in reducing uncertainties on doses from ingested (239)Pu and (241)Am, than reducing uncertainty on other model parameter values and (2) the results support the dose coefficients (Sv Bq(-1) intake) derived by ICRP for ingestion of (239)Pu and (241)Am by adult members of the public.

  14. Kilogram-scale purification of americium by ion exchange

    Energy Technology Data Exchange (ETDEWEB)

    Wheelwright, E. J.

    1979-01-01

    Sequential anion and cation exchange processes have been used for the final purification of /sup 241/Am recovered during the reprocessing of aged plutonium metallurgical scrap. Plutonium was removed by absorption of Dowex 1, X-3.5 (30 to 50 mesh) anion exchange resin from 6.5 to 7.5 M HNO/sub 3/ feed solution. Following a water dilution to 0.75 to 1.0 M HNO/sub 3/, americium was absorbed on Dowex 50W, X-8 (50 to 100 mesh) cation exchange resion. Final purification was accomplished by elution of the absorbed band down 3 to 4 successive beds of the same resin, preloaded with Zn/sup 2 +/, with an NH/sub 4/OH buffered chelating agent. The recovery of mixed /sup 241/Am-/sup 243/Am from power reactor reprocessing waste has been demonstrated. Solvent extraction was used to recover a HNO/sub 3/ solution of mixed lanthanides and actinides from waste generated by the reprocessng of 13.5 tons of Shippingport Power Reactor blanket fuel. Sequential cation exchange band-displacement processes were then used to separate americium and curium from the lanthanides and then to separate approx. 60 g of /sup 244/Cm from 1000 g of mixed /sup 241/Am-/sup 243/Am.

  15. Dicty_cDB: VHI233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHI233 (Link to dictyBase) - - - Contig-U16440-1 VHI233P (Link to Original site) VHI...233F 590 VHI233Z 762 VHI233P 1332 - - Show VHI233 Library VH (Link to library) Clone ID VHI...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHI2-B/VHI233Q.Seq.d/ Representative seq. ID VHI...233P (Link to Original site) Representative DNA sequence >VHI233 (VHI233Q) /CSM/VH/VHI2-B/VHI...i*cyry*tklis***iwy*r**csnfkx *xlqdnedf*kki Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value VHI

  16. Workshop on Preserving High Purity Uranium-233

    Energy Technology Data Exchange (ETDEWEB)

    Krichinsky, Alan M [ORNL; Giaquinto, Joseph [ORNL; Canaan, R Douglas {Doug} [ORNL

    2016-01-01

    A workshop was held on at the MARC X conference to provide a forum for the scientific community to communicate needs for high-purity 233U and its by-products in order to preserve critical items otherwise slated for downblending and disposal. Currently, only a small portion of the U.S. holdings of separated 233U is being preserved. However, many additional kilograms of 233U (>97% pure) still are destined to be downblended which will permanently destroy their potential value for many other applications. It is not likely that this material will ever be replaced due to a lack of operating production capability. Summaries of information conveyed at the workshop and feedback obtained from the scientific community are presented herein.

  17. Nano-cerium vanadate: a novel inorganic ion exchanger for removal of americium and uranium from simulated aqueous nuclear waste.

    Science.gov (United States)

    Banerjee, Chayan; Dudwadkar, Nilesh; Tripathi, Subhash Chandra; Gandhi, Pritam Maniklal; Grover, Vinita; Kaushik, Chetan Prakash; Tyagi, Avesh Kumar

    2014-09-15

    Cerium vanadate nanopowders were synthesized by a facile low temperature co-precipitation method. The product was characterized by X-ray diffraction and transmission electron microscopy and found to consist of ∼25 nm spherical nanoparticles. The efficiency of these nanopowders for uptake of alpha-emitting radionuclides (233)U (4.82 MeV α) and (241)Am (5.49 MeV α, 60 keV γ) has been investigated. Thermodynamically and kinetically favorable uptake of these radionuclides resulted in their complete removal within 3h from aqueous acidic feed solutions. The uptake capacity was observed to increase with increase in pH as the zeta potential value decreased with the increase in pH but effect of ionic strength was insignificant. Little influence of the ions like Sr(2+), Ru(3+), Fe(3+), etc., in the uptake process indicated CeVO4 nanopowders to be amenable for practical applications. The isotherms indicated predominant uptake of the radioactive metal ions in the solid phase of the exchanger at lower feed concentrations and linear Kielland plots with positive slopes indicated favorable exchange of the metal ions with the nanopowder. Performance comparison with the other sorbents reported indicated excellent potential of nano-cerium vanadate for removing americium and uranium from large volumes of aqueous acidic solutions.

  18. Hexavalent Americium Recovery Using Copper(III) Periodate

    Energy Technology Data Exchange (ETDEWEB)

    McCann, Kevin; Brigham, Derek M.; Morrison, Samuel; Braley, Jenifer C.

    2016-11-21

    Separation of americium from the lanthanides is considered one of the most difficult separation steps in closing the nuclear fuel cycle. One approach to this separation could involve oxidizing americium to the hexavalent state to form a linear dioxo cation while the lanthanides remain as trivalent ions. This work considers aqueous soluble Cu3+ periodate as an oxidant under molar nitric acid conditions to separate hexavalent Am with diamyl amylphosphonate (DAAP) in n-dodecane. Initial studies assessed the kinetics of Cu3+ periodate auto-reduction in acidic media to aid in development of the solvent extraction system. Following characterization of the Cu3+ periodate oxidant, solvent extraction studies optimized the recovery of Am from varied nitric acid media and in the presence of other fission product, or fission product surrogate, species. Short aqueous/organic contact times encouraged successful recovery of Am (distribution values as high as 2) from nitric acid media in the absence of redox active fission products. In the presence of a post-PUREX simulant aqueous feed, precipitation of tetravalent species (Ce, Ru, Zr) occurred and the distribution values of 241Am were suppressed, suggesting some oxidizing capacity of the Cu3+ periodate is significantly consumed by other redox active metals in the simulant. The manuscript demonstrates Cu3+ periodate as a potentially viable oxidant for Am oxidation and recovery and notes the consumption of oxidizing capacity observed in the presence of the post-PUREX simulant feed will need to be addressed for any approach seeking to oxidize Am for separations relevant to the nuclear fuel cycle.

  19. Oxidative Alkaline leaching of Americium from simulated high-level nuclear waste sludges

    Energy Technology Data Exchange (ETDEWEB)

    Reed, Wendy A.; Garnov, Alexander Yu.; Rao, Linfeng; Nash, Kenneth L.; Bond, Andrew H.

    2004-01-23

    Oxidative alkaline leaching has been proposed to pre-treat the high-level nuclear waste sludges to remove some of the problematic (e.g., Cr) and/or non-radioactive (e.g., Na, Al) constituents before vitrification. It is critical to understand the behavior of actinides, americium and plutonium in particular, in oxidative alkaline leaching. We have studied the leaching behavior of americium from four different sludge simulants (BiPO{sub 4}, BiPO{sub 4 modified}, Redox, PUREX) using potassium permanganate and potassium persulfate in alkaline solutions. Up to 60% of americium sorbed onto the simulants is leached from the sludges by alkaline persulfate and permanganate. The percentage of americium leached increases with [NaOH] (between 1.0 and 5.0 M). The initial rate of americium leaching by potassium persulfate increases in the order BiPO{sub 4} sludge < Redox sludge < PUREX sludge. The data are most consistent with oxidation of Am{sup 3+} in the sludge to either AmO{sub 2}{sup +} or AmO{sub 2}{sup 2+} in solution. Though neither of these species is expected to exhibit long-term stability in solution, the potential for mobilization of americium from sludge samples would have to be accommodated in the design of any oxidative leaching process for real sludge samples.

  20. The transmutation of americium: the Ecrix experiments in Phenix; Transmutation de l'americium: les experiences ecrix dans Phenix

    Energy Technology Data Exchange (ETDEWEB)

    Garnier, J.C.; Schmidt, N. [CEA Cadarache, Dept. d' Etudes des Combustibles (DEC/SESC), 13 - Saint-Paul-lez-Durance (France); Croixmarie, Y.; Ottaviani, J.P. [CEA Cadarache, Dept. d' Etudes des Combustibles (DEC/SPUA), 13 - Saint-Paul-lez-Durance (France); Varaine, F.; Saint Jean, C. de [CEA Cadarache, Dept. d' Etudes des Reacteurs (DER/SPRC), 13 - Saint-Paul-lez-Durance (France)

    1999-07-01

    The first americium transmutation experiment in a specific target in PHENIX will occur with the ECRIX-B and ECRIX-H experiments. Beside material testing, the objective is also to represent a concept of transmutation whose specificity is to enhance the kinetics of transmutation by using a moderated spectrum. The moderator materials will be {sup 11}B{sub 4}C and CaH{sub 2} for ECRIX-B and ECRIXH respectively, the irradiation conditions have been predicted for both the neutronics and thermal. The targets (MgO-AmO{sub X} pellets) are manufactured in the ATALANTE laboratory and the design is performed according to the PHENIX operating conditions. (authors)

  1. Dicty_cDB: CHR233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR233 (Link to dictyBase) - - - Contig-U16471-1 - (Link to Original site) - - CHR...233Z 789 - - - - Show CHR233 Library CH (Link to library) Clone ID CHR233 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHR2-B/CHR233Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHR233 (CHR233Q) /CSM/CH/CHR2-B/CHR233Q.Seq.d/ XXXXXXXXXXTATATGA...DNA Score E Sequences producing significant alignments: (bits) Value SHB457 (SHB457Q) /CSM/SH/SHB4-C/SHB457Q.Seq.d/ 747 0.0 CHR

  2. 45 CFR 233.52 - Overpayment to aliens.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Overpayment to aliens. 233.52 Section 233.52... ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.52 Overpayment to aliens. A State Plan under title IV-A of the Social Security Act, shall provide that: (a) Any sponsor of an alien and the alien shall...

  3. 27 CFR 24.233 - Addition of spirits to wine.

    Science.gov (United States)

    2010-04-01

    ... wine. 24.233 Section 24.233 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.233 Addition of spirits to wine. (a) Prior to the addition of spirits. Wine will be placed in tanks approved for the addition of spirits....

  4. Effect of americium-241 on luminous bacteria. Role of peroxides

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)

    2011-04-15

    The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.

  5. Particulate distribution of plutonium and americium in surface waters from the Spanish Mediterranean coast

    Energy Technology Data Exchange (ETDEWEB)

    Molero, J.; Sanchez-Cabeza, J.A.; Merino, J.; Vidal-Quadras, A. [Universidad Autonoma de Barcelona (Spain); Vives Batlle, J.; Mitchell, P.I. [University Coll., Dublin (Ireland)

    1995-12-31

    Measurements of the particulate distribution of plutonium and americium in Spanish Mediterranean coastal waters have been carried out. Plutonium-239,340 and {sup 241}Am concentrations have been measured in suspended particulate matter by filtering (< 0.22 {mu}m) large volume (200-300 litres) sea water samples. Results indicate that particulate plutonium constitutes on average 11 {+-} 4% of the total concentration in sea water. In the case of americium this percentage rises to 45 {+-} 14%. From the {sup 241}Am/{sup 239,240}Pu activity ratios it is clear that suspended particulate matter is enriched in {sup 241}Am relative to {sup 239,240}Pu by a factor 8 {+-} 4. Plutonium and americium in surface Mediterranean coastal waters appear to be fractionated as they present a different transfer rate to the particles. Our measurements allowed us to estimate sediment-water distribution coefficients (K{sub d}), which are a key parameter to interpret differences between the behaviour of plutonium and americium in sea water. Distribution coefficients K{sub d} have been estimated to be (1.4 {+-} 0.5) x 10{sup 5} litres kg{sup -1} for plutonium and (0.9 {+-} 0.5) x 10{sup 6} litres kg{sup -1} for americium in surface Mediterranean coastal waters. (author).

  6. Nano-cerium vanadate: A novel inorganic ion exchanger for removal of americium and uranium from simulated aqueous nuclear waste

    Energy Technology Data Exchange (ETDEWEB)

    Banerjee, Chayan; Dudwadkar, Nilesh [Fuel Reprocessing Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Tripathi, Subhash Chandra, E-mail: sctri001@gmail.com [Fuel Reprocessing Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Gandhi, Pritam Maniklal [Fuel Reprocessing Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Grover, Vinita [Waste Management Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Kaushik, Chetan Prakash [Chemistry Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); Tyagi, Avesh Kumar, E-mail: aktyagi@barc.gov.in [Waste Management Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

    2014-09-15

    Highlights: • Template free, low temperature synthesis of CeVO{sub 4} nanopowders. • Thermodynamically and kinetically favourable uptake of Am(III) and U(VI) exhibited. • K{sub d} and ΔG° values for Am(III) and U(VI) uptake in pH 1–6 are reported. • Interdiffusion coefficients and zeta potential values in pH 1–6 are reported. • Possible application in low level aqueous nuclear waste remediation. - Abstract: Cerium vanadate nanopowders were synthesized by a facile low temperature co-precipitation method. The product was characterized by X-ray diffraction and transmission electron microscopy and found to consist of ∼25 nm spherical nanoparticles. The efficiency of these nanopowders for uptake of alpha-emitting radionuclides {sup 233}U (4.82 MeV α) and {sup 241}Am (5.49 MeV α, 60 keV γ) has been investigated. Thermodynamically and kinetically favorable uptake of these radionuclides resulted in their complete removal within 3 h from aqueous acidic feed solutions. The uptake capacity was observed to increase with increase in pH as the zeta potential value decreased with the increase in pH but effect of ionic strength was insignificant. Little influence of the ions like Sr{sup 2+}, Ru{sup 3+}, Fe{sup 3+}, etc., in the uptake process indicated CeVO{sub 4} nanopowders to be amenable for practical applications. The isotherms indicated predominant uptake of the radioactive metal ions in the solid phase of the exchanger at lower feed concentrations and linear Kielland plots with positive slopes indicated favorable exchange of the metal ions with the nanopowder. Performance comparison with the other sorbents reported indicated excellent potential of nano-cerium vanadate for removing americium and uranium from large volumes of aqueous acidic solutions.

  7. Isotopic and elemental composition of plutonium/americium oxides influence pulmonary and extra-pulmonary distribution after inhalation in rats.

    Science.gov (United States)

    Van der Meeren, A; Grémy, O

    2010-09-01

    The biodistribution of plutonium and americium has been studied in a rat model after inhalation of two PuO(2) powders in lungs and extra-pulmonary organs from 3 d to 3 mo. The main difference between the two powders was the content of americium (approximately 46% and 4.5% of total alpha activity). The PuO(2) with a higher proportion of americium shows an accelerated transfer of activity from lungs to blood as compared to PuO(2) with the lower americium content, illustrated by increased urinary excretion and higher bone and liver actinide retention. The total alpha activity measured reflects mostly the americium biological behavior. The activity contained in epithelial lining fluid, recovered in the acellular phase of broncho-alveolar lavages, mainly contains americium, whereas plutonium remains trapped in macrophages. Epithelial lining fluid could represent a transitional pulmonary compartment prior to translocation of actinides to the blood and subsequent deposition in extra-pulmonary retention organs. In addition, differential behaviors of plutonium and americium are also observed between the PuO(2) powders with a higher dissolution rate for both plutonium and americium being obtained for the PuO(2) with the highest americium content. Our results indicate that the biological behavior of plutonium and americium after translocation into blood differ two-fold: (1) for the two actinides for the same PuO(2) aerosol, and (2) for the same actinide from the two different aerosols. These results highlight the importance of considering the specific behavior of each contaminant after accidental pulmonary intake when assessing extra-pulmonary deposits from the level of activity excreted in urine or for therapeutic strategy decisions.

  8. Feasibility studies for assessing internal exposure to {sup 233}U

    Energy Technology Data Exchange (ETDEWEB)

    Mehta, D.J.; Sharma, R.C.; Ramanujam, A.; Haridasan, T.K.; Sawant, P.D.; Rathinam, M

    2003-07-01

    The potential internal occupational exposure encountered as a consequence of the {sup 232}Th-{sup 233}U fuel cycle are likely to arise predominantly from the inhalation of {sup 232}Th, {sup 233}U and ({sup 232}Th + {sup 233}U) compounds of absorption Types M and S. In the past, although direct and indirect methods for assessments of internal exposure to {sup 232}Th and its daughters were developed, standardised and employed, no such attempts have been made with regard to {sup 233}U and {sup 233}U+{sup 232}Th. Therefore, feasibility studies for assessing internal exposures to {sup 233}U have been conducted using three methods: urine bioassay, in vivo counting and measurement of thoron gas in the exhaled breath of a worker. This paper describes details of these studies and discusses the results obtained. (author)

  9. National low-level waste management program radionuclide report series, Volume 14: Americium-241

    Energy Technology Data Exchange (ETDEWEB)

    Winberg, M.R.; Garcia, R.S.

    1995-09-01

    This report, Volume 14 of the National Low-Level Waste Management Program Radionuclide Report Series, discusses the radiological and chemical characteristics of americium-241 ({sup 241}Am). This report also includes discussions about waste types and forms in which {sup 241}Am can be found and {sup 241}Am behavior in the environment and in the human body.

  10. Understanding the Chemistry of Uncommon Americium Oxidation States for Application to Actinide/Lanthanide Separations

    Energy Technology Data Exchange (ETDEWEB)

    Leigh Martin; Bruce J. Mincher; Nicholas C. Schmitt

    2007-09-01

    A spectroscopic study of the stability of Am(V) and Am(VI) produced by oxidizing Am(III) with sodium bismuthate is presented, varying the initial americium concentration, temperature and length of the oxidation was seen to have profound effects on the resultant solutions.

  11. Extraction of 229Th From 233U Solution

    Institute of Scientific and Technical Information of China (English)

    XIAO; Guo-ping; ZHAO; Li-fei

    2013-01-01

    A two-step separation procedure for preparation of 229Th tracer from 233U was developed using CL-TBP and TEVA extraction chromatography.The decontamination factor of uranium from thorium is larger than 4.6×106.After separation,the content of 233U in uranium fraction was measured by ID-ICP-MS,

  12. 45 CFR 233.51 - Eligibility of sponsored aliens.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Eligibility of sponsored aliens. 233.51 Section... CONDITIONS OF ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.51 Eligibility of sponsored aliens... affidavit(s) of support or similar agreement on behalf of an alien (who is not the child of the sponsor...

  13. 48 CFR 1852.233-70 - Protests to NASA.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Protests to NASA. 1852.233... 1852.233-70 Protests to NASA. As prescribed in 1833.106-70, insert the following provision: Protests to NASA (OCT 2002) Potential bidders or offerors may submit a protest under 48 CFR part 33 (FAR part...

  14. 40 CFR 86.233-94-86.234-94 - [Reserved

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 18 2010-07-01 2010-07-01 false 86.233-94-86.234-94 Section 86.233-94-86.234-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS... 1994 and Later Model Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New...

  15. 29 CFR 1952.233 - Compliance staffing benchmarks.

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 9 2010-07-01 2010-07-01 false Compliance staffing benchmarks. 1952.233 Section 1952.233... Compliance staffing benchmarks. Under the terms of the 1978 Court Order in AFL-CIO v. Marshall compliance staffing levels (benchmarks) necessary for a “fully effective” enforcement program were required to...

  16. SKIN DOSIMETRY IN CONDITIONS OF ITS CONSTANT SURFACE CONTAMINATION WITH SOLUTIONS OF PLUTONIUM-239 AND AMERICIUM-241

    Directory of Open Access Journals (Sweden)

    E. B. Ershov

    2012-01-01

    Full Text Available The article considers, on the basis of experimental data, the issue of assessing dose burdens to the skin basal layer in conditions of its permanent contamination with solutions of plutonium-239 and americium-241 and subsequent decontamination.

  17. Influence of biofilms on migration of uranium, americium and europium in the environment; Einfluss von Biofilmen auf das Migrationsverhalten von Uran, Americium und Europium in der Umwelt

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-07-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  18. Standard test method for quantitative determination of americium 241 in plutonium by Gamma-Ray spectrometry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    1994-01-01

    1.1 This test method covers the quantitative determination of americium 241 by gamma-ray spectrometry in plutonium nitrate solution samples that do not contain significant amounts of radioactive fission products or other high specific activity gamma-ray emitters. 1.2 This test method can be used to determine the americium 241 in samples of plutonium metal, oxide and other solid forms, when the solid is appropriately sampled and dissolved. 1.3 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  19. Calcium and zinc DTPA administration for internal contamination with plutonium-238 and americium-241.

    Science.gov (United States)

    Kazzi, Ziad N; Heyl, Alexander; Ruprecht, Johann

    2012-08-01

    The accidental or intentional release of plutonium or americium can cause acute and long term adverse health effects if they enter the human body by ingestion, inhalation, or injection. These effects can be prevented by rapid removal of these radionuclides by chelators such as calcium or zinc diethylenetriaminepentaacetate (calcium or zinc DTPA). These compounds have been shown to be efficacious in enhancing the elimination of members of the actinide family particularly plutonium and americium when administered intravenously or by nebulizer. The efficacy and adverse effects profile depend on several factors that include the route of internalization of the actinide, the type, and route time of administration of the chelator, and whether the calcium or zinc salt of DTPA is used. Current and future research efforts should be directed at overcoming limitations associated with the use of these complex drugs by using innovative methods that can enhance their structural and therapeutic properties.

  20. Final Radiological Assessment of External Exposure for CLEAR-Line Americium Recovery Operations

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Adam C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Belooussova, Olga N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hetrick, Lucas Duane [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-11-12

    Los Alamos National Laboratory is currently planning to implement an americium recovery program. The americium, ordinarily isotopically pure 241Am, would be extracted from existing Pu materials, converted to an oxide and shipped to support fabrication of americium oxide-beryllium neutron sources. These operations would occur in the currently proposed Chloride Extraction and Actinide Recovery (CLEAR) line of glove boxes. This glove box line would be collocated with the currently-operational Experimental Chloride Extraction Line (EXCEL). The focus of this document is to provide an in-depth assessment of the currently planned radiation protection measures and to determine whether or not further design work is required to satisfy design-goal and ALARA requirements. Further, this document presents a history of americium recovery operations in the Department of Energy and high-level descriptions of the CLEAR line operations to provide a basis of comparison. Under the working assumptions adopted by this study, it was found that the evaluated design appears to mitigate doses to a level that satisfies the ALARA-in-design requirements of 10 CFR 835 as implemented by the Los Alamos National Laboratory procedure P121. The analyses indicate that extremity doses would also meet design requirements. Dose-rate calculations were performed using the radiation transport code MCNP5 and doses were estimated using a time-motion study developed in consort with the subject matter expert. A copy of this report and all supporting documentation are located on the Radiological Engineering server at Y:\\Rad Engineering\\2013 PROJECTS\\TA-55 Clear Line.

  1. On the Convergence of the Electronic Structure Properties of the FCC Americium (001) Surface

    OpenAIRE

    Gao, Da; Ray, Asok K.

    2006-01-01

    Electronic and magnetic properties of the fcc Americium (001) surface have been investigated via full-potential all-electron density-functional electronic structure calculations at both scalar and fully relativistic levels. Effects of various theoretical approximations on the fcc Am (001) surface properties have been thoroughly examined. The ground state of fcc Am (001) surface is found to be anti-ferromagnetic with spin-orbit coupling included (AFM-SO). At the ground state, the magnetic mome...

  2. Repository criticality control for {sup 233}U using depleted uranium

    Energy Technology Data Exchange (ETDEWEB)

    Forsberg, C.W.; Elam, K.R.; Hopper, C.M.

    1999-07-01

    The US is evaluating methods for the disposition of excess weapons-usable {sup 233}U, including disposal in a repository. Isotopic dilution studies were undertaken to determine how much depleted uranium (DU) would need to be added to the {sup 233}U to minimize the potential for nuclear criticality in a repository. Numerical evaluations were conducted to determine the nuclear equivalence of different {sup 235}U enrichments to {sup 233}U isotopically diluted with DU containing 0.2 wt% {sup 235}U. A homogeneous system of silicon dioxide, water, {sup 233}U, and DU, in which the ratio of each component was varied, was used to determine the conditions of maximum nuclear reactivity. In terms of preventing nuclear criticality in a repository, there are three important limits from these calculations. 1. Criticality safe in any nonnuclear system: The required isotopic dilution to ensure criticality under all conditions, except in the presence of man-made nuclear materials (beryllium, etc.), is {approximately}1.0% {sup 235}U in {sup 238}U. The equivalent {sup 233}U enrichment level is 0.53 wt% {sup 233}U in DU. 2. Critically safe in natural systems: The lowest {sup 235}U enrichment found in a natural reactor at shutdown was {approximately}1.3%. French studies, based on the characteristics of natural uranium ore bodies, indicate that a minimum enrichment of {approximately}1.28% {sup 235}U is required for criticality. These data suggest that nuclear criticality from migrating uranium is not realistic unless the {sup 235}U enrichments exceed {approximately}1.3%, which is a result that is equivalent to 0.72% {sup 233}U in DU. 3. Criticality safety equivalent to light water reactor (LWR) spent nuclear fuel (SNF): The {sup 233}U can be diluted with DU so that the uranium criticality characteristics match SNF uranium. Whatever repository criticality controls are used for SNF can then be used for {sup 233}U. The average LWR SNF assay (after decay of plutonium isotopes to uranium

  3. MARIOS: Irradiation of UO{sub 2} containing 15% americium at well defined temperature

    Energy Technology Data Exchange (ETDEWEB)

    D' Agata, E., E-mail: elio.dagata@ec.europa.eu [European Commission, Joint Research Centre, Institute for Energy - P.O. Box 2, 1755 ZG Petten (Netherlands); Hania, P.R. [Nuclear Research and Consultancy Group, P.O. Box 25, 1755 ZG Petten (Netherlands); Bejaoui, S. [Commissariat a l' Energie Atomique, DEC CEA-Cadarache, 13108 St. Paul lez Durance Cedex (France); Sciolla, C.; Wyatt, T.; Hannink, M.H.C. [Nuclear Research and Consultancy Group, P.O. Box 25, 1755 ZG Petten (Netherlands); Herlet, N.; Jankowiak, A. [Commissariat a l' Energie Atomique DTEC CEA Marcoule, 30207 Bagnols sur Ceze Cedex (France); Klaassen, F.C. [Nuclear Research and Consultancy Group, P.O. Box 25, 1755 ZG Petten (Netherlands); Bonnerot, J.-M. [Commissariat a l' Energie Atomique, DEC CEA-Cadarache, 13108 St. Paul lez Durance Cedex (France)

    2012-01-15

    Highlights: Black-Right-Pointing-Pointer MARIOS is designed to check the behaviour of Minor Actinide Blanket Module concept. Black-Right-Pointing-Pointer Main requirement of the experiment is an accurate control of the temperature. Black-Right-Pointing-Pointer The swelling and the helium release will be the main output of the experiment. Black-Right-Pointing-Pointer A complementary experiment (DIAMINO), will be performed in the next future. - Abstract: Americium is a strong contributor to the long term radiotoxicity of high activity nuclear waste. Transmutation by irradiation in nuclear reactors of long-lived nuclides like {sup 241}Am is, therefore, an option for the reduction of radiotoxicity and residual power packages as well as the repository area. The MARIOS irradiation experiment is the latest of a series of experiments on americium transmutation (e.g. EFTTRA-T4, EFTTRA-T4bis, HELIOS). MARIOS experiment is carried out in the framework of the 4-year project FAIRFUELS of the EURATOM 7th Framework Programme (FP7). During the past years of experimental work in the field of transmutation and tests of innovative nuclear fuel containing americium, the release or trapping of helium as well as swelling has shown to be the key issue for the design of such kinds of target. Therefore, the main objective of the MARIOS experiment is to study the in-pile behaviour of UO{sub 2} containing minor actinides (MAs) in order to gain knowledge on the role of the microstructure and of the temperature on the gas release and on fuel swelling. The MARIOS experiment will be conducted in the HFR (high flux reactor) in Petten (The Netherlands) and will start in the beginning of 2011. It has been planned that the experiment will last 11 cycles, corresponding to 11 months. This paper covers the description of the objective of the experiment, as well as a general description of the design of the experiment.

  4. Speciation of americium in seawater and accumulation in the marine sponge Aplysina cavernicola.

    Science.gov (United States)

    Maloubier, Melody; Michel, Hervé; Solari, Pier Lorenzo; Moisy, Philippe; Tribalat, Marie-Aude; Oberhaensli, François R; Dechraoui Bottein, Marie Yasmine; Thomas, Olivier P; Monfort, Marguerite; Moulin, Christophe; Den Auwer, Christophe

    2015-12-21

    The fate of radionuclides in the environment is a cause of great concern for modern society, seen especially in 2011 after the Fukushima accident. Among the environmental compartments, seawater covers most of the earth's surface and may be directly or indirectly impacted. The interaction between radionuclides and the marine compartment is therefore essential for better understanding the transfer mechanisms from the hydrosphere to the biosphere. This information allows for the evaluation of the impact on humans via our interaction with the biotope that has been largely undocumented up to now. In this report, we attempt to make a link between the speciation of heavy elements in natural seawater and their uptake by a model marine organism. More specifically, because the interaction of actinides with marine invertebrates has been poorly studied, the accumulation in a representative member of the Mediterranean coralligenous habitat, the sponge Aplysina cavernicola, was investigated and its uptake curve exposed to a radiotracer (241)Am was estimated using a high-purity Ge gamma spectrometer. But in order to go beyond the phenomenological accumulation rate, the speciation of americium(III) in seawater must be assessed. The speciation of (241)Am (and natural europium as its chemically stable surrogate) in seawater was determined using a combination of different techniques: Time-Resolved Laser-Induced Fluorescence (TRLIF), Extended X-ray Absorption Fine Structure (EXAFS) at the LIII edge, Attenuated Total Reflectance Fourier Transform Infrared (ATR-FTIR) spectroscopy and Scanning Electron Microscopy (SEM) and the resulting data were compared with the speciation modeling. In seawater, the americium(III) complex (as well as the corresponding europium complex, although with conformational differences) was identified as a ternary sodium biscarbonato complex, whose formula can be tentatively written as NaAm(CO3)2·nH2O. It is therefore this chemical form of americium that is

  5. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning;

    1986-01-01

    collected from the Irish coast in 1983. Fallout is found to dominate as a source of 239+240Pu north of latitude 65°N, while for 238Pu a substantial fraction originates from European nuclear fuel reprocessing facilities. The 238Pu/239+240Pu isotope ratio provides clear evidence of the transport of effluent...... of the Irish Sea) to Spitsbergen. 241Am found in Arctic waters probably originates from the decay of fallout 241Pu and, like Pu, tentatively has a residence time of the order of several years. Americium from Sellafield has an estimated mean residence time of 4–6 months in Scottish waters....

  6. 27 CFR 46.233 - Payment of floor stocks tax.

    Science.gov (United States)

    2010-04-01

    ... PRODUCTS AND CIGARETTE PAPERS AND TUBES Floor Stocks Tax on Certain Tobacco Products, Cigarette Papers, and Cigarette Tubes Held for Sale on April 1, 2009 Filing Requirements § 46.233 Payment of floor stocks tax. (a) Electronic funds transfer. If the dealer pays any other excise taxes collected by TTB by electronic...

  7. 45 CFR 233.101 - Dependent children of unemployed parents.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Dependent children of unemployed parents. 233.101... children of unemployed parents. A State plan under title IV-A for payment of such aid must: (1) Include a... any child, whichever parent, in a home in which both parents of such child are living, earned...

  8. 45 CFR 233.100 - Dependent children of unemployed parents.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Dependent children of unemployed parents. 233.100... unemployed parents. (a) Requirements for State Plans. If a State wishes to provide AFDC for children of... which shall include any child of an unemployed parent (as defined by the State pursuant to paragraph...

  9. 48 CFR 1352.233-70 - Agency protests.

    Science.gov (United States)

    2010-10-01

    ... upon the Contract Law Division of the Office of the General Counsel within one day of filing a protest..., Chief, Contract Law Division, Room 5893, Herbert C. Hoover Building, 14th Street and Constitution Avenue... FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 1352.233-70...

  10. 40 CFR 233.40 - Requirements for compliance evaluation programs.

    Science.gov (United States)

    2010-07-01

    ... DUMPING 404 STATE PROGRAM REGULATIONS Compliance Evaluation and Enforcement § 233.40 Requirements for compliance evaluation programs. (a) In order to abate violations of the permit program, the State shall... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Requirements for compliance...

  11. AP233: An Information Model for Systems Engineering

    Science.gov (United States)

    Siebes, Georg

    2009-01-01

    In today's world, information is abundant. We have no problems generating it. But we are challenged to find, organize, and exchange information. center dot A standardized model of information can help. Such a model nearly completed its development for Systems Engineering. It is referred to as AP233 (AP = Application Protocol).

  12. Experimental determination of the {sup 233}U half-life

    Energy Technology Data Exchange (ETDEWEB)

    Pomme, S.; Altzitzoglou, T.; Van Ammel, R.; Sibbens, G.; Eykens, R.; Richter, S.; Camps, J. [European Commission, Joint Research Centre, Institute for Reference Materials and Measurements, Geel (Belgium); Kossert, K.; Janben, H. [Physikalisch-Technische Bundesanstalt (PTB), Braunschweig (Germany); Garcia-Torano, E.; Duran, T. [CIEMAT, Lab. de Metrologia de Radiaciones Ionizantes, Madrid (Spain); Jaubert, F. [CEA Saclay, LNE-LNHB, Lab. National Henri Becquerel 91 - Gif-sur-Yvette (France)

    2009-10-15

    The half-life of {sup 233}U was determined by a specific activity method, in the frame of an international collaboration project of four metrology institutes. A purified, highly enriched {sup 233}U solution was prepared with certified concentration of uranium isotopes. The isotopic composition of the uranium material was determined by thermal ionization mass spectrometry. The ingrowth of daughter nuclides was calculated and confirmed by {alpha}-particle and {gamma}-ray spectrometry measurements. Quantitative sources were prepared from aliquots of the {sup 233}U solution and their disintegration rate was determined by means of {alpha}-particle counting at a defined small solid angle, liquid-scintillation counting and 4{pi} counting in a pressurized proportional counter and in a CsI(Tl) sandwich spectrometer. A half-life value of 1.5867(14) * 10{sup 5} a was obtained, in which the relative standard uncertainty amounts to 0.09%. The result is lower than the currently recommended value of 1.592(2) * 10{sup 5} a and a new best estimate of T(1/2)({sup 233}U) = 1.5903(13) * 10{sup 5} a was calculated from a partially weighted mean of a set of published data. (authors)

  13. Penetration and decontamination of americium-241 ex vivo using fresh and frozen pig skin.

    Science.gov (United States)

    Tazrart, A; Bolzinger, M A; Moureau, A; Molina, T; Coudert, S; Angulo, J F; Briancon, S; Griffiths, N M

    2017-04-01

    Skin contamination is one of the most probable risks following major nuclear or radiological incidents. However, accidents involving skin contamination with radionuclides may occur in the nuclear industry, in research laboratories and in nuclear medicine departments. This work aims to measure the penetration of the radiological contaminant Americium ((241)Am) in fresh and frozen skin and to evaluate the distribution of the contamination in the skin. Decontamination tests were performed using water, Fuller's earth and diethylene triamine pentaacetic acid (DTPA), which is the recommended treatment in case of skin contamination with actinides such as plutonium or americium. To assess these parameters, we used the Franz cell diffusion system with full-thickness skin obtained from pigs' ears, representative of human skin. Solutions of (241)Am were deposited on the skin samples. The radioactivity content in each compartment and skin layers was measured after 24 h by liquid scintillation counting and alpha spectrophotometry. The Am cutaneous penetration to the receiver compartment is almost negligible in fresh and frozen skin. Multiple washings with water and DTPA recovered about 90% of the initial activity. The rest remains fixed mainly in the stratum corneum. Traces of activity were detected within the epidermis and dermis which is fixed and not accessible to the decontamination.

  14. Thermal Stabilization of {sup 233}UO{sub 2}, {sup 233}UO{sub 3}, and {sup 233}U{sub 3}O{sub 8}

    Energy Technology Data Exchange (ETDEWEB)

    Thein, S.M.

    2000-07-26

    This report identifies an appropriate thermal stabilization temperature for {sup 233}U oxides. The temperature is chosen principally on the basis of eliminating moisture and other residual volatiles. This report supports the U. S. Department of Energy (DOE) Standard for safe storage of {sup 233}U (DOE 2000), written as part of the response to Recommendation 97-1 of the Defense Nuclear Facilities Safety Board (DNFSB), addressing safe storage of {sup 233}U. The primary goals in choosing a stabilization temperature are (1) to ensure that the residual volatiles content is less than 0.5 wt % including moisture, which might produce pressurizing gases via radiolysis during long-term sealed storage; (2) to minimize potential for water readsorption above the 0.5 wt % threshold; and (3) to eliminate reactive uranium species. The secondary goals are (1) to reduce potential future chemical reactivity and (2) to increase the particle size thereby reducing the potential airborne release fraction (ARF) under postulated accident scenarios. The prevalent species of uranium oxide are the chemical forms UO{sub 2}, UO{sub 3}, and U{sub 3}O{sub 8}. Conversion to U{sub 3}O{sub 8} is sufficient to accomplish all of the desired goals. The preferred storage form is U{sub 3}O{sub 8} because it is more stable than UO{sub 2} or UO{sub 3} in oxidizing atmospheres. Heating in an oxidizing atmosphere at 750 C for at least one hour will achieve the thermal stabilization desired.

  15. 40 CFR 23.3 - Timing of Administrator's action under Clean Air Act.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Timing of Administrator's action under Clean Air Act. 23.3 Section 23.3 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY GENERAL JUDICIAL REVIEW UNDER EPA-ADMINISTERED STATUTES § 23.3 Timing of Administrator's action under Clean Air...

  16. Updated and revised neutron reaction data for 233U

    Institute of Scientific and Technical Information of China (English)

    YU Bao-Sheng; CHEN Guo-Chang; ZHANG Hua; CAO Wen-Tian; TANG Guo-You; TAO Xi

    2013-01-01

    A complete set of n+233U neutron reaction data from 10-5 eV-20 MeV is updated and revised based on the evaluated experimental data and the feedback information of various benchmark tests.The main revised quantities are nubars,cross sections as well as angular distributions,etc.The benchmark tests indicate that the present evaluated data achieve very promising results.

  17. Energy Partition in n+233U Fission Reaction

    Institute of Scientific and Technical Information of China (English)

    CHEN; Yong-jing; LIU; Ting-jin; SHU; Neng-chuan

    2012-01-01

    <正>The partition of the total excitation energy between the fission fragments for the n+233U fission reactions are analyzed with a semi-empirical model, and it is a key point for calculating the prompt fission neutron spectrum, and it is still a long-standing problem for nuclear fission, and attracts more and more attention. With the available experimental data, such as the average total number of emitted neutrons, the

  18. Magnesium ionophore II as an extraction agent for trivalent europium and americium

    Energy Technology Data Exchange (ETDEWEB)

    Makrlik, Emanuel [Czech Univ. of Life Sciences, Prague (Czech Republic). Faculty of Environmental Sciences; Vanura, Petr [Univ. of Chemistry and Technology, Prague (Czech Republic). Dept. of Analytical Chemistry

    2016-11-01

    Solvent extraction of microamounts of trivalent europium and americium into nitrobenzene by using a mixture of hydrogen dicarbollylcobaltate (H{sup +}B{sup -}) and magnesium ionophore II (L) was studied. The equilibrium data were explained assuming that the species HL{sup +}, HL{sup +}{sub 2}, ML{sup 3+}{sub 2}, and ML{sup 3+}{sub 3} (M{sup 3+} = Eu{sup 3+}, Am{sup 3+}; L=magnesium, ionophore II) are extracted into the nitrobenzene phase. Extraction and stability constants of the cationic complex species in nitrobenzene saturated with water were determined and discussed. From the experimental results it is evident that this effective magnesium ionophore II receptor for the Eu{sup 3+} and Am{sup 3+} cations could be considered as a potential extraction agent for nuclear waste treatment.

  19. Imitators of plutonium and americium in a mixed uranium- plutonium nitride fuel

    Science.gov (United States)

    Nikitin, S. N.; Shornikov, D. P.; Tarasov, B. A.; Baranov, V. G.; Burlakova, M. A.

    2016-04-01

    Uranium nitride and mix uranium nitride (U-Pu)N is most popular nuclear fuel for Russian Fast Breeder Reactor. The works in hot cells associated with the radiation exposure of personnel and methodological difficulties. To know the main physical-chemical properties of uranium-plutonium nitride it necessary research to hot cells. In this paper, based on an assessment of physicochemical and thermodynamic properties of selected simulators Pu and Am. Analogues of Pu is are Ce and Y, and analogues Am - Dy. The technique of obtaining a model nitride fuel based on lanthanides nitrides and UN. Hydrogenation-dehydrogenation- nitration method of derived powders nitrides uranium, cerium, yttrium and dysprosium, held their mixing, pressing and sintering, the samples obtained model nitride fuel with plutonium and americium imitation. According to the results of structural studies have shown that all the samples are solid solution nitrides rare earth (REE) elements in UN.

  20. The Role of Colloids in the Transport of Plutonium and Americium: Implications for

    Energy Technology Data Exchange (ETDEWEB)

    Kersting, A B

    2003-09-17

    Colloids are small particulates (ranging in size from 1 to 0.001 micron) composed of inorganic and organic material and found in all natural water. Due to their small size, they have the ability to remain suspended in water and transported. Small amounts of plutonium (Pu) and americium (Am) can adsorb (attach) to colloids, and/or form colloidal-sized polymers and migrate in water. At Rocky Flats Environmental Technology Site (RFETS) sedimentation and resuspension of particulates and colloids in surface waters represent the dominant process for Pu and Am migration. The amount of Pu and Am that can be transported at RFETS has been quantified in the Pathway Analysis Report. The Pathway Analysis Report shows that the two dominant pathways for Pu and Am transport at RFETS are air and surface water. Shallow groundwater and biological pathways are minor.

  1. Standard practice for The separation of americium from plutonium by ion exchange

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2001-01-01

    1.1 This practice describes the use of an ion exchange technique to separate plutonium from solutions containing low concentrations of americium prior to measurement of the 241Am by gamma counting. 1.2 This practice covers the removal of plutonium, but not all the other radioactive isotopes that may interfere in the determination of 241Am. 1.3 This practice can be used when 241Am is to be determined in samples in which the plutonium is in the form of metal, oxide, or other solid provided that the solid is appropriately sampled and dissolved (See Test Methods C758, C759, and C1168). 1.4 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  2. Determination of {sup 233}U by inductively coupled argon plasma - atomic emission spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Patwardhan, A.B.; Kulkarni, V.T.; Radhakrishnan, K.; Ramanujam, A.; Page, A.G. [Bhabha Atomic Research Centre, Bombay (India)

    1994-09-01

    The paper describes studies carried out for the determination of {sup 233}U at various stages during the recovery and purification of {sup 233}U from {sup 233}U-Al alloy scraps generated during the fabrication of {sup 233}U-Al alloy fuel. Employing a high resolution sequential spectrometer and Inductively Coupled argon Plasma (ICP) as the spectral excitation source, isotope shift for {sup 233}U with respect to {sup 238}U has been resolved and recorded. The shift for the 424.437 nm emission line of {sup 238}U is found to be of the order of 0.040 nm on the lower wavelength side for {sup 233}U and this isotopic effect has been utilised for the quantitative determination of {sup 233}U. The overall precision of the method is 5% RSD with the detection limit of 0.01 {mu}g/ml.

  3. Th/U-233 multi-recycle in PWRs.

    Energy Technology Data Exchange (ETDEWEB)

    Yun, D.; Kim, T. K.; Taiwo, T. A.; Nuclear Engineering Division

    2010-09-07

    The use of thorium in current or advanced light water reactors (LWRs) has been of interest in recent years. These interests have been associated with the need to increase nuclear fuel resources and the perceived non-proliferation advantages of the utilization of thorium in the fuel cycle. Various options have been considered for the use of thorium in the LWR fuel cycle including: (1) its use in a once-through fuel cycle to replace non-fissile uranium or to extend fuel burnup due to its attractive fertile material conversion, (2) its use for fissile plutonium burning in limited recycle cores, and (3) its advantage in limiting the transuranic elements to be disposed off in a repository (if only Th/U-233 fuel is used). The possibility for thorium utilization in multirecycle system has also been considered by various researchers, primarily because of the potential for near breeders with Th/U-233 in the thermal energy range. The objective of this project is to evaluate the potential of the Th/U-233 fuel multirecycle in current LWRs, with focus this year on pressurized water reactors (PWRs). In this work, approaches for ensuring a sustainable multirecycle without the need for external source of makeup fissile material have been investigated. The intent is to achieve a design that allows existing PWRs to be used with minimal modifications. In all cases including homogeneous and heterogeneous assembly designs, the assembly pitch is kept consistent with that of the current PWRs (21.5 cm used). Because of design difficulties associated with using the same geometry and dimensions as a PWR core, the potential modifications (other than assembly pitch) that would be needed for PWRs to ensure a sustainable multirecycle system have been investigated and characterized. Additionally, the implications of the use of thorium on the LWR fuel cycle are discussed. In Section 2, background information on studies evaluating the use of thorium in the fuel cycle is provided, but focusing on

  4. Nuclear reactor for breeding U.sup.233

    Science.gov (United States)

    Bohanan, Charles S.; Jones, David H.; Raab, Jr., Harry F.; Radkowsky, Alvin

    1976-01-01

    A light-water-cooled nuclear reactor capable of breeding U.sup.233 for use in a light-water breeder reactor includes physically separated regions containing U.sup.235 fissile material and U.sup.238 fertile material and Th.sup.232 fertile material and Pu.sup.239 fissile material, if available. Preferably the U.sup.235 fissile material and U.sup.238 fertile material are contained in longitudinally movable seed regions and the Pu.sup.239 fissile material and Th.sup.232 fertile material are contained in blanket regions surrounding the seed regions.

  5. Separation of oxidized americium from lanthanides by use of pillared metal(IV) phosphate-phosphonate hybrid materials

    Energy Technology Data Exchange (ETDEWEB)

    Burns, J.D.; Clearfield, A. [Texas A and M Univ., College Station, TX (United States). Dept. of Chemistry; Borkowski, M.; Reed, D.T. [Los Alamos National Laboratory, Carlsbad, NM (United States). Earth and Environmental Sciences Div.

    2012-07-01

    Closing the nuclear fuel cycle in the US poses many challenges, one of which is found in the waste streams, which contain both trivalent lanthanides and actinides. The separation of americium from the raffinate will dramatically reduce the long-term radiotoxicity of the waste. The sorption of americium in both the tri- and pentavalent oxidation states was observed for four M(IV) phosphate-phosphonate ion exchange materials in nitric acid at pH 2. High selectivity was observed for reduced Am(III) with K{sub d} values ca. 6 x 10{sup 5} mL/g, while the K{sub d} values for Am(V) were much lower. A new method of synthesizing and stabilizing AmO{sub 2}{sup +} to yield a lifetime of at least 24 h in acidic media using a combination of sodium persulfate and calcium hypochlorite will be described.

  6. Theoretical investigation of pressure-induced structural transitions in americium using GGA+U and hybrid density functional theory methods

    DEFF Research Database (Denmark)

    Verma, Ashok K.; Modak, P.; Sharma, Surinder M.;

    2013-01-01

    First-principles calculations have been performed for americium (Am) metal using the generalized gradient approximation + orbital-dependent onsite Coulomb repulsion via Hubbard interaction (GGA+U) and hybrid density functional theory (HYB-DFT) methods to investigate various ground state properties...... spectrum at ambient pressure relate, for some parameter choices, well to peak positions in the calculated density of states function of Am-I....

  7. Vertical and horizontal fluxes of plutonium and americium in the western Mediterranean and the Strait of Gibraltar.

    Science.gov (United States)

    León Vintró, L; Mitchell, P I; Condren, O M; Downes, A B; Papucci, C; Delfanti, R

    1999-09-30

    New data on the vertical distributions of plutonium and americium in the waters of the western Mediterranean and the Strait of Gibraltar are examined in terms of the processes governing their delivery to, transport in and removal from the water column within the basin. Residence times for plutonium and americium in surface waters of approximately 15 and approximately 3 years, respectively, are deduced, and it is shown that by the mid 1990s only approximately 35% of the 239,240Pu and approximately 5% of the 241Am deposited as weapons fallout still resided in the water column. Present 239,240Pu inventories in the water column and the underlying sediments are estimated to be approximately 25 TBq and approximately 40 TBq, respectively, which reconcile well with the time-integrated fallout deposition in this zone, taken to be approximately 69 TBq. The data show that there are significant net outward fluxes of plutonium and americium from the basin through the Strait of Gibraltar at the present time. These appear to be compensated by net inward fluxes of similar magnitude through the Strait of Sicily. Thus, the time-integrated fallout deposition in the western basin can be accounted for satisfactorily in terms of present water column and sediment inventories. Enhanced scavenging on the continental shelves, as evidenced by the appreciably higher transuranic concentrations in shelf sediments, supports this contention.

  8. The behaviour under irradiation of molybdenum matrix for inert matrix fuel containing americium oxide (CerMet concept)

    Science.gov (United States)

    D'Agata, E.; Knol, S.; Fedorov, A. V.; Fernandez, A.; Somers, J.; Klaassen, F.

    2015-10-01

    Americium is a strong contributor to the long term radiotoxicity of high activity nuclear waste. Transmutation by irradiation in nuclear reactors or Accelerator Driven System (ADS, subcritical reactors dedicated to transmutation) of long-lived nuclides like 241Am is therefore an option for the reduction of radiotoxicity of waste packages to be stored in a repository. In order to safely burn americium in a fast reactor or ADS, it must be incorporated in a matrix that could be metallic (CerMet target) or ceramic (CerCer target). One of the most promising matrix to incorporate Am is molybdenum. In order to address the issues (swelling, stability under irradiation, gas retention and release) of using Mo as matrix to transmute Am, two irradiation experiments have been conducted recently at the High Flux Reactor (HFR) in Petten (The Netherland) namely HELIOS and BODEX. The BODEX experiment is a separate effect test, where the molybdenum behaviour is studied without the presence of fission products using 10B to "produce" helium, the HELIOS experiment included a more representative fuel target with the presence of Am and fission product. This paper covers the results of Post Irradiation Examination (PIE) of the two irradiation experiments mentioned above where molybdenum behaviour has been deeply investigated as possible matrix to transmute americium (CerMet fuel target). The behaviour of molybdenum looks satisfying at operating temperature but at high temperature (above 1000 °C) more investigation should be performed.

  9. HELIOS: the new design of the irradiation of U-free fuels for americium transmutation

    Energy Technology Data Exchange (ETDEWEB)

    D' Agata, E. [European Commission, Joint Research Centre, Institute for Energy, P.O. Box 2, 1755 ZG Petten (Netherlands); Klaassen, F.; Sciolla, C. [Nuclear Research and Consultancy Group, Dept. Life Cycle and Innovations, P.O. Box 25 1755 ZG Petten (Netherlands); Fernandez-Carretero, A. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Bonnerot, J.M. [Commissariat a l' Energie Atomique, DEC/SESC/LC2I CEA-Cadarache, 13108 St. Paul lez Durance Cedex (France)

    2009-06-15

    Americium is one of the radioactive elements that mostly contribute to the radiotoxicity of the nuclear spent fuel. Transmutation of long-lived nuclides like Americium is an option for the reduction of the mass, the radiotoxicity and the decay heat of nuclear waste. The HELIOS irradiation experiment is the last evolution in a series of experiments on americium transmutation. The previous experiments, EFTTRA-T4 and T4bis, have shown that the release or trapping of helium is the key issue for the design of such kind of target. In fact, the production of helium, which is characteristic of {sup 241}Am transmutation, is quite significant. The experiment is carried out in the framework of the 4-year project EUROTRANS of the EURATOM 6. Framework Programme (FP6). Therefore, the main objective of the HELIOS experiment is to study the in-pile behaviour of U-free fuels such as CerCer (Pu, Am, Zr)O{sub 2} and Am{sub 2}Zr{sub 2}O{sub 7}+MgO or CerMet (Pu, Am)O{sub 2}+Mo in order to gain knowledge on the role of the fuel microstructure and of the temperature on the gas release and on the fuel swelling. The experiment was planned to be conducted in the HFR (High Flux Reactor) in Petten (The Netherlands) starting the first quarter of 2007. Because of the innovative aspects of the fuel, the fabrication has had some delays as well as the final safety analyses of the original design showed some unexpected deviation. Besides, the HFR reactor has been unavailable since August 2008. Due to the reasons described above, the experiment has been postponed. HELIOS should start in the first quarter of 2009 and will last 300 full power days. The paper will cover the description of the new design of the irradiation experiment HELIOS. The experiment has been split in two parts (HELIOS1 and HELIOS2) which will be irradiated together. Moreover, due to the high temperature achieved in cladding and to the high amount of helium produced during transmutation the experiment previously designed for a

  10. Americium and plutonium in water, biota, and sediment from the central Oregon coast

    Energy Technology Data Exchange (ETDEWEB)

    Nielsen, R. D.

    1982-06-01

    Plutonium-239, 240 and americium-241 were measured in the mussel Mytilus californianus from the region of Coos Bay, OR. The flesh of this species has a plutonium concentration of about 90 fCi/kg, and an Am-241/Pu-239, 240 ratio that is high relative to mixed fallout, ranging between two and three. Transuranic concentrations in sediment, unfiltered water, and filterable particulates were also measured; none of these materials has an Am/Pu ratio as greatly elevated as the mussels, and there is no apparent difference in the Am/Pu ratio of terrestrial runoff and coastal water. Sediment core profiles do not allow accumulation rates or depositional histories to be identified, but it does not appear that material characterized by a high Am/Pu ratio has ever been introduced to this estuary. Other bivalves (Tresus capax and Macoma nasuta) and a polychaete (Abarenicola sp.) do not have an elevated Am/Pu ratio, although the absolute activity of plutonium in the infaunal bivalves is roughly four times that in the mussels.

  11. Development and Testing of an Americium/Lanthanide Separation Flowsheet Using Sodium Bismuthate

    Energy Technology Data Exchange (ETDEWEB)

    Jack Law; Bruce Mincher; Troy Garn; Mitchell Greenhalgh; Nicholas Schmitt; Veronica Rutledge

    2014-04-01

    The separation of Am from the lanthanides and curium is a key step in proposed advanced fuel cycle scenarios. The partitioning and transmutation of Am is desirable to minimize the long-term heat load of material interred in a future high-level waste repository. A separation process amenable to process scale-up remains elusive. Given only subtle chemistry differences within and between the ions of the trivalent actinide and lanthanide series this separation is challenging ; however, higher oxidation states of americium can be prepared using sodium bismuthate and separated via solvent extraction using diamylamylphosphonate (DAAP) extraction. Among the other trivalent metals only Ce is also oxidized and extracted. Due to the long-term instability of Am(VI) , the loaded organic phase is readily selectively stripped to partition the actinide to a new acidic aqueous phase. Batch extraction distribution ratio measurements were used to design a flowsheet to accomplish this separation. Additionally, crossflow filtration was investigated as a method to filter the bismuthate solids from the feed solution prior to extraction. Results of the filtration studies, flowsheet development work and flowsheet performance testing using a centrifugal contactor are detailed.

  12. Americium-based oxides: Dense pellet fabrication from co-converted oxalates

    Energy Technology Data Exchange (ETDEWEB)

    Horlait, Denis; Lebreton, Florent [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France); Gauthé, Aurélie [CEA, DEN, DRCP/SERA/LCAR, 30207 Bagnols-sur-Cèze (France); Caisso, Marie [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France); Arab-Chapelet, Bénédicte; Picart, Sébastien [CEA, DEN, DRCP/SERA/LCAR, 30207 Bagnols-sur-Cèze (France); Delahaye, Thibaud, E-mail: thibaud.delahaye@cea.fr [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France)

    2014-01-15

    Mixed oxides are used as nuclear fuels and are notably envisaged for future fuel cycles including plutonium and minor actinide recycling. In this context, processes are being developed for the fabrication of uranium–americium mixed-oxide compounds for transmutation. The purpose of these processes is not only the compliance with fuel specifications in terms of density and homogeneity, but also the simplification of the process for its industrialization as well as lowering dust generation. In this paper, the use of a U{sub 0.85}Am{sub 0.15}O{sub 2±δ} powder synthesized by oxalate co-conversion as a precursor for dense fuel fabrications is assessed. This study notably focuses on sintering, which yielded pellets up to 96% of the theoretical density, taking advantage of the high reactivity and homogeneity of the powder. As-obtained pellets were further characterized to be compared to those obtained via processes based on the UMACS (Uranium Minor Actinide Conventional Sintering) process. This comparison highlights several advantages of co-converted powder as a precursor for simplified processes that generate little dust.

  13. Experimental studies on the biokinetics of plutonium and americium in the cephalopod Octopus vulgaris

    Energy Technology Data Exchange (ETDEWEB)

    Guary, J.C.; Fowler, S.W.

    1982-03-05

    Radiotracer experiments using the photon-emitters /sup 237/Pu and /sup 241/Am were performed to examine uptake, tissue distribution and retention of plutonium and americium in the cephalopod Octopus vulgaris Cuvier. A 2 wk exposure in contaminated sea water resulted in twice as much /sup 237/Pu being taken up by whole octopus as /sup 241/Am. Immediately following uptake approximately 41% and 73% of the /sup 237/Pu and /sup 241/Am respectively were located in the branchial hearts. Depuration rates for both radionuclides were identical; approximately 46% of both radionuclides initially incorporated were associated with a long-lived compartment which turned over very slowly (Tbsub(1/2) = 1.5 yr). Longer exposures to /sup 241/Am resulted in an increase in the size of the slowly exchanging /sup 241/Am pool in the octopus. After 2 mo depuration, the majority of the residual activity of both radionuclides was in the branchial hearts. On average 33% of the /sup 241/Am ingested with food was assimilated into tissues, primarily the hepatopancreas. Different whole-body /sup 241/Am excretion rates were observed at different times following assimilation and were related to transfer processes taking place within internal tissues, most notably between hepatopancreas and the branchial hearts. Relationships between circulatory and excretory functions of these 2 organs are discussed and a physiological mechanism is proposed to explain the observed patterns of /sup 241/Am excretion in O. vulgaris.

  14. In Vitro Dissolution Tests of Plutonium and Americium Containing Contamination Originating From ZPPR Fuel Plates

    Energy Technology Data Exchange (ETDEWEB)

    William F. Bauer; Brian K. Schuetz; Gary M. Huestis; Thomas B. Lints; Brian K. Harris; R. Duane Ball; Gracy Elias

    2012-09-01

    Assessing the extent of internal dose is of concern whenever workers are exposed to airborne radionuclides or other contaminants. Internal dose determinations depend upon a reasonable estimate of the expected biological half-life of the contaminants in the respiratory tract. One issue with refractory elements is determining the dissolution rate of the element. Actinides such as plutonium (Pu) and Americium (Am) tend to be very refractory and can have biological half-lives of tens of years. In the event of an exposure, the dissolution rates of the radionuclides of interest needs to be assessed in order to assign the proper internal dose estimates. During the November 2011 incident at the Idaho National Laboratory (INL) involving a ZPPR fuel plate, air filters in a constant air monitor (CAM) and a giraffe filter apparatus captured airborne particulate matter. These filters were used in dissolution rate experiments to determine the apparent dissolution half-life of Pu and Am in simulated biological fluids. This report describes these experiments and the results. The dissolution rates were found to follow a three term exponential decay equation. Differences were noted depending upon the nature of the biological fluid simulant. Overall, greater than 95% of the Pu and 93% of the Am were in a very slow dissolving component with dissolution half-lives of over 10 years.

  15. Plutonium and americium monazite materials: Solid state synthesis and X-ray diffraction study

    Energy Technology Data Exchange (ETDEWEB)

    Bregiroux, D. [DEN/DEC/SPUA, Commissariat a l' Energie Atomique, Cadarache, 13108 Saint Paul Lez Durance (France); Laboratoire Science des Procedes Ceramiques et de Traitements de Surface, UMR CNRS-Universite no. 6638, Batiment Chimie, 123 avenue Albert Thomas, 87060 Limoges (France); E-mail: damien.bregiroux@ccr.jussieu.fr; Belin, R. [DEN/DEC/SPUA, Commissariat a l' Energie Atomique, Cadarache, 13108 Saint Paul Lez Durance (France); Valenza, P. [DEN/DEC/SPUA, Commissariat a l' Energie Atomique, Cadarache, 13108 Saint Paul Lez Durance (France); Audubert, F. [DEN/DEC/SPUA, Commissariat a l' Energie Atomique, Cadarache, 13108 Saint Paul Lez Durance (France); Bernache-Assollant, D. [Ecole Nationale Superieure des Mines, 158 Cours Fauriel, 42023 Saint Etienne (France)

    2007-06-30

    High-temperature solid state syntheses of monazite powders containing plutonium (III), plutonium (IV) and americium (III) were performed. Resulting powders were characterized by X-ray diffraction. Pu{sup 3+}PO{sub 4} was readily obtained as a single phase by heating a Pu{sup 4+}O{sub 2}-NH{sub 4}H{sub 2}PO{sub 4} mixture under argon atmosphere. Traces of tetravalent plutonium phosphate Pu{sup 4+}P{sub 2}O{sub 7} were detected when synthesized under air atmosphere. The incorporation of (Pu{sup 4+},Ca{sup 2+}) in the monazite structure was investigated under air and argon atmosphere. We showed that Pu{sup 4+} is fully reduced in Pu{sup 3+} under argon atmosphere whereas, under air, the compound with the formula Pu{sub 0.4}{sup 3+}Pu{sub 0.3}{sup 4+}Ca{sub 0.3}{sup 2+}PO{sub 4} was obtained. Pure Am{sup 3+}PO{sub 4} was also synthesized under argon atmosphere. X-ray patterns revealed a complete amorphisation of the monazite structure at a relatively low cumulative alpha dose for {sup 241}AmPO{sub 4}.

  16. Mutual separation of americium(III) and europium(III) using glycolamic acid and thioglycolamic acid

    Energy Technology Data Exchange (ETDEWEB)

    Suneesh, A.S.; Venkatesan, K.A.; Syamala, K.V.; Antony, M.P.; Vasudeva Rao, P.R. [Indira Gandhi Centre for Atomic Research, Kalpakkam (India). Fuel Chemistry Div.

    2012-07-01

    The extractants, bis(2-ethylhexyl)diglycolamicacid (HDEHDGA) and bis(2-ethylhexy)thiodiglycolamic acid (HDEHSDGA) were synthesized and characterized by {sup 1}H and {sup 13}C NMR, mass and IR spectroscopy. The extraction behaviour of {sup (152+154})Eu(III) and {sup 241}Am(III) from nitric acid medium by a solution of HDEHDGA (or HDEHSDGA) in n-dodecane (n-DD) was studied for the mutual separation of actinides and lanthanides. The effect of various parameters such as the pH, concentrations of HDEHDGA, HDEHSDGA, sodium nitrate, N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (TPEN) and diethylenetriaminepentaacetic acid (DTPA) on the separation factor (SF) of americium(III) over europium(III) and vice versa was studied, and the conditions needed for the preferential separation were optimised. The results show that HDEHDGA exhibits higher extraction for {sup (152+154)}Eu(III) and HDEHSDGA shows the superior selectivity for {sup 241}Am(III). (orig.)

  17. Solution speciation of plutonium and Americium at an Australian legacy radioactive waste disposal site.

    Science.gov (United States)

    Ikeda-Ohno, Atsushi; Harrison, Jennifer J; Thiruvoth, Sangeeth; Wilsher, Kerry; Wong, Henri K Y; Johansen, Mathew P; Waite, T David; Payne, Timothy E

    2014-09-01

    During the 1960s, radioactive waste containing small amounts of plutonium (Pu) and americium (Am) was disposed in shallow trenches at the Little Forest Burial Ground (LFBG), located near the southern suburbs of Sydney, Australia. Because of periodic saturation and overflowing of the former disposal trenches, Pu and Am have been transferred from the buried wastes into the surrounding surface soils. The presence of readily detected amounts of Pu and Am in the trench waters provides a unique opportunity to study their aqueous speciation under environmentally relevant conditions. This study aims to comprehensively investigate the chemical speciation of Pu and Am in the trench water by combining fluoride coprecipitation, solvent extraction, particle size fractionation, and thermochemical modeling. The predominant oxidation states of dissolved Pu and Am species were found to be Pu(IV) and Am(III), and large proportions of both actinides (Pu, 97.7%; Am, 86.8%) were associated with mobile colloids in the submicron size range. On the basis of this information, possible management options are assessed.

  18. 20 CFR 702.233 - Penalty for failure to pay without an award.

    Science.gov (United States)

    2010-04-01

    .... 702.233 Section 702.233 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR LONGSHOREMEN'S AND HARBOR WORKERS' COMPENSATION ACT AND RELATED STATUTES ADMINISTRATION AND PROCEDURE Claims... the same time as, but in addition to, such installment unless the employer files notice...

  19. 18 CFR 367.2330 - Account 233, Notes payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... Account 233, Notes payable to associate companies. (a) This account must include amounts owing to... accounts payable on demand or not more than one year from date of issue or creation. (b) Exclude from this... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Account 233,...

  20. 45 CFR 233.106 - Denial of AFDC benefits to strikers.

    Science.gov (United States)

    2010-10-01

    ...” by using the National Labor Relations Board definition (29 U.S.C. 142(2)) or another definition of... 45 Public Welfare 2 2010-10-01 2010-10-01 false Denial of AFDC benefits to strikers. 233.106 Section 233.106 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY...

  1. 27 CFR 31.233 - Mixing cocktails in advance of sale.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Mixing cocktails in advance of sale. 31.233 Section 31.233 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... liquors in advance of sale, except for the purpose of filling, for immediate consumption on the...

  2. 9 CFR 2.33 - Attending veterinarian and adequate veterinary care.

    Science.gov (United States)

    2010-01-01

    ... veterinary care. 2.33 Section 2.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... adequate veterinary care. (a) Each research facility shall have an attending veterinarian who shall provide adequate veterinary care to its animals in compliance with this section: (1) Each research facility...

  3. Americium/Lanthanide Separations in Alkaline Solutions for Advanced Nuclear Fuel Cycles

    Energy Technology Data Exchange (ETDEWEB)

    Goff, George S. [Los Alamos National Laboratory; Long, Kristy Marie [Los Alamos National Laboratory; Reilly, Sean D. [Los Alamos National Laboratory; Jarvinen, Gordon D. [Los Alamos National Laboratory; Runde, Wolfgang H. [Los Alamos National Laboratory

    2012-06-11

    Project goals: Can used nuclear fuel be partitioned by dissolution in alkaline aqueous solution to give a solution of uranium, neptunium, plutonium, americium and curium and a filterable solid containing nearly all of the lanthanide fission products and certain other fission products? What is the chemistry of Am/Cm/Ln in oxidative carbonate solutions? Can higher oxidation states of Am be stabilized and exploited? Conclusions: Am(VI) is kinetically stable in 0.5-2.0 M carbonate solutions for hours. Aliquat 336 in toluene has been successfully shown to extract U(VI) and Pu(VI) from carbonate solutions. (Stepanov et al 2011). Higher carbonate concentration gives lower D, SF{sub U/Eu} for = 4 in 1 M K{sub 2}CO{sub 3}. Experiments with Am(VI) were unsuccessful due to reduction by the organics. Multiple sources of reducing organics...more optimization. Reduction experiments of Am(VI) in dodecane/octanol/Aliquat 336 show that after 5 minutes of contact, only 30-40% of the Am(VI) has been reduced. Long enough to perform an extraction. Shorter contact times, lower T, and lower Aliquat 336 concentration still did not result in any significant extraction of Am. Anion exchange experiments using a strong base anion exchanger show uptake of U(VI) with minimal uptake of Nd(III). Experiments with Am(VI) indicate Am sorption with a Kd of 9 (10 minute contact) but sorption mechanism is not yet understood. SF{sub U/Nd} for = 7 and SF{sub U/Eu} for = 19 after 24 hours in 1 M K{sub 2}CO{sub 3}.

  4. Concentrations of plutonium and americium in plankton from the western Mediterranean Sea

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Cabeza, Joan-Albert; Merino, Juan; Masque, Pere [Insitut de Ciencia i Tecnologia Ambiental-Departament de Fisica, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Mitchell, Peter I.; Vintro, L. Leon [Department of Experimental Physics, University College Dublin, Dublin 4 (Ireland); Schell, William R. [Graduate School of Public Health, University of Pittsburgh, Pittsburgh, PA 15261 (United States); Cross, Lluisa; Calbet, Albert [Institut de Ciencies del Mar, Pg. Maritim Barceloneta, 37-49 08003, Barcelona (Spain)

    2003-07-20

    Understanding the transfer of radionuclides through the food chain leading to man and in particular, the uptake of transuranic nuclides by plankton, is basic to assess the potential radiological risk of the consumption of marine products by man. The main sources of transuranic elements in the Mediterranean Sea in the past were global fallout and the Palomares accident, although at present smaller amounts are released from nuclear establishments in the northwestern region. Plankton from the western Mediterranean Sea was collected and analyzed for plutonium and americium in order to study their biological uptake. The microplankton fractions accounted for approximately 50% of the total plutonium contents in particulate form. At Garrucha (Palomares area), microplankton showed much higher {sup 239,240}Pu activity, indicating the contamination with plutonium from the bottom sediments. Concentration factors were within the range of the values recommended by the International Atomic Energy Agency. Continental shelf mesoplankton was observed to efficiently concentrate transuranics. In open seawaters, concentrations were much lower. We speculate that sediments might play a role in the transfer of transuranics to mesoplankton in coastal waters, although we cannot discard that the difference in species composition may also play a role. In Palomares, both {sup 239,240}Pu and {sup 241}Am showed activities five times higher than the mean values observed in continental shelf mesoplankton. As the plutonium isotopic ratios in the contaminated sample were similar to those found in material related to the accident, the contamination was attributed to bomb debris from the Palomares accident. Concentration factors in mesoplankton were also in relatively good agreement with the ranges recommended by IAEA. In the Palomares station the highest concentration factor was observed in the sample that showed predominance of the dynoflagellate Ceratium spp. Mean values of the enrichment factors

  5. A 233 km tunnel for lepton and hadron colliders

    Energy Technology Data Exchange (ETDEWEB)

    Summers, D. J.; Cremaldi, L. M.; Datta, A.; Duraisamy, M.; Luo, T.; Lyons, G. T. [Dept. of Physics and Astronomy, University of Mississippi-Oxford, University, MS 38677 (United States)

    2012-12-21

    A decade ago, a cost analysis was conducted to bore a 233 km circumference Very Large Hadron Collider (VLHC) tunnel passing through Fermilab. Here we outline implementations of e{sup +}e{sup -}, pp-bar , and {mu}{sup +}{mu}{sup -} collider rings in this tunnel using recent technological innovations. The 240 and 500 GeV e{sup +}e{sup -} colliders employ Crab Waist Crossings, ultra low emittance damped bunches, short vertical IP focal lengths, superconducting RF, and low coercivity, grain oriented silicon steel/concrete dipoles. Some details are also provided for a high luminosity 240 GeV e{sup +}e{sup -} collider and 1.75 TeV muon accelerator in a Fermilab site filler tunnel. The 40 TeV pp-bar collider uses the high intensity Fermilab p-bar source, exploits high cross sections for pp-bar production of high mass states, and uses 2 Tesla ultra low carbon steel/YBCO superconducting magnets run with liquid neon. The 35 TeV muon ring ramps the 2 Tesla superconducting magnets at 9 Hz every 0.4 seconds, uses 250 GV of superconducting RF to accelerate muons from 1.75 to 17.5 TeV in 63 orbits with 71% survival, and mitigates neutrino radiation with phase shifting, roller coaster motion in a FODO lattice.

  6. A 233 km Tunnel for Lepton and Hadron Colliders

    CERN Document Server

    Summers, D J; Datta, A; Duraisamy, M; Luo, T; Lyons, G T

    2012-01-01

    A decade ago, a cost analysis was conducted to bore a 233 km circumference Very Large Hadron Collider (VLHC) tunnel passing through Fermilab. Here we outline implementations of $e^+e^-$, $p \\bar{p}$, and $\\mu^+ \\mu^-$ collider rings in this tunnel using recent technological innovations. The 240 and 500 GeV $e^+e^-$ colliders employ Crab Waist Crossings, ultra low emittance damped bunches, short vertical IP focal lengths, superconducting RF, and low coercivity, grain oriented silicon steel/concrete dipoles. Some details are also provided for a high luminosity 240 GeV $e^+ e^-$ collider and 1.75 TeV muon accelerator in a Fermilab site filler tunnel. The 40 TeV $p \\bar{p}$ collider uses the high intensity Fermilab $\\bar{p}$ source, exploits high cross sections for $p \\bar{p}$ production of high mass states, and uses 2 Tesla ultra low carbon steel/YBCO superconducting magnets run with liquid neon. The 35 TeV muon ring ramps the 2 Tesla superconducting magnets at 9 Hz every 0.4 seconds, uses 250 GV of superconduct...

  7. Statistical analysis of 233 cases in cerebovascular Diseases

    Institute of Scientific and Technical Information of China (English)

    Hu Hao-Yu; Zhejiang; Jlnhua

    2000-01-01

    Objection:Monitoring Clinical in-patient constituent ratio in cerebral vasscular diseases. Methods: we monitored 233 cases of CVD in clinical in--patient 13170 cases for three years with unique registry card accroding to ICD--9. These pepole′s data was putted in computer. Age, sex, constituent ratio of each disease in CVD was observed and number of death and rank order of cases of death as well. Results: In our data, number of male is more than female(1.75:I). Constituent ratio of age is increasing at 40 years old. Main part of CH is middle age and senility, but CI age is senility. Constituent ratio of each disease is following :CI 67.74%, CH 22.13%, CT 6.06%, SAH 3.79% respectlvly. The rank order of death in CVD is third later in cardiovascular diseases and tumors. Conclusions: Our materials revealsed that it is improtant that intensiv′e care and treatment group in pead population of CVD and prevention high risk facters of CVD and health care education

  8. In situ characterization of uranium and americium oxide solid solution formation for CRMP process: first combination of in situ XRD and XANES measurements.

    Science.gov (United States)

    Caisso, Marie; Picart, Sébastien; Belin, Renaud C; Lebreton, Florent; Martin, Philippe M; Dardenne, Kathy; Rothe, Jörg; Neuville, Daniel R; Delahaye, Thibaud; Ayral, André

    2015-04-14

    Transmutation of americium in heterogeneous mode through the use of U1-xAmxO2±δ ceramic pellets, also known as Americium Bearing Blankets (AmBB), has become a major research axis. Nevertheless, in order to consider future large-scale deployment, the processes involved in AmBB fabrication have to minimize fine particle dissemination, due to the presence of americium, which considerably increases the risk of contamination. New synthesis routes avoiding the use of pulverulent precursors are thus currently under development, such as the Calcined Resin Microsphere Pelletization (CRMP) process. It is based on the use of weak-acid resin (WAR) microspheres as precursors, loaded with actinide cations. After two specific calcinations under controlled atmospheres, resin microspheres are converted into oxide microspheres composed of a monophasic U1-xAmxO2±δ phase. Understanding the different mechanisms during thermal conversion, that lead to the release of organic matter and the formation of a solid solution, appear essential. By combining in situ techniques such as XRD and XAS, it has become possible to identify the key temperatures for oxide formation, and the corresponding oxidation states taken by uranium and americium during mineralization. This paper thus presents the first results on the mineralization of (U,Am) loaded resin microspheres into a solid solution, through in situ XAS analysis correlated with HT-XRD.

  9. LIBS Spectral Data for a Mixed Actinide Fuel Pellet Containing Uranium, Plutonium, Neptunium and Americium

    Energy Technology Data Exchange (ETDEWEB)

    Judge, Elizabeth J. [Los Alamos National Laboratory; Berg, John M. [Los Alamos National Laboratory; Le, Loan A. [Los Alamos National Laboratory; Lopez, Leon N. [Los Alamos National Laboratory; Barefield, James E. [Los Alamos National Laboratory

    2012-06-18

    Laser-induced breakdown spectroscopy (LIBS) was used to analyze a mixed actinide fuel pellet containing 75% UO{sub 2}/20% PuO{sub 2}/3% AmO{sub 2}/2% NpO{sub 2}. The preliminary data shown here is the first report of LIBS analysis of a mixed actinide fuel pellet, to the authors knowledge. The LIBS spectral data was acquired in a plutonium facility at Los Alamos National Laboratory where the sample was contained within a glove box. The initial installation of the glove box was not intended for complete ultraviolet (UV), visible (VIS) and near infrared (NIR) transmission, therefore the LIBS spectrum is truncated in the UV and NIR regions due to the optical transmission of the window port and filters that were installed. The optical collection of the emission from the LIBS plasma will be optimized in the future. However, the preliminary LIBS data acquired is worth reporting due to the uniqueness of the sample and spectral data. The analysis of several actinides in the presence of each other is an important feature of this analysis since traditional methods must chemically separate uranium, plutonium, neptunium, and americium prior to analysis. Due to the historic nature of the sample fuel pellet analyzed, the provided sample composition of 75% UO{sub 2}/20% PuO{sub 2}/3% AmO{sub 2}/2% NpO{sub 2} cannot be confirm without further analytical processing. Uranium, plutonium, and americium emission lines were abundant and easily assigned while neptunium was more difficult to identify. There may be several reasons for this observation, other than knowing the exact sample composition of the fuel pellet. First, the atomic emission wavelength resources for neptunium are limited and such techniques as hollow cathode discharge lamp have different dynamics than the plasma used in LIBS which results in different emission spectra. Secondly, due to the complex sample of four actinide elements, which all have very dense electronic energy levels, there may be reactions and

  10. 药疹233例临床特征分析%Clinical analysis of 233 patients with drug eruption

    Institute of Scientific and Technical Information of China (English)

    吴伊旋; 冯欢; 刘怡文; 钱骋风; 陆平

    2001-01-01

    目的:了解当前药疹的主要临床特征,为其防治工作提供参考。方法:收集1999年全年确诊为药疹的病例233例,并对其发病年龄、主要致敏药物、皮疹类型等临床特征进行分析。结果:药疹的发病年龄有所提高,主要致敏药物以抗生素最常见,其次为解热镇痛抗炎药、血清及疫苗制剂、中成药。皮疹类型以猩红热样或麻疹样型最常见,其次为荨麻疹型、多型红斑型、固定型。结论:临床医生在用药时应详细询问病史,避免不必要用药,以减少药疹发生%AIM:To discuss the main clinical characteristics of current drug eruption for reference of prevention and treatment of drug eruption. METHODS: Two hundred and thirty-three with drug eruption in 1999 were collected, and their clinical characteristics, such as age, main causative drugs and eruption types, etc. were analysed. RESULTS: The age of current drug eruption increased. Antibiotics was the most common causative drug, while antiinflammatory analgestics, serum and vaccine, traditional Chinese medicine were next to it. Scarlet fever-like or measles-like type was the most common eruption type, while urticaria type, erythema multiforme type and fixed type were next to it. CONCLUSION: Clinical physicians shoud inquire alergic history of patients thoroughly and avoid unnecessary drugs, so as to decrease the occurrence of drug eruption.

  11. L233P mutation of the Tax protein strongly correlated with leukemogenicity of bovine leukemia virus.

    Science.gov (United States)

    Inoue, Emi; Matsumura, Keiko; Soma, Norihiko; Hirasawa, Shintaro; Wakimoto, Mayuko; Arakaki, Yoshihiro; Yoshida, Takashi; Osawa, Yoshiaki; Okazaki, Katsunori

    2013-12-27

    The bovine leukemia virus (BLV) Tax protein is believed to play a crucial role in leukemogenesis by the virus. BLV usually causes asymptomatic infections in cattle, but only one-third develop persistent lymphocytosis that rarely progress after a long incubation period to lymphoid tumors, namely enzootic bovine leucosis (EBL). In the present study, we demonstrated that the BLV tax genes could be divided into two alleles and developed multiplex PCR detecting an L233P mutation of the Tax protein. Then, in order to define the relationship between the Tax protein and leukemogenicity, we examined 360 tumor samples randomly collected from dairy or breeding cattle in Japan, of which Tax proteins were categorized, for age at the time of diagnosis of EBL. The ages of 288 animals (80.0%) associated with L233-Tax and those of 70 animals (19.4%) with P233-Tax individually followed log-normal distributions. Only the two earliest cases (0.6%) with L233-Tax disobeyed the log-normal distribution. These findings suggest that the animals affected by EBL were infected with the virus at a particular point in life, probably less than a few months after birth. Median age of those with P233-Tax was 22 months older than that with L233-Tax and geometric means exhibited a significant difference (PTax protein infect older cattle. Here, we conclude that BLV could be divided into two categories on the basis of amino acid at position 233 of the Tax protein, which strongly correlated with leukemogenicity.

  12. Interim assessment of the denatured /sup 233/U fuel cycle: feasibility and nonproliferation characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Abbott, L.S.; Bartine, D.E.; Burns, T.J. (eds.)

    1978-12-01

    A fuel cycle that employs /sup 233/U denatured with /sup 238/U and mixed with thorium fertile material is examined with respect to its proliferation-resistance characteristics and its technical and economic feasibility. The rationale for considering the denatured /sup 233/U fuel cycle is presented, and the impact of the denatured fuel on the performance of Light-Water Reactors, Spectral-Shift-Controlled Reactors, Gas-Cooled Reactors, Heavy-Water Reactors, and Fast Breeder Reactors is discussed. The scope of the R, D and D programs to commercialize these reactors and their associated fuel cycles is also summarized and the resource requirements and economics of denatured /sup 233/U cycles are compared to those of the conventional Pu/U cycle. In addition, several nuclear power systems that employ denatured /sup 233/U fuel and are based on the energy center concept are evaluated. Under this concept, dispersed power reactors fueled with denatured or low-enriched uranium fuel are supported by secure energy centers in which sensitive activities of the nuclear cycle are performed. These activities include /sup 233/U production by Pu-fueled transmuters (thermal or fast reactors) and reprocessing. A summary chapter presents the most significant conclusions from the study and recommends areas for future work.

  13. Neutronic Study of Burnup, Radiotoxicity, Decay Heat and Basic Safety Parameters of Mono-Recycling of Americium in French Pressurised Water Reactors

    Directory of Open Access Journals (Sweden)

    Robert Bright Mawuko Sogbadji

    2017-03-01

    Full Text Available The reprocessing of actinides with long half-life has been non-existent except for plutonium (Pu. This work looks at reducing the actinides inventory nuclear fuel waste meant for permanent disposal. The uranium oxide fuel (UOX assembly, as in the open cycle system, was designed to reach a burnup of 46GWd/T and 68GWd/T using the MURE code. The MURE code is based on the coupling of a static Monte Carlo code and the calculation of the evolution of the fuel during irradiation and cooling periods. The MURE code has been used to address two different questions concerning the mono-recycling of americium (Am in present French pressurised water reactors (PWR. These are reduction of americium in the clear fuel cycle and the safe quantity of americium that can be introduced into mixed oxide (MOX as fuel. The spent UOX was reprocessed to fabricate MOX assemblies, by the extraction of plutonium and addition of depleted uranium to reach burnups of 46GWd/T and 68GWd/T, taking into account various cooling times of the spent UOX assembly in the repository. The effect of cooling time on burnup and radiotoxicity was then ascertained. After 30 years of cooling in the repository, the spent UOX fuel required a higher concentration of Pu to be reprocessed into MOX fuel due to the decay of Pu-241. Americium, with a mean half-life of 432 years, has a high radiotoxicity level, high mid-term residual heat and is a precursor for other long-lived isotopes. An innovative strategy would be to reprocess not only the plutonium from the UOX spent fuel but also the americium isotopes, which presently dominate the radiotoxicity of waste. The mono-recycling of Am is not a definitive solution because the once-through MOX cycle transmutation of Am in a PWR is not enough to destroy all americium. The main objective is to propose a ‘waiting strategy’ for both Am and Pu in the spent fuel so that they can be made available for further transmutation strategies. The MOX and

  14. THE FIRST ISOLATION OF AMERICIUM IN THE FORM OF PURE COMPOUNDS - THE SPECIFIC ALPHA-ACTIVITY AND HALF-LIFE OF Am241

    Energy Technology Data Exchange (ETDEWEB)

    Cunningham, B.B.; Asprey, L.B.

    1950-07-20

    The microgram scale isolation and preparation of pure compounds of americium is described. Data are presented to show that the alpha-half-life of the isotope Am{sup 241} is 490 {+-} 14 years. The absorption spectrum of Am(III) in 1M nitric acid in the range 3500-8000 mu is given. The wave lengths of 10 of the most prominent lines in the copper spark emission spectrum of americium are given to the nearest 0.01 {angstrom}. Evidence is presented to show that the potential for the Am(III)-Am(IV) couple in acid solution is more negative than -2v and that the potential for the Am(II)-Am(III) couple is more positive than +0.9v.

  15. Uranium-233 waste definition: Disposal options, safeguards, criticality control, and arms control

    Energy Technology Data Exchange (ETDEWEB)

    Forsberg, C.W.; Storch, S.N. [Oak Ridge National Lab., TN (United States); Lewis, L.C. [Lockheed Martin Idaho Technology Co., Idaho Falls, ID (United States). Idaho National Engineering and Environmental Lab.

    1998-07-07

    The US investigated the use of {sup 233}U for weapons, reactors, and other purposes from the 1950s into the 1970s. Based on the results of these investigations, it was decided not to use {sup 233}U on a large scale. Most of the {sup 233}U-containing materials were placed in long-term storage. At the end of the cold war, the US initiated, as part of its arms control policies, a disposition program for excess fissile materials. Other programs were accelerated for disposal of radioactive wastes placed in storage during the cold war. Last, potential safety issues were identified related to the storage of some {sup 233}U-containing materials. Because of these changes, significant activities associated with {sup 233}U-containing materials are expected. This report is one of a series of reports to provide the technical bases for future decisions on how to manage this material. A basis for defining when {sup 233}U-containing materials can be managed as waste and when they must be managed as concentrated fissile materials has been developed. The requirements for storage, transport, and disposal of radioactive wastes are significantly different than those for fissile materials. Because of these differences, it is important to classify material in its appropriate category. The establishment of a definition of what is waste and what is fissile material will provide the guidance for appropriate management of these materials. Wastes are defined in this report as materials containing sufficiently small masses or low concentrations of fissile materials such that they can be managed as typical radioactive waste. Concentrated fissile materials are defined herein as materials containing sufficient fissile content such as to warrant special handling to address nuclear criticality, safeguards, and arms control concerns.

  16. 50 CFR 23.3 - What other wildlife and plant regulations may apply?

    Science.gov (United States)

    2010-10-01

    ..., EXPORTATION, AND IMPORTATION OF WILDLIFE AND PLANTS (CONTINUED) CONVENTION ON INTERNATIONAL TRADE IN ENDANGERED SPECIES OF WILD FAUNA AND FLORA (CITES) Introduction § 23.3 What other wildlife and plant... permit or have additional restrictions. Many CITES species are also covered by one or more parts of...

  17. 45 CFR 233.21 - Budgeting methods for OAA, AB, APTD, and AABD.

    Science.gov (United States)

    2010-10-01

    ....21 Section 233.21 Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES... will exist in that month. This estimate shall be based on the agency's reasonable expectation...

  18. The Calculation of 233U and 232U in Irradiation Process of Thorium

    Institute of Scientific and Technical Information of China (English)

    MA; Peng; MAO; Guo-shu

    2012-01-01

    <正>Currently,sufficient nuclear fuel supply is the most important problem with the nuclear power growing rapidly, so the use of thorium fuel is being put on the agenda. The applicability of thorium as a power reactor fuel is based on a (n, γ) reaction of 232Th. The resulting nuclide, 233Th, is unstable to form

  19. 46 CFR 10.233 - Obligations of the holder of a merchant mariner credential.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Obligations of the holder of a merchant mariner... § 10.233 Obligations of the holder of a merchant mariner credential. (a) The holder of a credential may... credential. If the holder violates this section, the Coast Guard may pursue suspension or revocation of...

  20. 29 CFR 779.233 - Independent contractors performing work “for” an enterprise.

    Science.gov (United States)

    2010-07-01

    ... Apply; Enterprise Coverage Leased Departments, Franchise and Other Business Arrangements § 779.233... section 3(r) has reference to an independent business which performs services for other businesses as an established part of its own business activities. The term “independent contractor” as used in 3(r) thus...

  1. 48 CFR 52.233-4 - Applicable Law for Breach of Contract Claim.

    Science.gov (United States)

    2010-10-01

    ... Provisions and Clauses 52.233-4 Applicable Law for Breach of Contract Claim. As prescribed in 33.215(b), insert the following clause: Applicable Law for Breach of Contract Claim (OCT 2004) United States law... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Applicable Law for...

  2. Engineering evaluation/cost analysis for the 233-S Plutonium Concentration Facility

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1997-01-01

    The deactivated 233-S Plutonium Concentration Facility (233-S Facility) is located in the 200 Area. The facility has undergone severe degradation due to exposure to extreme weather conditions. A rapid freeze and thaw cycle occurred at the Hanford Site during February 1996, which caused cracking to occur on portions of the building`s roof. This has resulted in significantly infiltration of water into the facility, which provides a pathway for potential release of radioactive material into the environment (air and/or ground). The weather caused several existing cracks in the concrete portions of the structure to lengthen, increasing the potential for failed confinement of the radioactive material in the building. Differential settlement has also occurred, causing portions of the facility to separate from the main building structure thus creating a potential for release of radioactive material t the environment. An expedited removal action is proposed to ensure that a release from the 233-S Facility does not occur. The US Department of Energy (DOE), Richland Operations Office (RL), in cooperation with the EPA, has prepared this Engineering Evaluation/Cost Analysis (EE/CA) pursuant to CERCLA. Based on the evaluation, RL has determined that hazardous substances in the 233-S Facility may present a potential threat to human health and/or the environment, and that an expedited removal action is warranted. The purpose of the EE/CA is to provide the framework for the evaluation and selection of a technology from a viable set of alternatives for a removal action.

  3. 16 CFR 233.2 - Retail price comparisons; comparable value comparisons.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Retail price comparisons; comparable value... GUIDES AGAINST DECEPTIVE PRICING § 233.2 Retail price comparisons; comparable value comparisons. (a.... Expressed another way, if a number of the principal retail outlets in the area are regularly selling Brand...

  4. 5 CFR 591.233 - Who can receive a post differential?

    Science.gov (United States)

    2010-01-01

    ... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Who can receive a post differential? 591... ALLOWANCES AND DIFFERENTIALS Cost-of-Living Allowance and Post Differential-Nonforeign Areas Post Differentials § 591.233 Who can receive a post differential? An employee must meet all of the...

  5. 46 CFR 153.233 - Separation of tanks from machinery, service and other spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Separation of tanks from machinery, service and other... Design and Equipment Cargo Containment Systems § 153.233 Separation of tanks from machinery, service and... joint: (1) Machinery spaces. (2) Service spaces. (3) Accommodation spaces. (4) Spaces for...

  6. 24 CFR 5.233 - Mandated use of HUD's Enterprise Income Verification (EIV) System.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Mandated use of HUD's Enterprise... and Verification of Social Security Numbers and Employer Identification Numbers; Procedures for... § 5.233 Mandated use of HUD's Enterprise Income Verification (EIV) System. (a) Programs subject...

  7. Breeding of {sup 233}U in the thorium–uranium fuel cycle in VVER reactors using heavy water

    Energy Technology Data Exchange (ETDEWEB)

    Marshalkin, V. E., E-mail: marshalkin@vniief.ru; Povyshev, V. M. [Russian Federal Nuclear Center All-Russian Research Institute of Experimental Physics (VNIIEF) (Russian Federation)

    2015-12-15

    A method is proposed for achieving optimal neutron kinetics and efficient isotope transmutation in the {sup 233}U–{sup 232}Th oxide fuel of water-moderated reactors with variable water composition (D{sub 2}O, H{sub 2}O) that ensures breeding of the {sup 233}U and {sup 235}U isotopes. The method is comparatively simple to implement.

  8. 77 FR 67394 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Western Planning Area (WPA) Lease Sale 233...

    Science.gov (United States)

    2012-11-09

    ... Area (WPA) Lease Sale 233 and Central Planning Area (CPA) Lease Sale 231, Oil and Gas Lease Sales... Supplemental EIS for oil and gas lease sales tentatively scheduled in 2013 and 2014 in the WPA and CPA offshore... environmental and socioeconomic analyses for proposed WPA Lease Sale 233 and proposed CPA Lease Sale 231,...

  9. Calculation of Prompt Fission Neutron Spectrum for 233U(n, f) Reaction by Semi-empirical Method

    Institute of Scientific and Technical Information of China (English)

    CHEN; Yong-jing; LIU; Ting-jin; SHU; Neng-chuan

    2013-01-01

    The prompt fission neutron spectra for neutron-induced fission of 233U for low energy neutron(below 6 MeV)are calculated using the nuclear evaporation theory with a semi-empirical method,in which the partition of the total excitation energy between the fission fragments for the nth+233U fission

  10. Breeding of 233U in the thorium-uranium fuel cycle in VVER reactors using heavy water

    Science.gov (United States)

    Marshalkin, V. E.; Povyshev, V. M.

    2015-12-01

    A method is proposed for achieving optimal neutron kinetics and efficient isotope transmutation in the 233U-232Th oxide fuel of water-moderated reactors with variable water composition (D2O, H2O) that ensures breeding of the 233U and 235U isotopes. The method is comparatively simple to implement.

  11. Technical Competencies for the Safe Interim Storage and Management of 233U at U.S. Department of Energy Facilities

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, D.O.; Krichinsky, A.M.; Laughlin, S.S.; Van Essen, D.C.; Yong, L.K.

    1999-02-17

    Uranium-233 (with concomitant {sup 232}U) is a man-made fissile isotope of uranium with unique nuclear characteristics which require high-integrity alpha containment biological shielding, and remote handling. The special handling considerations and the fact that much of the {sup 233}U processing and large-scale handling was performed over a decade ago underscore the importance of identifying the people within the DOE complex who are currently working with or have worked with {sup 233}U. The availability of these key personnel is important in ensuring safe interim storage, management and ultimate disposition of {sup 233}U at DOE facilities. Significant programs are ongoing at several DOE sites with actinides. The properties of these actinide materials require many of the same types of facilities and handling expertise as does {sup 233}U.

  12. Intramolecular sensitization of americium luminescence in solution: shining light on short-lived forbidden 5f transitions.

    Science.gov (United States)

    Sturzbecher-Hoehne, M; Yang, P; D'Aléo, A; Abergel, R J

    2016-06-14

    The photophysical properties and solution thermodynamics of water soluble trivalent americium (Am(III)) complexes formed with multidentate chromophore-bearing ligands, 3,4,3-LI(1,2-HOPO), Enterobactin, and 5-LIO(Me-3,2-HOPO), were investigated. The three chelators were shown to act as antenna chromophores for Am(III), generating sensitized luminescence emission from the metal upon complexation, with very short lifetimes ranging from 33 to 42 ns and low luminescence quantum yields (10(-3) to 10(-2)%), characteristic of Near Infra-Red emitters in similar systems. The specific emission peak of Am(III) assigned to the (5)D1 → (7)F1 f-f transition was exploited to characterize the high proton-independent stability of the complex formed with the most efficient sensitizer 3,4,3-LI(1,2-HOPO), with a log β110 = 20.4 ± 0.2 value. In addition, the optical and solution thermodynamic features of these Am(III) complexes, combined with density functional theory calculations, were used to probe the influence of electronic structure on coordination properties across the f-element series and to gain insight into ligand field effects.

  13. Response of avalanche photo-diodes of the CMS Electromagnetic Calorimeter to neutrons from an Americium-Beryllium source.

    CERN Document Server

    Deiters, Konrad; Renker, Dieter

    2010-01-01

    The response of avalanche photo-diodes (APDs) used in the CMS Electromagnetic Calorimeter to low energy neutrons from an Americium-Beryllium source is reported. Signals due to recoil protons from neutron interactions with the hydrogen nuclei in the protective epoxy layer, mainly close to the silicon surface of the APD, have been identified. These signals increase in size with the applied bias voltage more slowly than the nominal gain of the APDs, and appear to have a substantially lower effective gain at the operating voltage. The signals originating from interactions in the epoxy are mostly equivalent to signals of a few GeV in CMS, but range up to a few tens of GeV equivalent. There are also signals not attributed to reactions in the epoxy extending up to the end of the range of these measurements, a few hundreds of GeV equivalent. Signals from the x-rays from the source can also be in the GeV equivalent scale in CMS. Simulations used to describe events due to particle interactions in the APDs need to take ...

  14. Determination by gamma-ray spectrometry of the plutonium and americium content of the Pu/Am separation scraps. Application to molten salts; Determination par spectrometrie gamma de la teneur en plutonium et en americium de produits issus de separation Pu/Am. Application aux bains de sels

    Energy Technology Data Exchange (ETDEWEB)

    Godot, A. [CEA Valduc, Dept. de Traitement des Materiaux Nucleaires, 21 - Is-sur-Tille (France); Perot, B. [CEA Cadarache, Dept. de Technologie Nucleaire, Service de Modelisation des Transferts et Mesures Nucleaires, 13 - Saint-Paul-lez-Durance (France)

    2005-07-01

    Within the framework of plutonium recycling operations in CEA Valduc (France), americium is extracted from molten plutonium metal into a molten salt during an electrolysis process. The scraps (spent salt, cathode, and crucible) contain extracted americium and a part of plutonium. Nuclear material management requires a very accurate determination of the plutonium content. Gamma-ray spectroscopy is performed on Molten Salt Extraction (MSE) scraps located inside the glove box, in order to assess the plutonium and americium contents. The measurement accuracy is influenced by the device geometry, nuclear instrumentation, screens located between the sample and the detector, counting statistics and matrix attenuation, self-absorption within the spent salt being very important. The purpose of this study is to validate the 'infinite energy extrapolation' method employed to correct for self-attenuation, and to detect any potential bias. We present a numerical study performed with the MCNP computer code to identify the most influential parameters and some suggestions to improve the measurement accuracy. A final uncertainty of approximately 40% is achieved on the plutonium mass. (authors)

  15. Review of thorium-U233 cycle thermal reactor benchmark studies (AWBA Development Program)

    Energy Technology Data Exchange (ETDEWEB)

    Ullo, J.J.; Hardy, J. Jr.; Steen, N.M.

    1980-03-01

    A survey is made of existing integral experiments for U233 systems and thorium-uranium based fuel systems. The aim is to understand to what extent they give a consistent test of ENDF/B-IV nuclear data. A principal result is that ENDF/B-IV leads to an underprediction of neutron leakage. Results from testing alternate thorium data sets are presented. For one evaluation due to Leonard, the results depict a possible growing discrepancy between measured integral parameters such as rho/sup 02/ and I/sup 232/ and the differential data, which underpredicts these parameters. Sensitivities to other nuclear data components, notably the fission neutron spectrum, were determined. A new harder U233 spectrum significantly reduces a bias trend in K/sub eff/ vs leakage.

  16. Transfer across the human gut of environmental plutonium, americium, cobalt, caesium and technetium: studies with cockles (Cerastoderma edule) from the Irish Sea.

    Science.gov (United States)

    Hunt, G J

    1998-06-01

    Our previous studies have indicated lower values of the gut transfer factor ('f1 values') for plutonium and americium in winkles (Littorina littorea) than adopted by ICRP. The present study was undertaken primarily to investigate whether this observation extends to other species. Samples of cockles (Carastoderma edule) from Ravenglass, Cumbria were eaten by volunteers who provided 24 h samples of urine and faeces. Urine samples indicated f1 values for cockles which were higher than for winkles; for plutonium these ranged overall up to 7 x 10(-4) with an arithmetic mean in the range (2-3) x 10(-4), and for americium up to 2.6 x 10(-4) with an arithmetic mean of 1.2 x 10(-4). Limited data based on volunteers eating cockles from the Solway suggest that f1 values for americium may be greater at distance from Sellafield. The measured values compare with 5 x 10(-4) used by the ICRP for environmental forms of both elements, which would appear to provide adequate protection when calculating doses from Cumbrian cockles. Data for other nuclides were obtained by analysing faecal samples from the volunteers who ate the Ravenglass cockles. Cobalt-60 showed an f1 value in the region of 0.2, twice the value currently used by ICRP. For 137Cs, variabilities were indicated in the range 0.08 to 0.43, within the ICRP value of f1 = 1.0. Technetium-99 gave f1 values up to about 0.6, in reasonable conformity with the ICRP value of 0.5.

  17. Transfer across the human gut of environmental plutonium, americium, cobalt, caesium and technetium: studies with cockles (Cerastoderma edule) from the Irish Sea

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, G.J. [CEFAS Laboratory, Lowestoft, Suffolk NR33 0HT (United Kingdom)

    1998-06-01

    Our previous studies have indicated lower values of the gut transfer factor ('f{sub L} values') for plutonium and americium in winkles (Littorina littorea) than adopted by ICRP. The present study was undertaken primarily to investigate whether this observation extends to other species. Samples of cockles (Cerastoderma edule) from Ravenglass, Cumbria were eaten by volunteers who provided 24 samples of urine and faeces. Urine samples indicated f{sub L} values for cockles which were higher than for winkles; for plutonium these ranged overall up to 7x10{sup -4} with an arithmetic mean in the range (2-3)x10{sup -4}, and for americium up to 2.6x10{sup -4} with an arithmetic mean of 1.2x10{sup -4}. Limited data based on volunteers eating cockles from the Solway suggest that f{sub L} values for americium may be greater at distance from Sellafield. The measured values compare with 5x10{sup -4} used by the ICRP for environmental forms of both elements, which would appear to provide adequate protection when calculating doses from Cumbrian cockles. Data for other nuclides were obtained by analysing faecal samples from the volunteers who ate the Ravenglass cockles. Cobalt-60 showed an f{sub L} value in the region of 0.2, twice the value currently used by ICRP. For {sup 137}Cs, variabilities were indicated in the range 0.08 to 0.43, within the ICRP value of f{sub L}=1.0. Technetium-99 gave f{sub L} values up to about 0.6, in reasonable conformity with the ICRP value of 0.5. (author)

  18. Plutonium, americium and radiocaesium in the marine environment close to the Vandellos I nuclear power plant before decommissioning

    Energy Technology Data Exchange (ETDEWEB)

    Sanchez-Cabeza, J.A. E-mail: joanalbert.sanchez@uab.es; Molero, J

    2000-11-01

    The Vandellos nuclear power plant (NPP), releasing low-level radioactive liquid waste to the Mediterranean Sea, is the first to be decommissioned in Spain, after an incident which occurred in 1989. The presence, distribution and uptake of various artificial radionuclides (radiocaesium, plutonium and americium) in the environment close to the plant were studied in seawater, bottom sediments and biota, including Posidonia oceanica, fish, crustaceans and molluscs. Seawater, sediments and Posidonia oceanica showed enhanced levels in the close vicinity of the NPP, although the effect was restricted to its near environment. Maximum concentrations in seawater were 11.6{+-}0.5 Bq m{sup -3} and 16.9{+-}1.2 mBq m{sup -3} for {sup 137}Cs and {sup 239,240}Pu, respectively. When sediment concentrations were normalized to excess {sup 210}Pb, they showed both the short-distance transport of artificial radionuclides from the Vandellos plant and the long-distance transport of {sup 137}Cs from the Asco NPP. Posidonia oceanica showed the presence of various gamma-emitters attributed to the impact of the Chernobyl accident, on which the effect of the NPP was superimposed. Seawater, sediment and Posidonia oceanica collected near the plant also showed an enhancement of the plutonium isotopic ratio above the fallout value. The uptake of these radionuclides by marine organisms was detectable but limited. Pelagic fish showed relatively higher {sup 137}Cs concentrations and only in the case of demersal fish was the plutonium isotopic ratio increased. The reported levels constitute a set of baseline values against which the impact of the decommissioning operations of the Vandellos I NPP can be studied.

  19. Site specific health and safety plan, 233-S decontamination and decommissioning

    Energy Technology Data Exchange (ETDEWEB)

    J. E. Fasso

    1997-12-31

    The deactivated 233-S Plutonium Concentration Facility, located in the 200 Area at the Hanford Site, is the subject of this Health and Safety Plan.The 233-S Facility operated from January 1952 until July 1967 at which time the building entered the U.S. Department of Energy`s Surplus Facility Management Program as a retired facility. The facility has since undergone severe degradation due to exposure to extreme weather conditions. Additionally, the weather caused existing cracks in concrete structures of the building to lengthen, thereby increasing the potential for failed confinement of the radioactive material in the building. Differential settlement has also occurred causing portions of the facility to separate from the main building structure, increasing the potential for release of radioactive material to the environment. An expedited response is proposed to remove this threat and ensure protection of human health and the environment. On this premise it is intended that the 233-S Facility removal action be performed as a Comprehensive Environmental Response, Compensation, and Liability Act of 1980 Time-Critical Project being conducted under the Pilot Hanford Environmental Restoration (ER) Initiative

  20. Criticality safety validation: Simple geometry, single unit {sup 233}U systems

    Energy Technology Data Exchange (ETDEWEB)

    Putman, V.L.

    1997-06-01

    Typically used LMITCO criticality safety computational methods are evaluated for suitability when applied to INEEL {sup 233}U systems which reasonably can be modeled as simple-geometry, single-unit systems. Sixty-seven critical experiments of uranium highly enriched in {sup 233}U, including 57 aqueous solution, thermal-energy systems and 10 metal, fast-energy systems, were modeled. These experiments include 41 cylindrical and 26 spherical cores, and 41 reflected and 26 unreflected systems. No experiments were found for intermediate-neutron-energy ranges, or with interstitial non-hydrogenous materials typical of waste systems, mixed {sup 233}U and plutonium, or reflectors such as steel, lead, or concrete. No simple geometry experiments were found with cubic or annular cores, or approximating infinite sea systems. Calculations were performed with various tools and methodologies. Nine cross-section libraries, based on ENDF/B-IV, -V, or -VI.2, or on Hansen-Roach source data, were used with cross-section processing methods of MCNP or SCALE. The k{sub eff} calculations were performed with neutral-particle transport and Monte Carlo methods of criticality codes DANT, MCNP 4A, and KENO Va.

  1. 16 CFR 23.3 - Misuse of the terms “hand-made,” “hand-polished,” etc.

    Science.gov (United States)

    2010-01-01

    ... RULES GUIDES FOR THE JEWELRY, PRECIOUS METALS, AND PEWTER INDUSTRIES § 23.3 Misuse of the terms “hand... bulk sheet, strip, wire, and similar items that have not been cut, shaped, or formed into jewelry...

  2. Effect of electrolyte concentration on low-temperature electrochemical properties of LaNi5 alloy electrodes at 233 K

    Institute of Scientific and Technical Information of China (English)

    ZHANG Xiaoyan; CHEN Yungui; TAO Mingda; WU Chaoling

    2008-01-01

    The effect of KOH electrolyte concentration on low-temperature electrochemical properties of LaNi5 alloy electrodes at 233 K was studied. The results indicated that the electrolyte concentration had great influence on discharge capacity and discharge voltage plateau of LaNi5 alloy electrode at 233 K, and the highest discharge capacity and discharge voltage plateau were both obtained at 6 mol/L KOH. When the KOH electrolyte concentration changed from 5 to 9 mol/L at 233 K, the high rate discharge ability (HRD) had the same change tendency as the diffusion coefficient, but the exchange current density did not change significantly, which implied that hydrogen diffusion was the control step at low temperature 233 K for discharge process of LaNi5 alloy electrode.

  3. Conserved aspartic acid 233 and alanine 231 are not required for poliovirus polymerase function in replicons

    Directory of Open Access Journals (Sweden)

    Freistadt Marion S

    2007-03-01

    Full Text Available Abstract Nucleic acid polymerases have similar structures and motifs. The function of an aspartic acid (conserved in all classes of nucleic acid polymerases in motif A remains poorly understood in RNA-dependent RNA polymerases. We mutated this residue to alanine in a poliovirus replicon. The resulting mutant could still replicate, although at a reduced level. In addition, mutation A231C (also in motif A yielded high levels of replication. Taken together these results show that poliovirus polymerase conserved residues D233 and A231 are not essential to poliovirus replicon function.

  4. Conserved aspartic acid 233 and alanine 231 are not required for poliovirus polymerase function in replicons

    Science.gov (United States)

    Freistadt, Marion S; Eberle, Karen E

    2007-01-01

    Nucleic acid polymerases have similar structures and motifs. The function of an aspartic acid (conserved in all classes of nucleic acid polymerases) in motif A remains poorly understood in RNA-dependent RNA polymerases. We mutated this residue to alanine in a poliovirus replicon. The resulting mutant could still replicate, although at a reduced level. In addition, mutation A231C (also in motif A) yielded high levels of replication. Taken together these results show that poliovirus polymerase conserved residues D233 and A231 are not essential to poliovirus replicon function. PMID:17352827

  5. Study on Mass Distribution of n+233U Fission With Phenomenological Model

    Institute of Scientific and Technical Information of China (English)

    LIU; Li-le; SHU; Neng-chuan; LIU; Ting-jin; CHEN; Xiao-song; SUN; Zheng-jun; CHEN; Yong-jing; QIAN; Jing

    2012-01-01

    <正>The yields, as well as the dependences on incident energy, of n+233U fission are important in study of the Th/U fuel cycle. A phenomenological model was used to study the yield mass distribution over the incident neutron energy of 0-20 MeV, which has 11 parameters and were determined by fitting to the measured cumulative yields. The model could well reproduce the measured data, which had a significant improvement, comparing with the results of systematic calculation program CYFP and Talys.

  6. Clinically abnormal case with paternally derived partial trisomy 8p23.3 to 8p12 including maternal isodisomy of 8p23.3: a case report

    Directory of Open Access Journals (Sweden)

    Thieme Heike

    2009-06-01

    Full Text Available Abstract Background Because of low copy repeats (LCRs and common inversion polymorphisms, the human chromosome 8p is prone to a number of recurrent rearrangements. Each of these rearrangements is associated with several phenotypic features. We report on a patient with various clinical malformations and developmental delay in connection with an inverted duplication event, involving chromosome 8p. Methods Chromosome analysis, multicolor banding analysis (MCB, extensive fluorescence in situ hybridization (FISH analysis and microsatellite analysis were performed. Results The karyotype was characterized in detail by multicolor banding (MCB, subtelomeric and centromere-near probes as 46,XY,dup(8(pter->p23.3::p12->p23.3::p23.3->qter. Additionally, microsatellite analysis revealed the paternal origin of the duplication and gave hints for a mitotic recombination involving about 6 MB in 8p23.3. Conclusion A comprehensive analysis of the derivative chromosome 8 suggested a previously unreported mechanism of formation, which included an early mitotic aberration leading to maternal isodisomy, followed by an inverted duplication of the 8p12p23.3 region.

  7. 233例大学生失眠的心因性研究%Investigation and Analysis on the Psychological Factors of 233 College Students' Insomnia

    Institute of Scientific and Technical Information of China (English)

    王连发; 夏冬芹

    2007-01-01

    目的 探讨大学生失眠产生的心因性因素.方法 采用睡眠状况自评量表(SRSS)和自编失眠心因性量表,对233名大学生的睡眠状况进行调查研究.结果 失眠的大学生SRSS总分以及因子分(除因子8外)都显著高于常模,而且失眠的大学生表现出非常显著的年级差异.抑郁、焦虑、疑病素质和自我挫败感等心因性因素与SRSS总分相关非常显著(P<0.01).抑郁、家庭经济贫困及学业成绩不及格因子进入逐步回归分析.结论 大学生,特别是失眠大学生的睡眠状况值得关注;应重在提高大学生失眠的心理应对、调节和改善机制.

  8. Process bases and specifications thorium---U-233 separations at the Purex Plant

    Energy Technology Data Exchange (ETDEWEB)

    Nielson, S.M.

    1965-07-26

    The Purex Plant was originally designed for the chemical processing of irradiated natural uranium. It has been used nearly exclusively for this purpose during its approximately ten-year operating lifetime. However, during the winter of 1964--1965, a special processing campaign was planned and accomplished in which approximately 6 tons of irradiated thoria targets were introduced to the plant, and the thorium-232 and uranium-233 were successfully separated and purified on a demonstration basis. For the demonstration thorium processing operation (6-ton test) of the winter of 1964--1965, process specifications were issued. These specifications were necessarily specific to the particular campaign inasmuch as a rather unusual processing scheme was required, by virtue of the small tonnage involved and the equipment limitations of the plant. Thus, for the relatively large operation subsequently planned, other process specifications are required. The purpose of this present document is to provide these specifications. Depending on the manner and extent of thorium -- uranium-233 production developments, these present specifications may have future application, at least in part. In addition to the process specifications, this document includes a section describing the flowsheet, and a section in which the technological bases for good process control are presented. In conjunction with the specifications, these sections are intended to provide the bases for the processing operations required to accomplish the processing objectives in a safe manner, and with minimum effect on equipment service life. All sections are organized in a manner to provide for relatively simple additions or revisions.

  9. Efficient Low-Voltage Operation of a CW Gyrotron Oscillator at 233 GHz.

    Science.gov (United States)

    Hornstein, Melissa K; Bajaj, Vikram S; Griffin, Robert G; Temkin, Richard J

    2007-02-01

    The gyrotron oscillator is a source of high average power millimeter-wave through terahertz radiation. In this paper, we report low beam power and high-efficiency operation of a tunable gyrotron oscillator at 233 GHz. The low-voltage operating mode provides a path to further miniaturization of the gyrotron through reduction in the size of the electron gun, power supply, collector, and cooling system, which will benefit industrial and scientific applications requiring portability. Detailed studies of low-voltage operation in the TE(2) (,) (3) (,) (1) mode reveal that the mode can be excited with less than 7 W of beam power at 3.5 kV. During CW operation with 3.5-kV beam voltage and 50-mA beam current, the gyrotron generates 12 W of RF power at 233.2 GHz. The EGUN electron optics code describes the low-voltage operation of the electron gun. Using gun-operating parameters derived from EGUN simulations, we show that a linear theory adequately predicts the low experimental starting currents.

  10. Shutdown margin for high conversion BWRs operating in Th-{sup 233}U fuel cycle

    Energy Technology Data Exchange (ETDEWEB)

    Shaposhnik, Y., E-mail: shaposhy@bgu.ac.il [NRCN – Nuclear Research Center Negev, POB 9001, Beer Sheva 84190 (Israel); Department of Nuclear Engineering, Ben-Gurion University of the Negev, POB 653, Beer Sheva 84105 (Israel); Shwageraus, E. [Department of Nuclear Engineering, Ben-Gurion University of the Negev, POB 653, Beer Sheva 84105 (Israel); Elias, E. [Faculty of Mechanical Engineering, Technion – Israel Institute of Technology, Technion City 32000, Haifa (Israel)

    2014-09-15

    Highlights: • BWR core operating in a closed self-sustainable Th-{sup 233}U fuel cycle. • Shutdown Margin in Th-RBWR design. • Fully coupled MC with fuel depletion and thermo-hydraulic feedback modules. • Thermal–hydraulic analysis includes MCPR observation. - Abstract: Several reactivity control system design options are explored in order to satisfy shutdown margin (SDM) requirements in a high conversion BWRs operating in Th-{sup 233}U fuel cycle (Th-RBWR). The studied core has an axially heterogeneous fuel assembly structure with a single fissile zone “sandwiched” between two fertile blanket zones. The utilization of an originally suggested RBWR Y-shape control rod in Th-RBWR is shown to be insufficient for maintaining adequate SDM to balance the high negative reactivity feedbacks, while maintaining fuel breeding potential, core power rating, and minimum Critical Power Ratio (CPR). Implementation of alternative reactivity control materials, reducing axial leakage through non-uniform enrichment distribution, use of burnable poisons, reducing number of pins as well as increasing pin diameter are also shown to be incapable of meeting the SDM requirements. Instead, an alternative assembly design, based on Rod Cluster Control Assembly with absorber rods was investigated. This design matches the reference ABWR core power and has adequate shutdown margin. The new concept was modeled as a single three-dimensional fuel assembly having reflective radial boundaries, using the BGCore system, which consists of the MCNP code coupled with fuel depletion and thermo-hydraulic feedback modules.

  11. The structures of CyMe4-BTBP complexes of americium(iii) and europium(iii) in solvents used in solvent extraction, explaining their separation properties.

    Science.gov (United States)

    Ekberg, Christian; Löfström-Engdahl, Elin; Aneheim, Emma; Foreman, Mark R StJ; Geist, Andreas; Lundberg, Daniel; Denecke, Melissa; Persson, Ingmar

    2015-11-14

    Separation of trivalent actinoid (An(iii)) and lanthanoid (Ln(iii)) ions is extremely challenging due to their similar ionic radii and chemical properties. Poly-aromatic nitrogen compounds acting as tetradentate chelating ligands to the metal ions in the extraction, have the ability to sufficiently separate An(iii) from Ln(iii). One of these compounds, 6,6'-bis(5,5,8,8-tetramethyl-5,6,7,8-tetrahydro-benzol[1,2,4]triazin-3-yl)[2,2]bipyridine, CyMe4-BTBP, has proven to be resistant towards acidic environments and strong radiation from radioactive decomposition. EXAFS studies of the dicomplexes of CyMe4-BTBP with americium(iii) and europium(iii) in nitrobenzene, cyclohexanone, 1-hexanol, 1-octanol and malonamide (DMDOHEMA) in 1-octanol have been carried out to get a deeper understanding of the parameters responsible for the separation. The predominating complexes independent of solvent used are [Am(CyMe4-BTBP)2(NO3)](2+) and [Eu(CyMe4-BTBP)2](3+), respectively, which are present as outer-sphere ion-pairs with nitrate ions in the studied solvents with low relative permittivity. The presence of a nitrate ion in the first coordination sphere of the americium(iii) complex compensates the charge density of the complex considerably in comparison when only outer-sphere ion-pairs are formed as for the [Eu(CyMe4-BTBP)2](3+) complex. The stability and solubility of a complex in a solvent with low relative permittivity increase with decreasing charge density. The [Am(CyMe4-BTBP)2(NO3)](2+) complex will therefore be increasingly soluble and stabilized over the [Eu(CyMe4-BTBP)2](3+) complex in solvents with decreasing relative permittivity of the solvent. The separation of americium(iii) from europium(iii) with CyMe4-BTBP as extraction agent will increase with decreasing relative permittivity of the solvent, and thereby also with decreasing solubility of CyMe4-BTBP. The choice of solvent is therefore a balance of a high separation factor and sufficient solubility of the CyMe4-BTBP

  12. A novel GH secretagogue, A233, exhibits enhanced growth activity and innate immune system stimulation in teleosts fish.

    Science.gov (United States)

    Martinez, Rebeca; Ubieta, Kenia; Herrera, Fidel; Forellat, Alina; Morales, Reynold; de la Nuez, Ania; Rodriguez, Rolando; Reyes, Osvaldo; Oliva, Ayme; Estrada, Mario P

    2012-09-01

    In teleosts fish, secretion of GH is regulated by several hypothalamic factors that are influenced by the physiological state of the animal. There is an interaction between immune and endocrine systems through hormones and cytokines. GH in fish is involved in many physiological processes that are not overtly growth related, such as saltwater osmoregulation, antifreeze synthesis, and the regulation of sexual maturation and immune functions. This study was conducted to characterize a decapeptide compound A233 (GKFDLSPEHQ) designed by molecular modeling to evaluate its function as a GH secretagogue (GHS). In pituitary cell culture, the peptide A233 induces GH secretion and it is also able to increase superoxide production in tilapia head-kidney leukocyte cultures. This effect is blocked by preincubation with the GHS receptor antagonist [d-Lys(3)]-GHRP6. Immunoneutralization of GH by addition of anti-tilapia GH monoclonal antibody blocked the stimulatory effect of A233 on superoxide production. These experiments propose a GH-mediated mechanism for the action of A233. The in vivo biological action of the decapeptide was also demonstrated for growth stimulation in goldfish and tilapia larvae (P<0.001). Superoxide dismutase levels, antiprotease activity, and lectin titer were enhanced in tilapia larvae treated with this novel molecule. The decapeptide A233 designed by molecular modeling is able to function as a GHS in teleosts and enhance parameters of the innate immune system in the fish larvae.

  13. Determination of Atto- to Femtogram Levels of Americium and Curium Isotopes in Large-Volume Urine Samples by Compact Accelerator Mass Spectrometry.

    Science.gov (United States)

    Dai, Xiongxin; Christl, Marcus; Kramer-Tremblay, Sheila; Synal, Hans-Arno

    2016-03-01

    Ultralow level analysis of actinides in urine samples may be required for dose assessment in the event of internal exposures to these radionuclides at nuclear facilities and nuclear power plants. A new bioassay method for analysis of sub-femtogram levels of Am and Cm in large-volume urine samples was developed. Americium and curium were co-precipitated with hydrous titanium oxide from the urine matrix and purified by column chromatography separation. After target preparation using mixed titanium/iron oxides, the final sample was measured by compact accelerator mass spectrometry. Urine samples spiked with known quantities of Am and Cm isotopes in the range of attogram to femtogram levels were measured for method evaluation. The results are in good agreement with the expected values, demonstrating the feasibility of compact accelerator mass spectrometry (AMS) for the determination of minor actinides at the levels of attogram/liter in urine samples to meet stringent sensitivity requirements for internal dosimetry assessment.

  14. Artificial radionuclides in the Northern European Marine Environment. Distribution of radiocaesium, plutonium and americium in sea water and sediments in 1995

    Energy Technology Data Exchange (ETDEWEB)

    Groettheim, Siri

    2000-07-01

    This study considers the distribution of radiocaesium, plutonium and americium in the northern marine environment. The highest radiocaesium activity in sea water was observed in Skagerrak, 26 Bq/m{sub 3}, and in surface sediments in the Norwegian Sea, 60 Bq/kg. These enhanced levels were related to Chernobyl. The highest 239,240Pu activity in surface water was measured in the western North Sea, 66 mBq/m{sub 3}. In sea water, sub-surface maxima were observed at several locations with an 239,240Pu activity up to 160 mBq/m{sub 3}, and were related to Sellafield. With the exception to the North Sea, surface sediments reflected Pu from global fallout from weapons tests only. (author)

  15. Development of an automatic method for americium and plutonium separation and preconcentration using an multisyringe flow injection analysis-multipumping flow system.

    Science.gov (United States)

    Fajardo, Yamila; Ferrer, Laura; Gómez, Enrique; Garcias, Francesca; Casas, Monserrat; Cerdà, Víctor

    2008-01-01

    A new procedure for automatic separation and preconcentration of 241Am and 239+240Pu from interfering matrixes using transuranide (TRU)-resin is proposed. Combination of the multisyringe flow injection analysis and multipumping flow system techniques with the TRU-resin allows carrying out the sampling treatment and separation in a short time using large sample volumes. Americium is eluted from the column with 4 mol L(-1) hydrochloric acid, and then plutonium is separated via on-column Pu(IV) reduction to Pu(III) with titanium(III) chloride. The corresponding alpha activities are measured off-line, with a relative standard deviation of 3% and a lower limit of detection of 0.004 Bq mL(-1), by using a multiplanchet low-background proportional counter.

  16. Recovery of Americium-241 from lightning rod by the method of chemical treatment; Recuperacion del Americio-241 provenientes de los pararrayos por el metodo de tratamiento quimico

    Energy Technology Data Exchange (ETDEWEB)

    Cruz, W.H., E-mail: wcruz@ipen.gob.pe [Instituto Peruano de Energia Nuclear (GRRA/IPEN), Lima (Peru). Division de Gestion de Residuos Radiactivos

    2013-07-01

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ({sup 241}Am), fewer and Radium 226 ({sup 226}Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of {sup 241}Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The {sup 241}Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel {sup 241}Am technique was used electrodeposition. (author)

  17. Americium-241 Decorporation Model

    Science.gov (United States)

    2014-10-01

    sources when combined with beryllium. Radioactive sources are used for a number of industrial applications that range from oil well logging devices...is any exposure resulting in a 50-year whole-body committed effective dose greater than 200 mSv (Rojas- Palma 2009). Therefore, the model can also...Tracheobronchial geometry: Human, dog, rat, hamster (Report LF-53). Lovelace Foundation, Albuquerque, NM Rojas- Palma C, et al. 2009. TMT Handbook

  18. Analysis of homogeneous U233 and U235 critical assemblies with ENDF/B-IV data (AWBA development program)

    Energy Technology Data Exchange (ETDEWEB)

    Ullo, J.J.; Hardy, J. Jr.

    1977-10-01

    Thirty-two U233 and U235 homogeneous aqueous critical experiments were analyzed with ENDF/B-IV data. Calculated eigenvalues for both fuel types increased by nearly 2 percent over the range of hydrogen/uranium atomic ratio covered (from 2106 to 27.1). This is attributed mostly to an underprediction of fast leakage, with some contribution from the fission and capture resonance integrals of ENDF/B-IV U235. Eigenvalue sensitivities to several nuclear data changes were examined. Values of the thermal criticality parameter constraint K2 for U233 and U235 were derived from the Gwin-Magnuson critical experiments at the zero leakage limit.

  19. Fuel utilization improvement in PWRs using the denatured /sup 233/U-Th cycle

    Energy Technology Data Exchange (ETDEWEB)

    Jones, H.M.; Schwenk, G.A.; Toops, E.C.; Yotinen, V.O.

    1980-06-01

    A number of changes in PWR core design and/or operating strategy were evaluated to assess the fuel utilization improvement achievable by their implementation in a PWR using thorium-based fuel and operating in a recycle mode. The reference PWR for this study was identical to the B and W Standard Plant except that the fuel pellets were of denatured (/sup 233/U//sup 238/U-Th)O/sub 2/. An initial scoping study identified the three most promising improvement concepts as (1) a very tight lattice, (2) thorium blankets, and (3) ThO/sub 2/ rods placed in available guide tubes. A conceptual core design incorporating these changes was then developed, and the fuel utilization of this modified design was compared with that of the reference case.

  20. Yeast Interacting Proteins Database: YLR166C, YGL233W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available YLR166C SEC10 Essential 100kDa subunit of the exocyst complex (Sec3p, Sec5p, Sec6p,... Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which has the essential function of mediating polarized targeti...s prey (0) YGL233W SEC15 Essential 113kDa subunit of the exocyst complex (Sec3p, ...ait ORF YLR166C Bait gene name SEC10 Bait description Essential 100kDa subunit of the exocyst complex (Sec3p..., Sec5p, Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which has the essential function of mediating po

  1. 233U mass yield measurements around and within the symmetry region with the ILL Lohengrin spectrometer

    Directory of Open Access Journals (Sweden)

    Chebboubi A.

    2016-01-01

    Full Text Available The study of fission yields has a major impact on the characterization and understanding of the fission process and is mandatory for reactor applications. The LPSC in collaboration with ILL and CEA has developed a measurement program on fission fragment distributions at the Lohengrin spectrometer of the ILL, with a special focus on the masses constituting the heavy peak. We will present in this paper our measurement of the very low fission yields in the symmetry mass region and the heavy mass wing of the distribution for 233U thermal neutron induced fission. The difficulty due to the strong contamination by other masses with much higher yields will be addressed in the form of a new analysis method featuring the required contaminant correction. The apparition of structures in the kinetic energy distributions and possible interpretations will be discussed, such as a possible evidence of fission modes.

  2. Shutdown Margin for High Conversion BWRs Operating in Th-233U Fuel Cycle

    CERN Document Server

    Shaposhnik, Yaniv; Elias, Ezra

    2013-01-01

    Several reactivity control system design options are explored in order to satisfy shutdown margin (SDM) requirements in a high conversion BWRs operating in Th-233U fuel cycle (Th-RBWR). The studied has an axially heterogeneous fuel assembly structure with a single fissile zone sandwiched between two fertile blanket zones. The utilization of an originally suggested RBWR Y-shape control rod in Th-RBWR is shown to be insufficient for maintaining adequate SDM to balance the high negative reactivity feedbacks, while maintaining fuel breeding potential, core power rating, and minimum Critical Power Ratio (CPR). Instead, an alternative assembly design, also relying on heterogeneous fuel zoning, is proposed for achieving fissile inventory ratio (FIR) above unity, adequate SDM and meeting minimum CPR limit at thermal core output matching the ABWR power. The new concept was modeled as a single 3-dimensional fuel assembly having reflective radial boundaries, using the BGCore system, which consists of the MCNP code coupl...

  3. 233U mass yield measurements around and within the symmetry region with the ILL Lohengrin spectrometer

    Science.gov (United States)

    Chebboubi, A.; Kessedjian, G.; Sage, C.; Bernard, D.; Blanc, A.; Faust, H.; Köster, U.; Litaize, O.; Mutti, P.; Serot, O.

    2016-03-01

    The study of fission yields has a major impact on the characterization and understanding of the fission process and is mandatory for reactor applications. The LPSC in collaboration with ILL and CEA has developed a measurement program on fission fragment distributions at the Lohengrin spectrometer of the ILL, with a special focus on the masses constituting the heavy peak. We will present in this paper our measurement of the very low fission yields in the symmetry mass region and the heavy mass wing of the distribution for 233U thermal neutron induced fission. The difficulty due to the strong contamination by other masses with much higher yields will be addressed in the form of a new analysis method featuring the required contaminant correction. The apparition of structures in the kinetic energy distributions and possible interpretations will be discussed, such as a possible evidence of fission modes.

  4. Laparoskopi ved formodet appendicitis acuta. Erfaringer med de 233 første laparoskopier på en universitetsafdeling

    DEFF Research Database (Denmark)

    Pedersen, A G; Petersen, O B; Wara, P

    1996-01-01

    In an initial stage of introducing laparoscopic appendicectomy, 233 patients with indication for surgical treatment were evaluated in an open prospective trial. Surgery was done by a total of 39 trainees on duty. The procedure was started as a diagnostic laparoscopy followed by laparoscopic appen...

  5. 45 CFR 233.34 - Computing the assistance payment in the initial one or two months (AFDC).

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Computing the assistance payment in the initial... § 233.34 Computing the assistance payment in the initial one or two months (AFDC). A State shall compute.... (d) A State may suspend, rather than terminate, assistance when: (1) The agency has knowledge of,...

  6. 29 CFR 2.33 - Responsibilities of DOL, DOL social service providers and State and local governments...

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Responsibilities of DOL, DOL social service providers and... Organizations; Protection of Religious Liberty of Department of Labor Social Service Providers and Beneficiaries § 2.33 Responsibilities of DOL, DOL social service providers and State and local...

  7. Characterization of the HBB: c.*233G > C Variant: No Evidence of a β-Thalassemic Phenotype.

    Science.gov (United States)

    Smith, Debra L; Mitui, Midori; Park, Jason Y; Luu, Hung S; Timmons, Charles F

    2016-01-01

    β-Thalassemia (β-thal) results from homozygous or compound heterozygous inheritance of β-globin alleles that yield decreased or absent synthesis of the β chain. Disease is frequently severe, requiring lifelong transfusion therapy. Heterozygosity for a β-thal allele results in an asymptomatic carrier state with mild but characteristic hematological findings. More than 200 β-globin alleles have been demonstrated to produce β-thal. For populations with a high prevalence of β-thal, screening for carrier status, genetic counseling and prenatal diagnosis are important components of efforts to both reduce disease incidence and provide early diagnosis and treatment. It is therefore important to define and characterize potential β-thal alleles. We sought to further characterize the previously reported β-thal allele, HBB: c.*233G > C. This variant is provisionally included in the HbVar database based on a study of Palestinians in the Gaza Strip with β-thal disease or carrier status (known or suspected) where 4.2% of subjects were found to have HBB: c.*233G > C. In our patient population, we detected the HBB: c.*233G > C variant in 17.3% of individuals (17 heterozygotes, one homozygote) undergoing β hemoglobin (Hb) gene sequencing at our laboratory over a 25-month period. Hematological parameters were analyzed to determine if these individuals demonstrated findings consistent with inheritance of a β-thal allele. Individuals with the HBB: c.*233G > C variant did not demonstrate any abnormalities in hematological parameters characteristic of β-thal carrier state (17 heterozygotes) or clinical evidence of disease (homozygote). Our data demonstrate no evidence for pathogenicity of the HBB: c.*233G > C variant but rather demonstrate that this variant is a common benign polymorphism.

  8. Actinide Oxidation State and O/M Ratio in Hypostoichiometric Uranium-Plutonium-Americium U0.750Pu0.246Am0.004O2-x Mixed Oxides.

    Science.gov (United States)

    Vauchy, Romain; Belin, Renaud C; Robisson, Anne-Charlotte; Lebreton, Florent; Aufore, Laurence; Scheinost, Andreas C; Martin, Philippe M

    2016-03-07

    Innovative americium-bearing uranium-plutonium mixed oxides U1-yPuyO2-x are envisioned as nuclear fuel for sodium-cooled fast neutron reactors (SFRs). The oxygen-to-metal (O/M) ratio, directly related to the oxidation state of cations, affects many of the fuel properties. Thus, a thorough knowledge of its variation with the sintering conditions is essential. The aim of this work is to follow the oxidation state of uranium, plutonium, and americium, and so the O/M ratio, in U0.750Pu0.246Am0.004O2-x samples sintered for 4 h at 2023 K in various Ar + 5% H2 + z vpm H2O (z = ∼ 15, ∼ 90, and ∼ 200) gas mixtures. The O/M ratios were determined by gravimetry, XAS, and XRD and evidenced a partial oxidation of the samples at room temperature. Finally, by comparing XANES and EXAFS results to that of a previous study, we demonstrate that the presence of uranium does not influence the interactions between americium and plutonium and that the differences in the O/M ratio between the investigated conditions is controlled by the reduction of plutonium. We also discuss the role of the homogeneity of cation distribution, as determined by EPMA, on the mechanisms involved in the reduction process.

  9. Nylon and teflon scribe effect on NBR to Chemlok 233 and NBR to NBR bond interfaces

    Science.gov (United States)

    Jensen, S. K.

    1990-01-01

    A study was requested by Manufacturing Engineering to determine what effects marking with nylon (6/6) and Teflon scribes may have on subsequent bonding. Witness panel bond specimens were fabricated by the development lab to test both acrylonitrile butadiene rubber (NBR) to Chemlok and NBR to NBR after controlled exposure. The nylon rod used as a scribe tool demonstrates virtually no bond deterioration when used to scribe lines on either the Chemlok to NBR surfaces or the NBR to NBR interface. Lab test results indicate that the nylon rod-exposed samples produce tensile and peel values very similar to the control samples and the Teflon exposed samples produce tensile and peel values much lower than the control samples. Visual observation of the failure surfaces of the tested samples shows that Teflon scribing produces an obvious contamination to the surface and the nylon produces no effect. Photographs of test samples are provided. It is concluded that Teflon stock used as a scribe tool on a Chemlok 233 to NBR surface or an NBR to NBR surface has a detrimental effect on the bond integrity on either of these bond interfaces. Therefore, it is recommended that the nylon rod continue to be used where a scribe line is required in the redesigned solid rocket motor segment insulation layup operations. The use of Teflon scribes should not be considered.

  10. Reinvestigation of the α-decays of 249Cf and 233U

    Science.gov (United States)

    Aka, A. Koua; Ardisson, G.; Barci, V.; El Samad, O.; Trubert, D.; Ahmad, I.

    1996-02-01

    The alpha-particle decay of 249Cf has been reinvestigated using coaxial and planar HPGe detectors. Energies and emission probabilities of thirty γ-rays were measured, of which nine are reported for the first time. All transitions have been included in the 245Cm level scheme suggested in this work: 14 excited states are found to be fed and assigned to 4 rotational bands. The Iπ = {11}/{2}- member of the {7}/{2} [743] Nilsson state was found to be fed at 772.3 keV. Alpha-particle transition probabilities were calculated from the revised 249Cf decay scheme. The alpha-particle decay of 233U has been reinvestigated using a UO 22+ source purified continuously from daughters by ion exchange chromatography. Energies and intensities of 178 γ-rays were determined, of which 49 are reported for the first time. γ-γ coincidence studies were also performed to help in the construction of the 229Th level scheme.

  11. Measurements of neutron induced capture and fission reactions on $^{233}$ U (EAR1)

    CERN Multimedia

    The $^{233}$U plays the essential role of ssile nucleus in the Th-U fuel cycle, which has been proposed as a safer and cleaner alternative to the U-Pu fuel cycle. Considered the scarce data available to assess the capture cross section, a measurement was proposed and successfully performed at the n_TOF facility at CERN using the 4$\\pi$ Total Absorp- tion Calorimeter (TAC). The measurement was extremely dicult due to the need to accurately distinguish between capture and fission $\\gamma$-rays without any additional discrim-ination tool and the measured capture cross section showed a signicant disagreement in magnitude when compared with the ENDF/B-VII.1 library despite the agreement in shape. We propose a new measurement that is aimed at providing a higher level of dis-crimination between competing nuclear reactions, to extend the neutron energy range and to obtain more precise and accurate data, thus fullling the demands of the "NEA High Priority Nuclear Data Request List". The setup is envisaged as a combin...

  12. Rapid oxygenation of Earth's atmosphere 2.33 billion years ago.

    Science.gov (United States)

    Luo, Genming; Ono, Shuhei; Beukes, Nicolas J; Wang, David T; Xie, Shucheng; Summons, Roger E

    2016-05-01

    Molecular oxygen (O2) is, and has been, a primary driver of biological evolution and shapes the contemporary landscape of Earth's biogeochemical cycles. Although "whiffs" of oxygen have been documented in the Archean atmosphere, substantial O2 did not accumulate irreversibly until the Early Paleoproterozoic, during what has been termed the Great Oxygenation Event (GOE). The timing of the GOE and the rate at which this oxygenation took place have been poorly constrained until now. We report the transition (that is, from being mass-independent to becoming mass-dependent) in multiple sulfur isotope signals of diagenetic pyrite in a continuous sedimentary sequence in three coeval drill cores in the Transvaal Supergroup, South Africa. These data precisely constrain the GOE to 2.33 billion years ago. The new data suggest that the oxygenation occurred rapidly-within 1 to 10 million years-and was followed by a slower rise in the ocean sulfate inventory. Our data indicate that a climate perturbation predated the GOE, whereas the relationships among GOE, "Snowball Earth" glaciation, and biogeochemical cycling will require further stratigraphic correlation supported with precise chronologies and paleolatitude reconstructions.

  13. Analysis of evolution and virological characteristics of rtI233V mutations in the hepatitis B virus reverse transcriptase domain

    Directory of Open Access Journals (Sweden)

    Xiao-ling YE

    2015-04-01

    Full Text Available Objective To analyze the evolution of rtI233V mutation in the reverse transcriptase domain of hepatitis B virus (HBV and its association with adefovir dipivoxil (ADV resistance. Methods The rate of detection of rtI233V mutation in 9830 patients with chronic HBV infection was analyzed. HBV reverse transcriptase genes isolated from serial serum samples of two patients were amplified by nested PCR, and clonal sequencing (>20 clones/sample was performed to analyze the evolution of rtI233V mutations. The replica of pTriEx-HBV1.1 vectors harboring wild-type and mutant strains (rtI233V, rtN236T, rtI233V+rtN236T were respectively constructed and transiently transfected into HepG2 cells. Media containing serial concentrations of lamivudine (LAM, ADV, entecavir (ETV, or tenofovir (TDF were used to treat the cells. Then HBV DNA in the supernatants was quantitatively determined by real-time PCR in order to analyze HBV mutants' replication competence and phenotypic characteristics under the drug pressures. Results The detection rate of rtI233V mutation in 9830 nucleos(tide analogues-treated patients was 0.28% (28/9830, including 0.19% (19 patients with rtI233V individual mutation and 0.09% (9 patients with rtI233V mutation combining with rtN236T or other mutations. All of the patients had rtI233V had ADV exposure history: 16 (57.1% of them received ADV monotherapy for over six months, and 12(42.9% of them received ADV combined sequential therapy for over 12 months. Replication competence and phenotypic resistance analysis showed rtI233V and wild-type strains had similar viral replication competence, while rtN236T exhibited significantly lower replication competence compared with wild-type strains. rtI233V strains remained sensitive to LAM, ADV, ETV, and TDF and showed little influence on drug resistance when combined with rtN236T, but it showed ability to restore the defected replication capacity of rtN236T strains. Conclusions  The rtI233V mutation

  14. Study of biosorbents application on the treatment of radioactive liquid wastes with americium-241; Estudo da aplicacao de biossorventes no tratamento de rejeitos radioativos liquidos contendo americio-241

    Energy Technology Data Exchange (ETDEWEB)

    Borba, Tania Regina de

    2010-07-01

    The use of nuclear energy for many different purposes has been intensified and highlighted by the benefits that it provides. Medical diagnosis and therapy, agriculture, industry and electricity generation are examples of its application. However, nuclear energy generates radioactive wastes that require suitable treatment ensuring life and environmental safety. Biosorption and bioaccumulation represent an emergent alternative for the treatment of radioactive liquid wastes, providing volume reduction and physical state change. This work aimed to study biosorbents for the treatment of radioactive liquid wastes contaminated with americium-241 in order to reduce the volume and change the physical state from liquid to solid. The biosorbents evaluated were Saccharomyces cerevisiae immobilized in calcium alginate beads, inactivated and free cells of Saccharomyces cerevisiae, calcium alginate beads, Bacillus subtilis, Cupriavidus metallidurans and Ochrobactrum anthropi. The results were quite satisfactory, achieving 100% in some cases. The technique presented in this work may be useful and viable for implementing at the Waste Management Laboratory of IPEN - CNEN/SP in short term, since it is an easy and low cost method. (author)

  15. Human bones obtained from routine joint replacement surgery as a tool for studies of plutonium, americium and {sup 90}Sr body-burden in general public

    Energy Technology Data Exchange (ETDEWEB)

    Mietelski, Jerzy W., E-mail: jerzy.mietelski@ifj.edu.pl [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Edward B. [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Department of Physical Therapy Basics, Faculty of Physical Therapy, Administration College, Bielsko-Biala (Poland); Tomankiewicz, Ewa [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Joanna [Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Nowak, Sebastian [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Szczygiel, Elzbieta [Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Brudecki, Kamil [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland)

    2011-06-15

    The paper presents a new sampling method for studying in-body radioactive contamination by bone-seeking radionuclides such as {sup 90}Sr, {sup 239+240}Pu, {sup 238}Pu, {sup 241}Am and selected gamma-emitters, in human bones. The presented results were obtained for samples retrieved from routine surgeries, namely knee or hip joints replacements with implants, performed on individuals from Southern Poland. This allowed to collect representative sets of general public samples. The applied analytical radiochemical procedure for bone matrix is described in details. Due to low concentrations of {sup 238}Pu the ratio of Pu isotopes which might be used for Pu source identification is obtained only as upper limits other then global fallout (for example Chernobyl) origin of Pu. Calculated concentrations of radioisotopes are comparable to the existing data from post-mortem studies on human bones retrieved from autopsy or exhumations. Human bones removed during knee or hip joint surgery provide a simple and ethical way for obtaining samples for plutonium, americium and {sup 90}Sr in-body contamination studies in general public. - Highlights: > Surgery for joint replacement as novel sampling method for studying in-body radioactive contamination. > Proposed way of sampling is not causing ethic doubts. > It is a convenient way of collecting human bone samples from global population. > The applied analytical radiochemical procedure for bone matrix is described in details. > The opposite patient age correlations trends were found for 90Sr (negative) and Pu, Am (positive).

  16. Simultaneous {sup 233}U and{sup 235}U characterization through the assay of delayed neutron temporal behavior

    Energy Technology Data Exchange (ETDEWEB)

    Sellers, M. T.; Corcoran, E. C.; Kelly, D. G. [Dept. of Chemistry and Chemical Engineering, Royal Military College of Canada, Stn. Forces, P.O. Box 17000, Kingston, ON K7K 7B4 (Canada)

    2012-07-01

    Aqueous solutions containing dissolved uranium-233 and uranium-235 were irradiated for 60's in the SLOWPOKE-2 reactor at the Royal Military College of Canada. The temporal behavior of the delayed neutrons produced was recorded by the Facility's Delayed Neutron Counting (DNC) system. The percentage of uranium-233 as a function of total fissile mass present in each sample ranged from 0 to 100% and was predicted by the DNC system with average absolute errors of {+-} 4%. Future work will upgrade the system electronics and software to reduce both uncertainties in timings and electrical noise. Mixture analysis will also be expanded to include plutonium-239 and fissile materials contained in non-aqueous matrices. (authors)

  17. Material control and accountability aspects of safeguards for the USA /sup 233/U/TH fuel recycle plant

    Energy Technology Data Exchange (ETDEWEB)

    Carpenter, Jr., J. A.; McNeany, S. R.; Angelini, P.; Holder, N. D.; Abraham, L.

    1979-01-01

    Two fuel cycles are considered. The highly enriched uranium (HEU) cycle uses uranium enriched 93% in /sup 235/U as the initial fuel. The medium enriched uranium (MEU) cycle uses uranium with a /sup 235/U enrichment less than 20% as its initial fuel. In both, /sup 233/U is bred from thorium. The HEU /sup 235/U and the /sup 233/U of both cycles are recycled. The MEU /sup 235/U is retired to waste after one reactor cycle. Typical heavy metal contents of spent fuel elements from both cycles are presented. The main functional areas of the recycle plant are Shipping, Receiving, and Storage; Reprocessing; Refabrication; and Waste Treatment. A real-time materials accountability system will manage the data provided by measurements from all four areas. Simulations of material flow used in the HTGR development program are forerunners of such a system. The material control and accountability aspects of Reprocessing and Refabrication only are discussed. The proposed accountability areas are identified and the measurement techniques appropriate to various streams crossing the boundaries of the areas are identified. Special emphasis is placed on novel nondestructive methods developed for assaying solid materials containing /sup 233/U-Th. The material form, total uranium and plutonium, and activity of selected reprocessing streams are listed. The isotopics and activity of the uranium input into Refabrication are also presented.

  18. Molecular Gas and Dust in the Massive Star Forming Region S 233 IR

    Institute of Scientific and Technical Information of China (English)

    Rui-Qing Mao; Qin Zeng

    2004-01-01

    The massive star forming region S 233 IR is observed in the molecular lines CO J = 2-1, 3-2, NH3 (1,1), (2,2) and the 870μm dust continuum. Four submillimeter continuum sources, labelled SMM 1-4, are revealed in the 870μm dust emission. The main core, SMM1, is found to be associated with a deeply embedded near infrared cluster in the northeast; while the weaker source SMM2 coincides with a more evolved cluster in the southwest. The best fit spectral energy distribution of SMM1 gives an emissivity ofβ = 1.6, and temperatures of 32 K and 92 K for the cold- and hot-dust components. An SMM1 core mass of 246 M⊙ and a total mass of 445 M⊙ are estimated from the 870 μm dust continuum emission.SMM1 is found to have a temperature gradient decreasing from inside out, indicative of the presence of interior heating sources. The total outflow gas mass as traced by the CO J - 3-2 emission is estimated to be 35 M⊙. Low velocity outflows are also found in the NH3 (1,1) emission. The non-thermal dominant NH3 line width as well as the substantial core mass suggest that the SMM1 core is a "turbulent,massive dense core", in the process of forming a group or a cluster of stars. The much higher star formation efficiency found in the southwest cluster supports the suggestion that this cluster is more evolved than the northeast one. Large near infrared photometric variations found in the source PCS-IR93, a previously found highly polarized nebulosity, indicate an underlying star showing the FU Orionis type of behavior.

  19. 8 CFR 233.5 - Aliens entering Guam pursuant to section 14 of Public Law 99-396, “Omnibus Territories Act.”

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Aliens entering Guam pursuant to section 14 of Public Law 99-396, âOmnibus Territories Act.â 233.5 Section 233.5 Aliens and Nationality... entering Guam pursuant to section 14 of Public Law 99-396, “Omnibus Territories Act.” A transportation...

  20. Autoimmune diseases induced by TNF-targeted therapies: analysis of 233 cases.

    Science.gov (United States)

    Ramos-Casals, Manuel; Brito-Zerón, Pilar; Muñoz, Sandra; Soria, Natalia; Galiana, Diana; Bertolaccini, Laura; Cuadrado, Maria-Jose; Khamashta, Munther A

    2007-07-01

    Tumor necrosis factor (TNF)-targeted therapies are increasingly used for a rapidly expanding number of rheumatic and autoimmune diseases. With this use and longer follow-up periods of treatment, there are a growing number of reports of the development of autoimmune processes related to anti-TNF agents. We have analyzed the clinical characteristics, outcomes, and patterns of association with the different anti-TNF agents used in all reports of autoimmune diseases developing after TNF-targeted therapy found through a MEDLINE search of articles published between January 1990 and December 2006. We identified 233 cases of autoimmune diseases (vasculitis in 113, lupus in 92, interstitial lung diseases in 24, and other diseases in 4) secondary to TNF-targeted therapies in 226 patients. The anti-TNF agents were administered for rheumatoid arthritis (RA) in 187 (83%) patients, Crohn disease in 17, ankylosing spondylitis in 7, psoriatic arthritis in 6, juvenile RA in 5, and other diseases in 3. The anti-TNF agents administered were infliximab in 105 patients, etanercept in 96, adalimumab in 21, and other anti-TNF agents in 3. We found 92 reported cases of lupus following anti-TNF therapy (infliximab in 40 cases, etanercept in 37, and adalimumab in 15). Nearly half the cases fulfilled 4 or more classification criteria for systemic lupus erythematosus (SLE), which fell to one-third after discarding preexisting lupus-like features. One hundred thirteen patients developed vasculitis after receiving anti-TNF agents (etanercept in 59 cases, infliximab in 47, adalimumab in 5, and other agents in 2). Leukocytoclastic vasculitis was the most frequent type of vasculitis, and purpura was the most frequent cutaneous lesion. A significant finding was that one-quarter of patients with vasculitis related to anti-TNF agents had extracutaneous involvement. Twenty-four cases of interstitial lung disease associated with the use of anti-TNF agents were reported. In these patients, 2 specific

  1. The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium

    Energy Technology Data Exchange (ETDEWEB)

    Ketelaer, Jens

    2010-06-14

    The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium: Nuclear masses are an important quantity to study nuclear structure since they reflect the sum of all nucleonic interactions. Many experimental possibilities exist to precisely measure masses, out of which the Penning trap is the tool to reach the highest precision. Moreover, absolute mass measurements can be performed using carbon, the atomic-mass standard, as a reference. The new double-Penning trap mass spectrometer TRIGA-TRAP has been installed and commissioned within this thesis work, which is the very first experimental setup of this kind located at a nuclear reactor. New technical developments have been carried out such as a reliable non-resonant laser ablation ion source for the production of carbon cluster ions and are still continued, like a non-destructive ion detection technique for single-ion measurements. Neutron-rich fission products will be available by the reactor that are important for nuclear astrophysics, especially the r-process. Prior to the on-line coupling to the reactor, TRIGA-TRAP already performed off-line mass measurements on stable and long-lived isotopes and will continue this program. The main focus within this thesis was on certain rare-earth nuclides in the well-established region of deformation around N {proportional_to} 90. Another field of interest are mass measurements on actinoids to test mass models and to provide direct links to the mass standard. Within this thesis, the mass of {sup 241}Am could be measured directly for the first time. (orig.)

  2. Fission, total and neutron capture cross section measurements at ORELA for {sup 233}U, {sup 27}Al and natural chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Guber, K.H.; Spencer, R.R.; Leal, L.C.; Larson, D.C.; Santos, G. Dos; Harvey, J.A.; Hill, N.W.

    1998-08-01

    The authors have made use of the Oak Ridge Electron Linear Accelerator (ORELA) to measure the fission cross section of {sup 233}U in the neutron energy range of 0.36 eV to {approximately} 700 keV. This paper reports integral data and average cross sections. In addition they measured the total neutron cross section of {sup 27}Al and natural chlorine, as well as the capture cross section of Al over an energy range from 100 eV up to about 400 keV.

  3. Calculation of Prompt Fission Neutron from 233U(n, f) Reaction by Multi-Modal Los Alamos Model%Calculation of Prompt Fission Neutron from 233U(n, f) Reaction by Multi-Modal Los Alamos Model

    Institute of Scientific and Technical Information of China (English)

    郑娜; 钟春来; 樊铁栓

    2012-01-01

    An attempt is made to improve the evaluation of the prompt fission neutron emis- sion from 233U(n, f) reaction for incident neutron energies below 6 MeV. The multi-modal fission approach is applied to the improved version of Los Alamos model and the point by point model. The prompt fission neutron spectra and the prompt fission neutron as a function of fragment mass (usually named "sawtooth" data) v(A) are calculated independently for the three most dominant fission modes (standard I, standard II and superlong), and the total spectra and v(A) are syn- thesized. The multi-modal parameters are determined on the basis of experimental data of fission fragment mass distributions. The present calculation results can describe the experimental data very well, and the proposed treatment is thus a useful tool for prompt fission neutron emission prediction.

  4. Investigation of the fission yields of the fast neutron-induced fission of {sup 233}U; Mesure de la distribution en masse et en charge des produits de la fission rapide de l'{sup 233}U

    Energy Technology Data Exchange (ETDEWEB)

    Galy, J

    1999-09-01

    As a stars, a survey of the different methods of investigations of the fission product yields and the experimental data status have been studied, showing advantages and shortcomings for the different approaches. An overview of the existing models for the fission product distributions has been as well intended. The main part of this thesis was the measurement of the independent yields of the fast neutron-induced fission of{sup 233}U, never investigated before this work. The experiment has been carried out using the mass separator OSIRIS (Isotope Separator On-Line). Its integrated ion-source and its specific properties required an analysis of the delay-parameter and ionisation efficiency for each chemical species. On the other hand, this technique allows measurement of independent yields and cumulative yields for elements from Cu to Ba, covering most of the fission yield distribution. Thus, we measured about 180 independent yields from Zn (Z=30) to Sr (Z=38) in the mass range A=74-99 and from Pd (Z=46) to Ba (Z=56) in the mass range A=113-147, including many isomeric states. An additional experiment using direct {gamma}-spectroscopy of aggregates of fission products was used to determine more than 50 cumulative yields of element with half-life from 15 min to a several days. All experimental data have been compared to estimates from a semi-empirical model, to calculated values and to evaluated values from the European library JEF 2.2. Furthermore, a study of both thermal and fast neutron-induced fission of {sup 233}U measured at Studsvik, the comparison of the OSIRIS and LOHENGRIN facilities and the trends in new data for the Reactors Physics have been discussed. (author)

  5. Contribution to the study of {sup 233}U production with MOX-ThPu fuel in PWR reactor. Transition scenarios towards Th/{sup 233}U iso-generating concepts in thermal spectrum. Development of the MURE fuel evolution code; Contribution a l'etude de la production d'{sup 233}U en combustible MOX-ThPu en reacteur a eau sous pression. Scenarios de transition vers des concepts isogenerateurs Th/{sup 233}U en spectre thermique. Developpement du code MURE d'evolution du combustible

    Energy Technology Data Exchange (ETDEWEB)

    Michel-Sendis, F

    2006-12-15

    If nuclear power is to provide a significant fraction of the growing world energy demand, only through the breeding concept can the development of sustainable nuclear energy become a reality. The study of such a transition, from present-day nuclear technologies to future breeding concepts is therefore pertinent. Among these future concepts, those using the thorium cycle Th/U-233 in a thermal neutron spectrum are of particular interest; molten-salt type thermal reactors would allow for breeding while requiring comparatively low initial inventories of U-233. The upstream production of U-233 can be obtained through the use of thorium-plutonium mixed oxide fuel in present-day light water reactors. This work presents, firstly, the development of the MURE evolution code system, a C++ object-oriented code that allows the study, through Monte Carlo (M.C.) simulation, of nuclear reactors and the evolution of their fuel under neutron irradiation. The M.C. methods are well-suited for the study of any reactor, whether it'd be an existing reactor using a new kind of fuel or a future concept altogether, the simulation is only dependent on nuclear data. Exact and complex geometries can be simulated and continuous energy particle transport is performed. MURE is an interface with MCNP, the well-known and validated transport code, that allows, among other functionalities, to simulate constant power and constant reactivity evolutions. Secondly, the study of MOX ThPu fuel in a conventional light water reactor (REP) is presented; it explores different plutonium concentrations and isotopic qualities in order to evaluate their safety characteristics. Simulation of their evolution allows us to quantify the production of U-233 at the end of burnup. Last, different french scenarios validating a possible transition towards a park of thermal Th/U-233 breeders, are presented. In these scenarios, U-233 is produced in ThPu moxed light water reactors. (author)

  6. Cost-based optimizations of power density and target-blanket modularity for {sup 232}Th/{sup 233}U-based ADEP

    Energy Technology Data Exchange (ETDEWEB)

    Krakowski, R.A.

    1995-07-01

    A cost-based parametric systems model is developed for an Accelerator-Driven Energy Production (ADEP) system based on a {sup 232}Th/{sup 233}U fuel cycle and a molten-salt (LiF/BeF{sub 2}/ThF{sub 3}) fluid-fuel primary system. Simplified neutron-balance, accelerator, reactor-core, chemical-processing, and balance-of-plant models are combined parametrically with a simplified costing model. The main focus of this model is to examine trade offs related to fission power density, reactor-core modularity, {sup 233}U breeding rate, and fission product transmutation capacity.

  7. Critical Experiments With Aqueous Solutions of {sup 233}UO{sub 2}(NO{sub 3}){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, J.T.

    2001-05-17

    This report provides the critical experimenter's interpretations and descriptions of informal critical experiment logbook notes and associated information (e.g., experimental equipment designs/sketches, chemical and isotopic analyses, etc.) for the purpose of formally documenting the results of critical experiments performed in the late 1960s at the Oak Ridge Critical Experiments Facility. The experiments were conducted with aqueous solutions of 97.6 wt % {sup 233}U uranyl nitrate having uranium densities varying between about 346 g U/l and 45 g U/l. Criticality was achieved with single simple units (e.g., cylinders and spheres) and with spaced subcritical simple cylindrical units arranged in unreflected, water-reflected, and polyethylene reflected critical arrays.

  8. Critical Experiments With Aqueous Solutions of {sup 233}UO{sub 2}(NO{sub ;3}){sub 2}

    Energy Technology Data Exchange (ETDEWEB)

    Thomas, J T

    2001-05-17

    This report provides the critical experimenter's interpretations and descriptions of informal critical experiment logbook notes and associated information (e.g., experimental equipment designs/sketches, chemical and isotopic analyses, etc.) for the purpose of formally documenting the results of critical experiments performed in the late 1960s at the Oak Ridge Critical Experiments Facility. The experiments were conducted with aqueous solutions of 97.6 wt % {sup 233}U uranyl nitrate having uranium densities varying between about 346 g U/l and 45 g U/l. Criticality was achieved with single simple units (e.g., cylinders and spheres) and with spaced subcritical simple cylindrical units arranged in unreflected, water-reflected, and polyethylene reflected critical arrays.

  9. Partial trisomy of 11q23.3-q25 inherited from a maternal low-level mosaic unbalanced translocation.

    Science.gov (United States)

    Choi, Jungyoon; Lee, Hojung; Lee, Cha Gon

    2015-08-01

    Partial trisomy of 11q is characterized by pre/postnatal growth retardation, microcephaly, dysmorphic craniofacial features, cognitive disability, abnormal muscle tone, inguinal hernia, and possible congenital heart defects. Here, we describe a 17-year-old male with a 17.77 Mb-sized [arr 11q23.3-q25 (116,667,559 -134,434,130) ×3] partial trisomy resulting from the unbalanced translocation between chromosomes 11 and 22. The terminal translocation was detected using oligonucleotide array comparative genomic hybridization (CGH) with fluorescence in situ hybridization (FISH) confirmation. The partial trisomy was inherited from his mother who had the low-level (22.7%) mosaic unbalanced translocation and a normal phenotype. The patient showed most of the common features of partial trisomy 11q syndrome, with additional findings, including mesenteric fibromatosis.

  10. Nuclear structure of229Th from γ-ray spectroscopy study of233U α-particle decay

    Science.gov (United States)

    Barci, V.; Ardisson, G.; Barci-Funel, G.; Weiss, B.; El Samad, O.; Sheline, R. K.

    2003-09-01

    The level structure of 229Th, produced by α-particle decay of 233U, was studied with γ-ray spectroscopy measurements. The sources were continuously separated from daughters with ion-exchange chromatographic methods. Singles and coincidence measurements were performed with high-purity germanium detectors. Energies and intensities of about 220 γ rays were accurately determined. About 70 transitions were reported for the first time, especially in the 300 700 keV energy range. A 229Th level scheme was proposed, accounting for 220 transitions among 47 excited states. Alpha-particle feeding intensities and hindrance factors were deduced and compared to direct α-particle measurements; the agreement was found to be relatively good. The level structure was interpreted in the framework of rotational and/or reflection asymmetric models. The agreement with experimental data was shown to be satisfactory.

  11. Performance Study of RS (255, 239 and RS (255.233 Used Respectively in DVB-T and NASA

    Directory of Open Access Journals (Sweden)

    Hajri Abdesslam

    2016-11-01

    Full Text Available The error correction codes have a wide range of applications in digital communication (satellite, wireless and digital data storage. This paper presents a comparative study of performance between RS (255, 239 and RS (255.233 used respectively in the Digital Video Broadcasting – Terrestrial (DVB-T and National Aeronautics and Space Administration (NASA. The performances were evaluated by applying modulation scheme in additive white Gaussian noise (AWGN channel. Performances of modulation with RS codes are evaluated in bit error rate (BER and signal energy -to- noise power density ratio (Eb / No. The analysis is studied with the help of MATLAB simulator to analyze a communication link with AWGN Channel, and different modulations.

  12. Multiplicity and energy of neutrons from {sup 233}U(n{sub th},f) fission fragments

    Energy Technology Data Exchange (ETDEWEB)

    Nishio, Katsuhisa; Kimura, Itsuro; Nakagome, Yoshihiro [Kyoto Univ. (Japan)

    1998-03-01

    The correlation between fission fragments and prompt neutrons from the reaction {sup 233}U(n{sub th},f) was measured with improved accuracy. The results determined the neutron multiplicity and emission energy as a function of fragment mass and total kinetic energy. The average energy as a function of fragment mass followed a nearly symmetric distribution centered about the equal mass-split and formed a remarkable contrast with the saw-tooth distribution of the average neutron multiplicity. The neutron multiplicity from the specified fragment decreases linearly with total kinetic energy, and the slope of multiplicity with kinetic energy had the minimum value at about 130 u. The level density parameter versus mass determined from the neutron data showed a saw-tooth structure with the pronounced minimum at about 128 and generally followed the formula by Gilbert and Cameron, suggesting that the neutron emission process was very much affected by the shell-effect of the fission fragment. (author)

  13. Within the framework of the new fuel cycle {sup 232}Th/{sup 233}U, determination of the {sup 233}Pa(n.{gamma}) radiative capture cross section for neutron energies ranging between 0 and 1 MeV; Dans le cadre du nouveau cycle de combustible {sup 232}Th/{sup 233}U, determination de la section efficace de capture radiative {sup 233}Pa(n,{gamma}) pour des energies de neutrons comprises entre 0 et 1 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Boyer, S

    2004-10-15

    The Thorium cycle Th{sup 232}/U{sup 233} may face brilliant perspectives through advanced concepts like molten salt reactors or accelerator driven systems but it lacks accurate nuclear data concerning some nuclei. Pa{sup 233} is one of these nuclei, its high activity makes the direct measurement of its radiative neutron capture cross-section almost impossible. This difficulty has been evaded by considering the transfer reaction Th{sup 232}(He{sup 3},p)Pa{sup 234}* in which the Pa{sup 234} nucleus is produced in various excited states according to the amount of energy available in the reaction. The first chapter deals with the thorium cycle and its assets to contribute to the quenching of the fast growing world energy demand. The second chapter gives a detailed description of the experimental setting. A scintillation detector based on deuterated benzene (C{sub 6}D{sub 6}) has been used to counter gamma ray cascades. The third chapter is dedicated to data analysis. In the last chapter we compare our experimental results with ENDF and JENDL data and with computed values from 2 statistical models in the 0-1 MeV neutron energy range. Our results disagree clearly with evaluated data: our values are always above ENDF and JENDL data but tend to near computed values. We have also perform the measurement of the radiative neutron cross-section of Pa{sup 231} for a 110 keV neutron: {sigma}(n,{gamma}) 2.00 {+-} 0.14 barn. (A.C.)

  14. EURADOS action for determination of americium in skull measures in vivo and Monte Carlo simulation; Accion EURADOS para la determinacion de americio en craneo mediante medidas in-vivo y simulacion Monte Carlo

    Energy Technology Data Exchange (ETDEWEB)

    Lopez Ponte, M. A.; Navarro Amaro, J. F.; Perez Lopez, B.; Navarro Bravo, T.; Nogueira, P.; Vrba, T.

    2013-07-01

    From the Group of WG7 internal dosimetry of the EURADOS Organization (European Radiation Dosimetry group, e.V.) which It coordinates CIEMAT, international action for the vivo measurement of americium has been conducted in three mannequins type skull with detectors of Germanium by gamma spectrometry and simulation by Monte Carlo methods. Such action has been raised as two separate exercises, with the participation of institutions in Europe, America and Asia. Other actions similar precede this vivo intercomparison of measurement and modeling Monte Carlo1. The preliminary results and associated findings are presented in this work. The laboratory of the body radioactivity (CRC) of service counter of dosimetry staff internal (DPI) of the CIEMAT, it has been one of the participants in vivo measures exercise. On the other hand part, the Group of numerical dosimetry of CIEMAT is participant of the Monte Carlo2 simulation exercise. (Author)

  15. Americium behaviour in plastic vessels

    Energy Technology Data Exchange (ETDEWEB)

    Legarda, F.; Herranz, M. [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain); Idoeta, R., E-mail: raquel.idoeta@ehu.e [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain); Abelairas, A. [Departamento de Ingenieria Nuclear y Mecanica de Fluidos, Escuela Tecnica Superior de Ingenieria de Bilbao, Universidad del Pais Vasco (UPV/EHU), Alameda de Urquijo s/n, 48013 Bilbao (Spain)

    2010-07-15

    The adsorption of {sup 241}Am dissolved in water in different plastic storage vessels was determined. Three different plastics were investigated with natural and distilled waters and the retention of {sup 241}Am by these plastics was studied. The same was done by varying vessel agitation time, vessel agitation speed, surface/volume ratio of water in the vessels and water pH. Adsorptions were measured to be between 0% and 70%. The adsorption of {sup 241}Am is minimized with no water agitation, with PET or PVC plastics, and by water acidification.

  16. Comparative proteomic analysis of growth hormone secretagogue A233 treatment of murine macrophage cells J774A.2 indicates it has a role in antiviral innate response

    Directory of Open Access Journals (Sweden)

    Rebeca Martínez

    2016-03-01

    General Significance: The increase of IFN-γ level and the differential modulation of antiviral proteins by the A233 peptide suggest that the molecule could activate an innate immune response with a possible further impact in the treatment of acute and chronic diseases.

  17. Utilization of non-weapons-grade plutonium and highly enriched uranium with breeding of the 233U isotope in the VVER reactors using thorium and heavy water

    Science.gov (United States)

    Marshalkin, V. E.; Povyshev, V. M.

    2015-12-01

    A method for joint utilization of non-weapons-grade plutonium and highly enriched uranium in the thorium-uranium—plutonium oxide fuel of a water-moderated reactor with a varying water composition (D2O, H2O) is proposed. The method is characterized by efficient breeding of the 233U isotope and safe reactor operation and is comparatively simple to implement.

  18. Measurement of the fission cross section induced by fast neutrons of the {sup 232}Th/{sup 233}U nuclei within the innovating fuel cycles framework; Mesure de la section efficace de fission induite par neutrons rapides des noyaux {sup 232}Th/{sup 233}U dans le cadre des cycles de combustible innovants

    Energy Technology Data Exchange (ETDEWEB)

    Grosjean, C

    2005-03-15

    The thorium-U{sup 233} fuel cycle might provided safer and cleaner nuclear energy than the present Uranium/Pu fuelled reactors. Over the last 10 years, a vast campaign of measurements has been initiated to bring the precision of neutron data for the key nuclei (Th{sup 232}, Pa{sup 233} and U{sup 233}) at the level of those for the U-Pu cycle. This is the framework of these measurements, the energy dependent neutron induced fission cross section of Th{sup 232} and U{sup 233} has been measured from 1 to 7 MeV with a target accuracy lesser than 5 per cent. These measurements imply the accurate determination of the fission rate, the number of the target nuclei as well as the incident neutron flux impinging on the target, the latter has been obtained using the elastic scattering (n,p). The cross section of which is very well known in a large neutron energy domain ({approx} 0,5 % from 1 eV to 50 MeV) compared to the U{sup 235}(n,f) reaction. This technique has been applied for the first time to the Th{sup 232}(n,f) and U{sup 233}(n,f) cases. A Hauser-Feshbach statistical model has been developed. It consists of describing the different decay channels of the compound nucleus U{sup 234} from 0,01 to 10 MeV neutron energy. The parameters of this model were adjusted in order to reproduce the measured fission cross section of U{sup 233}. From these parameters, the cross sections from the following reactions could be extracted: inelastic scattering U{sup 233}(n,n'), radiative capture U{sup 233}(n,{gamma}) and U{sup 233}(n,2n). These cross sections are still difficult to measure by direct neutron reactions. The calculated values have allowed us to fill the lack of experimental data for the major fissile nucleus of the thorium cycle. (author)

  19. A 233 km Circumference Tunnel for $e^+$$e^-$, $p$$\\bar {p}$, and $\\mu^{+} \\mu^{-}$ Colliders

    CERN Document Server

    Lyons, George T

    2011-01-01

    In 2001 a cost analysis survey was conducted to build a 233km circumference tunnel in northern Illinois in which to build a Very Large Hadron Collider. Ten years later I have reexamined the proposal, taking into consideration the technological advancements in all the aspects of construction cost analysis. I outline the implementations of $e^+ e^-$, $p{\\bar{p}}$, and $\\mu^+\\mu^-$ collider rings in the tunnel using 21${\\rm{st}}$ century technology. The $e^+e^-$ collider employs a Crab Waist Crossing, ultra low emittance damped bunches, 12 GV of superconducting RF, and 0.026 Tesla low coercivity grain oriented silicon steel/concrete dipoles. The $p{\\bar{p}}$ collider uses the high intensity Fermilab $\\bar{p}$ source, exploits high cross sections for $p\\bar{p}$ production of high mass states, and uses 2 Tesla ultra low carbon steel/YBCO superconductor magnets run with liquid neon. The $\\mu^+\\mu^-$ ring ramps the $p{\\bar{p}}$ magnets at 8 Hz every 0.4 seconds, uses 250 GV of SRF, and mitigates neutrino radiation w...

  20. Ammonia excitation imaging of shocked gas towards the W28 gamma-ray source HESS J1801-233

    CERN Document Server

    Maxted, Nigel I; Rowell, Gavin P; Nicholas, Brent P; Burton, Michael G; Walsh, Andrew; Fukui, Yasuo; Kawamura, Akiko

    2016-01-01

    We present 12 mm Mopra observations of the dense (>10^3 cm^-3 ) molecular gas towards the north-east (NE) of the W28 supernova remnant (SNR). This cloud is spatially well-matched to the TeV gamma-ray source HESS J1801-233 and is known to be a SNR-molecular cloud interaction region. Shock-disruption is evident from broad NH3 (1,1) spectral line-widths in regions towards the W28 SNR, while strong detections of spatially-extended NH3(3,3), NH3(4,4) and NH3(6,6) inversion emission towards the cloud strengthen the case for the existence of high temperatures within the cloud. Velocity dispersion measurements and NH3(n,n)/(1,1) ratio maps, where n=2, 3, 4 and 6, indicate that the source of disruption is from the side of the cloud nearest to the W28 SNR, suggesting that it is the source of cloud-disruption. Towards part of the cloud, the ratio of ortho to para-NH3 is observed to exceed 2, suggesting gas-phase NH3 enrichment due to NH3 liberation from dust grain mantles. The measured NH3 abundance with respect to H2 i...

  1. Reforma tributária: os efeitos macroeconômicos e setoriais da PEC 233/2008

    Directory of Open Access Journals (Sweden)

    Nelson Leitão Paes

    2011-06-01

    Full Text Available A despeito de um histórico desalentador, o atual governo enviou nova proposta de reforma tributária ao Congresso Nacional, a PEC 233/2008. A proposta unifica alguns tributos federais do consumo no IVA-F, simplifica e diminui drasticamente a legislação do ICMS, alivia a tributação sobre a folha de pagamento e bens essenciais e desonera investimentos. Para a análise do impacto destas mudanças, foi construído um modelo de equilíbrio geral, que contempla 55 firmas no lado produtivo da economia. Os resultados sugerem que do lado agregado haverá modesta expansão do produto, consumo, emprego e investimento, com pequena perda de arrecadação e aumento de bem-estar. Houve substanciais alterações no produto setorial, com uma tendência de aumento dos setores industrial e agropecuário em detrimento dos serviços.

  2. Genotype and phenotype of a new 2-bp deletion of hMSH2 at codon 233.

    Science.gov (United States)

    Müller, A; Beyser, K; Arps, H; Bolander, S; Becker, H; Rüschhoff, J

    2001-08-01

    Germline mutations within mismatch repair genes, such as hMSH2, hMLH1, and hMSH6, have been shown to be the hallmark of the hereditary nonpolyposis colorectal cancer (HNPCC) syndrome. The spectrum of tumors associated with mismatch repair gene defects and the possible relationship between genotype and phenotype are still unclear. Therefore, the spectrum of tumors and the possible genotype-phenotype relationship are still under discussion. Here, we report on a family with a new germline mutation in the hMSH2 gene with a 2-bp deletion at codons 232 and 233 leading to a frame shift and a stop at codon 254. Accordingly, immunohistochemistry revealed loss of hMSH2 expression in colorectal carcinomas of three affected family members. In this one family, there was a high penetrance. Interestingly, mutational screening of the family revealed a high penetrance of the mutation affecting four of five tested people at risk, with a high mortality rate and a trend toward lower age of onset in subsequent generations. Finally, a metachronous breast cancer in one patient turned out to be a tumor unrelated to microsatellite instability phenocopy, i.e., a sporadic tumor unrelated to HNPCC that expressed the hMSH2 gene and did not show any microsatellite instability.

  3. Mutation S233L in the 1B domain of keratin 1 causes epidermolytic palmoplantar keratoderma with "tonotubular" keratin.

    Science.gov (United States)

    Terron-Kwiatkowski, Ana; van Steensel, Maurice A M; van Geel, Michel; Lane, E Birgitte; McLean, W H Irwin; Steijlen, Peter M

    2006-03-01

    Epidermolytic palmoplantar keratoderma (EPPK) is an autosomal dominant genodermatosis characterized by epidermolytic hyperkeratosis restricted to the palm and sole epidermis. The disorder is normally associated with dominant-negative mutations in the keratin 9 (K9) gene; however, a small number of cases have been reported where causative mutations were identified in the K1 gene. Here, we present two unrelated Dutch EPPK families with striking ultrastructural findings: tubular keratin structures in the cytoplasm of suprabasal cells. Similar structures were reported previously in a German EPPK family and were termed "tonotubular" keratin. After excluding the involvement of the K9 gene by complete sequencing, we identified a novel mutation, S233L, at the beginning of the 1B domain of K1 in both families. Protein expression studies in cultured cells indicated pathogenicity of this mutation. This is the first report of a genetic defect in this domain of K1. The unusual gain-of-function mutation points to a subtle role of the 1B domain in mediating filament-filament interactions with regular periodicity.

  4. C2 Fracture Subtypes, Incidence, and Treatment Allocation Change with Age: A Retrospective Cohort Study of 233 Consecutive Cases

    Directory of Open Access Journals (Sweden)

    Anna-Lena Robinson

    2017-01-01

    Full Text Available The currently available data on the distribution of C2 fracture subtypes is sparse. This study was designed to identify the proportions of the second cervical vertebra (C2 fracture subtypes and to present age and gender specific incidences of subgroups. A dataset of all patients treated between 2002 and 2014 for C2 fractures was extracted from the regional hospital information system. C2 fractures were classified into odontoid fractures types 1, 2, and 3, Hangman’s fractures types 1, 2, and 3, and atypical C2 fractures. 233 patients (female 51%, age 72±19 years were treated for a C2 fracture. Odontoid fractures were found in 183 patients, of which 2 were type 1, 127 type 2, and 54 type 3, while 26 of C2 fractures were Hangman’s fractures and 24 were atypical C2 fractures. In the geriatric subgroup 89% of all C2 fractures were odontoid, of which 71% were type 2 and 29% type 3. There was an increasing incidence of odontoid fractures types 2 and 3 from 2002 to 2014. 40% of C2 fractures were treated surgically. This study presents reliable subset proportions of C2 fractures in a prospectively collected regional cohort. Knowledge of these proportions facilitates future epidemiological studies of C2 fractures.

  5. C2 Fracture Subtypes, Incidence, and Treatment Allocation Change with Age: A Retrospective Cohort Study of 233 Consecutive Cases.

    Science.gov (United States)

    Robinson, Anna-Lena; Möller, Anders; Robinson, Yohan; Olerud, Claes

    2017-01-01

    The currently available data on the distribution of C2 fracture subtypes is sparse. This study was designed to identify the proportions of the second cervical vertebra (C2) fracture subtypes and to present age and gender specific incidences of subgroups. A dataset of all patients treated between 2002 and 2014 for C2 fractures was extracted from the regional hospital information system. C2 fractures were classified into odontoid fractures types 1, 2, and 3, Hangman's fractures types 1, 2, and 3, and atypical C2 fractures. 233 patients (female 51%, age 72 ± 19 years) were treated for a C2 fracture. Odontoid fractures were found in 183 patients, of which 2 were type 1, 127 type 2, and 54 type 3, while 26 of C2 fractures were Hangman's fractures and 24 were atypical C2 fractures. In the geriatric subgroup 89% of all C2 fractures were odontoid, of which 71% were type 2 and 29% type 3. There was an increasing incidence of odontoid fractures types 2 and 3 from 2002 to 2014. 40% of C2 fractures were treated surgically. This study presents reliable subset proportions of C2 fractures in a prospectively collected regional cohort. Knowledge of these proportions facilitates future epidemiological studies of C2 fractures.

  6. Measurement of the $^{233}$U neutron capture cross section at the n_TOF facility at CERN

    CERN Document Server

    Carrapiço, Carlos; Berthoumieux, Eric; Gonçalves, Isabel; Gunsing, Frank

    2012-12-12

    The Thorium-Uranium (Th-U) fuel cycle has been envisaged as an alternative to the Uranium-Plutonium (U-Pu) fuel cycle for electricity generation using nuclear power reactors. Indeed, thorium can be used as a nuclear fuel, and several studies and R&D programs seem to provide evidence on the sustainability of the Th-U fuel cycle, due to (i) the natural abundance of Thorium, (ii) the improved proliferation resistance offered by the Th-U fuel cycle relative to the U-Pu fuel cycle, (iii) the better neutronics performance of the Th-U fuel cycle throughout the whole neutron energy range compared to the U-Pu fuel cycle, (iv) the lower radiotoxicity of the generated spent fuel in reactors with Th-U fuel cycle and, consequently (v) better economics and public acceptance of the reactors operated using the Th-U fuel cycle compared to those using the U-Pu fuel cycle (prior to the Generation IV nuclear reactors). In a nuclear reactor operated using the Th-U fuel cycle, $^{233}$U is a key nuclide governing the neutr...

  7. 我院药物临床试验中严重不良事件报告233例分析%Analysis of 233 Cases of Severe Adverse Events in Drug Clinical Trials of Our Hospital

    Institute of Scientific and Technical Information of China (English)

    张田香; 陆明莹; 张彩霞; 袁祖贻

    2016-01-01

    目的:为药物临床试验中进行质控和保护受试者权益提供参考。方法:收集我院2012年1月-2015年6月上报的药物临床试验中的233例严重不良事件(SAE)报告,按照受试者性别、年龄、上报科室、药物/器械种类、药物/器械名称、SAE的类型、SAE与药物/器械的相关性、受试者合并疾病情况等进行统计分析。结果:男性SAE发生率高于女性(71.2%vs.28.8%);SAE主要发生在50岁以上的人群中(189例,81.1%);心内科SAE发生率最高(137例,58.8%);主要的SAE类型是导致住院(183例,78.5%);大部分SAE与研究药物肯定无关(164例,70.4%);发生SAE的受试者中一半以上自身合并有其他疾病(128例,54.9%)。结论:为确保药物临床试验数据的质量和受试者的安全,临床试验过程中研究者应重点加强对老年和自身合并疾病受试者的管理,确保每例SAE得到及时处理,并如实记录和报告。%OBJECTIVE:To provide reference for performing quality control and protecting the subjects’rights and interests. METHODS:233 severe adverse events (SAE) cases reported by our hospital during Jan. 2012-Jun. 2015 were collected and ana-lyzed statistically in respects of subjects’gender and age,department,drug/equipment types,SAE types,relationship of SAE with drug/equipment,comorbidities,etc. RESULTS:The incidence of SAE in male was higher than female(71.2% vs. 28.8%);SAE mainly occurred in people over the age of 50(189 cases,81.1%);the incidence of SAE in cardiology department was the highest (137 cases,58.8%);main SAE type was hospitalization(183 cases,78.5%);most of SAE had nothing to do with studied drugs (164 cases,70.4%);more than half of the subjects suffered from other comorbidities(128 cases,54.9%). CONCLUSIONS:In order to ensure the quality of drug clinical trial data and safety of subjects,the investigator should strengthen the management of the

  8. Fission Product Yields of 233U, 235U, 238U and 239Pu in Fields of Thermal Neutrons, Fission Neutrons and 14.7-MeV Neutrons

    Science.gov (United States)

    Laurec, J.; Adam, A.; de Bruyne, T.; Bauge, E.; Granier, T.; Aupiais, J.; Bersillon, O.; Le Petit, G.; Authier, N.; Casoli, P.

    2010-12-01

    The yields of more than fifteen fission products have been carefully measured using radiochemical techniques, for 235U(n,f), 239Pu(n,f) in a thermal spectrum, for 233U(n,f), 235U(n,f), and 239Pu(n,f) reactions in a fission neutron spectrum, and for 233U(n,f), 235U(n,f), 238U(n,f), and 239Pu(n,f) for 14.7 MeV monoenergetic neutrons. Irradiations were performed at the EL3 reactor, at the Caliban and Prospero critical assemblies, and at the Lancelot electrostatic accelerator in CEA-Valduc. Fissions were counted in thin deposits using fission ionization chambers. The number of fission products of each species were measured by gamma spectrometry of co-located thick deposits.

  9. Determination of the extraction efficiency for $^{233}$U source $\\alpha$-recoil ions from the MLL buffer-gas stopping cell

    CERN Document Server

    von der Wense, Lars; Laatiaoui, Mustapha; Thirolf, Peter G

    2016-01-01

    Following the $\\alpha$ decay of $^{233}$U, $^{229}$Th recoil ions are shown to be extracted in a significant amount from the MLL buffer-gas stopping cell. The produced recoil ions and subsequent daughter nuclei are mass purified with the help of a customized quadrupole mass spectrometer. The combined extraction and mass-purification efficiency for $^{229}$Th$^{3+}$ is determined via MCP-based measurements and via the direct detection of the $^{229}$Th $\\alpha$ decay. A large value of $(10\\pm2)$\\% for the combined extraction and mass-purification efficiency of $^{229}$Th$^{3+}$ is obtained at a mass resolution of about 1 u/e. In addition to $^{229}$Th, also other $\\alpha$-recoil ions of the $^{233,232}$U decay chains are addressed.

  10. Utilization of non-weapons-grade plutonium and highly enriched uranium with breeding of the {sup 233}U isotope in the VVER reactors using thorium and heavy water

    Energy Technology Data Exchange (ETDEWEB)

    Marshalkin, V. E., E-mail: marshalkin@vniief.ru; Povyshev, V. M. [Russian Federal Nuclear Center All-Russian Research Institute of Experimental Physics (Russian Federation)

    2015-12-15

    A method for joint utilization of non-weapons-grade plutonium and highly enriched uranium in the thorium–uranium—plutonium oxide fuel of a water-moderated reactor with a varying water composition (D{sub 2}O, H{sub 2}O) is proposed. The method is characterized by efficient breeding of the {sup 233}U isotope and safe reactor operation and is comparatively simple to implement.

  11. De Novo Trisomy 1q10q23.3 Mosaicism Causes Microcephaly, Severe Developmental Delay, and Facial Dysmorphic Features but No Cardiac Anomalies

    Directory of Open Access Journals (Sweden)

    Shirley Lo-A-Njoe

    2016-01-01

    Full Text Available Proximal duplications of chromosome 1q are rare chromosomal abnormalities. Most patients with this condition present with neurological, urogenital, and congenital heart disease and short life expectancy. Mosaicism for trisomy 1q10q23.3 has only been reported once in the literature. Here we discuss a second case: a girl with a postnatal diagnosis of a de novo pure mosaic trisomy 1q1023.3 who has no urogenital or cardiac anomalies.

  12. A HST study of the environment of the Herbig Ae/Be star LkHa 233 and its bipolar jet

    CERN Document Server

    Melnikov, Stanislav Yu; Eislöffel, Jochen; Bacciotti, Francesca; Locatelli, Ugo; Ray, Thomas P

    2008-01-01

    We present the results of HST/STIS and WFPC2 observations of LkHa 233 and its environment. LkHa233 is a Herbig Ae/Be star with a collimated bipolar jet. We investigate optical forbidden lines along the LkHa 233 jet to determine physical parameters of this jet (electron density n_e, hydrogen ionisation fraction x_e, electron temperature T_e, and mass density n_H). The knowledge of these parameters allows us a direct comparison of a jet from a Herbig star with those from T Tauri stars. The WFPC2 images in broad-band filters clearly show a dark lane caused either by a circumstellar disk or a dust torus. In the blueshifted lobe, n_e is close to or above the critical density for [SII] lines (2.5x10^4 cm^-3) in the first arcsecond and decreases with distance from the source. The ionisation x_e~0.2-0.6 gently rises for the first 500 AU of the flow and shows two re-ionisation events further away from the origin. The T_e varies along the flow between 10^4 K and 3x10^4 K. The (radial) outflow velocities are ~ 80-160 km...

  13. A MOLECULARLY CHARACTERIZED INTERSTITIAL DELETION ENCOMPASSING THE 11q14.1-q23.3 REGION IN A CASE WITH MULTIPLE CONGENITAL ABNORMALITIES.

    Science.gov (United States)

    Cetin, Z; Altiok-Clark, O; Yakut, S; Guzel-Nur, B; Mihci, E; Berker-Karauzum, S

    2016-01-01

    Interstitial deletion of chromosome 11 long arm is a rare event. In most of the interstitial deletions on the long arm of chromosome 11 both the position and the size of these deletions are heterogeneous making a precise karyotype-phenotype correlation. In only a few of the reported cases has the deletion been molecularly characterized. Our patient was a 13-year-old male presented; mental motor retardation, strabismus, myopia, retinopathy, sensorineural hearing loss, a long and triangular face, a broad forehead, hypotelorism, nasal septal deviation, a beaked nose, hypoplastic ala nasie, bilateral low-set ears, a high arched palate, crowded teeth, retrognathia, thin lips, a long neck, and sloping shoulders, hyperactive behavior, pulmonary stenosis and lumbar scoliosis. Conventional cytogenetic analysis revealed 46,XY,del(11)(q14.1-q23.3) karyotype in the patient. Array-CGH analysis of the patient's DNA revealed an interstitial deletion encompassing 33.2 Mb in the 11q14.1-q23.3 genomic region (chr11: 83,161,443-116,401,751 ; Hg19). In this report, we present a patient with an interstitial deletion on the long arm of chromosome 11 that encompassed the 11q14.1-q23.3 region; and, using array-CGH analysis, we molecularly characterized the deleted region.

  14. Delayed Fission Gamma-ray Characteristics of Th-232 U-233 U-235 U-238 and Pu-239

    Energy Technology Data Exchange (ETDEWEB)

    Lane, Taylor [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States); Parma, Edward J. [Sandia National Laboratories (SNL-NM), Albuquerque, NM (United States)

    2015-08-01

    Delayed fission gamma-rays play an important role in determining the time dependent ioniz- ing dose for experiments in the central irradiation cavity of the Annular Core Research Reactor (ACRR). Delayed gamma-rays are produced from both fission product decay and from acti- vation of materials in the core, such as cladding and support structures. Knowing both the delayed gamma-ray emission rate and the time-dependent gamma-ray energy spectrum is nec- essary in order to properly determine the dose contributions from delayed fission gamma-rays. This information is especially important when attempting to deconvolute the time-dependent neutron, prompt gamma-ray, and delayed gamma-ray contribution to the response of a diamond photo-conducting diode (PCD) or fission chamber in time frames of milliseconds to seconds following a reactor pulse. This work focused on investigating delayed gamma-ray character- istics produced from fission products from thermal, fast, and high energy fission of Th-232, U-233, U-235, U-238, and Pu-239. This work uses a modified version of CINDER2008, a transmutation code developed at Los Alamos National Laboratory, to model time and energy dependent photon characteristics due to fission. This modified code adds the capability to track photon-induced transmutations, photo-fission, and the subsequent radiation caused by fission products due to photo-fission. The data is compared against previous work done with SNL- modified CINDER2008 [ 1 ] and experimental data [ 2 , 3 ] and other published literature, includ- ing ENDF/B-VII.1 [ 4 ]. The ability to produce a high-fidelity (7,428 group) energy-dependent photon fluence at various times post-fission can improve the delayed photon characterization for radiation effects tests at research reactors, as well as other applications.

  15. Ammonia excitation imaging of shocked gas towards the W28 gamma-ray source HESS J1801-233

    Science.gov (United States)

    Maxted, Nigel I.; de Wilt, Phoebe; Rowell, Gavin P.; Nicholas, Brent P.; Burton, Michael. G.; Walsh, Andrew; Fukui, Yasuo; Kawamura, Akiko

    2016-10-01

    We present 12 mm Mopra observations of the dense (>103 cm-3) molecular gas towards the north-east of the W28 supernova remnant (SNR). This cloud is spatially well matched to the TeV gamma-ray source HESS J1801-233 and is known to be an SNR-molecular cloud interaction region. Shock-disruption is evident from broad NH3 (1,1) spectral linewidths in regions towards the W28 SNR, while strong detections of spatially extended NH3 (3,3), NH3(4,4) and NH3(6,6) inversion emission towards the cloud strengthen the case for the existence of high temperatures within the cloud. Velocity dispersion measurements and NH3(n,n)/(1,1) ratio maps, where n = 2, 3, 4 and 6, indicate that the source of disruption is from the side of the cloud nearest to the W28 SNR, suggesting that it is the source of cloud-disruption. Towards part of the cloud, the ratio of ortho to para-NH3 is observed to exceed 2, suggesting gas-phase NH3 enrichment due to NH3 liberation from dust-grain mantles. The measured NH3 abundance with respect to H2 is ˜(1.2 ± 0.5) × 10-9, which is not high, as might be expected for a hot, dense molecular cloud enriched by sublimated grain-surface molecules. The results are suggestive of NH3 sublimation and destruction in this molecular cloud, which is likely to be interacting with the W28 SNR shock.

  16. Complications associated with transobturator sling procedures: analysis of 233 consecutive cases with a 27 months follow-up

    Directory of Open Access Journals (Sweden)

    Dubuisson Jean-Bernard

    2009-09-01

    Full Text Available Abstract Backround The transobturator tape procedure (TOT is an effective surgical treatment of female stress urinary incontinence. However data concerning safety are rare, follow-up is often less than two years, and complications are probably underreported. The aim of this study was to describe early and late complications associated with TOT procedures and identify risk factors for erosions. Methods It was a 27 months follow-up of a cohort of 233 women who underwent TOT with three different types of slings (Aris®, Obtape®, TVT-O®. Follow-up information was available for 225 (96.6% women. Results There were few per operative complications. Forty-eight women (21.3% reported late complications including de novo or worsening of preexisting urgencies (10.2%, perineal pain (2.2%, de novo dyspareunia (9%, and vaginal erosion (7.6%. The risk of erosion significantly differed between the three types of slings and was 4%, 17% and 0% for Aris®, Obtape® and TVT-O® respectively (P = 0.001. The overall proportion of women satisfied by the procedure was 72.1%. The percentage of women satisfied was significantly lower in women who experienced erosion (29.4% compared to women who did not (78.4% (RR 0.14, 95% CI 0.05-0.38, P Conclusion Late post operative complications are relatively frequent after TOT and can impair patient's satisfaction. Women should be informed of these potential complications preoperatively and require careful follow-up after the procedure. Choice of the safest sling material is crucial as it is a risk factor for erosion.

  17. Selectivity of bis-triazinyl bipyridine ligands for americium(III) in Am/Eu separation by solvent extraction. Part 1. Quantum mechanical study on the structures of BTBP complexes and on the energy of the separation.

    Science.gov (United States)

    Narbutt, Jerzy; Oziminski, Wojciech P

    2012-12-21

    Theoretical studies were carried out on two pairs of americium and europium complexes formed by tetra-N-dentate lipophilic BTBP ligands, neutral [ML(NO(3))(3)] and cationic [ML(2)](3+) where M = Am(III) or Eu(III), and L = 6,6'-bis-(5,6-diethyl-1,2,4-triazin-3-yl)-2,2'-bipyridine (C2-BTBP). Molecular structures of the complexes have been optimized at the B3LYP/6-31G(d) level and total energies of the complexes in various media were estimated using single point calculations performed at the B3LYP/6-311G(d,p) and MP2/6-311G(d,p) levels of theory. In the calculations americium and europium ions were treated using pseudo-relativistic Stuttgart-Dresden effective core potentials and the accompanying basis sets. Selectivity in solvent extraction separation of two metal ions is a co-operative function of contributions from all extractable metal complexes, which depend on physico-chemical properties of each individual complex and on its relative amount in the system. Semi-quantitative analysis of BTBP selectivity in the Am/Eu separation process, based on the contributions from the two pairs of Am(III) and Eu(III) complexes, has been carried out. To calculate the energy of Am/Eu separation, a model of the extraction process was used, consisting of complex formation in water and transfer of the formed complex to the organic phase. Under the assumptions discussed in the paper, this simple two-step model results in reliable values of the calculated differences in the energy changes for each pair of the Am/Eu complexes in both steps of the process. The greater thermodynamic stability (in water) of the Am-BTBP complexes, as compared with the analogous Eu species, caused by greater covalency of the Am-N than Eu-N bonds, is most likely the main reason for BTBP selectivity in the separation of the two metal ions. The other potential reason, i.e. differences in lipophilic properties of the analogous complexes of Am and Eu, is less important with regard to this selectivity.

  18. Fiscal Year 2008 Phased Construction Completion Report for EU Z2-33 in Zone 2, East Tennessee Technology Park, Oak Ridge, Tennessee

    Energy Technology Data Exchange (ETDEWEB)

    Bechtel Jacobs

    2008-09-11

    The Record of Decision for Soil, Buried Waste, and Subsurface Structure Actions in Zone 2, East Tennessee Technology Park, Oak Ridge, Tennessee (DOE/OR/01-2161&D2) (Zone 2 ROD) acknowledged that most of the 800 acres in Zone 2 were contaminated, but that sufficient data to confirm the levels of contamination were lacking. The Zone 2 ROD further specified that a sampling strategy for filling the data gaps would be developed. The Remedial Design Report/Remedial Action Work Plan for Zone 2 Soils, Slabs, and Subsurface Structures, East Tennessee Technology Park, Oak Ridge, Tennessee (DOE/OR/01-2224&D3) (Zone 2 RDR/RAWP) defined the sampling strategy as the Dynamic Verification Strategy (DVS), generally following the approach used for characterization of the Zone 1 exposure units (EUs). The Zone 2 ROD divided the Zone 2 area into seven geographic areas and 44 EUs. To facilitate the data quality objectives (DQOs) of the DVS process, the Zone 2 RDR/RAWP regrouped the 44 EUs into 12 DQO scoping EU groups. These groups facilitated the DQO process by placing similar facilities and their support facilities together and allowing identification of data gaps. The EU groups were no longer pertinent after DQO planning was completed and characterization was conducted as areas became accessible. As the opportunity to complete characterization became available, the planned DVS program and remedial actions (RAs) were completed for EU Z2-33. Remedial action was also performed at two additional areas in adjacent EU Z2-42 because of their close proximity and similar nature to a small surface soil RA in EU Z2-33. Remedial actions for building slabs performed in EU Z2-33 during fiscal year (FY) 2007 were reported in the Fiscal Year 2007 Phased Construction Completion Report for the Zone 2 Soils, Slabs, and Subsurface Structures at East Tennessee Technology Park, Oak Ridge, Tennessee (DOE/OR/01-2723&D1). Recommended RAs for EU Z2-42 were described in the Fiscal Year 2006 Phased Construction

  19. Use of radioanalytical methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in radioactive wastes; Utilizacao de metodos radioanaliticos para a determinacao de isotopos de uranio, plutonio, americio e curio em rejeitos radioativos

    Energy Technology Data Exchange (ETDEWEB)

    Geraldo, Bianca

    2012-07-01

    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)

  20. Desorption Kinetics of H2O from Cab-O-Sil-M-7D and Hi-Sil-233 Silica Particles

    Energy Technology Data Exchange (ETDEWEB)

    Dinh, L.; Balooch, M.; LeMay, J.D.

    2000-01-26

    Temperature programmed desorption (TPD) was performed at temperatures up to 850K on Cab-O-Sil-M-7D and Hi-Sil-233 silica particles. Physisorbed water molecules on both types of silica had activation energies in the range of 9-14.5 kcal/mol. However, the activation energies of desorption for chemisorbed water varied from {approx} 19 kcal/mol to > 59 kcal/mol for Cab-O-Sil-M-7D, and {approx} 23-37 kcal/mol for Hi-Sil-233. Our results suggest that physisorbed water can be effectively pumped away at room temperature (or preferably at 320 K) in a matter of hours. Chemisorbed water with high activation energies of desorption (>30 kcal/mol) will not escape the silica surfaces in 100 years even at 320 K, while a significant amount of the chemisorbed water with medium activation energies (19-26 kcal/mol) will leave the silica surfaces in that time span. Most of the chemisorbed water with activation energies < 30 kcal/mol can be pumped away in a matter of days in a good vacuum environment at 500 K. We had previously measured about 0.1-0.4 wt. % of water in M9787 polysiloxane formulations containing {approx} 21% Cab-O-Sil-M-7D and {approx} 4% Hi-Sil-233. Comparing present results with these formulations, we conclude that absorbed H{sub 2}O and Si-OH bonds on the silica surfaces are the major contributors to water outgassing from M97 series silicones.

  1. 双核[Cu2(phen)2(3,3'-tda)2]配合物的合成、结构与光谱表征

    Institute of Scientific and Technical Information of China (English)

    刘艳华

    2010-01-01

    以丙二酸硫醚(3,3'-tdaH2)为主配体,以邻菲哆啉(phen)为辅助配体,合成了一例双核配合物[Cu:(phen)2(3,3'-tda](1),并通过X射线单晶结构分析、元素分析以及红外光谱、紫外光谱对配合物进行了表征.

  2. Evaluation of fission cross sections and covariances for {sup 233}U, {sup 235}U, {sup 238}U, {sup 239}Pu, {sup 240}Pu, and {sup 241}Pu

    Energy Technology Data Exchange (ETDEWEB)

    Kawano, Toshihiko [Kyushu Univ., Fukuoka (Japan); Matsunobu, Hiroyuki [Data Engineering, Inc. (Japan); Murata, Toru [AITEL Corporation, Tokyo (JP)] [and others

    2000-02-01

    A simultaneous evaluation code SOK (Simultaneous evaluation on KALMAN) has been developed, which is a least-squares fitting program to absolute and relative measurements. The SOK code was employed to evaluate the fission cross sections of {sup 233}U, {sup 235}U, {sup 238}U, {sup 239}Pu, {sup 240}Pu, and {sup 241}Pu for the evaluated nuclear data library JENDL-3.3. Procedures of the simultaneous evaluation and the experimental database of the fission cross sections are described. The fission cross sections obtained were compared with evaluated values given in JENDL-3.2 and ENDF/B-VI. (author)

  3. Neutron-induced fission cross sections of 233U and 243Am in the energy range 0.5 Mev En 20 MeV @ n_TOF

    CERN Document Server

    Belloni, F; Milazzo, P M; Calviani, M; Colonna, N; Mastinu, P; Abbondanno, U; Aerts, G; Álvarez, H; Álvarez-Velarde, F; Andriamonje, S; Andrzejewski, J; Assimakopoulos, P; Audouin, L; Badurek, G; Baumann, P; Becvár, F; Berthoumieux, E; Calviño, F; Cano-Ott, D; Capote, R; Carrapiço, C; Cennini, P; Chepel, V; Chiaveri, E; Cortes, G; Couture, A; Cox, J; Dahlfors, M; David, S; Dillmann, I; Domingo-Pardo, C; Dridi, W; Duran, I; Eleftheriadis, C; Embid-Segura, M; Ferrant, L; Ferrari, A; Ferreira-Marques, R; Fujii, K; Furman, W; Goncalves, I; González-Romero, E; Gramegna, F; Guerrero, C; Gunsing, F; Haas, B; Haight, R; Heil, M; Herrera-Martinez, A; Igashira, M; Jericha, E; Käppeler, F; Kadi, Y; Karadimos, D; Karamanis, D; Kerveno, M; Koehler, P; Kossionides, E; Krticka, M; Lampoudis, C; Leeb, H; Lindote, A; Lopes, I; Lozano, M; Lukic, S; Marganiec, J; Marrone, S; Martínez, T; Massimi, C; Mengoni, A; Moreau, C; Mosconi, M; Neves, F; Oberhummer, H; O'Brien, S; Pancin, J; Papachristodoulou, C; Papadopoulos, C; Paradela, C; Patronis, N; Pavlik, A; Pavlopoulos, P; Perrot, L; Pigni, M T; Plag, R; Plompen, A; Plukis, A; Poch, A; Praena, J; Pretel, C; Quesada, J; Rauscher, T; Reifarth, R; Rubbia, C; Rudolf, G; Rullhusen, P; Salgado, J; Santos, C; Sarchiapone, L; Savvidis, I; Stephan, C; Tagliente, G; Tain, J L; Tassan-Got, L; Tavora, L; Terlizzi, R; Vannini, G; Vazl, P; Ventura, A; Villamarin, D; Vincente, M C; Vlachoudis, V; Vlastou, R; Voss, F; Walter, S; Wiescher, M; Wisshak, K

    2011-01-01

    Neutron-induced fission cross-sections of actinides have been recently measured at the neutron time of flight facility n_TOF at CERN in the frame of a research project involving isotopes relevant for nuclear astrophysics and nuclear technologies. Fission fragments are detected by a gas counter with good discrimination between nuclear fission products and background events. Neutron-induced fission cross-sections of 233U and 243Am were determined relative to 235U. The present paper reports the results obtained at neutron energies between 0.5 and 20 MeV.

  4. pVT data of liquid 1-, 2-, and 3-pentanol from 10 to 200 MPa and from 233 to 433 K

    Energy Technology Data Exchange (ETDEWEB)

    Wappmann, S.; Karger, N.; Luedemann, H.D. (Univ. Regensburg (Germany). Inst. fuer Biophysik und Physikalische Biochemie)

    Molar volumes of 1-, 2-, and 3-pentanol have been determined using a piston-cylinder apparatus. All isotherms are well described by the modified Tait equation (V[sub o] - V)/V[sub o] = A ln[(B + p)/(B + p[sub o])], with a temperature-independent parameter A, while B proved to increase monotonically with falling temperature. The quality of the fits suggests that the results can be extrapolated reliably by the Tait equation to pressures and temperatures beyond the range covered by these experiments (10--200 MPa, 233--433 K).

  5. Study of the excited levels of 233{sup P}a by the 237{sup N}p alpha decay; Estudio de los niveles excitados en el 233{sup P}a por la desintegracion alfa del 237{sup N}p

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, J.; Gaeta, R.; Vano, E.; Los Arcos, J. M.

    1978-07-01

    The excited levels in 233{sup P}a following the 237{sup N}p alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233{sup P}a radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs.

  6. Characterization of Extracellular Dextranase from a Novel Halophilic Bacillus subtilis NRC-B233b a Mutagenic Honey Isolate under Solid State Fermentation

    Directory of Open Access Journals (Sweden)

    Mona A. Esawy

    2012-01-01

    Full Text Available Bacillus subtilis NRC-B233b was isolated from Libyan honey sample proved to be a potent dextranase producer by applying solid state fermentation and utilizing corn flour as the sole carbon source. The optimized culture conditions for dextranase productions were 37°C, pH 10, 32 h, and 20% (v/w moisture content. A unique character of this isolate is its ability to produce steady dextranase irrespective to the presence of NaCl in the medium. The addition of 0.175 Mm CrCl3 increased the enzyme production by about 4.5 fold. Further improvement in enzyme production was achieved by simple UV mutation which increased the enzyme production up to about 2842 U/g. The crude extract has been partially purified about 112-fold from crude extract by only two purification steps involving ultra-filtration. The partially purified dextranase showed its maximum activity at pH 9.2 and 70°C. It retained full activity (100% at 75°C for one hour. Dextranase activity increased about 4 fold in the presence of 10% NaCl. This enzyme showed variable degradation effect on different types of dextran and its derivatives. The treatment of viscous sugar cane juice with the enzyme preparation resulted in clear visual dextran hydrolysis. These results suggest that the dextranase produced by Bacillus subtilis NRC-B233b is industrially applicable.

  7. Third case of 8q23.3-q24.13 deletion in a patient with Langer-Giedion syndrome phenotype without TRPS1 gene deletion.

    Science.gov (United States)

    Pereza, Nina; Severinski, Srećko; Ostojić, Saša; Volk, Marija; Maver, Aleš; Dekanić, Kristina Baraba; Kapović, Miljenko; Peterlin, Borut

    2012-03-01

    Langer-Giedion syndrome (LGS) is a contiguous gene syndrome caused by a hemizygous deletion on chromosome 8q23.3-q24.11 involving TRPS1 and EXT1 genes. We report on a girl with LGS phenotype and a 7.5 Mb interstitial deletion at chromosome 8q23.3-q24.13. Array-comparative genomic hybridization (a-CGH) revealed a deletion encompassing only the EXT1 and not the TRPS1 gene. Even though the deletion of TRPS1 and EXT1 genes is responsible for craniofacial and skeletal features of LGS, there have been previous reports of patients with LGS phenotype and 8q24 deletions leaving the TRPS1 gene intact. To our knowledge, this is the third such case. Our patient differs from previously reported LGS patients without TRPS1 gene deletion in that she has the typical LGS facial dysmorphism and skeletal abnormalities. However, the girl is of normal height and has only a mild developmental delay. Additionally, she has dyslalia and premature adrenarche classified as Tanner stage 3 premature pubarche which have not yet been described as features of LGS. We examine the molecular breakpoints and phenotypes of our patient and previously reported cases.

  8. Absolute measurements of the /sup 233/U (n,f) cross section between 0. 13 and 8. 0 MeV. [Cross sections, 0. 13 to 8. 0 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Poenitz, W.P.

    1978-04-01

    The fast neutron fission cross section of /sup 233/U was measured absolutely between 0.13 and 8.0 MeV. The absolute cross section values were obtained by low geometry alpha counting and isotopic dilution analysis of various /sup 233/U samples, 2..pi..-detection of the fission fragments with an ionization chamber, and the measurement of the neutron flux with several black neutron detectors. Absolute cross sections were obtained with a 2 to 3% uncertainty over the most important energy range.

  9. High-accuracy 233U(n, f ) cross-section measurement at the white-neutron source n TOF from near-thermal to 1 MeV neutron energy

    OpenAIRE

    Sarchiapone, L.; Savvidis, I.; Konovalov, V; Stephan, C.; Tagliente, G.; Krticka, M; Rudolf, G.; Kossionides, E.; Rullhusen, P; Leeb, H.; Salgado, J.; Capote, R.; Cano-Ott, D.; Mengoni, A.; Calviño Tavares, Francisco

    2009-01-01

    The 233U(n,f ) cross section has been measured at the white neutron source n TOF in a wide energy range with a dedicated fission ionization chamber. We report here the results from ∼30 meV to 1 MeV neutron energy. The 233U(n,f ) cross section has been determined relative to a reference sample of 235U(n,f )measured simultaneously with the same detector. The very high instantaneous neutron flux and the intrinsically low background of the n TOF installation result in an accuracy arou...

  10. R-MATRIX RESONANCE ANALYSIS AND STATISTICAL PROPERTIES OF THE RESONANCE PARAMETERS OF 233U IN THE NEUTRON ENERGY RANGE FROM THERMAL TO 600 eV

    Energy Technology Data Exchange (ETDEWEB)

    Leal, L.C.

    2001-02-27

    The R-matrix resonance analysis of experimental neutron transmission and cross sections of {sup 233}U, with the Reich-Moore Bayesian code SAMMY, was extended up to the neutron energy of 600 eV by taking advantage of new high resolution neutron transmission and fission cross section measurements performed at the Oak Ridge Electron Linear Accelerator (ORELA). The experimental data base is described. In addition to the microscopic data (time-of-flight measurements of transmission and cross sections), some experimental and evaluated integral quantities were included in the data base. Tabulated and graphical comparisons between the experimental data and the SAMMY calculated cross sections are given. The ability of the calculated cross sections to reproduce the effective multiplication factors k{sub eff} for various thermal, intermediate, and fast systems was tested. The statistical properties of the resonance parameters were examined and recommended values of the average s-wave resonance parameters are given.

  11. Fission Cross-section Measurements of (233)U, (245)Cm and (241,243)Am at CERN n_TOF Facility

    CERN Document Server

    Calviani, M; Andriamonje, S; Chiaveri, E; Vlachoudis, V; Colonna, N; Meaze, M H; Marrone, S; Tagliente, G; Terlizzi, R; Belloni, F; Abbondanno, U; Fujii, K; Milazzo, P M; Moreau, C; Aerts, G; Berthoumieux, E; Dridi, W; Gunsing, F; Pancin, J; Perrot, L; Plukis, A; Alvarez, H; Duran, I; Paradela, C; Alvarez-Velarde, F; Cano-Ott, D; Gonzalez-Romero, E; Guerrero, C; Martinez, T; Villamarin, D; Vicente, M C; Andrzejewski, J; Marganiec, J; Assimakopoulos, P; Karadimos, D; Karamanis, D; Papachristodoulou, C; Patronis, N; Audouin, L; David, S; Ferrant, L; Isaev, S; Stephan, C; Tassan-Got, L; Badurek, G; Jericha, E; Leeb, H; Oberhummer, H; Pigni, M T; Baumann, P; Kerveno, M; Lukic, S; Rudolf, G; Becvar, F; Krticka, M; Calvino, F; Capote, R; Carrillo De Albornoz, A; Marques, L; Salgado, J; Tavora, L; Vaz, P; Cennini, P; Dahlfors, M; Ferrari, A; Gramegna, F; Herrera-Martinez, A; Kadi, Y; Mastinu, P; Praena, J; Sarchiapone, L; Wendler, H; Chepel, V; Ferreira-Marques, R; Goncalves, I; Lindote, A; Lopes, I; Neves, F; Cortes, G; Poch, A; Pretel, C; Couture, A; Cox, J; O'brien, S; Wiescher, M; Dillman, I; Heil, M; Kappeler, F; Mosconi, M; Plag, R; Voss, F; Walter, S; Wisshak, K; Dolfini, R; Rubbia, C; Domingo-Pardo, C; Tain, J L; Eleftheriadis, C; Savvidis, I; Frais-Koelbl, H; Griesmayer, E; Furman, W; Konovalov, V; Goverdovski, A; Ketlerov, V; Haas, B; Haight, R; Reifarth, R; Igashira, M; Koehler, P; Kossionides, E; Lampoudis, C; Lozano, M; Quesada, J; Massimi, C; Vannini, G; Mengoni, A; Oshima, M; Papadopoulos, C; Vlastou, R; Pavlik, A; Pavlopoulos, P; Plompen, A; Rullhusen, P; Rauscher, T; Rosetti, M; Ventura, A

    2011-01-01

    Neutron-induced fission cross-sections of minor actinides have been measured using the n_TOF white neutron source at CERN, Geneva, as part of a large experimental program aiming at collecting new data relevant for nuclear astrophysics and for the design of advanced reactor systems. The measurements at n_TOF take advantage of the innovative features of the n_TOF facility, namely the wide energy range, high instantaneous neutron flux and good energy resolution. Final results on the fission cross-section of 233U, 245Cm and 243Am from thermal to 20 MeV are here reported, together with preliminary results for 241Am. The measurement have been performed with a dedicated Fast Ionization Chamber (FIC), a fission fragment detector with a very high efficiency, relative to the very well known cross-section of 235U, measured simultaneously with the same detector.

  12. 听性脑干反应与听觉稳态反应对233例听力复筛未通过婴幼儿早期听力测试结果分析%Analysis of ABR and ASSR test in early hearing diagnostic of 233 infants failed in second hearing screening

    Institute of Scientific and Technical Information of China (English)

    张东红; 王玉璟; 马秀岚

    2012-01-01

    Objective; To discuss the effect of ABR and ASSR test in early hearing diagnostic of infants failed in second hearing screening. Methods: ABR and ASSR were tested in 233 (466 ears) in first and second hearing diagnostic, the results were analyzed. Results;Of 233 infants, 64 infants were normal in first diagnostic tested in 1 to 3 months, 169 infants were with one or two cars hearing loss, among them 88 with milder hearing loss, 60 with moderate hearing loss 12 of the 60 infants with severe hearing loss, 9 with very severe hearing loss. 106 infants accepted second diagnostic test, among them 60 infants with normal hearing, 46 infants with hearing loss 12 of the 46 infants with milder hearing loss, 15 with moderate hearing loss, 10 with severe hearing loss, 9 with very severe hearing loss. Conclusion; Hearing loss infants can de early founded by ABR and ASSR test. ABR and ASSR also provide accurate diagnostic test for early hearing intervention.%目的:探讨听性脑干反应(ABR)与听觉稳态反应(ASSR)在听力复筛未通过婴幼儿早期听力评估中的作用.方法:对233例(466耳)听力复筛未通过的婴幼儿使用ABR、ASSR测试,进行听力学初诊及复诊.分析ABR与ASSR的临床应用情况.结果:233例婴幼儿,在1~3个月时初诊听力正常64例,单耳或双耳听力损失169例,其中轻度88例,中度60例,重度12例,极重度9例.6个月时复诊106例,听力正常60例,听力损失46例,其中轻度12例,中度15例,重度10例,极重度9例.失访63例.结论:ABR与ASSR联合应用可早期发现听力损失,为听力障碍的早期干预提供可靠的依据.

  13. Complete genomic sequences of Campylobacter jejuni strains RM3196 (233.94) and RM3197 (308.95) that were isolated from patients with Guillain-Barré Syndrome

    Science.gov (United States)

    An infection with Campylobacter jejuni subsp. jejuni (Cjj) is a leading cause of foodborne gastroenteritis in humans and also the most prevalent infection preceding Guillain-Barré syndrome (GBS). This study describes the complete genomic sequences of Cjj HS:41 strains RM3196 (233.94) and RM3197 (308...

  14. Complex three-way translocation involving MLL, ELL, RREB1, and CMAHP genes in an infant with acute myeloid leukemia and t(6;19;11)(p22.2;p13.1;q23.3)

    DEFF Research Database (Denmark)

    Tuborgh, A; Meyer, C; Marschalek, R;

    2013-01-01

    until progression to acute myeloid leukemia, AML-M5. The leukemic cells harbored a novel apparent 3-way translocation t(6;19;11)(p22.2;p13.1;q23.3). We utilized advanced molecular cytogenetic methods including 24-color karyotyping, high-resolution array comparative genomic hybridization (aCGH) and DNA...

  15. Molecular level characterization of diatom-associated biopolymers that bind 234Th, 233Pa, 210Pb, and 7Be in seawater: A case study with Phaeodactylum tricornutum

    Science.gov (United States)

    Chuang, Chia-Ying; Santschi, Peter H.; Xu, Chen; Jiang, Yuelu; Ho, Yi-Fang; Quigg, Antonietta; Guo, Laodong; Hatcher, Patrick G.; Ayranov, Marin; Schumann, Dorothea

    2015-09-01

    In order to investigate the importance of biogenic silica associated biopolymers on the scavenging of radionuclides, the diatom Phaeodactylum tricornutum was incubated together with the radionuclides 234Th, 233Pa, 210Pb, and 7Be during their growth phase. Normalized affinity coefficients were determined for the radionuclides bound with different organic compound classes (i.e., proteins, total carbohydrates, uronic acids) in extracellular (nonattached and attached exopolymeric substances), intracellular (ethylene diamine tetraacetic acid and sodium dodecyl sulfate extractable), and frustule embedded biopolymeric fractions (BF). Results indicated that radionuclides were mostly concentrated in frustule BF. Among three measured organic components, Uronic acids showed the strongest affinities to all tested radionuclides. Confirmed by spectrophotometry and two-dimensional heteronuclear single quantum coherence-nuclear magnetic resonance analyses, the frustule BF were mainly composed of carboxyl-rich, aliphatic-phosphoproteins, which were likely responsible for the strong binding of many of the radionuclides. Results from this study provide evidence for selective absorption of radionuclides with different kinds of diatom-associated biopolymers acting in concert rather than as a single compound. This clearly indicates the importance of these diatom-related biopolymers, especially frustule biopolymers, in the scavenging and fractionation of radionuclides used as particle tracers in the ocean.

  16. Delocalization and new phase in Americium: theory

    Energy Technology Data Exchange (ETDEWEB)

    Soderlind, P

    1999-04-23

    Density-functional electronic structure calculations have been used to investigate the high pressure behavior of Am. At about 80 kbar (8 GPa) calculations reveal a monoclinic phase similar to the ground state structure of plutonium ({alpha}-Pu). The experimentally suggested {alpha}-U structure is found to be substantially higher in energy. The phase transition from fcc to the low symmetry structure is shown to originate from a drastic change in the nature of the electronic structure induced by the elevated pressure. A calculated volume collapse of about 25% is associated with the transition. For the low density phase, an orbital polarization correction to the local spin density (LSD) theory was applied. Gradient terms of the electron density were included in the calculation of the exchange/correlation energy and potential, according to the generalized gradient approximation (GGA). The results are consistent with a Mott transition; the 5f electrons are delocalized and bonding on the high density side of the transition and chemically inert and non-bonding (localized) on the other. Theory compares rather well with recent experimental data which implies that electron correlation effects are reasonably modeled in our orbital polarization scheme.

  17. The proliferation potential of neptunium and americium

    Energy Technology Data Exchange (ETDEWEB)

    An, J. S.; Shin, J. S.; Kim, J. S.; Kwack, E. H.; Kim, B. K

    2000-05-01

    It is recognized that some trans-uranic elements other than plutonium, in particular Np and Am, if will be available in sufficient quantities, could be used for nuclear explosive devices. The spent fuel has been accumulating in number of nuclear power plant and operation of large scale commercial reprocessing plants. However, these materials are not covered by the definition of special fissionable material in the Agency Statute. At the time when the Statute was adopted, the availability of meaningful quantities of separated Np and Am was remote and they were not included in the definition of special fissionable material. Then, IAEA Board decided a measure for control of Np and Am on September 1999. This report contains the control method and the characteristic of Np and Am for using domestic nuclear industries, and it can be useful for understanding how to report and account of Np and Am. (author)

  18. Evaluation of neutron data for americium-241

    Energy Technology Data Exchange (ETDEWEB)

    Maslov, V.M.; Sukhovitskij, E.Sh.; Porodzinskij, Yu.V.; Klepatskij, A.B.; Morogovskij, G.B. [Radiation Physics and Chemistry Problems Inst., Minsk-Sosny (Belarus)

    1997-03-01

    The evaluation of neutron data for {sup 241}Am is made in the energy region from 10{sup -5} eV up to 20 MeV. The results of the evaluation are compiled in the ENDF/B-VI format. This work is performed under the Project Agreement CIS-03-95 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. The evaluation was requested by Y. Kikuchi (JAERI). (author). 60 refs.

  19. Colorectal cancer risk variants at 8q23.3 and 11q23.1 are associated with disease phenotype in APC mutation carriers.

    Science.gov (United States)

    Ghorbanoghli, Z; Nieuwenhuis, M H; Houwing-Duistermaat, J J; Jagmohan-Changur, S; Hes, F J; Tops, C M; Wagner, A; Aalfs, C M; Verhoef, S; Gómez García, E B; Sijmons, R H; Menko, F H; Letteboer, T G; Hoogerbrugge, N; van Wezel, T; Vasen, H F A; Wijnen, J T

    2016-10-01

    Familial adenomatous polyposis (FAP) is a dominantly inherited syndrome caused by germline mutations in the APC gene and characterized by the development of multiple colorectal adenomas and a high risk of developing colorectal cancer (CRC). The severity of polyposis is correlated with the site of the APC mutation. However, there is also phenotypic variability within families with the same underlying APC mutation, suggesting that additional factors influence the severity of polyposis. Genome-wide association studies identified several single nucleotide polymorphisms (SNPs) that are associated with CRC. We assessed whether these SNPs are associated with polyp multiplicity in proven APC mutation carriers. Sixteen CRC-associated SNPs were analysed in a cohort of 419 APC germline mutation carriers from 182 families. Clinical data were retrieved from the Dutch Polyposis Registry. Allele frequencies of the SNPs were compared for patients with colorectal adenomas versus patients with ≥100 adenomas, using generalized estimating equations with the APC genotype as a covariate. We found a trend of association of two of the tested SNPs with the ≥100 adenoma phenotype: the C alleles of rs16892766 at 8q23.3 (OR 1.71, 95 % CI 1.05-2.76, p = 0.03, dominant model) and rs3802842 at 11q23.1 (OR 1.51, 95 % CI 1.03-2.22, p = 0.04, dominant model). We identified two risk variants that are associated with a more severe phenotype in APC mutation carriers. These risk variants may partly explain the phenotypic variability in families with the same APC gene defect. Further studies with a larger sample size are recommended to evaluate and confirm the phenotypic effect of these SNPs in FAP.

  20. An Investigation on Government Affairs Micro-Blog and its Improvement Direction---Empirical Evidence from the Investigation on 233 Civil Servants for Chongqing%政务微博的公共治理调查及提升方向*--基于重庆市233个样本数据的分析

    Institute of Scientific and Technical Information of China (English)

    王正攀; 陈文权; 徐信贵

    2015-01-01

    The government affairs micro-blog is not only development of the result from times, but also the concrete embodiment of a-bility of improving government’s public governance. Investigation is adopted on 233 civil servants of ChongQing on knowledge degree, concern degree,satisfaction and social effects on government affairs micro-blog by means of questionnaire. Through these analyses,it is found that:First, there are three features for the survey sample,which are “the higher proportion of owning micro-blog,the higher fre-quency of using micro-blog,a higher degree of interest on the government affairs micro-blog”;Second, the relationship between the sur-vey civil servant’s ages is negatively correlated with its knowledge degree under the age of 46,and the education and awareness are posi-tively related;Third, the survey sample of micro-blog government’ s concern degree is weak. However, the satisfaction is not high;Fourth,the investigation on 233 civil servants’ social effect of government micro-blog hold a positive and positive attitude. Finally,this paper explores some measures to overcome these bottlenecks,such as regular system,professional training ,increasing promotional ef-forts.%“政务微博”不仅是时代发展的结果,也是提升政府公共服务治理能力的具体体现。以问卷调查的方式,调查了重庆市233个公务员样本对政务微博知晓度、关注度、满意度以及社会效果等方面态度。研究发现:调查样本呈现出“有微博账号比例高、使用微博频率高、对政务微博兴趣度较高”的特点;46岁以下调查样本的年龄段与政务微博知晓度呈负相关关系,学历程度与政务微博知晓度呈正相关关系;调查样本对对政务微博的关注度偏弱,满意度不高;调查样本对政务微博的社会效果持肯定、正面态度。最后,从完善制度、专业人才培养、加大推广力度等方面提出了改进建议。

  1. Expeditious method to determine uranium in the process control samples of chemical plant separating (233)U from thoria irradiated in power reactors.

    Science.gov (United States)

    Kedari, C S; Kharwandikar, B K; Banerjee, K

    2016-11-01

    Analysis of U in the samples containing a significant proportion of (232)U and high concentration of Th is of great concern. Transmutation of Th in the nuclear power reactor produces a notable quantity of (232)U (half life 68.9 years) along with fissile isotope (233)U. The decay series of (232)U is initiated with (228)Th (half life 1.9 year) and it is followed by several short lived α emitting progenies, (224)Ra, (220)Rn, (216)Po, (212)Bi and (212)Po. Even at the smallest contamination of (228)Th in the sample, a very high pulse rate of α emission is obtained, which is to be counted for the radiometric determination of [U]. A commercially available anionic type of extractant Alamine®336 is used to obtain the selective extraction of U from other alpha active elements and fission products present in the sample. Experimental conditions of liquid-liquid extraction (LLE) are optimized for obtaining maximum decontamination and recovery of U in the organic phase. The effect of some interfering ionic impurities in the sample on the process of separation is investigated. Depending on the level of the concentration of U in the samples, spectrophotometry or radiometry methods are adopted for its determination after separation by LLE. Under optimized experimental conditions, i.e. 5.5M HCl in the aqueous phase and 0.27M Alamin®336 in the organic phase, the recovery of U is about 100%, the decontamination factor with respect to Th is >2000 and the extraction of fission products like (90)Sr, (144)Ce and (134,137)Cs is negligible. The detection limit for [U] using α radiometry is 10mg/L, even in presence of >100g/L of Th in the sample. Accuracy and precision for the determination of U is also assessed. Reproducibility of results is within 5%. This method shows very good agreement with the results obtained by mass spectrometry.

  2. A replication study of GWAS-derived lipid genes in Asian Indians: the chromosomal region 11q23.3 harbors loci contributing to triglycerides.

    Directory of Open Access Journals (Sweden)

    Timothy R Braun

    Full Text Available Recent genome-wide association scans (GWAS and meta-analysis studies on European populations have identified many genes previously implicated in lipid regulation. Validation of these loci on different global populations is important in determining their clinical relevance, particularly for development of novel drug targets for treating and preventing diabetic dyslipidemia and coronary artery disease (CAD. In an attempt to replicate GWAS findings on a non-European sample, we examined the role of six of these loci (CELSR2-PSRC1-SORT1 rs599839; CDKN2A-2B rs1333049; BUD13-ZNF259 rs964184; ZNF259 rs12286037; CETP rs3764261; APOE-C1-C4-C2 rs4420638 in our Asian Indian cohort from the Sikh Diabetes Study (SDS comprising 3,781 individuals (2,902 from Punjab and 879 from the US. Two of the six SNPs examined showed convincing replication in these populations of Asian Indian origin. Our study confirmed a strong association of CETP rs3764261 with high-density lipoprotein cholesterol (HDL-C (p = 2.03×10(-26. Our results also showed significant associations of two GWAS SNPs (rs964184 and rs12286037 from BUD13-ZNF259 near the APOA5-A4-C3-A1 genes with triglyceride (TG levels in this Asian Indian cohort (rs964184: p = 1.74×10(-17; rs12286037: p = 1.58×10(-2. We further explored 45 SNPs in a ∼195 kb region within the chromosomal region 11q23.3 (encompassing the BUD13-ZNF259, APOA5-A4-C3-A1, and SIK3 genes in 8,530 Asian Indians from the London Life Sciences Population (LOLIPOP (UK and SDS cohorts. Five more SNPs revealed significant associations with TG in both cohorts individually as well as in a joint meta-analysis. However, the strongest signal for TG remained with BUD13-ZNF259 (rs964184: p = 1.06×10(-39. Future targeted deep sequencing and functional studies should enhance our understanding of the clinical relevance of these genes in dyslipidemia and hypertriglyceridemia (HTG and, consequently, diabetes and CAD.

  3. Non-invasive ventilation (NIV) in the clinical management of acute COPD in 233 UK hospitals: results from the RCP/BTS 2003 National COPD Audit.

    Science.gov (United States)

    Kaul, Sundeep; Pearson, Michael; Coutts, Ian; Lowe, Derek; Roberts, Michael

    2009-06-01

    Non-invasive ventilation (NIV) is a clinically proven, cost-effective intervention for acidotic exacerbations of COPD that is recommended by UK national guidelines. This study examines the extent to which these recommendations are being followed in the UK. Between August and October 2003 a national audit of COPD exacerbations was conducted by the Royal College of Physicians and the British Thoracic Society. 233 (94%) UK hospitals submitted data for 7,529 prospectively recruited acute COPD admissions, documenting process of care and outcomes from a retrospective case note audit. They also completed a resources and organisation of care proforma. Nineteen hospitals (8%) reported they did not offer NIV. There was no access to NIV in 92 (39%) intensive care units in 88 (36%), high-dependency units or on general wards of 85 (34%) hospitals. In 74 (30%) NIV was available on all 3 sites. A low pH (<7.35) was noted at some time during admission for 26% (1714/6544) of patients and NIV was administered to 31%. Patients receiving NIV were more often admitted under a respiratory physician, or seen at some stage by a respiratory specialist and had more severe disease (higher PaCO2 (median 9.8 v 7.8 kPa), lower oxygen tension (median 8.8 v 9.8 kPa), higher incidence of peripheral oedema (48% v 39%), of pneumonia (27% v 16%), higher in-hospital mortality (26% v 14%) and at 90 days (37% v 24%) and longer hospital stays (median 9 v 7 days) than those not receiving NIV. Hospitals with least usage of NIV had similar mortality rates to those using NIV more often. A comprehensive NIV service is not available in many hospitals admitting patients with acute respiratory failure secondary to COPD. Access to acute NIV is inadequate and does not conform with NICE and BTS guidelines. These observational audit data do not demonstrate benefits of NIV on survival when compared to conventional management, contrary to results from randomised trials. Reasons for this are unclear but unmeasured

  4. The effect of dissolved hydrogen on the dissolution of {sup 233}U doped UO{sub 2}(s) high burn-up spent fuel and MOX fuel

    Energy Technology Data Exchange (ETDEWEB)

    Carbol, P. [Inst. for Transuranium Elements, Karlsruhe (Germany); Spahiu, K. (ed.) [and others

    2005-03-01

    In this report the results of the experimental work carried out in a large EU-research project (SFS, 2001-2004) on spent fuel stability in the presence of various amounts of near field hydrogen are presented. Studies of the dissolution of {sup 233}U doped UO{sub 2}(s) simulating 'old' spent fuel were carried out as static leaching tests, autoclave tests with various hydrogen concentrations and electrochemical tests. The results of the leaching behaviour of a high burn-up spent fuel pellet in 5 M NaCl solutions in the presence of 3.2 bar H{sub 2} pressure and of MOX fuel in dilute synthetic groundwater under 53 bar H{sub 2} pressure are also presented. In all the experimental studies carried out in this project, a considerable effect of hydrogen in the dissolution rates of radioactive materials was observed. The experimental results obtained in this project with a-doped UO{sub 2}, high burn-up spent fuel and MOX fuel together with literature data give a reliable background to use fractional alteration/dissolution rates for spent fuel of the order of 10{sup -6}/yr - 10{sup -8}/yr with a recommended value of 4x10{sup -7}/yr for dissolved hydrogen concentrations above 10{sup -3} M and Fe(II) concentrations typical for European repository concepts. Finally, based on a review of the experimental data and available literature data, potential mechanisms of the hydrogen effect are also discussed. The work reported in this document was performed as part of the Project SFS of the European Commission 5th Framework Programme under contract no FIKW-CT-2001-20192 SFS. It represents the deliverable D10 of the experimental work package 'Key experiments using a-doped UO{sub 2} and real spent fuel', coordinated by SKB with the participation of ITU, FZK-INE, ENRESA, CIEMAT, ARMINES-SUBATECH and SKB.

  5. 232Th、233U、238Pu、240Pu、242Pu、241Am、242Cm、243Cm和244Cm的裂变释放热能研究%Thermal Energy Released in Fission of 232 Th,233 U,238 Pu, 240 Pu,242 Pu,241 Am,242 Cm,243 Cm and 244 Cm

    Institute of Scientific and Technical Information of China (English)

    赵艳飞; 马续波; 陈义学

    2013-01-01

    In the nuclear reactor design ,the precise calculation of thermal fission energy is of great significance .In the pressurized water reactor ,high energy neutron-induced fission rarely occurs ,the isotopes including 233 U ,241 Am and 243 Cm are mostly induced by thermal neutrons ,while the other isotopes such as 232Th ,238Pu ,240Pu ,242Pu ,242Cm and 244 Cm are by fast neutron . In order to carry out this work , the nuclear data extracted from the latest evaluated nuclear data file (ENDF/B-Ⅶ ) were adopted ,and the energy-conservation law for the calculation of total fission energy were used , meanw hile ,with the consideration of capture energy and the correction of βand γ ,the thermal fission energy of nine isotopes was obtained .Compared with the data excerpted from IAEA issued WIMS-D database ,the results are reasonable .The thermal fission energy and its uncertainties of the nine isotopes are :(193.939 ± 0.176) MeV for 232 Th , (200.063 ± 0.084) MeV for 233 U ,(208.786 ± 1.133 ) MeV for 238 Pu ,(211.266 ± 0.220 ) MeV for 240 Pu ,(213.862 ± 0.299 ) MeV for 242 Pu ,(215.077 ± 0.210 ) MeV for 241 Am ,(218.821 ± 0.159) MeV for 242Cm ,(218.525 ± 0.388) MeV for 243Cm ,and (220.067 ± 0.131) MeV for 244 Cm ,respectively .%在核反应堆设计中,对每次裂变释放热能进行精确计算具有重要意义。在压水堆内,高能中子诱发核裂变份额很小,233 U、241 Am、243 Cm主要由热中子诱发裂变,232 T h、238 Pu、240 Pu、242 Pu、242 Cm、244 Cm主要由快中子诱发裂变。本文采用最新的核评价数据库 ENDF/B-Ⅶ,利用质量守恒法计算裂变释放总能,同时研究了中微子带走的能量,中子俘获能及β、γ修正项,最终给出了9种核素裂变释放热能。与IAEA颁布的WIMS-D格式数据库中的裂变释放热能数据的对比表明,本文所用方法计算结果合理。9种核素每次裂变释放热能分别为:232 Th ,(193.939±0.176) MeV ;233 U ,(200.063

  6. Measurement of neutron-induced fission cross-sections of Th232, U238, U233 and Np237 relative to U235 from 1 MeV to 200 MeV

    Energy Technology Data Exchange (ETDEWEB)

    Shcherbakov, O.A.; Laptev, A.B.; Petrov, G.A. [Petersburg Nuclear Physics Inst., Gatchina, Leningrad district (Russian Federation); Fomichev, A.V.; Donets, A.Y.; Osetrov, O.I.

    1998-11-01

    The measurements of neutron-induced cross-section ratios for Th232, U238, U233 and Np237 relative to U235 have been carried out in the energy range from 1 MeV up to 200 MeV using the neutron time-of-flight spectrometer GNEIS based on 1 GeV proton synchrocyclotron. Below 20 MeV, the results of present measurements are roughly in agreement with evaluated data though there are some discrepances to be resolved. (author)

  7. Preliminary results of calculations for heavy-water nuclear-power-plant reactors employing 235U, 233U, and 232Th as a fuel and meeting requirements of a nonproliferation of nuclear weapons

    Science.gov (United States)

    Ioffe, B. L.; Kochurov, B. P.

    2012-02-01

    A physical design is developed for a gas-cooled heavy-water nuclear reactor intended for a project of a nuclear power plant. As a fuel, the reactor would employ thorium with a small admixture of enriched uranium that contains not more than 20% of 235U. It operates in the open-cycle mode involving 233U production from thorium and its subsequent burnup. The reactor meets the conditions of a nonproliferation of nuclear weapons: the content of fissionable isotopes in uranium at all stages of the process, including the final one, is below the threshold for constructing an atomic bomb, the amount of product plutonium being extremely small.

  8. Vapor-liquid equilibrium data for the carbon dioxide and oxygen (CO2 + O2) system at the temperatures 218, 233, 253, 273, 288 and 298 K and pressures up to 14 MPa

    OpenAIRE

    Westman, Snorre Foss; Stang, Hans Georg Jacob; Løvseth, Sigurd W.; Austegard, Anders; Snustad, Ingrid; Ertesvåg, Ivar S.

    2015-01-01

    Accurate thermophysical data for the CO2-rich mixtures relevant for carbon capture, transport and storage (CCS) are essential for the development of the accurate equations of state (EOS) and models needed for the design and operation of the processes within CCS. Vapor-liquid equilibrium measurements for the binary system CO2+O2 are reported at 218, 233, 253, 273, 288 and 298 K, with estimated standard uncertainties of maximum 8 mK in temperature, maximum 3 kPa in pressure, and max...

  9. Measurement of the Neutron Capture Cross Sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm with a Total Absorption Calorimeter at n_TOF

    CERN Multimedia

    Beer, H; Wiescher, M; Cox, J; Rapp, W; Embid, M; Dababneh, S

    2002-01-01

    Accurate and reliable neutron capture cross section data for actinides are necessary for the poper design, safety regulation and precise performance assessment of transmutation devices such as Fast Critical Reactors or Accelerator Driven Systems (ADS). The goal of this proposal is the measurement of the neutron capture cross sections of $^{233}$U, $^{237}$Np, $^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm at n_TOF with an accuracy of 5~\\%. $^{233}$U plays an essential role in the Th fuel cycle, which has been proposed as a safer and cleaner alternative to the U fuel cycle. The capture cross sections of $^{237}$Np,$^{240,242}$Pu, $^{241,243}$Am and $^{245}$Cm play a key role in the design and optimization of a strategy for the Nuclear Waste Transmutation. A high accuracy can be achieved at n_TOF in such measurements due to a combination of features unique in the world: high instantaneous neutron fluence and excellent energy resolution of the facility, innovative Data Acquisition System based on flash ADCs and t...

  10. 233例脐带绕颈分娩方式选择与围生儿预后的研究%Delivery the circulor ofumbilical cord of childbirth mode and perinatal stage of child's prognosis

    Institute of Scientific and Technical Information of China (English)

    周丽萍; 梁碧娜; 陈芳

    2010-01-01

    目的 探讨脐带绕颈分娩方式与围生儿预后的关系.方法 对2009年1-12月我院妇产科住院分娩233例脐带绕颈病例资料进行回顾性分析.结果 脐带绕颈以顺产占多数,脐带绕颈剖宫产组与顺产组围生儿结局差异无显著性(P>0.05).结论 脐带绕颈分娩方式以顺产占大多数,剖作为医生应当正确引导孕妇及家属选择顺产,以降低剖宫产率.%Objiective approaching the relations between circulor of umbilical cord's childbirth mode and perinatal stage of child's prognosis.Method analyses retrospectively 233 examples of circulor of umbilical cord which were in our department from 1 to 12 month in 2009.Result normal labor is majority in circulor of umbilical cord's childbirth, and there is no significant difference between uterineincision delivery class and normal labor class(P>0.05).Conclusion normal labor is majority in cireulor of umbilical cord's childbirth, doetors should guide gravidas and their family members to choice normal labor correctly and that would cut down the rate of uterine-incision delivery.

  11. Fase aguda da doença de Chagas na Amazônia brasileira: estudo de 233 casos do Pará, Amapá e Maranhão observados entre 1988 e 2005 Acute phase of Chagas disease in the Brazilian Amazon region: study of 233 cases from Pará, Amapá and Maranhão observed between 1988 and 2005

    Directory of Open Access Journals (Sweden)

    Ana Yecê das Neves Pinto

    2008-12-01

    Full Text Available Foram estudados 233 casos de fase aguda da doença de Chagas, oriundos do Pará, Amapá e Maranhão, observados no período de 1988 a 2005, cento e sessenta deles retrospectivamente de 1988 a 2002 e setenta e três prospectivamente de 2003 a 2005. Entre os casos estudados 78,5% (183/233 faziam parte de surtos provavelmente por transmissão oral, acometendo em média 4 pessoas e 21,5% (50/233 eram casos isolados. Foram considerados casos agudos aqueles que apresentaram exames parasitológicos diretos (a fresco, gota espessa ou Quantitative Buffy Coat - QBC e/ou IgM anti-Trypanosoma cruzi positivos. Foram feitos ainda xenodiagnósticos em 224 pacientes e hemoculturas em 213. Todos foram avaliados clinica e epidemiologicamente. As manifestações clínicas mais freqüentes foram febre (100%, cefaléia (92,3%, mialgia (84,1%, palidez (67%, dispnéia (58,4%, edema de membros inferiores (57,9%, edema de face (57,5% dor abdominal (44,2%, miocardite (39,9% e exantema (27%. O eletrocardiograma mostrou alterações de repolarização ventricular em 38,5% dos casos, baixa voltagem de QRS em 15,4% e desvio de SAQRS em 11,5%, extra-sístoles ventriculares em 5,8%, bradicardia em 5,8% e taquicardia em 5,8%, bloqueio de ramo direito em 4,8% e fibrilação atrial em 4,8%. A alteração mais freqüente vista no ecocardiograma foi o derrame pericárdico em 46,2% dos casos. Treze (5,6% pacientes evoluíram para o óbito, 10 (76,9% dos quais por comprometimento cardiovascular, dois por complicações de origem digestiva e um de causa mal definida.Two hundred and thirty-three cases of the acute phase of Chagas disease, from Pará, Amapá and Maranhão, were observed between 1988 and 2005. One hundred and sixty were studied retrospectively from 1988 to 2002 and seventy-three were prospectively followed up from 2003 to 2005. Among the cases studied, 78.5% (183/233 formed part of outbreaks, probably due to oral transmission (affecting a mean of 4 individuals, and 21

  12. Preliminary study of the {alpha} ratio measurement, ratio of the neutron capture cross section to the fission one for {sup 233}U, on the PEREN platform. Development and study of the experimental setup; Etude preliminaire de la mesure du rapport {alpha}, rapport de la section efficace moyenne de capture sur celle de fission de l'{sup 233}U, sur la plateforme PEREN. Developpement et etude du dispositif experimental

    Energy Technology Data Exchange (ETDEWEB)

    Cognet, M.A

    2007-12-15

    Producing nuclear energy in order to reduce anthropic CO{sub 2} emission and to meet high energy demand, implies three conditions to the nuclear plants of the IV. generation: safety improvements, radioactive waste minimization, and fuel breeding for a sustainable use of the resources. The Thorium fuel cycle used in Molten Salt Reactors seems promising. Many numerical studies based on probabilistic codes are carried out in order to analyse the behaviour of such reactors. Nevertheless, one of the most important parameters is badly known: the alpha ratio of {sup 233}U, ratio of the neutron capture cross section to fission one for {sup 233}U. This key-parameter is necessary to calculate the breeding ratio and thus, the deployment capacities of those reactors. This Ph-D thesis was intended to prepare a precise measurement of the alpha ratio of {sup 233}U between 1 eV and 10 keV. Preliminary measurements have been performed on the experimental platform PEREN. This experimental environment is composed of a lead slowing-down time spectrometer associated with an intense pulsed neutron generator. Capture and fission rates are measured thanks to eight scintillators with their photomultipliers, surrounding a fission chamber. A software analysis sets the coincidence rate between the scintillators. In order to understand perfectly the experimental setup, preliminary tests using a {sup 235}U fission chamber have been done. This experiment resulted in a very low signal to background ratio (1 %). The background coming from the scintillators themselves seriously handicapped the measurement. Another series of experiment has been done with scintillators 5 times thinner. Nevertheless, the signal to background ratio should still be increased to measure the capture of {sup 235}U. To make sure that the experimental setup has totally been understood, we made many comparisons between experimental results and simulations. Two simulation codes were mainly used: MCNP and GEANT4. We paid

  13. New measurements of (n,γ) and (n,fission) cross sections and capture-to-fission ratios for ^233,235U and ^239Pu using the DANCE 4π BaF2 array

    Science.gov (United States)

    Bredeweg, T. A.; Jandel, M.; Fowler, M. M.; Bond, E. M.; Haight, R. C.; Keksis, A. L.; O'Donnell, J. M.; Reifarth, R.; Rundberg, R. S.; Ullmann, J. L.; Vieira, D. J.; Wilhelmy, J. B.; Wouters, J. M.; Becker, J. A.; Parker, W. E.; Wu, C. Y.; Baker, J. D.; McGrath, C. A.

    2009-10-01

    Accurate neutron nuclear data are important to many issues in stockpile stewardship, nuclear reactor design and re-certification, nuclear non-proliferation and nuclear forensics. Of particular interest are the production and destruction reactions for all of the major and most of the minor actinides. The competition between capture and fission in many of the actinides presents both an obstacle and an opportunity for large γ detector arrays such as DANCE. Additional instrumentation is required to deconvolve the two contributions to the total observed γ-ray spectrum. However, conducting a simultaneous measurement can simplify background treatment and other sources of systematic uncertainty. An outline of the current experimental program will be presented along with results from neutron capture measurements on ^233,235U and ^239Pu.

  14. Concept of a demonstrational hybrid reactor—a tokamak with molten-salt blanket for {sup 233}U fuel production: 1. Concept of a stationary Tokamak as a neutron source

    Energy Technology Data Exchange (ETDEWEB)

    Azizov, E. A.; Gladush, G. G., E-mail: gladush@triniti.ru; Dokuka, V. N.; Khayrutdinov, R. R. [State Research Center of the Russian Federation, Troitsk Institute for Innovation and Fusion Research (Russian Federation)

    2015-12-15

    On the basis of current understanding of physical processes in tokamaks and taking into account engineering constraints, it is shown that a low-cost facility of a moderate size can be designed within the adopted concept. This facility makes it possible to achieve the power density of neutron flux which is of interest, in particular, for solving the problem of {sup 233}U fuel production from thorium. By using a molten-salt blanket, the important task of ensuring the safe operation of such a reactor in the case of possible coolant loss is accomplished. Moreover, in a hybrid reactor with the blanket based on liquid salts, the problem of periodic refueling that is difficult to perform in solid blankets can be solved.

  15. Concept of a demonstrational hybrid reactor—a tokamak with molten-salt blanket for 233U fuel production: 1. Concept of a stationary Tokamak as a neutron source

    Science.gov (United States)

    Azizov, E. A.; Gladush, G. G.; Dokuka, V. N.; Khayrutdinov, R. R.

    2015-12-01

    On the basis of current understanding of physical processes in tokamaks and taking into account engineering constraints, it is shown that a low-cost facility of a moderate size can be designed within the adopted concept. This facility makes it possible to achieve the power density of neutron flux which is of interest, in particular, for solving the problem of 233U fuel production from thorium. By using a molten-salt blanket, the important task of ensuring the safe operation of such a reactor in the case of possible coolant loss is accomplished. Moreover, in a hybrid reactor with the blanket based on liquid salts, the problem of periodic refueling that is difficult to perform in solid blankets can be solved.

  16. Divergent, stereoselective access to heterocyclic α,α-quaternary- and β(2,3,3)-amino acid derivatives from a N-Pmp-protected Orn-derived β-lactam.

    Science.gov (United States)

    Núñez-Villanueva, Diego; García-López, M Teresa; Martín-Martínez, Mercedes; González-Muñiz, Rosario

    2015-05-14

    A suitably protected Orn-derived (3S,4S)-β-lactam was used as common intermediate in the synthesis of conformationally constrained (3S,4S)-2-oxoazepane α,α- and (2S,3S)-2-oxopiperidine-β(2,3,3)-amino acid derivatives. Compared to alternative procedures using an N-p-methoxybenzyl group at the 2-azetidinone, the incorporation of a p-methoxyphenyl moiety is crucial for the excellent stereochemical outcomes in the preparation of these heterocyclic amino acids. Chemoselective 7- or 6-exo-trig cyclization was achieved through alternative sequences of Pmp-deprotection/Boc-activation, followed by inter- and intramolecular β-lactam ring opening, respectively.

  17. Proceedings of the NEANDC/NEACRP specialists meeting on fast neutron fission cross sections of U-233, U-235, U-238, and Pu-239, June 28--30, 1976, at Argonne National Laboratory

    Energy Technology Data Exchange (ETDEWEB)

    Poenitz, W P; Guenther, P T

    1976-01-01

    Data files of all available data of absolute cross section measurements of U-233, U-235, U-238 and Pu-239, and of the ratios of U-233, U-238, and Pu-239 to U-235 were assembled at Argonne National Laboratory for use by the two Working Groups. The data files of absolute cross sections included also data measured relative to one of the standard cross sections H(n,n), Li-6(n,..cap alpha..), and B-10(n,..cap alpha..), and the ratio data files included ratios derived from absolute values which were measured in an identical type of experiment by the same group of experimenters. The subject files (e.g., U-235-Absolute, or U-238/U-235-Ratio, etc.) consisted of ''Sets.'' These sets contained the data from one experimental group which may have been published at different times. The assembling of the files was started with an extract from the CSISRS data files of the National Neutron Cross Section Center at the Brookhaven National Laboratory. Ratios were derived from quoted consistent sets of absolute cross sections, or from data which were actually measured as ratios but quoted as absolute values. The latter type of data was eliminated from the data files on absolute values. The files were improved by an extensive search for errors and data missing on the original CSISRS files at the time the extract was made. Other additions to the present subject files came from presentations made at this meeting and are described in the proceedings.

  18. Brad Patterson, Tom Brooking, and Jim McAloon, Unpacking the Kist: The Scots in New Zealand. McGill-Queen's Studies in Ethnic History Series, No. 2.33. Montreal: McGill-Queen’s University Press, 2013. Pp. 412. ISBN 978-0-7735-4190-0. CAD $100.00.

    Directory of Open Access Journals (Sweden)

    Seán Gerard Brosnahan

    2014-11-01

    Full Text Available Brad Patterson, Tom Brooking, and Jim McAloon, Unpacking the Kist: The Scots in New Zealand. McGill-Queen's Studies in Ethnic History Series, No. 2.33. Montreal: McGill-Queen’s University Press, 2013. Pp. 412. ISBN 978-0-7735-4190-0. CAD $100.00.

  19. Study of the electrochemical oxidation of Am with lacunary heteropolyanions and silver nitrate; Etude de l'oxydation electrochimique de l'americium en presence d'heteropolyanions lacunaires et de nitrate d'argent en milieu aqueux acide

    Energy Technology Data Exchange (ETDEWEB)

    Chartier, D

    1999-07-01

    Electrochemical oxidation of Am(III) with certain lacunary heteropolyanions (LHPA {alpha}{sub 2}-P{sub 2}W{sub 17}O{sub 61}{sup 10-} or {alpha}SiW{sub 11}O{sub 39}{sup 8-}) and silver nitrate is an efficient way to prepare Am(VI). This document presents bibliographic data and an experimental study of the process. Thus, it has been established that Am(IV) is an intermediate species in the reaction and occurs in 1:1 (Amt{sup IV}LHPA) or 1:2 (Am {sup IV}(LHAP){sub 2}) complexes with the relevant LHPA. These 1:1 complexes of Am(IV) have been identified and isolated in this work whereas 1:2 complexes were known from previous studies. The reactivity of these complexes in oxidation shows that 1:1 complexes of Am(IV) are oxidised much more quickly than 1:2 complexes. Apparent stability constants of Am(III) and Am(IV) complexes with the relevant LHPA have been measured for a 1 M nitric acid medium. Thermodynamic data of the reaction are then assessed: redox potentials of Am pairs are computed for a 1 M nitric acid medium containing various amount of LHPA ligands. Those results show that the role of LHPA is to stabilize the intermediate species Am(IV) by lowering the Am(IV)/Am(III) pair potential of about 1 Volt. Nevertheless, if this stabilisation is too strong (i.e. of tungsto-silicate), the oxidation of Am(IV) requires high anodic potential (more than 2 V/ENH). Then, the faradic yield of the oxidation of americium is poor because of water oxidation. This study has also shown that the main role of silver is to catalyze the electrochemical oxidation of Am{sup IV}(LHPA){sub X} complexes. Indeed, these oxidations without silver are extremely slow. An oxygen tracer experiment has been performed during the oxidation of Am(III) in Am(VI). It has been shown that the oxygen atoms of Am(VI) (AMO{sub 2}{sup 2+}) come from water molecules of the solvent and not from the complexing oxygen atoms of the ligands. (author)

  20. Fabrication of targets for transmutation of americium : synthesis of inertial matrix by sol-gel method. Procedure study on the infiltration of a radioactive solutions; Fabricacion de blancos para la transmutacion de americio: sintesis de matrices inertes por el metodo sol-gel. Estudio del procedimiento de infiltracion de disoluciones radiactivas

    Energy Technology Data Exchange (ETDEWEB)

    Fernandez Carretero, A. [Universidad Complutense de Madrid (Spain)

    2002-07-01

    made. In addition a new and unexpected phase formed by the reaction of americium with spinel during the high temperature synthesis process has been identified. This new phase could provide a unique menas to stabilise Am in one particular oxidation state. (Author)

  1. Synthesis, crystal structures and characterization of two novel organic-inorganic hybrid compounds (C5NH6)6Bi4Br18 and [C(NH2)3]3BiI6

    Science.gov (United States)

    Li, S. G.; Chen, L.; Xiang, Y.

    2017-02-01

    Two novel organic-inorganic compounds (C5NH6)6Bi4Br18 (1) and [C(NH2)3]3BiI6 (2) have been synthesized and characterized by elemental analysis, measured by DSC and single-crystal X-ray diffraction at room temperature. The crystal structure of (1) crystallizes in the monoclinic space group C2/m, with a = 17.12 (3), b = 15.3939 (1), c = 13.412 (2) Å, β = 123.702 (7)°, V = 3042.2 (8) Å3 and Z = 2. The crystal structure consists of discrete quad-core [Bi4Br18]6- anions and [C5NH6]+ cations. 2 crystallizes in triclinic space group P-1, with the following unit cell parameters: a = 9.3435 (2), b = 15.583 (4), c = 17.200 (4) Å, α = 86.383 (1), β = 75.689 (1), γ = 89.918 (6)°, V = 2421.5 (10) Å3 and Z = 4. The crystal lattice is composed of discrete [BiI6]3- anions surrounded by [C(NH2)3]+ cations. The DSC experiment of 1 clearly displays that a phase transition occurred at 124.7 K, while 2 undergoes a phase transition at 192.5 K.

  2. Co-occurrence of non-mosaic trisomy 22 and inherited balanced t(4;6)(q33;q23.3) in a liveborn female: case report and review of the literature.

    Science.gov (United States)

    Kehinde, Folasade I; Anderson, Carol E; McGowan, Jane E; Jethva, Reena N; Wahab, Mohammed A; Glick, Adina R; Sterner, Mark R; Pascasio, Judy M; Punnett, Hope H; Liu, Jinglan

    2014-12-01

    Trisomy 22 is the third most common autosomal trisomy occurring in about 0.4% of all clinically recognized pregnancies. Complete non-mosaic trisomy 22 is extremely rare in live births. Most affected children die before one year of age. To date, only 29 liveborn cases have been reported and none has carried an additional genetic lesion. In this report, we describe the clinical presentation, cytogenetic, and cytogenomic findings in a liveborn female with complete non-mosaic trisomy 22 as well as a paternally inherited, balanced reciprocal chromosomal rearrangement t(4;6)(q33;q23.3). The proband manifested features commonly seen in individuals with non-mosaic trisomy 22 such as intrauterine growth retardation (IUGR), single umbilical artery, cranial abnormalities, short neck, cleft lip and palate, dysmorphic ears, hypoplastic nipples, digital malformation, congenital heart defects, dysplastic kidneys, and genital anomalies. In addition, she had lobar holoprosencephaly, aqueductal stenosis, and limb and eye problems that have not been associated with complete trisomy 22 in previous reports. She died at 35 days of age of complex heart disease and renal failure. We are hereby expanding the cytogenetic and clinical spectrum of this rare chromosome disorder. Clinical features of liveborn children with non-mosaic trisomy 22 are reviewed and compared to those in our proband. The impact of genomic content in relation to the survival of trisomies in humans is also discussed.

  3. A novel tRNA variable number tandem repeat at human chromosome 1q23.3 is implicated as a boundary element based on conservation of a CTCF motif in mouse.

    Science.gov (United States)

    Darrow, Emily M; Chadwick, Brian P

    2014-06-01

    The human genome contains numerous large tandem repeats, many of which remain poorly characterized. Here we report a novel transfer RNA (tRNA) tandem repeat on human chromosome 1q23.3 that shows extensive copy number variation with 9-43 repeat units per allele and displays evidence of meiotic and mitotic instability. Each repeat unit consists of a 7.3 kb GC-rich sequence that binds the insulator protein CTCF and bears the chromatin hallmarks of a bivalent domain in human embryonic stem cells. A tRNA containing tandem repeat composed of at least three 7.6-kb GC-rich repeat units reside within a syntenic region of mouse chromosome 1. However, DNA sequence analysis reveals that, with the exception of the tRNA genes that account for less than 6% of a repeat unit, the remaining 7.2 kb is not conserved with the notable exception of a 24 base pair sequence corresponding to the CTCF binding site, suggesting an important role for this protein at the locus.

  4. Measurement and calculation of absolute single- and double-charge-exchange cross sections for O6 + ions at 1.17 and 2.33 keV/u impacting He and H2

    Science.gov (United States)

    Machacek, J. R.; Mahapatra, D. P.; Schultz, D. R.; Ralchenko, Yu.; Chutjian, A.; Simcic, J.; Mawhorter, R. J.

    2014-11-01

    Absolute single- and double-charge-exchange cross sections for the astrophysically prominent O6 + ion with the atomic and molecular targets He and H2 are reported. These collisions give rise to x-ray emissions in the interplanetary medium, planetary atmospheres, and comets as they approach the sun. Measurements have been carried out using the Caltech Jet Propulsion Laboratory electron cyclotron resonance ion source with O6 + at energies of 1.17 and 2.33 keV/u characteristic of the slow and fast components of the solar wind. Absolute charge-exchange (CE) data are derived from knowledge of the target gas pressure, target path length, incident ion current, and charge-exchanged ion currents. These data are compared with results obtained using the n -electron classical trajectory Monte Carlo method. The radiative and Auger evolution of ion populations following one- and two-electron transfers is calculated with the time-dependent collisional-radiative code nomad using atomic data from the flexible atomic code. Calculated CE emission spectra for 100 Å <λ <1400 Å are reported as well and compared with experimental sublevel spectra and cross sections.

  5. 241镅跟骨骨密度测定在骨质疏松症中的初步应用 ——与腰椎骨密度测定的对比研究%Preliminary application of 241-Americium calcaneus bone mineral density measurement in osteoporosis ——comparison with double X-ray densitometry of the lumber spine

    Institute of Scientific and Technical Information of China (English)

    管梁; 朱承谟; 李培勇; 王辉; 濮鸣芳; 仇季高

    2001-01-01

    Bone mineral density (BMD) of calcaneus in 54 normals, 45 Osteoporosis, 25 suspected osteoporosis and 16 other non-osteoporosis patients, a total of 140 cases were measured by HUAKE (HK-1) 241-Americium BMD absorpmetry, among them 43 were compared with that of lumber spine (L2—L4) measured by Lunar Corporation's Expert-XL absorpmeter. BMD of normal group of calcaneus was (409.8±79.4)mg/cm2. The BMD were decreased slowly with the increased age. The BMD of osteoporosis, suspected osteoporosis and non-osteoporosis group were 230.3±62.3, 395.7±57.4 and 363.3±51.9mg/cm2 respectively. The BMD of osteoporosis group was much lower than that of normal group, and also lower than that of the other two groups, among 26 patients (57.78%) had bone fracture, all was in accordance with the clinical diagnosis of osteoporosis. The BMD of suspected ospteoporosis and non-osteoporosis had no significant difference with normal group. The coefficient variation (CV) of BMD in repeated measurement in calcaneus of 4 pariticipants was less than 1.2%. The correlative coefficient (r) between BMD of calcaneus and lumber spine (L2—L4) group was 0.6824. The correlative coefficient of normal young adult-matched percentage and T value in 2 groups were 0.6863 and 0.6755 respectively, whereas aged-matched percentage, Z value were 0.4614 and 0.5009 respectively. In conclusion 241-Americium calcaneus BMD absorpmetry has the advantage of low price, easy to operate, reliable and valuable in diagnosis osteoporosis. The correlations of calcaneus and lumber spine BMD, normal young adult-matched percentagy and T value were rather good.%为评价跟骨骨密度测定在骨质疏松症中的初步临床应用及与腰椎测定结果的相关性,用国产华科(HK-1型)241镅骨密度仪测定了140例跟骨骨密度(BMD)。其中正常人组54例,骨质疏松确诊组45例,骨质疏松可疑组25例和其他非骨质疏松组16例。其中43例与美国Luner 公司的Expert-XL图像骨密度仪腰

  6. Job Intentions in Community Nursing and Its Driving Factor among Nursing Students%233名护生社区护理就业意向及驱动因素分析

    Institute of Scientific and Technical Information of China (English)

    涂丽娟; 张平; 孔令磷

    2012-01-01

    Objective To understand job intentions in coiTimunity nursing and its driving factors among nursing students and to provide guidance for community nursing. Methods A self-designed questionnaire was applied among 233 nursing students about job intention, its driving factors and employment autonomy. Results Of the total. 47,2% students showed willingness to work in community health center and there existed difference among students with different educational background and nursing experience (P<0.05 or P<0.03.). Driving factor of students' willingness to work in community nursing included pressure of employment, cognition of community nursing and personal ambition. Difference of employment autonomy showed statistic significance among nursing students with, low employment autonomy, those from different birthplaces and those with nursing experience and those without (P<0.01). Conclusion The job intentions in community nursing among nursing students keeps in moderate level. There exist differences among job intentions, form and employment autonomy. Teaching reform and employment guidance in community nursing should be enhanced.%目的 了解不同类别护生的社区就业意向及驱动因素,以期为社区护理教学及社区护理就业指导提供参考.方法 运用自制问卷对233 名护理本、专科学生进行问卷调查,内容包括社区就业意向,愿意、不愿意到社区就业的驱动因素及就业决策自主性等.结果 47.2%的护生表示愿意从事社区护理工作,本、专科护生之间、是否有实习经历的护生之间差异有统计学意义(P<0.05 或P<0.01);就业压力、对社区护理工作的认知、个人志向是护生从事社区护理工作的主要驱动因素;护生就业决策自主性不高,不同生源地护生、是否有实习经历护生决策自主性差异有统计学意义(P<0.01).结论 地方院校护生社区就业积极性为中等水平,不同类型护生的就业意愿、形式及决策自主性有

  7. 45 CFR 233.80 - Disability.

    Science.gov (United States)

    2010-10-01

    ... CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES COVERAGE AND CONDITIONS OF ELIGIBILITY IN... or XVI of the Social Security Act must: (1) Contain a definition of permanently and totally disabled... occupations within his competence, such as holding a job. Under this definition: “Permanently” refers to...

  8. 45 CFR 233.60 - Institutional status.

    Science.gov (United States)

    2010-10-01

    ... patient in an institution for tuberculosis or mental diseases. (ii) Federal financial participation under..., or a patient in an institution for tuberculosis or mental diseases; (ii) Whether an institution is one for tuberculosis or mental diseases will be determined by whether its overall character is that...

  9. 37 CFR 2.33 - Verified statement.

    Science.gov (United States)

    2010-07-01

    ... behalf of the applicant under § 2.193(e)(1). (b)(1) In an application under section 1(a) of the Act, the... likely, when applied to the goods or services of the other person, to cause confusion or mistake, or to... 44 of the Act, the verified statement must allege: That the applicant has a bona fide intention...

  10. 40 CFR 233.70 - Michigan.

    Science.gov (United States)

    2010-07-01

    ... susceptible for use in their natural condition or by reasonable improvement as a means to transport interstate... December 9, 1983. (2) The Memorandum of Agreement between the U.S. Army Corps of Engineers and the...

  11. TMFunction data: 233 [TMFunction[Archive

    Lifescience Database Archive (English)

    Full Text Available Biol Chem. 2000 Jul 14;275(28):21017-24 mutagenesis ... affinity chromatography 1AJJ ... LDLR_HUMAN (P01130) Helix ... ligand binding site; surface exposed; acidic residue; conserved

  12. 34 CFR 668.233 - Student eligibility.

    Science.gov (United States)

    2010-07-01

    ..., DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Financial Assistance for Students With... evaluation and diagnosis of an intellectual disability by a psychologist or other qualified professional;...

  13. 233西番莲%Passionflower1

    Institute of Scientific and Technical Information of China (English)

    2005-01-01

    @@ 又名 Apricot Vine, Corona De Cristo, Fleischfarbige, Fleur De La Passion, Flor De Passion, Madre Selva, Maypop, Maypop Passion Flower, Passiflora, Passiflorae herba, Passiflore, Passiflorina, Passion Flower, Passion Vine, Passionaria, Passionblume, Passionflower Herb, Passionsblumenkraut,Purple Passion Flower, Water Lemon, Wild Passion Flower.

  14. 39 CFR 233.3 - Mail covers.

    Science.gov (United States)

    2010-07-01

    ... avoid prosecution for a crime, to avoid punishment for a crime, or to avoid giving testimony in a criminal proceeding. (6) Crime, for the purposes of this section, is any commission of an act or the..., (ii) Locate a fugitive, (iii) Obtain evidence of commission or attempted commission of a crime,...

  15. 45 CFR 233.70 - Blindness.

    Science.gov (United States)

    2010-10-01

    ... Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES COVERAGE AND CONDITIONS OF ELIGIBILITY IN... necessary when both eyes are missing. (ii) Where an initial eye examination or re-examination is...

  16. 40 CFR 233.21 - General permits.

    Science.gov (United States)

    2010-07-01

    ... apply for an individual permit. This discretionary authority will be based on concerns for the aquatic... the discharger of his decision to exercise discretionary authority to require an individual...

  17. 12 CFR 233.2 - Definitions.

    Science.gov (United States)

    2010-01-01

    ... to win a lottery or other prize (which opportunity to win is predominantly subject to chance); (3... defined in 28 U.S.C. 3701) and that meets the following conditions: (A) All prizes and awards offered to... participants and are determined predominantly by accumulated statistical results of the performance...

  18. 48 CFR 52.233-1 - Disputes.

    Science.gov (United States)

    2010-10-01

    .... (c) Claim, as used in this clause, means a written demand or written assertion by one of the... demand or written assertion by the Contractor seeking the payment of money exceeding $100,000 is not a... to use alternative dispute resolution (ADR). If the Contractor refuses an offer for ADR,...

  19. Americium separation from nuclear fuel dissolution using higher oxidation states.

    Energy Technology Data Exchange (ETDEWEB)

    Bruce J. Mincher

    2009-09-01

    Much of the complexity in current AFCI proposals is driven by the need to separate the minor actinides from the lanthanides. Partitioning and recycling Am, but not Cm, would allow for significant simplification because Am has redox chemistry that may be exploited while Cm does not. Here, we have explored methods based on higher oxidation states of Am (AmV and AmVI) to partition Am from the lanthanides. In a separate but related approach we have also initiated an investigation of the utility of TRUEX Am extraction from thiocyanate solution. The stripping of loaded TRUEX by Am oxidation or SCN- has not yet proved successful; however, the partitioning of inextractable AmV by TRUEX shows promise.

  20. Further Studies of Plutonium and Americium at Thule, Greenland

    DEFF Research Database (Denmark)

    Aarkrog, Asker; Dahlgaard, Henning; Nilsson, Karen Kristina;

    1984-01-01

    further away from the impact point and at some locations the vertical distribution indicated a downward displacement of Pu in the sediment column since 1974. Seawater and seaplants showed no evidence of the presence of Pu from sources other than fallout; but Pu in benthos varied nearly proportionally......, but in benthos 241Am/239,240Pu were two times higher than in sediments. Seaplants showed the same value of Am/Pu as seawater. There was no indication of any biomagnification of Pu or Am through the marine food chains at Thule....

  1. Property Data for Simulated Americium/Curium Glasses

    Energy Technology Data Exchange (ETDEWEB)

    Riley, B.J.; Smith, D.E.; Peeler, D.K.; Reamer, I.A.; Vienna, J.D.; Schweiger, M.J.

    1999-10-20

    The authors studied the properties of mixed lanthanide-alumino-borosilicate glasses. Fifty-five glasses were designed to augment a previous, Phase I, study by systematically varying the composition of Ln{sub 2}O{sub 3} and the concentrations of Ln{sub 2}O{sub 3}, SiO{sub 2}, B{sub 2}O{sub 3}, Al{sub 2}O{sub 3}, and SrO in glass. These glasses were designed and fabricated at the Savannah River Technology Center and tested at the Pacific Northwest National Laboratory. The properties measured include the high-temperature viscosity ({eta}) as a function of temperature (T) and the liquidus temperature (T{sub L}) of Phase II test glasses.

  2. Plutonium and americium contamination in Rocky Flats soil, 1973

    Energy Technology Data Exchange (ETDEWEB)

    Krey, P.; Hardy, E.; Volchok, H.; Toonkel, L.; Knuth, R.; Coppes, M.; Tamura, T.

    1976-03-01

    The plutonium mass isotopic analysis and the Am-241 analysis of soil samples from Rocky Flats identify the contamination as Pu which was processed in 1958. The Am-241 activity in the soil will reach its maximum in 2033 and represent 18 percent of the Pu-239-240 activity. Nuclide ratios indicate that current operations at Rocky Flats contribute little to the airborne Pu concentrations which are due to resuspension of the contaminated soil. Root uptake of Pu or Am by vegetation is slight or shows no discrimination among the isotopes and nuclides studied. The relationship between Pu deposition contour and the area enclosed by that contour has been verified for contour values extending over 7 orders of magnitude. This gives confidence to our calculations of the quantities of Pu released on and off the Rocky Flats plant site. (auth)

  3. Biosorption of americium-241 by immobilized Rhizopus arrihizus

    Energy Technology Data Exchange (ETDEWEB)

    Liao Jiali E-mail: liaojiali@163.com; Yang Yuanyou; Luo Shunzhong; Liu Ning; Jin Jiannan; Zhang Taiming; Zhao Pengji

    2004-01-01

    Rhizopus arrihizus (R. arrihizus), a fungus, which in previous experiments had shown encouraging ability to remove {sup 241}Am from solutions, was immobilized by calcium alginate and other reagents. The various factors affecting {sup 241}Am biosorption by the immobilized R. arrihizus were investigated. The results showed that not only can immobilized R. arrihizus adsorb {sup 241}Am as efficiently as free R. arrihizus, but that also can be used repeatedly or continuously. The biosorption equilibrium was achieved within 2 h, and more than 94% of {sup 241}Am was removed from {sup 241}Am solutions of 1.08 MBq/l by immobilized R. arrihizu in the pH range 1-7. Temperature did not affect the adsorption on immobilized R. arrihizus in the range 15-45 deg. C. After repeated adsorption for 8 times, the immobilized R. arrihizus still adsorbed more than 97% of {sup 241}Am. At this time, the total adsorption of {sup 241}Am was more than 88.6 KBq/g, and had not yet reached saturation. Ninety-five percent of the adsorbed {sup 241}Am was desorbed by saturated EDTA solution and 98% by 2 mol/l HNO{sub 3}.

  4. Overexpression of the catalytically impaired Taspase1 T234V or Taspase1 D233A variants does not have a dominant negative effect in T(4;11 leukemia cells.

    Directory of Open Access Journals (Sweden)

    Carolin Bier

    Full Text Available BACKGROUND: The chromosomal translocation t(4;11(q21;q23 is associated with high-risk acute lymphoblastic leukemia of infants. The resulting AF4•MLL oncoprotein becomes activated by Taspase1 hydrolysis and is considered to promote oncogenic transcriptional activation. Hence, Taspase1's proteolytic activity is a critical step in AF4•MLL pathophysiology. The Taspase1 proenzyme is autoproteolytically processed in its subunits and is assumed to assemble into an αββα-heterodimer, the active protease. Therefore, we investigated here whether overexpression of catalytically inactive Taspase1 variants are able to interfere with the proteolytic activity of the wild type enzyme in AF4•MLL model systems. METHODOLOGY/FINDINGS: The consequences of overexpressing the catalytically dead Taspase1 mutant, Taspase1(T234V, or the highly attenuated variant, Taspase1(D233A, on Taspase1's processing of AF4•MLL and of other Taspase1 targets was analyzed in living cancer cells employing an optimized cell-based assay. Notably, even a nine-fold overexpression of the respective Taspase1 mutants neither inhibited Taspase1's cis- nor trans-cleavage activity in vivo. Likewise, enforced expression of the α- or β-subunits showed no trans-dominant effect against the ectopically or endogenously expressed enzyme. Notably, co-expression of the individual α- and β-subunits did not result in their assembly into an enzymatically active protease complex. Probing Taspase1 multimerization in living cells by a translocation-based protein interaction assay as well as by biochemical methods indicated that the inactive Taspase1 failed to assemble into stable heterocomplexes with the wild type enzyme. CONCLUSIONS: Collectively, our results demonstrate that inefficient heterodimerization appears to be the mechanism by which inactive Taspase1 variants fail to inhibit wild type Taspase1's activity in trans. Our work favours strategies targeting Taspase1's catalytic activity

  5. An 8.9 Mb 19p13 duplication associated with precocious puberty and a sporadic 3.9 Mb 2q23.3q24.1 deletion containing NR4A2 in mentally retarded members of a family with an intrachromosomal 19p-into-19q between-arm insertion.

    Science.gov (United States)

    Lybaek, Helle; Ørstavik, Karen Helene; Prescott, Trine; Hovland, Randi; Breilid, Harald; Stansberg, Christine; Steen, Vidar Martin; Houge, Gunnar

    2009-07-01

    In a 2 and a half-year-old girl with onset of puberty before the age of 5 months, short stature, hand anomalies and severe mental retardation, an 8.9 Mb interstitial 19p13 duplication containing 215 predicted genes was detected. It was initially assumed that the duplication involved the kisspeptin receptor gene, GPR54, known to stimulate induction of puberty, but more refined duplication mapping excluded this possibility. In an attempt to further understand the genotype-phenotype correlation, global gene expression was measured in skin fibroblasts. The overall expression pattern was quite similar to controls, and only about 25% of the duplicated genes had an expression level that was increased by more than 1.3-fold, with no obvious changes that could explain the precocious puberty. The proband's mother carried a balanced between-arm insertion of the duplicated segment that resembled a pericentric inversion. The same insertion was found in several other family members, including one who had lost a daughter with severe mental retardation and menarche at the age of 10 years. Another close relative was severely mentally retarded, but neither dysmorphic nor microcephalic. His phenotype was initially ascribed to a presumed cryptic chromosome 19 imbalance caused by the 19p-into19q insertion, but subsequent array-CGH detected a 3.9-Mb deletion of 2q23.3q24.1. This novel microdeletion involves seven genes, of which FMNL2, a suggested regulator of Rho-GTPases, and NR4A2, an essential gene for differentiation of dopaminergic neurons, may be critical genes for the proposed 2q23q24 microdeletion syndrome.

  6. Dicty_cDB: AFN233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available isqem* cryscistih**n*titleiynnll*fkylynr*tkl*snskinv*n*ykrvingfsfti nyyt**ckd*stsnvtisyc*sd*ssl*sl*fsimcre...GLDDTLASR EEINKTLMLKISSIFLNFGLKLEKVEI--- ---*snskinv*n*ykrvingfsftinyyt**ckd*stsnvtisyc*sd*ssl*sl*fsi mcre...igsnitkinhw*ygfr*yfslk rgn**ninvkd**ylfkfws*irks*n--- ---ik*lkn*cikliqesh*wiflynqll...igsnitkinhw*ygfr*yfslkrgn**ninvkd**ylfkfws*irks*nfrnftft insrcitftnfirtct*skcnfsrrf

  7. 40 CFR 233.53 - Withdrawal of program approval.

    Science.gov (United States)

    2010-07-01

    ... 22 are applicable to proceedings under this paragraph: (A) Section 22.02—(use of number/gender); (B... memorandum or other communication addressed to the Administrator, the Regional Administrator, the Regional... memorandum or communication. (C) Intervention—(1) Motion. A motion for leave to intervene in any...

  8. 45 CFR 233.31 - Budgeting methods for AFDC.

    Science.gov (United States)

    2010-10-01

    ... Public Welfare Regulations Relating to Public Welfare OFFICE OF FAMILY ASSISTANCE (ASSISTANCE PROGRAMS), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES COVERAGE AND CONDITIONS OF... agency's reasonable expectation and knowledge of current, past or future circumstances. (2)...

  9. 39 CFR 233.2 - Circulars and rewards.

    Science.gov (United States)

    2010-07-01

    ... threatening communications, actual or simulated weapons of mass destruction, dangerous chemicals or biological... reserves the right to reject a claim for reward where there has been collusion, criminal involvement, or... collected by the Postal Service as a result of civil or criminal proceedings to recover losses or...

  10. Systems Requirement Document for the MSRE U-233 Conversion System

    Energy Technology Data Exchange (ETDEWEB)

    Aigner, R.D.

    2001-01-11

    The fissile material reclamation activities for the MSRE remediation project include the removal and recovery of uranium from the off-gas system, from the stored fuel salt, and finally, from the uranium-laden charcoal in the Auxiliary Charcoal Bed (ACB). Each of these operations produces an uranium/fluoride compound that is not suitable for long-term storage. The uranium-fluoride compounds can be stored for a limited period of time in pressure vessels. The interim-storage vessels are designed to handle the internal pressure buildup from gases formed by radiolysis of the uranium-fluoride compounds. The conversion process will take the pressurized vessels from interim storage and process the materials in a hot cell located at Building 4501. The gas in the vessels will be vented through chemical traps and then the traps will be processed to convert the various uranium-fluoride compounds to a stable uranium oxide form. This will be done one trap at a time. The chemical form of uranium being extracted from the off-gas system and from fuel salt fluorination process is uranium hexafluoride UF{sub 6}. During the operations at MSRE, the UF{sub 6} is chemisorbed onto sodium fluoride (NaF) traps where it forms the complex, 2NaF{center_dot}UF{sub 6}. The conversion process that will be installed in the Building 4501 Hot Cell D will recover the UF{sub 6} from the NaF traps by decomposition of the binary complex at elevated temperatures (>300 C). After the uranium is extracted from the NaF traps, it is collected in the conversion process reaction vessel. The reaction vessel is then hydrolized and heated through several step operations up to 900 C in order to convert the material to a stable uranium oxide. The ACB at MSRE contains uranium-laden charcoal with unstable C{sub x}F compounds. After extraction at MSRE, this material will be delivered to Building 4501 Hot Cell D for processing to a stable oxide. The charcoal conversion process is still under development, with mockup and full scale testing of the proposed flow sheet funded in FY 99 and FY 00. The uranium-laden charcoal has been pre-treated with ammonia to prevent the deflagration of the C{sub x}F if localized heating (>{approximately}150 C) occurs during the charcoal removal process. Prior to removal, the treatment will be performed a second time to denature the 1 to 5% reformation of C{sub x}F that has occurred due to radiolysis of NH{sub 4}F. The uranium-laden charcoal will be physically extracted and stored in several pressure vessels at MSRE until the conversion process is designed and installed in Hot Cell A in Building 4501.

  11. 45 CFR 233.50 - Citizenship and alienage.

    Science.gov (United States)

    2010-10-01

    ...), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES COVERAGE AND CONDITIONS OF... Conditional Entrant Refugees. (3) Section 208—Aliens Granted Political Asylum by the Attorney General....

  12. Dicty_cDB: VFE233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 1 BD183626 |BD183626.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium.... 76 6e-61 10 BD183625 |BD183625.1 Material for diagnosing malaria and immune antigen for suppressing growth of plasmodium

  13. 39 CFR 233.7 - Forfeiture authority and procedures.

    Science.gov (United States)

    2010-07-01

    ... property is completed, it appears that the proceeds of sale will not be sufficient to pay the costs of sale... related crimes, unless the arrestee was acquitted or the charges were dismissed for lack of evidence; a conviction for a related crime or completion of sentence within ten years of the acquisition of the...

  14. Dicty_cDB: CHG233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 863585.1 kx46a06.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides trichosuri...1e-21 4 BI863575 |BI863575.1 kx45h07.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongyloides... BI451383 |BI451383.1 kx23e09.y1 Parastrongyloides trichosuri FL pAMP1 v1 Chiapelli McCarter Parastrongylo...ides trichosuri cDNA 5' similar to SW:EF2_CAEEL P29691 ELONGATION FACTOR 2 ;, mRNA ..., complete cds. 159 e-117 8 X15386 |X15386.1 Dictyostelium discoideum H6 gene mRNA. 155 3e-38 2 BI863585 |BI

  15. 42 CFR 456.233 - Initial continued stay review date.

    Science.gov (United States)

    2010-10-01

    ... assigns the initial continued stay review date within 1 working day after the mental hospital is notified... SERVICES (CONTINUED) MEDICAL ASSISTANCE PROGRAMS UTILIZATION CONTROL Utilization Control: Mental Hospitals... must provide that— (a) When a recipient is admitted to the mental hospital under admission...

  16. 45 CFR 233.90 - Factors specific to AFDC.

    Science.gov (United States)

    2010-10-01

    ... physical or mental injury, sexual abuse or exploitation, or negligent treatment or maltreatment of such child, under circumstances which indicate the child's health or welfare is threatened, the State or...), ADMINISTRATION FOR CHILDREN AND FAMILIES, DEPARTMENT OF HEALTH AND HUMAN SERVICES COVERAGE AND CONDITIONS...

  17. 16 CFR 233.1 - Former price comparisons.

    Science.gov (United States)

    2010-01-01

    ... of time, in the recent, regular course of his business, honestly and in good faith—and, of course... not used in the regular course of business, or which was not used in the recent past but at some... descriptive terminology such as “Regularly,” “Usually,” “Formerly,” etc., the advertiser should make...

  18. 45 CFR 233.20 - Need and amount of assistance.

    Science.gov (United States)

    2010-10-01

    ... retroactive to the date that the individual was required to be in the assistance unit either through birth... State option, as late as the corresponding payment month. For purposes of applying the lump sum... eligible households under the Low Income Home Energy Assistance Act of 1981 pursuant to section 2605(f)...

  19. Treating 233 Cases of Dermatosis with Nettle%荨麻治疗三种皮肤疾患233

    Institute of Scientific and Technical Information of China (English)

    聂鲁

    2003-01-01

    @@ 受玉溪市卫生局和新平县科委的委托,新平县彝族医药翻译整理课题组于1999年9月至2002年10月期间,以新平县人民医院和新平县平甸乡卫生院为载体,对彝族药荨麻设课题进行临床运用研究,旨在通过临床观察,验证荨麻对荨麻疹、痤疮、黄褐斑等皮肤疾患的治疗功效,分析并推断其相应的药理药效.

  20. Americium and plutonium separation by extraction chromatography for determination by accelerator mass spectrometry.

    Science.gov (United States)

    Kazi, Zakir H; Cornett, Jack R; Zhao, Xaiolei; Kieser, Liam

    2014-06-04

    A simple method was developed to separate Pu and Am using single column extraction chromatography employing N,N,N',N'-tetra-n-octyldiglycolamide (DGA) resin. Isotope dilution measurements of Am and Pu were performed using accelerator mass spectrometry (AMS) and alpha spectrometry. For maximum adsorption Pu was stabilized in the tetra valent oxidation state in 8M HNO3 with 0.05 M NaNO2 before loading the sample onto the resin. Am(III) was adsorbed also onto the resin from concentrated HNO3, and desorbed with 0.1 M HCl while keeping the Pu adsorbed. The on-column reduction of Pu(IV) to Pu(III) with 0.02 M TiCl3 facilitated the complete desorption of Pu. Interferences (e.g. Ca(2+), Fe(3+)) were washed off from the resin bed with excess HNO3. Using NdF3, micro-precipitates of the separated isotopes were prepared for analysis by both AMS and alpha spectrometry. The recovery was 97.7±5.3% and 95.5±4.6% for (241)Am and (242)Pu respectively in reagents without a matrix. The recoveries of the same isotopes were 99.1±6.0 and 96.8±5.3% respectively in garden soil. The robustness of the method was validated using certified reference materials (IAEA 384 and IAEA 385). The measurements agree with the certified values over a range of about 1-100 Bq kg(-1). The single column separation of Pu and Am saves reagents, separation time, and cost.

  1. Neutron capture and neutron-induced fission experiments on americium isotopes with DANCE

    Science.gov (United States)

    Jandel, M.; Bredeweg, T. A.; Stoyer, M. A.; Wu, C. Y.; Fowler, M. M.; Becker, J. A.; Bond, E. M.; Couture, A.; Haight, R. C.; Haslett, R. J.; Henderson, R. A.; Keksis, A. L.; O'Donnell, J. M.; Rundberg, R. S.; Ullmann, J. L.; Vieira, D. J.; Wilhelmy, J. B.; Wouters, J. M.

    2009-01-01

    Neutron capture cross section data on Am isotopes were measured using the Detector for Advanced Neutron Capture Experiments (DANCE) at Los Alamos National Laboratory. The neutron capture cross section was determined for 241Am for neutron energies between thermal and 320 keV. Preliminary results were also obtained for 243Am for neutron energies between 10 eV and 250 keV. The results on concurrent neutron-induced fission and neutron-capture measurements on 242mAm will be presented where the fission events were actively triggered during the experiments. In these experiments, a Parallel-Plate Avalanche Counter (PPAC) detector that surrounds the target located in the center of the DANCE array was used as a fission-tagging detector to separate (n,γ) events from (n,f) events. The first direct observation of neutron capture on 242mAm in the resonance region in between 2 and 9 eV of the neutron energy was obtained.

  2. Evaluation of the readsorption of plutonium and americium in dynamic fractionations of environmental solid samples

    DEFF Research Database (Denmark)

    Petersen, Roongrat; Hou, Xiaolin; Hansen, Elo Harald

    2008-01-01

    A dynamic extraction system exploiting sequential injection (SI) for sequential extractions incorporating a specially designed extraction column is developed to fractionate radionuclides in environmental solid samples such as soils and sediments. The extraction column can contain a large amount...... of the two radionuclides. However, the dynamic system is fully automated, eliminates manual separations, significantly reduces the operational time required, and offers detailed kinetic information....

  3. Effect of solvent on in vitro dissolution: Summary of results for uranium, americium, and cobalt aerosols

    Energy Technology Data Exchange (ETDEWEB)

    Guilmette, R.A.; Hoover, M.D.

    1995-12-01

    The revised 10 CFR Part 20 has adopted the ICRP Publication 30 method for calculating the committed effective dose equivalent from intakes of radionuclides. This dosimetry scheme requires knowledge or assumptions about the chemical form of the radionuclide, its particle size, and its known or assumed solubility. The solubility is classified as being either D (relatively soluble), W, or Y (relatively insoluble), depending on whether the material dissolves over periods of days, weeks, or years. Although Nuclear Regulatory Commission licensees may wish to take advantage of material-specific knowledge in order to adjust annual limits on intake and derived air concentrations, relatively few radioactive materials to which workers and the general population may be exposed have been adequately characterized either in terms of physicochemical form or solubility. Experimental measurement of solubility using some type of in vitro dissolution measurement system is therefore needed. However, there is currently no clear consensus regarding the appropriate design of in vitro dissolution systems, particularly when considering the range of different radionuclides to be studied, and the complexity of the biological mechanisms involved in the retention and clearance of inhaled deposited radioactive particles. The purpose of this study was to evaluate the effect of the several solvents on the dissolution of four test aerosols ({sup 57}Co{sub 3}O{sub 4}, {sup 241}AmO{sub 2}, ammonium diuranate [ADU], and U{sub 3}O{sub 8}) selected to encompass a variety of chemical and biochemical properties in vivo. The results of this study provide some guidance on the usefulness of in vitro dissolution tests for estimating the solubility of unknown radionuclide particles within the context of a simple model such as the class D, W, and Y formulation of ICRP 30.

  4. Rapid selective separation of americium/curium from simulated nuclear forensic matrices using triazine ligands

    Energy Technology Data Exchange (ETDEWEB)

    Higginson, Matthew A.; Livens, Francis R.; Heath, Sarah L. [Manchester Univ. (United Kingdom). Centre for Radiochemistry Research; Thompson, Paul; Marsden, Olivia J. [AWE, Aldermaston, Reading (United Kingdom); Harwood, Laurence M.; Hudson, Michael J. [Reading Univ. (United Kingdom). Dept. of Chemistry; Lewis, Frank W. [Reading Univ. (United Kingdom). Dept. of Chemistry; Northumbria Univ., Newcastle upon Tyne (United Kingdom). Dept. of Chemical and Forensic Sciences

    2015-07-01

    In analysis of complex nuclear forensic samples containing lanthanides, actinides and matrix elements, rapid selective extraction of Am/Cm for quantification is challenging, in particular due the difficult separation of Am/Cm from lanthanides. Here we present a separation process for Am/Cm(III) which is achieved using a combination of AG1-X8 chromatography followed by Am/Cm extraction with a triazine ligand. The ligands tested in our process were CyMe{sub 4}-BTPhen, CyMe{sub 4}-BTBP, CA-BTP and CA-BTPhen. Our process allows for purification and quantification of Am and Cm (recoveries 80% - 100%) and other major actinides in < 2 d without the use of multiple columns or thiocyanate. The process is unaffected by high level Ca(II)/Fe(III)/Al(III) (10 mg mL{sup -1}) and thus requires little pre-treatment of samples.

  5. Americium-Curium Stabilization - 5'' Cylindrical Induction Melter System Design Basis

    Energy Technology Data Exchange (ETDEWEB)

    Witt, D.C.

    1999-11-08

    Approximately 11,000 liters (3,600) gallons of solution containing isotopes of Am and Cm are currently stored in F-Canyon Tank 17.1. These isotopes were recovered during plutonium-242 production campaigns in the mid- and late-1970s. Experimental work for the project began in 1995 by the Savannah River Technology Center (SRTC). Details of the process are given in the various sections of this document.

  6. Concordant plutonium-241-americium-241 dating of environmental samples: results from forest fire ash

    Energy Technology Data Exchange (ETDEWEB)

    Goldstein, Steven J [Los Alamos National Laboratory; Oldham, Warren J [Los Alamos National Laboratory; Murrell, Michael T [Los Alamos National Laboratory; Katzman, Danny [Los Alamos National Laboratory

    2010-12-07

    We have measured the Pu, {sup 237}Np, {sup 241}Am, and {sup 151}Sm isotopic systematics for a set of forest fire ash samples from various locations in the western U.S. including Montana, Wyoming, Idaho, and New Mexico. The goal of this study is to develop a concordant {sup 241}Pu (t{sub 1/2} = 14.4 y)-{sup 241}Am dating method for environmental collections. Environmental samples often contain mixtures of components including global fallout. There are a number of approaches for subtracting the global fallout component for such samples. One approach is to use {sup 242}/{sup 239}Pu as a normalizing isotope ratio in a three-isotope plot, where this ratio for the nonglobal fallout component can be estimated or assumed to be small. This study investigates a new, complementary method of normalization using the long-lived fission product, {sup 151}Sm (t{sub 1/2} = 90 y). We find that forest fire ash concentrates actinides and fission products with {approx}1E10 atoms {sup 239}Pu/g and {approx}1E8 atoms {sup 151}Sm/g, allowing us to measure these nuclides by mass spectrometric (MIC-TIMS) and radiometric (liquid scintillation counting) methods. The forest fire ash samples are characterized by a western U.S. regional isotopic signature representing varying mixtures of global fallout with a local component from atmospheric testing of nuclear weapons at the Nevada Test Site (NTS). Our results also show that {sup 151}Sm is well correlated with the Pu nuclides in the forest fire ash, suggesting that these nuclides have similar geochemical behavior in the environment. Results of this correlation indicate that the {sup 151}Sm/{sup 239}Pu atom ratio for global fallout is {approx}0.164, in agreement with an independent estimate of 0.165 based on {sup 137}Cs fission yields for atmospheric weapons tests at the NTS. {sup 241}Pu-{sup 241}Am dating of the non-global fallout component in the forest fire ash samples yield ages in the late 1950's-early 1960's, consistent with a peak in NTS weapons testing at that time. The age results for this component are in agreement using both {sup 242}Pu and {sup 151}Sm normalizations, although the errors for the {sup 151}Sm correction are currently larger due to the greater uncertainty of their measurements. Additional efforts to develop a concordant {sup 241}Pu-{sup 241}Am dating method for environmental collections are underway with emphasis on soil cores.

  7. Functional sorbents for selective capture of plutonium, americium, uranium, and thorium in blood.

    Science.gov (United States)

    Yantasee, Wassana; Sangvanich, Thanapon; Creim, Jeffery A; Pattamakomsan, Kanda; Wiacek, Robert J; Fryxell, Glen E; Addleman, R Shane; Timchalk, Charles

    2010-09-01

    Self-assembled monolayer on mesoporous supports (SAMMS) are hybrid materials created from attachment of organic moieties onto very high surface area mesoporous silica. SAMMS with surface chemistries including three isomers of hydroxypyridinone, diphosphonic acid, acetamide phosphonic acid, glycinyl urea, and diethylenetriamine pentaacetate (DTPA) analog were evaluated for chelation of actinides ((239)Pu, (241)Am, uranium, thorium) from blood. Direct blood decorporation using sorbents does not have the toxicity or renal challenges associated with traditional chelation therapy and may have potential applications for critical exposure cases, reduction of nonspecific dose during actinide radiotherapy, and for sorbent hemoperfusion in renal insufficient patients, whose kidneys clear radionuclides at a very slow rate. Sorption affinity (K(d)), sorption rate, selectivity, and stability of SAMMS were measured in batch contact experiments. An isomer of hydroxypyridinone (3,4-HOPO) on SAMMS demonstrated the highest affinity for all four actinides from blood and plasma and greatly outperformed the DTPA analog on SAMMS and commercial resins. In batch contact, a fifty percent reduction of actinides in blood was achieved within minutes, and there was no evidence of protein fouling or material leaching in blood after 24 h. The engineered form of SAMMS (bead format) was further evaluated in a 100-fold scaled-down hemoperfusion device and showed no blood clotting after 2 h. A 0.2 g quantity of SAMMS could reduce 50 wt.% of 100 ppb uranium in 50 mL of plasma in 18 min and that of 500 dpm mL(-1) in 24 min. 3,4-HOPO-SAMMS has a long shelf-life in air and at room temperature for at least 8 y, indicating its feasibility for stockpiling in preparedness for an emergency. The excellent efficacy and stability of SAMMS materials in complex biological matrices suggest that SAMMS can also be used as orally administered drugs and for wound decontamination. By changing the organic groups of SAMMS, they can be used not only for actinides but also for other radionuclides. By using the mixture of these SAMMS materials, broad spectrum decorporation of radionuclides is very feasible.

  8. Subsurface Behavior of Plutonium and Americium at Non-Hanford Sites and Relevance to Hanford

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Riley, Robert G.

    2008-02-01

    Seven sites where Pu release to the environment has raised significant environmental concerns have been reviewed. A summary of the most significant hydrologic and geochemical features, contaminant release events and transport processes relevant to Pu migration at the seven sites is presented.

  9. New Synthetic Methods and Structure-Property Relationships in Neptunium, Plutonium, and Americium Borates. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Albrecht-Schmitt, Thomas Edward

    2013-09-14

    The past three years of support by the Heavy Elements Chemistry Program have been highly productive in terms of advanced degrees awarded, currently supported graduate students, peer-reviewed publications, and presentations made at universities, national laboratories, and at international conferences. Ph.D. degrees were granted to Shuao Wang and Juan Diwu, who both went on to post-doctoral appointments at the Glenn T. Seaborg Center at Lawrence Berkeley National Laboratory with Jeff Long and Ken Raymond, respectively. Pius Adelani completed his Ph.D. with me and is now a post-doc with Peter C. Burns. Andrea Alsobrook finished her Ph.D. and is now a post-doc at Savannah River with Dave Hobbs. Anna Nelson completed her Ph.D. and is now a post-doc with Rod Ewing at the University of Michigan. As can be gleaned from this list, students supported by the Heavy Elements Chemistry grant have remained interested in actinide science after leaving my program. This follows in line with previous graduates in this program such as Richard E. Sykora, who did his post-doctoral work at Oak Ridge National Laboratory with R. G. Haire, and Amanda C. Bean, who is a staff scientist at Los Alamos National Laboratory, and Philip M. Almond and Thomas C. Shehee, who are both staff scientists at Savannah River National Laboratory, Gengbang Jin who is a staff scientist at Argonne National Lab, and Travis Bray who has been a post-doc at both LBNL and ANL. Clearly this program is serving as a pipe-line for students to enter into careers in the national laboratories. About half of my students depart the DOE complex for academia or industry. My undergraduate researchers also remain active in actinide chemistry after leaving my group. Dan Wells was a productive undergraduate of mine, and went on to pursue a Ph.D. on uranium and neptunium chalcogenides with Jim Ibers at Northwestern. After earning his Ph.D., he went directly into the nuclear industry.

  10. Americium-241 and plutonium-237 turnover in mussels ( Mytilus galloprovincialis) living in field enclosures

    Science.gov (United States)

    Guary, J. C.; Fowler, S. W.

    1981-02-01

    Loss of 241Am and 237Pu from contaminated mussels ( Mytilus galloprovincialis) living in situ in the Mediterranean Sea is described as the sum of three exponential functions. In the case of 241Am, two short-lived compartments representing a total of 80% of the incorporated radionuclide turned over rapidly with biological half-lives of 2 and 3 weeks. The remaining fraction of 241Am, associated with a long-lived compartment, was lost at an extremely slow rate ( Tb1/2=1·3 years). Plutonium-237 turnover in the two short-lived compartments (containing 70% of the Pu) was more rapid ( Tb1/2=1-2 days and 2 weeks) than that of 241Am; however, there was some indication that subsequent loss rates of the two radionuclides in long-lived compartments may be similar if determined over comparable periods of time. Loss rates of 241Am differed for the various tissues, with the most rapid rates occurring in gill, viscera and shell. Abrupt changes in loss observed in muscle and mantle suggested a translocation of 241Am to muscle and mantle during depuration. Whole shell contained by far the largest fraction (˜90%) of both 241Am and 237Pu taken up; in addition, these radionuclides are not irreversibly bound to mussel shell but readily leach into the water. These observations suggest that mollusc shell may influence the biogeochemistry of transuranic elements in littoral zones.

  11. Plutonium and americium inventories in atmospheric fallout and sediment cores from Blelham Tarn, Cumbria (UK)

    Energy Technology Data Exchange (ETDEWEB)

    Michel, H. E-mail: herve.michel@unice.fr; Barci-Funel, G.; Dalmasso, J.; Ardisson, G.; Appleby, P.G.; Haworth, E.; El-Daoushy, F

    2002-07-01

    The objective of this paper is to report on the results of a study of {sup 238}Pu, {sup 239+240}Pu and {sup 241}Am inventories onto Blelham Tarn in Cumbria (UK). The atmospheric fallout inventory was obtained by analysing soil cores and the results are in good agreement with the literature: 101 Bq m{sup -2} for {sup 239+240}Pu; 4.5 Bq m{sup -2} for {sup 238}Pu and 37 Bq m{sup -2} for {sup 241}Am. The sediment core inventory for the whole lake is compared to the atmospheric fallout inventory. The sediment activity is 60-80% higher than the estimated fallout activity, showing a catchment area contribution and in particular the stream input.

  12. Plutonium and americium inventories in atmospheric fallout and sediment cores from Blelham Tarn, Cumbria (UK).

    Science.gov (United States)

    Michel, H; Barci-Funel, G; Dalmasso, J; Ardisson, G; Appleby, P G; Haworth, E; El-Daoushy, F

    2002-01-01

    The objective of this paper is to report on the results of a study of 238Pu, 239 + 240Pu and 241Am inventories onto Blelham Tarn in Cumbria (UK). The atmospheric fallout inventory was obtained by analysing soil cores and the results are in good agreement with the literature: 101 Bq m(-2) for 239 + 240Pu; 4.5 Bq m(-2) for 238Pu and 37 Bq m(-2) for 241Am. The sediment core inventory for the whole lake is compared to the atmospheric fallout inventory. The sediment activity is 60-80% higher than the estimated fallout activity, showing a catchment area contribution and in particular the stream input.

  13. Assessment of Neptunium, Americium, and Curium in the Savannah River Site Environment

    Energy Technology Data Exchange (ETDEWEB)

    Carlton, W.H. [Westinghouse Savannah River Company, AIKEN, SC (United States)

    1997-12-17

    A series of documents has been published in which the impact of various radionuclides released to the environment by Savannah River Site (SRS) operations has been assessed. The quantity released, the disposition of the radionuclides in the environment, and the dose to offsite individuals has been presented for activation products, carbon cesium, iodine, plutonium, selected fission products, strontium, technetium, tritium, uranium, and the noble gases. An assessment of the impact of nonradioactive mercury also has been published.This document assesses the impact of radioactive transuranics released from SRS facilities since the first reactor became operational late in 1953. The isotopes reported here are 239Np, 241Am, and 244Cm.

  14. Fundamental chemistry and materials science of americium in selected immobilization glasses

    Energy Technology Data Exchange (ETDEWEB)

    Haire, R.G. [Oak Ridge National Lab., TN (United States); Stump, N.A. [Winston-Salem State Univ., NC (United States). Dept. of Physical Sciences

    1996-12-01

    We have pursued some of the fundamental chemistry and materials science of Am in 3 glass matrices, two being high-temperature (850 and 1400 C mp) silicate-based glasses and the third a sol-gel glass. Optical spectroscopy was the principal tool. One aspect of this work was to determine the oxidation state exhibited by Am in these matrices, as well as factors that control or may alter this state. A correlation was noted between the oxidation state of the f-elements in the two high-temperature glasses with their high-temperature oxide chemistries. One exception was Am: although AmO{sub 2} is the stable oxide encountered in air, when this dioxide was incorporated into the high-temperature glasses, only trivalent Am was found in the products. When Am(III) was used to prepare the sol-gel glasses at ambient temperature, and after these products were heated in air to 800 C, only Am(III) was observed. Potential explanations for the unexpected Am behavior is offered in the context of its basic chemistry. Experimental spectra, spectroscopic assignments, etc. are discussed.

  15. Americium, curium and neodymium analysis in ECRIX-H irradiated pellet. Sample preparation for TIMS measurements

    Energy Technology Data Exchange (ETDEWEB)

    Esbelin, E.; Buravand, E. [Commissariat a l' Energie Atomique, Bagnols-sur-Ceze (France). Centre de Marcoule; Bejaoui, S.; Lamontagne, J.; Bonnerot, J.M. [Commissariat a l' Energie Atomique, St-Paul-Lez-Durance (France). Centre de Cadarache

    2013-08-01

    This paper concerns quantitative isotopic analysis of Am, Cm and Nd contained in an irradiated AmO{sub 1.62}/MgO pellet. The complete analysis protocol is described, from dissolution of the pellets in a shielded line to the laboratory glove separation processes box for TIMS analysis. Emphasis is placed on the separation processes: by ion exchange resin in a hot cell and by HPLC in the laboratory. Intermediate measurements by X-ray fluorescence, alpha spectrometry, and ICP-AES are described. (orig.)

  16. Optimization of TRPO Process Parameters for Americium Extraction from High Level Waste

    Institute of Scientific and Technical Information of China (English)

    CHEN Jing; WANG Jianchen; SONG Chongli

    2001-01-01

    The numerical calculations for Am multistage fractional extraction by trialkyl phosphine oxide (TRPO) were verified by a hot test.1750 L/t-U high level waste (HLW) was used as the feed to the TRPO process.The analysis used the simple objective function to minimize the total waste content in the TRPO process streams.Some process parameters were optimized after other parameters were selected.The optimal process parameters for Am extraction by TRPO are:10 stages for extraction and 2 stages for scrubbing;a flow rate ratio of 0.931 for extraction and 4.42 for scrubbing;nitric acid concentration of 1.35 mol/L for the feed and 0.5 mol/L for the scrubbing solution.Finally,the nitric acid and Am concentration profiles in the optimal TRPO extraction process are given.

  17. Vertical distribution of radiocaesium, plutonium and americium in the Catalan Sea (northwestern Mediterranean)

    Energy Technology Data Exchange (ETDEWEB)

    Molero, J.; Sanchez-Cabeza, J.A.; Merino, J.; Pujol, Ll.; Vidal-Quadras, A. [Universidad Autonoma de Barcelona (Spain). Facultad de Ciencias; Mitchell, P.I. [University Coll., Dublin (Ireland). Lab. of Radiation Physics

    1995-07-01

    Caesium-137, {sup 239,240}Pu and {sup 241}Am concentration profiles (0-1000 m) have been determined in unfiltered large volume water samples collected from the Catalan Sea (northwestern Mediterranean). Results showed that radiocaesium concentration decreases quickly through the water column while the transuranic concentration increases with depth, showing a faster migration to the bottom layers. Comparing our results with those reported by other authors (1975-1980), radiocaesium input from Chernobyl releases has been identified through the profile. In addition, transuranic concentrations have decreased considerably in the different layers of the profile. (Author).

  18. Americium and plutonium separation by extraction chromatography for determination by accelerator mass spectrometry

    Energy Technology Data Exchange (ETDEWEB)

    Kazi, Zakir H. [Department of Earth Science, University of Ottawa, 140 Louis Pasteur Avenue, Ottawa K1N 6N5 (Canada); Cornett, Jack R., E-mail: jack.cornett@uottawa.ca [Department of Earth Science, University of Ottawa, 140 Louis Pasteur Avenue, Ottawa K1N 6N5 (Canada); Zhao, Xaiolei; Kieser, Liam [Department of Physics, University of Ottawa, 140 Louis Pasteur Avenue, Ottawa K1N 6N5 (Canada)

    2014-06-01

    Highlights: • Am and Pu were adsorbed and separated using a single extraction chromatography DGA column. • Pu was eluted from the column completely using on-column reduction of Pu(IV) to Pu(III). • ²⁴¹Am and 239,240Pu measurements by accelerator mass spectrometry (AMS) agree with the certified values in two SRMs. Abstract: A simple method was developed to separate Pu and Am using single column extraction chromatography employing N,N,N',N'-tetra-n-octyldiglycolamide (DGA) resin. Isotope dilution measurements of Am and Pu were performed using accelerator mass spectrometry (AMS) and alpha spectrometry. For maximum adsorption Pu was stabilized in the tetra valent oxidation state in 8 M HNO₃ with 0.05 M NaNO₂ before loading the sample onto the resin. Am(III) was adsorbed also onto the resin from concentrated HNO₃, and desorbed with 0.1 M HCl while keeping the Pu adsorbed. The on-column reduction of Pu(IV) to Pu(III) with 0.02 M TiCl₃ facilitated the complete desorption of Pu. Interferences (e.g. Ca²⁺, Fe³⁺) were washed off from the resin bed with excess HNO₃. Using NdF₃, micro-precipitates of the separated isotopes were prepared for analysis by both AMS and alpha spectrometry. The recovery was 97.7 ± 5.3% and 95.5 ± 4.6% for ²⁴¹Am and ²⁴²Pu respectively in reagents without a matrix. The recoveries of the same isotopes were 99.1 ± 6.0 and 96.8 ± 5.3% respectively in garden soil. The robustness of the method was validated using certified reference materials (IAEA 384 and IAEA 385). The measurements agree with the certified values over a range of about 1–100 Bq kg⁻¹. The single column separation of Pu and Am saves reagents, separation time, and cost.

  19. Criteria Considered in Selecting Feed Items for Americium-241 Oxide Production Operations

    Energy Technology Data Exchange (ETDEWEB)

    Schulte, Louis D. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2015-01-30

    The analysis in this document serves the purpose of defining a number of attributes in selection of feed items to be utilized in recovery/recycle of Pu and also production operations of 241AmO2 material intended to meet specification requirements. This document was written in response to a specific request on the part of the 2014 annual program review which took place over the dates of October 28-29, 2014. A number of feed attributes are noted including: (1) Non-interference with existing Pu recovery operations; (2) Content of sufficient 241Am to allow process efficiency in recovery operations; (3) Absence of indications that 243Am might be mixed in with the Pu/241Am material; (4) Absence of indications that Cm might be mixed in with the Pu/241Am material; (5) Absence of indications of other chemical elements that would present difficulty in chemical separation from 241Am; (6) Feed material not expected to present difficulty in dissolution; (7) Dose issues; (8) Process efficiency; (9) Size; (10) Hazard associated with items and package configuration in the vault; (11) Within existing NEPA documentation. The analysis in this document provides a baseline of attributes considered for feed materials, but does not presume to replace the need for technical expertise and judgment on the part of individuals responsible for selecting the material feed to be processed. This document is not comprehensive as regards all attributes that could prove to be important. The value of placing a formal QA hold point on accepting feed items versus more informal management of feed items is discussed in the summation of this analysis. The existing planned QA hold points on 241AmO2 products produced and packaged may be adequate as the entire project is based on QA of the product rather than QA of the process. The probability of introduction of items that would inherently cause the241AmO2 products produced to be outside of specification requirements appears to be rather small.

  20. Actinide partitioning and transmutation program. Progress report, July 1--September 30, 1977

    Energy Technology Data Exchange (ETDEWEB)

    Tedder, D.W.; Blomeke, J.O. (comps.)

    1978-02-01

    In Purex process modifications, two cold runs with mixer-settlers were made on the extraction and stripping of ruthenium and zirconium without the presence of uranium. Efforts in actinide recovery from solids were directed toward the determination of dissolution parameters in various reagents for /sup 241/Am and /sup 239/Pu oxide mixtures, /sup 233/U oxide, /sup 237/Np oxide, /sup 244/Cm oxide, /sup 232/Th oxide, and PuO/sub 2/. Studies in americium-curium recovery with OPIX (oxalate precipitation and ion exchange), Talspeak, and cation exchange chromatography focused on the feasibility of forming oxalate precipitates in continuous systems, the effects of zirconium on Talspeak, and methods for removing solvent degradation products of the Talspeak system. In studies of americium-curium recovery using bidentate extractants, additional distribution coefficients for actinides and other key elements between reduced synthetic LWR waste solution and 30 percent dihexyl-N, N-diethyl-carbamylmethylene phosphonate in diisopropylbenzene were measured. Studies in the americium-curium recovery using inorganic ion exchange media to determine the pH dependence of lanthanide ion affinity for niobate, titanate, and zirconate ion exchange materials have been completed. A modified flowsheet for the extraction of uranium, neptunium, plutonium, americium, and curium from high-level liquid waste is presented. Evaluation of methods for measuring actinides from incinerator ash is continuing. A preliminary evaluation of methods for treatment of salt waste and waste waters was completed. In thermal reactor transmutation studies, waste actinides from an LWR lattice containing mixed uranium-plutonium assemblies were recycled in separate target assemblies. (LK)

  1. A Review of Subsurface Behavior of Plutonium and Americium at the 200-PW-1/3/6 Operable Units

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Riley, Robert G.

    2008-01-31

    This report begins with a brief summary of the history and current status of 200-PW-1/3/6 OUs in section 2.0. This is followed by a description of our concentual model of Pu/Am migration at the 200-PW-1/3/6 OUs, during both past artificial recharge conditions and current natural recharge condictions (section 3.0). Section 4.0 discusses data gaps and information needs. The final section (section 5.0) provides recommendations for futher work to address the data gaps and information needs identified in section 4.0.

  2. Input contribution and vertical migration of plutonium, americium and cesium in lake sediments (Belham Tarn, Cumbria, UK)

    Energy Technology Data Exchange (ETDEWEB)

    Michel, H.; Barci-Funel, G.; Barci, V.; Ardisson, G. [Lab. de Radiochimie et de Radioecologie, Univ. de Nice Sophia Antipolis, Nice (France)

    2002-07-01

    The record of the global atmospheric fallout could be found in the lake sediments. A mass balance for fallout radionuclides in Blelham Tarn and its catchment is established. The sediment activity contribution is coming from direct atmospheric fallout and from indirect atmospheric fallout via the catchment. The catchement activity is conveyed to the sediment by the rivers and the direct streaming. A comparison of the fallout and the sediment inventory allows the activity estimation of these different contributions and to understand the mobility of these elements on the catchment and in the sediments. The study of activity profile in sediment core allows to characterise the different radioactive events occurred in the past. For the lake Blelham, the results show two cesium activity peaks and only one peak for transuranic activities. The deepest peaks correspond to the atmospheric nuclear test fallout in the sixties (1963) and the second peak to the Chernobyl accident (1986). The activity ratio {sup 239-240}Pu/{sup 137}Cs allows estimating the ratio between cesium activities in sediments coming from these two events. Plutonium and cesium diffusion coefficients are calculated with a simple analytical model. (orig.)

  3. Analysis of cascade impactor and EPA method 29 data from the americium/curium pilot melter system

    Energy Technology Data Exchange (ETDEWEB)

    Zamecnik, J.R.

    1997-11-01

    The offgas system of the Am/Cm pilot melter at TNX was characterized by measuring the particulate evolution using a cascade impactor and EPA Method 29. This sampling work was performed by John Harden of the Clemson Environmental Technologies Laboratory, under SCUREF Task SC0056. Elemental analyses were performed by the SRTC Mobile Laboratory.Operation of the Am/Cm melter with B2000 frit has resulted in deposition of PbO and boron compounds in the offgas system that has contributed to pluggage of the High Efficiency Mist Eliminator (HEME). Sampling of the offgas system was performed to quantify the amount of particulate in the offgas system under several sets of conditions. Particulate concentration and particle size distribution were measured just downstream of the melter pressure control air addition port and at the HEME inlet. At both locations, the particulate was measured with and without steam to the film cooler while the melter was idled at about 1450 degrees Celsius. Additional determinations were made at the melter location during feeding and during idling at 1150 degrees Celsius rather than 1450 degrees Celsius (both with no steam to the film cooler). Deposition of particulates upstream of the melter sample point may have, and most likely did occur in each run, so the particulate concentrations measured do no necessarily reflect the total particulate emission at the melt surface. However, the data may be used in a relative sense to judge the system performance.

  4. Rapid selective separation of americium/curium\\ud from simulated nuclear forensic matrices using\\ud triazine ligands

    OpenAIRE

    Higginson, Matthew A.; Thompson, Paul; Marsden, Olivia J.; Livens, Francis R.; Harwood, Laurence M.; Lewis, Frank W.; Hudson, Michael J.; Heath, Sarah L.

    2015-01-01

    In analysis of complex nuclear forensic samples\\ud containing lanthanides, actinides and matrix elements,\\ud rapid selective extraction of Am/Cm for quantification\\ud is challenging, in particular due the difficult separation\\ud of Am/Cm from lanthanides. Here we present\\ud a separation process for Am/Cm(III) which is achieved\\ud using a combination of AG1-X8 chromatography followed\\ud by Am/Cm extraction with a triazine ligand. The ligands\\ud tested in our process were CyMe4-BTPhen, CyMe4-\\u...

  5. LITERATURE REVIEW ON THE SORPTION OF PLUTONIUM, URANIUM, NEPTUNIUM, AMERICIUM AND TECHNETIUM TO CORROSION PRODUCTS ON WASTE TANK LINERS

    Energy Technology Data Exchange (ETDEWEB)

    Li, D.; Kaplan, D.

    2012-02-29

    The Savannah River Site (SRS) has conducted performance assessment (PA) calculations to determine the risk associated with closing liquid waste tanks. The PA estimates the risk associated with a number of scenarios, making various assumptions. Throughout all of these scenarios, it is assumed that the carbon-steel tank liners holding the liquid waste do not sorb the radionuclides. Tank liners have been shown to form corrosion products, such as Fe-oxyhydroxides (Wiersma and Subramanian 2002). Many corrosion products, including Fe-oxyhydroxides, at the high pH values of tank effluent, take on a very strong negative charge. Given that many radionuclides may have net positive charges, either as free ions or complexed species, it is expected that many radionuclides will sorb to corrosion products associated with tank liners. The objective of this report was to conduct a literature review to investigate whether Pu, U, Np, Am and Tc would sorb to corrosion products on tank liners after they were filled with reducing grout (cementitious material containing slag to promote reducing conditions). The approach was to evaluate radionuclides sorption literature with iron oxyhydroxide phases, such as hematite ({alpha}-Fe{sub 2}O{sub 3}), magnetite (Fe{sub 3}O{sub 4}), goethite ({alpha}-FeOOH) and ferrihydrite (Fe{sub 2}O{sub 3} {center_dot} 0.5H{sub 2}O). The primary interest was the sorption behavior under tank closure conditions where the tanks will be filled with reducing cementitious materials. Because there were no laboratory studies conducted using site specific experimental conditions, (e.g., high pH and HLW tank aqueous and solid phase chemical conditions), it was necessary to extend the literature review to lower pH studies and noncementitious conditions. Consequently, this report relied on existing lower pH trends, existing geochemical modeling, and experimental spectroscopic evidence conducted at lower pH levels. The scope did not include evaluating the appropriateness of K{sub d} values for the Fe-oxyhydroxides, but instead to evaluate whether it is a conservative assumption to exclude this sorption process of radionuclides onto tank liner corrosion products in the PA model. This may identify another source for PA conservatism since the modeling did not consider any sorption by the tank liner.

  6. 45 CFR 233.53 - Support and maintenance assistance (including home energy assistance) in AFDC.

    Science.gov (United States)

    2010-10-01

    ... assistance. In kind assistance means assistance furnished in any form except direct cash payments to an... which are convertible to cash. Private, nonprofit organization means a religious, charitable.... (Actual tax exempt certification by IRS is not necessary). Rate-of-return entity means an entity...

  7. Measuring the Th-229 nuclear isomer transition with U-233 doped crystals

    CERN Document Server

    Stellmer, Simon; Kazakov, Georgy; Sterba, Johannes; Schumm, Thorsten

    2015-01-01

    We propose a simple approach to measure the energy of the few-eV isomeric state in Th-229. To this end, U-229 nuclei are doped into VUV-transparent crystals, where they undergo alpha decay into Th-229, and, with a probability of 2%, populate the isomeric state. These Th-229m nuclei may decay into the nuclear ground state under emission of the sought-after VUV gamma, whose wavelength can be determined with a spectrometer. Based on measurements of the optical transmission of U:CaF2 crystals in the VUV range, we expect a signal at least 2 orders of magnitude larger compared to current schemes using surface-implantation of recoil nuclei. The signal background is dominated by Cherenkov radiation induced by beta decays of the thorium decay chain. We estimate that, even if the isomer undergoes radiative de-excitation with a probability of only 0.1%, the VUV gamma can be detected within a reasonable measurement time.

  8. 49 CFR 23.3 - What do the terms used in this part mean?

    Science.gov (United States)

    2010-10-01

    ..., license, or other agreement. For example, providers of taxi, limousine, car rental, or hotel services are... case of a hotel operator, a hotel located anywhere on airport property. (4) Any business meeting the... Secretary determines to have more than 10,000 passengers enplaned annually. Primary industry...

  9. SU-E-J-233: A Facility for Radiobiological Experiments in a Large Magnetic Field

    Energy Technology Data Exchange (ETDEWEB)

    Carlone, M; Heaton, R; Keller, H [Princess Margaret Hospital, Toronto, ON (Canada); University of Toronto, Toronto, ON (Canada); Wouters, B [Ontario Cancer Institute, Toronto, ON (Canada); University of Toronto, Toronto, ON (Canada); Jaffray, D [Princess Margaret Hospital, Toronto, ON (Canada); Ontario Cancer Institute, Toronto, ON (Canada); University of Toronto, Toronto, ON (Canada)

    2014-06-01

    Purpose: There is considerable interest in developing medical linear accelerators with integrated image guidance by MRI. Less work has been done on the fundamental biology of cell survival in the presence of a strong magnetic field. The purpose of this work is to describe an experimental system capable of measuring cell survival response in the types of MRI-linac systems currently under development. Methods: We have integrated a cobalt irradiator with a solenoid magnet. The solenoid magnet has inner diameter of 10 cm. To enable measurement of the biological effects as a function of depth, we are utilizing the sliced gel technique, in which cells are embedded and fixed within a gelatin matrix. Irradiated cells at defined positions (sub mm resolution) can subsequently be recovered and assessed for cell survival or other biological effects. Results: The magnetic field profile in the solenoid has a peak magnetic field 36 cm below the top edge of the magnet bore and can be placed at and SAD of 100 cm. At a solenoid current of 35 A, the peak magnetic field is 0.25 T. The dose rate of the cobalt irradiator is 16 cGy/min at 100 cm SAD. EBT3 film was used to demonstrate the system functionality. It was irradiated at 1 cm depth at 100 cm SSD with a 4×4 field to 1.5 Gy in a 0.25 T magnetic field. The dose profile was similar between this film and the control exposure without magnetic field. Conclusion: Integrating a cobalt irradiator with a high field magnet is demonstrated. The magnetic field at the cobalt defining head was minimal and did not interfere with the functioning of this unit. Cell survival experiments can be reproduced exactly in the presence or absence of a magnetic field since a resistive magnet is used.

  10. Public Law 88-233 : 88th Congress S. 2275 [Hawaiian Islands National Wildlife Refuge

    Data.gov (United States)

    US Fish and Wildlife Service, Department of the Interior — This document is an act made to revise the procedures of conveying certain lands to the state of Hawaii. It designates certain lands on Sand Island as lands that can...

  11. Yeast Interacting Proteins Database: YOL006C, YMR233W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available by cleaving and re-sealing the phosphodiester backbone; relaxes both positively and negatively supercoiled D...in DNA by cleaving and re-sealing the phosphodiester backbone; relaxes both positively and negatively superc

  12. Yeast Interacting Proteins Database: YOR285W, YDR233C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available racts with exocyst subunit Sec6p and with Yip3p; also interacts with Sbh1p; null mutant has an altered (most...tion ER membrane protein that interacts with exocyst subunit Sec6p and with Yip3p; also interacts with Sbh1p; null mutant has an alte...red (mostly cisternal) ER morphology; member of the RTNL

  13. 19 CFR 10.233 - Articles eligible for preferential tariff treatment.

    Science.gov (United States)

    2010-04-01

    ... any manner, in airtight containers; (3) Petroleum, or any product derived from petroleum, provided for... rules of origin. In determining whether an article is a CBTPA originating good for purposes of...

  14. 45 CFR 233.10 - General provisions regarding coverage and eligibility.

    Science.gov (United States)

    2010-10-01

    ... age of 18, or age 18 if a full-time student in a secondary school, or in the equivalent level of... must be met by the individuals in the groups. The groups selected for inclusion in the plan and the... AB, disability in APTD, physical or mental incapacity, continued absence of a parent, or...

  15. 48 CFR 1352.233-71 - GAO and Court of Federal Claims protests.

    Science.gov (United States)

    2010-10-01

    ... attachments, shall be served upon (i) the Contracting Officer, and (ii) the Contract Law Division of the... Claims. (c) Service upon the Contract Law Division shall be made as follows: U.S. Department of Commerce, Office of the General Counsel, Chief, Contract Law Division, Room 5893, Herbert C. Hoover Building,...

  16. 40 CFR 52.233 - Review of new sources and modifications.

    Science.gov (United States)

    2010-07-01

    ... steam purchased from Watson Energy Systems and the amount generated by boilers #31, #32, #33, #42, #51...) Continuous written records of steam purchased from Watson Energy Systems and of the steam produced by boilers... fired steam generating efficiency of boilers #31, #32, #33, #42, #51, and #52 at the ARCO...

  17. 76 FR 50113 - Airworthiness Directives; Airbus Model A320-214, -232, and -233 Airplanes

    Science.gov (United States)

    2011-08-12

    ... above, this AD requires a modification of the electrical installation of ELAC2 and THS Motor 1 power... case of emergency electrical configuration combined with a Green and Yellow hydraulic system loss... INFORMATION CONTACT: Sanjay Ralhan, Aerospace Engineer, International Branch, ANM-116, Transport...

  18. 76 FR 19714 - Airworthiness Directives; Airbus Model A320-214, -232, and -233 Airplanes

    Science.gov (United States)

    2011-04-08

    ... a modification of the electrical installation of ELAC2 and THS Motor 1 power supply, restoring the... case of emergency electrical configuration combined with a Green and Yellow hydraulic system loss... receipt. FOR FURTHER INFORMATION CONTACT: Sanjay Ralhan, Aerospace Engineer, International Branch,...

  19. Editorial Revista Contaduría y Administración 233

    OpenAIRE

    López Herrera Francisco

    2011-01-01

    Existen diversos aspectos que resultan ser de importancia para alcanzar los diversos objetivos que los administradores de organizaciones públicas o privadas, lucrativas o no lucrativas, deben cumplir. Evidentemente la satisfacción del cliente o usuario es uno de los aspectos clave. Una de las ideas que ha alcanzado un alto grado de consenso desde hace ya varios años, a juzgar por lo vasto de la literatura dedicada a ese punto, es que en esa satisfacción juega un papel primordial y crítico el ...

  20. 12 CFR 233.6 - Non-exclusive examples of policies and procedures.

    Science.gov (United States)

    2010-01-01

    ...-party processor, or a card issuer, are deemed to be reasonably designed to identify and block or... designated payment system is permitted to design and implement policies and procedures tailored to its..., those due diligence procedures will be deemed to be reasonably designed to identify and block...

  1. Yeast Interacting Proteins Database: YER081W, YPL233W [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available oins kinetochore subunits contacting DNA to those contacting microtubules; requir...tacting DNA to those contacting microtubules; required for accurate chromosome segr...t of the MIND kinetochore complex (Mtw1p Including Nnf1p-Nsl1p-Dsn1p) which joins kinetochore subunits con

  2. Yeast Interacting Proteins Database: YDL089W, YDR233C [Yeast Interacting Proteins Database

    Lifescience Database Archive (English)

    Full Text Available rDNA repeat stability; null mutant causes increase in unequal sister-chromatid exchange; GFP-fusion protein...DNA repeat stability; null mutant causes increase in unequal sister-chromatid exchange; GFP-fusion protein l

  3. Correction: Cocaine cardiomyopathy: A case report (2014, vol. 9, no. 3, pp. 233-237)

    OpenAIRE

    Georgijev Antonio; Zhivadinovic Julija

    2016-01-01

    In Sanamed Medical Journal, vol. 9, issue 3, in the text titled 'COCAINE CARDIOMYOPATHY-A CASE REPORT' authors made a mistake by inadequately citing parts of scientific paper, in sections Introduction and Discussion. The mistake was discovered by Center for Evaluation in Education and Science (CEON). Authors were informed from the Editorial Board of Medical Journal 'Sanamed' and the stated parts of paper were timely corrected.

  4. 49 CFR 40.233 - What are the requirements for proper use and care of EBTs?

    Science.gov (United States)

    2010-10-01

    ... an EBT manufacturer, you must submit, for NHTSA approval, a quality assurance plan (QAP) for your EBT before NHTSA places the EBT on the CPL. (1) Your QAP must specify the methods used to perform external..., and the intervals at which these checks must be performed. In designating these intervals, your...

  5. 16 CFR 233.4 - Bargain offers based upon the purchase of other merchandise.

    Science.gov (United States)

    2010-01-01

    ... given a customer on the condition that he purchase a particular article at the price usually offered by... used, care be taken not to mislead the consumer. (b) Where the seller, in making such an offer, increases his regular price of the article required to be bought, or decreases the quantity and quality...

  6. Investigation of the chemical explosion of an ion exchange resin column and resulting americium contamination of personnel in the 242-Z building, August 30, 1976

    Energy Technology Data Exchange (ETDEWEB)

    1976-10-19

    As a result of an explosion in the Waste Treatment Facility, 242-Z Building, 200 West Area of the Hanford Reservation on August 30, 1976, the Manager of the Richland Operations Office (RL), Energy Research and Development Administration (ERDA), appointed an ERDA Committee to conduct a formal investigation and to prepare a report on their findings of this occurrence. The Committee was instructed to conduct the investigation in accordance with ERDAMC 0502, insofar as circumstances would permit, to cover and explain technical elements of the casual sequence(s) of the occurrence, and to describe management systems which should have or could have prevented the occurrence. This report is the result of the investigation and presents the conclusions of the review.

  7. Aqueous complexation of citrate with neodymium(III) and americium(III): a study by potentiometry, absorption spectrophotometry, microcalorimetry, and XAFS.

    Science.gov (United States)

    Brown, M Alex; Kropf, A Jeremy; Paulenova, Alena; Gelis, Artem V

    2014-05-07

    The aqueous complexation of Nd(III) and Am(III) with anions of citrate was studied by potentiometry, absorption spectrophotometry, microcalorimetry, and X-ray absorption fine structure (XAFS). Using potentiometric titration data fitting the metal-ligand (L) complexes that were identified for Nd(III) were NdHL, NdL, NdHL2, and NdL2; a review of trivalent metal-citrate complexes is also included. Stability constants for these complexes were calculated from potentiometric and spectrophotometric titrations. Microcalorimetric results concluded that the entropy term of complex formation is much more dominant than the enthalpy. XAFS results showed a dependence in the Debye-Waller factor that indicated Nd(iii)-citrate complexation over the pH range of 1.56-6.12.

  8. Americium(III) oxidation by copper(III) periodate in nitric acid solution as compared with the action of Bi(V) compounds of sodium, lithium, and potassium

    Energy Technology Data Exchange (ETDEWEB)

    Sinkov, Sergey I.; Lumetta, Gregg J. [Pacific Northwest National Laboratory, Radiochemical Processing Lab., Richland, WA (United States)

    2015-07-01

    The oxidative action of a Cu(III) periodate compound toward Am(III) in nitric acid was studied. The extent of oxidation of Am(III) to Am(VI) was investigated using a constant initial Cu(III)-to-Am(III) molar ratio of 10:1 and varying nitric acid concentrations from 0.25 to 3.5 mol/L. From 0.25 to 3 mol/L HNO3, more than 98% of the Am(III) was oxidized to Am(VI); however, at 3.5 mol/L HNO{sub 3}, the conversion to Am(VI) was only 80%. Increasing the Cu(III)-to-Am(III) molar ratio to 20:1 in 3.5 mol/L HNO{sub 3} resulted in 98% conversion to Am(VI). For comparison, oxidation of Am(III) with NaBiO{sub 3} was studied at 3.5 mol/L HNO{sub 3} and the same stoichiometric excess of Bi(V) oxidant over Am(III) (stoichiometric ratio of 3.33:1). With NaBiO{sub 3}, the extent of Am(III) conversion to Am(VI) was only 19%, while with the Cu(III) compound this value was found to be about 4 times higher under otherwise identical conditions. Similar results were obtained with other Bi(V) salts. These results show that the Cu(III) periodate compound is a superior oxidant to NaBiO{sub 3}, yielding rapid conversion to Am(VI) in a homogeneous acidic solution, and is, therefore, an excellent candidate for further development of Am separation systems.

  9. Chemical speciation of strontium, americium, and curium in high level waste: Predictive modeling of phase partitioning during tank processing. Annual progress report, October 1996--September 1997

    Energy Technology Data Exchange (ETDEWEB)

    Felmy, A.R. [Pacific Northwest National Lab., Richland, WA (US); Choppin, G. [Florida State Univ., Tallahassee, FL (US)

    1997-12-31

    'The program at Florida State University was funded to collaborate with Dr. A. Felmy (PNNL) on speciation in high level wastes and with Dr. D. Rai (PNNL) on redox of Pu under high level waste conditions. The funding provided support for 3 research associates (postdoctoral researchers) under Professor G. R. Choppin as P.I. Dr. Kath Morris from U. Manchester (Great Britain), Dr. Dean Peterman and Dr. Amy Irwin (both from U. Cincinnati) joined the laboratory in the latter part of 1996. After an initial training period to become familiar with basic actinide chemistry and radiochemical techniques, they began their research. Dr. Peterman was assigned the task of measuring Th-EDTA complexation prior to measuring Pu(IV)-EDTA complexation. These studies are associated with the speciation program with Dr. Felmy. Drs. Morris and Irwin initiated research on redox of plutonium with agents present in the Hanford Tanks as a result of radiolysis or from use in separations. The preliminary results obtained thus far are described in this report. It is expected that the rate of progress will continue to increase significantly as the researchers gain more experience with plutonium chemistry.'

  10. Studies on the feasibility of using completely incinerable reagents for the single-cycle separation of americium(III) from simulated high-level liquid waste

    Energy Technology Data Exchange (ETDEWEB)

    Nayak, P.K.; Kumaresan, R.; Venkatesan, K.A.; Subramanian, G.G.S.; Prathibha, T.; Syamala, K.V.; Selvan, B. Robert; Rajeswari, S.; Antony, M.P.; Rao, P.R. Vasudeva [Indira Gandhi Centre for Atomic Research, Kalpakkam (India). Fuel Chemistry Div.; Chaurasia, Shivkumar; Bhanage, B.M. [Institute of Chemical Technology, Mumbai (India)

    2015-06-01

    The extraction and stripping behavior of various metal ions present in the fast reactor simulated high-level liquid waste (FR-SHLLW) was studied using a solvent phase composed of a neutral extractant, N,N,-didodecyl-N',N'-dioctyl-3-oxapentane-1,5-diamide (D{sup 3}DODGA) and an acidic extractant, di-2-ethylhexyl diglycolamic acid (HDEHDGA) in n-dodecane (n-DD). The third phase formation behavior of the solvent formulation D{sup 3}DODGA + HDEHDGA/n-DD, was studied when it was contacted with FR-SHLLW, and the concentration of neutral and acidic extractant needed to avoid the third phase formation was optimized. The distribution ratio of various metal ions present in FR-SHLLW was measured in a solution of 0.1 M D{sup 3}DODGA + 0.2 M HDEHDGA/n-DD. The extraction of Am(III) was accompanied by the co-extraction of lanthanides and unwanted metal ions such as Zr(IV), Y(III), and Pd(II). A procedure was developed to minimize the extraction of unwanted metal ions by using aqueous soluble complexing agents in FR-SHLLW. Based on those results, the counter-current mixer-settler run was performed in a 20-stage mixer-settler. Quantitative extraction of Am(III), Ln(III), Y(III), and Sr(II) in 0.1 M D{sup 3}DODGA + 0.2 M HDEHDGA/n-DD was observed. The recovery of Am(III) from the loaded organic phase was carried out by the optimized aqueous formulation composed of 0.01 M diethylenetriaminepentaacetic acid (DTPA) + 0.5 M citric acid (CA) at pH 1.5. The stripping of Am(III) was accompanied by co-stripping of some early lanthanides. However the later lanthanides (Eu(III) and beyond) were not back extracted to Am(III) product. Therefore, the studies foresee the possibility of intra-lanthanides as well as lanthanide-actinide separation in a single-processing cycle.

  11. Proceedings of the specialists' meeting on nuclear data of plutonium and americium isotopes for reactor applications. [BNL, Nov. 20-21, 1978

    Energy Technology Data Exchange (ETDEWEB)

    Chrien, R E [ed.

    1979-05-01

    Separate abstracts were prepared for 17 of the papers in these Proceedings. The remaining six have already been cited in ERA, and can be located by referring to the entry CONF-781174-- in the Report Number Index. (RWR)

  12. Determination of Neptunium, Americium and Curium in Spent Nuclear Fuel Samples by Alpha Spectrometry Using {sup 239}Np and {sup 243}Am as a Spike and a Tracer

    Energy Technology Data Exchange (ETDEWEB)

    Jeo, Kih-Soo; Song, Byung-Chul; Kim, Young-Bok; Han, Sun-Ho; Jeon, Young-Shin; Jung, Euo-Chang; Jee, Kwang-Yong [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of)

    2007-07-01

    Determination of actinide elements and fission products in spent nuclear fuels is of importance for a burnup determination and source term evaluation. Especially, the amounts of uranium and plutonium isotopes are used for the evaluation of a burnup credit in spent nuclear fuels. Additionally, other actinides such as Np, Am and Cm in spent nuclear fuel samples is also required for the purposes mentioned above. In this study, {sup 237}Np, {sup 241}Am and {sup 244}Cm were determined by an alpha spectrometry for the source term data for high burnup spent nuclear fuels ranging from 37 to 62.9 GWD/MtU as a burnup. Generally, mass spectrometry has been known as the most powerful method for isotope determinations such as high concentrations of uranium and plutonium. However, in the case of minor actinides such as Np, Am and Cm, alpha spectrometry would be recommended instead. Determination of the transuranic elements in spent nuclear fuel samples is different from that for environmental samples because the amount of each nuclide in the spent fuel samples is higher and the relative ratios between each nuclide are also different from those for environmental samples. So, it is important to select an appropriate tracer and an optimum sample size depending on the nuclides and analytical method. In this study {sup 237}Np was determined by an isotope dilution alpha(gamma) spectrometry using {sup 239}Np as a spike, and {sup 241}Am and curium isotopes were determined by alpha spectrometry using {sup 243}Am as a tracer. The content of each nuclide was compared with that by the Origen-2 code.

  13. Identification of extensive drug resistant Pseudomonas aeruginosa strains: New clone ST1725 and high-risk clone ST233

    Science.gov (United States)

    Aguilar-Rodea, Pamela; Zúñiga, Gerardo; Rodríguez-Espino, Benjamín Antonio; Olivares Cervantes, Alma Lidia; Gamiño Arroyo, Ana Estela; Moreno-Espinosa, Sarbelio; de la Rosa Zamboni, Daniela; López Martínez, Briceida; Castellanos-Cruz, María del Carmen; Parra-Ortega, Israel; Jiménez Rojas, Verónica Leticia; Vigueras Galindo, Juan Carlos; Velázquez-Guadarrama, Norma

    2017-01-01

    Several microorganisms produce nosocomial infections (NIs), among which Pseudomonas aeruginosa stands out as an opportunist pathogen with the capacity to develop multiresistance to first-choice antibiotics. From 2007 to 2013, forty-six NIs produced by P. aeruginosa were detected at a pediatric tertiary care hospital in Mexico with a significant mortality rate (17.39%). All isolates (n = 58/46 patients) were characterized by evaluating their response to several antibiotics as panresistant (PDR), extensively resistant (XDR), multiresistant (MDR) or sensitive (S). In addition, all isolates were typified through multilocus sequencing of seven genes: acsA, aroE, guaA, mutL, nuoD, ppsA and trpE. Furthermore, to establish the genetic relationships among these isolates, we carried out a phylogenetic inference analysis using maximum likelihood to construct a phylogenetic network. To assess evolutionary parameters, recombination was evaluated using the PHI test, and the ratio of nonsynonymous to synonymous substitutions was determined. Two of the strains were PDR (ST1725); 42 were XDR; four were MDR; and ten were S. Twenty-one new sequence types were detected. Thirty-three strains exhibited novel sequence type ST1725. The ratio of nonsynonym to synonym substitutions was 1:1 considering all genes. Phylogenetic analysis showed that the genetic relationship of the PDR, XDR and MDR strains was mainly clonal; however, the PHI test and the phylogenetic network suggest that recombination events occurred to produce a non-clonal population. This study aimed not only to determine the genetic diversity of clinical P. aeruginosa but also to provide a warning regarding the identification and spreading of clone ST1725, its ability to cause outbreaks with high mortality rates, and to remain in the hospital environment for over seven years. These characteristics highlight the need to identify clonal outbreaks, especially where high resistance to most antibiotics is observed, and control measures are needed. This study also represents the first report of the PDR ST1725. PMID:28253282

  14. 40 CFR 421.233 - Effluent limitations guidelines representing the degree of effluent reduction attainable by the...

    Science.gov (United States)

    2010-07-01

    ... cobalt in the crushed raw material Copper 0.099 0.047 Nickel 0.042 0.028 Ammonia (as N) 10.260 4.512... pounds) of nickel powder washed Copper 0.043 0.021 Nickel 0.019 0.013 Ammonia (as N) 4.515 1.985 Cobalt 0... pounds) of nickel produced Copper 16.250 7.744 Nickel 6.982 4.697 Ammonia (as N) 1,692.000 743.900...

  15. SU-E-J-233: Effect of Brachytherapy Seed Artifacts in T2 and Proton Density Maps in MR Images

    Energy Technology Data Exchange (ETDEWEB)

    Mashouf, S [Sunnybrook Odette Cancer Centre, Toronto, Ontario (Canada); University of Toronto, Dept of Radiation Oncology, Toronto, Ontario (Canada); Fatemi-Ardekani, A [Sunnybrook Odette Cancer Centre, Toronto, Ontario (Canada); Sunnybrook Research Institute, Toronto, Ontario (Canada); Song, W [Sunnybrook Odette Cancer Centre, Toronto, Ontario (Canada); University of Toronto, Dept of Radiation Oncology, Toronto, Ontario (Canada); Sunnybrook Research Institute, Toronto, Ontario (Canada)

    2015-06-15

    Purpose: This study aims at investigating the influence of brachytherapy seeds on T2 and proton density (PD) maps generated from MR images. Proton density maps can be used to extract water content. Since dose absorbed in tissue surrounding low energy brachytherapy seeds are highly influenced by tissue composition, knowing the water content is a first step towards implementing a heterogeneity correction algorithm using MR images. Methods: An LDR brachytherapy (IsoAid Advantage Pd-103) seed was placed in the middle of an agar-based gel phantom and imaged using a 3T Philips MR scanner with a 168-channel head coil. A multiple echo sequence with TE=20, 40, 60, 80, 100 (ms) with large repetition time (TR=6259ms) was used to extract T2 and PD maps. Results: Seed artifacts were considerably reduced on T2 maps compared to PD maps. The variation of PD around the mean was obtained as −97% to 125% (±1%) while for T2 it was recorded as −71% to 24% (±1%). Conclusion: PD maps which are required for heterogeneity corrections are susceptible to artifacts from seeds. Seed artifacts on T2 maps, however, are significantly reduced due to not being sensitive to B0 field variation.

  16. Aquastress D2.3.3 - Integrated water balance models for water stress adapted to test sites

    OpenAIRE

    Schmidt, S; P. Rosso; Loubier, S.; Preziosi, E.; Tarnacki, K.; Van den Wyngaert, I.

    2008-01-01

    This report is based on the report Milestone 2.3-1 of the Aquastress project (Schmidt et al, 2005), which presented an inventory of examples of water balance models and gave a list of criteria to characterise hydrological models, and on the report Deliverable 2.3-1 of the Aquastress project (Schmidt et al, 2006), which describes the concept of the water balance model and the structure of the water stress assessment in the domestic, industrial, agricultural and (semi)natural ecosystem sectors....

  17. Measurement of Effective Cross Section of Th-233(n,γ)Th-234 Reaction Using the KUR

    Science.gov (United States)

    Chatani, Hiroshi

    2005-05-01

    Thorium nitrate was irradiated together with Au and Co neutron fluence monitors in the Kyoto University Reactor (KUR). The thorium was chemically purified using the solvent extraction and ion-exchange methods. The γ-rays in the decay of Th-234 were measured using high-purity Ge detectors (HPGes). Thermal neutron fluxes and epithermal indexes, i.e., the relative strength of the epithermal dE/E component, were determined using the Westcott convention. Five effective cross sections were determined for epithermal indexes from 0.01 to 0.04 using three irradiation facilities. The cross section for 2200 m/s neutrons and the resonance integral were deduced to be (1270±50) b and (1680±930) b, respectively, from the results of the five effective cross sections.

  18. 16 CFR 233.3 - Advertising retail prices which have been established or suggested by manufacturers (or other...

    Science.gov (United States)

    2010-01-01

    ... advertising by one who is selling at a lower price. If, however, the list price is being followed only by, for... representative communities, the principal retail outlets are selling the product at this price in the regular... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Advertising retail prices which have...

  19. Defense Transformation a’ la francaise and U.S. Interests. Strategic Forum, Number 233, September 2008

    Science.gov (United States)

    2008-09-01

    espérance déçue,” Le Figaro, June 18, 2008; see also, “Le scud d’Alain Juppé contre la politique de défense de Nicolas Sarkozy,” Le Monde, June 19...internationales_1032/organisations- internationales-europe_1126/otan_1134/seminaire- haut-niveau-ue-otan-7-juillet-2008_19024/ discours -m. bernard-kouchner_64303.html...Defense Conference, September 11, 2007, available at <www.defense. gouv.fr/ministre/prises_de_parole/ discours /discours_de_m_

  20. C2 Fracture Subtypes, Incidence, and Treatment Allocation Change with Age: A Retrospective Cohort Study of 233 Consecutive Cases

    OpenAIRE

    Anna-Lena Robinson; Anders Möller; Yohan Robinson; Claes Olerud

    2017-01-01

    The currently available data on the distribution of C2 fracture subtypes is sparse. This study was designed to identify the proportions of the second cervical vertebra (C2) fracture subtypes and to present age and gender specific incidences of subgroups. A dataset of all patients treated between 2002 and 2014 for C2 fractures was extracted from the regional hospital information system. C2 fractures were classified into odontoid fractures types 1, 2, and 3, Hangman’s fractures types 1, 2, and ...

  1. Chromosome 8q23.3 and 11q23.1 Variants Modify Colorectal Cancer Risk in Lynch Syndrome

    NARCIS (Netherlands)

    Wijnen, Juul T.; Brohet, Richard M.; Van Eijk, Ronald; Jagmohan-Changur, Shanty; Middeldorp, Anneke; Tops, Carli M.; Van Puijenbroek, Mario; Ausems, Margreet G. E. M.; Garcia, Encarna Gomez; Hes, Frederik J.; Hoogerbrugge, Nicoline; Menko, Fred H.; Van Os, Theo A. M.; Sijmons, Rolf H.; Verhoef, Senno; Wagner, Anja; Nagengast, Fokko M.; Kleibeuker, Jan H.; Devilee, Peter; Morreau, Hans; Goldgar, David; Tomlinson, Ian P.; Houlston, Richard S.; Van Wezel, Tom; Vasen, Hans F. A.

    2009-01-01

    Background & Aims: Recent genome-wide association studies have identified common low-risk variants for colorectal cancer (CRC). To assess whether these influence CRC risk in the Lynch syndrome, we genotyped these variants in a large series of proven mutation carriers. Methods: We studied 675 individ

  2. An Assessment of the Current Day Impact of Various Materials Associated with the U.S. Nuclear Test Program in the Marshall Island

    Energy Technology Data Exchange (ETDEWEB)

    Robison, W L; Noshkin, V E; Hamilton, T F; Conrado, C L; Bogen, K T

    2001-05-01

    Different stable elements, and some natural and man-made radionuclides, were used as tracers or associated in other ways with nuclear devices that were detonated at Bikini and Enewetak Atolls as part of the U.S. nuclear testing program from 1946 through 1958. The question has been raised whether any of these materials dispersed by the explosions could be of sufficient concentration in either the marine environment or on the coral islands to be of a health concern to people living, or planning to live, on the atolls. This report addresses that concern. An inventory of the materials involved during the test period was prepared and provided to us by the Office of Defense Programs (DP) of the United States Department of Energy (DOE). The materials that the DOE and the Republic of the Marshall Islands (RMI) ask to be evaluated are--sulfur, arsenic, yttrium, tantalum, gold, rhodium, indium, tungsten, thallium, thorium-230,232 ({sup 230,232}Th), uranium-233,238 ({sup 233,238}U), polonium-210 ({sup 210}Po), curium-232 ({sup 232}Cu), and americium-241 ({sup 241}Am). The stable elements were used primarily as tracers for determining neutron energy and flux, and for other diagnostic purposes in the larger yield, multistage devices. It is reasonable to assume that these materials would be distributed in a similar manner as the fission products subsequent to detonation. A large inventory of fission product and uranium data was available for assessment. Detailed calculations show only a very small fraction of the fission products produced during the entire test series remain at the test site atolls. Consequently, based on the information provided, we conclude that the concentration of these materials in the atoll environment pose no adverse health effects to humans.

  3. A contribution to the physical and chemical model of long-lived radioactive wastes by clayey materials; Contribution a la modelisation physico-chimique de la retention de radioelements a vie longue par des materiaux argileux

    Energy Technology Data Exchange (ETDEWEB)

    Gorgeon, L.

    1994-11-25

    This work deals with the high-level and long-lived radioactive wastes confinement which come from the irradiated fuels reprocessing. These wastes are generally coated in a deep geological structure confinement matrix. The radiation protection of a such storage requires that the coating matrix, the technological barriers which separate the storage and the geological medium and the reception rock does not let the radioactive wastes pass. The materials used in this work for the confinement studies are clayey minerals and the retention mechanisms studies are realized on cesium 135, neptunium 237, americium 241 and uranium 233. The first part of this thesis concerns the clayey minerals retention properties towards ions in aqueous solutions. More particularly the relations between these properties and the chemical structure of these solids are investigated. In the second part are presented the experimental works which have allowed to specify the intrinsic characteristics of the studied minerals. Indeed the knowledge of these parameters is essential to quantitatively explain the results of the radionuclides retention. The adsorption mechanisms are described in a third part. (O.L.). 112 refs., 59 figs., 51 tabs.

  4. The synchronization of palaeoclimatic events in the North Atlantic region during Greenland Stadial 3 (ca 27.5 to 23.3 kyr b2k)

    DEFF Research Database (Denmark)

    Hibbert, F.D.; Peters, C.; Rasmussen, Sune Olander

    2012-01-01

    SST records demonstrates that such events may not readily be identified within the coldest stadials of the Greenland ice cores, highlights the need for carefully constructed event stratigraphies (independently tested by the use of tephra isochrones and radiocarbon) and illustrates pervasive millennial...

  5. Crystal structure of (2R*,3aR*-2-phenylsulfonyl-2,3,3a,4,5,6-hexahydropyrrolo[1,2-b]isoxazole

    Directory of Open Access Journals (Sweden)

    Yaiza Hernández

    2017-01-01

    Full Text Available The title compound, C12H15NO3S, was prepared by 1,3-dipolar cycloaddition of 3,4-dihydro-2H-pyrrole 1-oxide and phenyl vinyl sulfone. In the molecule, both fused five-membered rings display a twisted conformation. In the crystal, C—H...O hydrogen bonds link neighbouring molecules, forming chains running parallel to the b axis.

  6. Loss of heterozygosity on 10q23.3 and mutation of tumor suppressor gene PTEN in gastric cancer and precancerous lesions

    Institute of Scientific and Technical Information of China (English)

    Yi-Ling Li; Zhong Tian; Dong-Ying Wu; Bao-Yu Fu; Yan Xin

    2005-01-01

    AIM: To investigate the loss of heterozygosity (LOH) and mutation of tumor suppressor gene PTEN in gastric cancer and precancerous lesions.METHODS: Thirty cases of normal gastric mucosa, advanced and early stage gastric cancer, intestinal metaplasia, atrophic gastritis, and atypical hyperplasia were analyzed for PTEN LOH and mutations within the entire coding region of PTEN gene by PCR-SSCP denaturing PAGE gel electrophoresis,and PTEN mutation was detected by PCR-SSCP sequencing followed by silver staining.RESULTS: LOH rate found in respectively atrophic gastritis was 10% (3/30), intestinal metaplasia 10% (3/30), atypical hyperpiasia 13.3% (4/30), early stage gastric cancer 20%(6/30), and advanced stage gastric cancer 33.3% (9/30),None of the precancerous lesions and early stage gastric cancer showed PTEN mutations, but 10% (3/30) of the advanced stage gastric cancers, which were all positive for LOH, showed PTEN mutation.CONCLUSION: LOH of PTEN gene appears in precancerous lesions, and PTEN mutations are restricted to advanced gastric cancer, LOH and mutation of PTEN gene are closely related to the infiltration and metastasis of gastric cancer.

  7. Colorectal cancer risk variants at 8q23.3 and 11q23.1 are associated with disease phenotype in APC mutation carriers

    NARCIS (Netherlands)

    Ghorbanoghli, Z.; Nieuwenhuis, M. H.; Houwing-Duistermaat, J. J.; Jagmohan-Changur, S.; Hes, F. J.; Tops, C. M.; Wagner, A.; Aalfs, C. M.; Verhoef, S.; Garcia, E. B. Gomez; Sijmons, R. H.; Menko, F. H.; Letteboer, T. G.; Hoogerbrugge, N.; van Wezel, T.; Vasen, H. F. A.; Wijnen, J. T.

    2016-01-01

    Familial adenomatous polyposis (FAP) is a dominantly inherited syndrome caused by germline mutations in the APC gene and characterized by the development of multiple colorectal adenomas and a high risk of developing colorectal cancer (CRC). The severity of polyposis is correlated with the site of th

  8. Clinical aspects of an autosomal dominantly inherited hearing impairment linked to the DFNA60 locus on chromosome 2q23.1-2q23.3

    NARCIS (Netherlands)

    Beelen, E. van; Schraders, M.; Huygen, P.L.M.; Oostrik, J.; Plantinga, R.F.; Drunen, W.J. van; Collin, R.W.J.; Kooper, D.P.; Pennings, R.J.E.; Cremers, C.W.R.J.; Kremer, H.; Kunst, H.P.M.

    2013-01-01

    A total of 64 loci for autosomal dominant non-syndromic hearing impairment have been described, and the causative genes have been identified for 24 of these. The present study reports on the clinical characteristics of an autosomal dominantly inherited hearing impairment that is linked to a region w

  9. Clinical aspects of an autosomal dominantly inherited hearing impairment linked to the DFNA60 locus on chromosome 2q23.1-2q23.3.

    Science.gov (United States)

    van Beelen, E; Schraders, M; Huygen, P L M; Oostrik, J; Plantinga, R F; van Drunen, W; Collin, R W J; Kooper, D P; Pennings, R J E; Cremers, C W R J; Kremer, H; Kunst, H P M

    2013-06-01

    A total of 64 loci for autosomal dominant non-syndromic hearing impairment have been described, and the causative genes have been identified for 24 of these. The present study reports on the clinical characteristics of an autosomal dominantly inherited hearing impairment that is linked to a region within the DFNA60 locus located on chromosome 2 in q22.1-24.1. A pedigree spanning four generations was established with 13 affected individuals. Linkage analysis demonstrated that the locus extended over a 2.96 Mb region flanked by markers D2S2335 and D2S2275. The audiograms mainly showed a distinctive U-shaped configuration. Deterioration of hearing started at a wide age range, from 12 to 40 years. Cross-sectional analysis showed rapid progression of hearing impairment from mild to severe, between the ages of 40 and 60 years, a phenomenon that is also observed in DFNA9 patients. The results of the individual longitudinal analyses were generally in line with those obtained by the cross-sectional analysis. Speech recognition scores related to the level of hearing impairment (PTA1,2,4 kHz) appeared to be fairly similar to those of presbyacusis patients. It is speculated that hearing impairment starting in mid-life, as shown by DFNA60 patients, could play a role in the development of presbyacusis. Furthermore, speech recognition did not deteriorate appreciably before the sixth decade of life. We conclude that DFNA60 should be considered in hearing impaired patients who undergo a rapid progression in middle age and are negative for DFNA9. Furthermore, cochlear implantation resulted in good rehabilitation in two DFNA60 patients.

  10. Dynamic analysis of muscular lymphokinetic activities in the treatment of lymphedema of the upper limbs - doi:10.5020/18061230.2007.p233

    Directory of Open Access Journals (Sweden)

    Maria de Fátima Guerreiro Godoy

    2012-01-01

    Full Text Available The aim of the present study was to evaluate the resting and working pressures associated to a restrain mechanism, in patients suffering from lymphedema of the upper limbs, postbreast cancer treatment, whilst performing occupational and day-to-day self-care activities. Six female patients under treatment of lymphedema due to surgical, radiotherapeutic and chemotherapeutic treatment of breast cancer, in the age group between 32 and 76 years (mean 54 years old, ± 31.11 were selected. A compression sleeve of “gorgurão” (cotton-polyester material was applied as a restrain mechanism. The occupational and daily personal care activities evaluated were those common to all participants. These activities included washingup, cooking in a small pan, sweeping the floor using the affected arm, brushing the teeth, brushing the hair, washing small items of clothes, ironing clothes and making the bed. For statistical analysis, mean and standard deviation between resting pressures and minimum and maximum working pressures were determined. The two-tailed student t-test and variance analysis were used for repeated measurements. The Bonferroni limit was used in the analysis of the variables to calculate the alpha error, with a value of 5%, considered statistically significant. All of the analyzed activities associated to the “gorgurão” compression sleeve generated both resting and working pressures (p <0.005. In conclusion, the occupational daily life tasks used in the present study generate resting and working pressures and can be used as a form of treatment of the lymphedema.

  11. Guilhem de Saint Gregori, "Ben grans avolesa intra" (BdT 233.2; Bartolomeo Zorzi, "En tal dezir mos cors intra" (BdT 74.4

    Directory of Open Access Journals (Sweden)

    Alessandro Bampa

    2014-02-01

    Full Text Available This paper provides a commentary and translation of two contrafacta of Arnaut Daniel’s sestina: Guilhem de Saint Gregori’s "Ben gran avolesa intra" and Bartolomeo Zorzi’s "En tal dezir mos cors intra". For the first song, I will highlight the new contexts and meanings given to Arnaut’s images (which are taken from his sestina and other poems within Guilhem’s invective against Aimers II of Poitiers, in order to evaluate its literary qualities and innovations. Through lexical analysis, this paper will reveal the strong connection between Zorzi’s and Guilhem’s songs. In particular, the paper analyses specifically their common theme of Hell, suggesting Bartolomeo’s text is most likely an answer to Arnaut’s sestina, which clearly expresses a desire of sensual pleasure. The study pays particular attention to the relation between sexual love and the matter of eternal damnation: Zorzi attacks Arnaut’s ferm voler, advancing his argument by evoking Chrétien de Troyes’ "Perceval" (references to which are spread throughout the text, and not only in l. 18 and through his constant stress on the duties towards one’s family.

  12. SU-E-T-233: Cyberknife Versus Linac IMRT for Dose Comparision in Hypofractionated Hemi Larynx Irradiation of Early Stage True Vocal Cord Cancer: A Dosimetric Study

    Energy Technology Data Exchange (ETDEWEB)

    Ding, C; Lee, P; Jiang, S [UT Southwestern Medical Center, Dallas, TX (United States)

    2015-06-15

    Purpose: To compare dosimetric data of patients treated for early-stage larynx cancer on Cyberknife and Linac IMRT. Methods: Nine patients were treated with Cyberknife to a dose of 45 Gy in 10 fractions of the involved hemilarynx. The prescription dose provided at least 95% of PTV coverage. After Cyberknife treatment, the CT images and contours were sent to Pinnacle treatment planning system for IMRT planning on a regular SBRT linac with same dose prescription and constrains. Dose to target and normal tissue, including the arytenoids, cord, carotid arteries, thyroid, and skin, were analyzed using dose volume histograms. Results: For Cyberknife plan, the conformity indices are within 1.11–1.33. The average dose to the contralateral arytenoids for Cyberknife plans was 28.9±6.5Gy), which is lower than the same mean dose for IMRT plans (34.0±5.2 Gy). The average maximum dose to the ipsilateral and contralateral carotid artery were 20.6 ±9.1 Gy and 10.2±6.0 Gy respectively for Cybeknife comparing with 22.1±8.0 Gy and 12.0±5.1 Gy for IMRT. The mean dose to the thyroid was 3.6±2.2 Gy for Cyberknife and 3.4±2.4 Gy for IMRT. As shown in DVH, the Cyberknife can deliver less dose to the normal tissue which is close to target area comparing with IMRT Plans. However, IMRT plan’s can give more sparing for the critical organs which is far away from the target area. Conclusion: We have compared the dosimetric parameters of Cyberknife and linac IMRT plans for patients with early-stage larynx cancer. Both Cyberknife and IMRT plans can achieve conformal dose distribution to the target area. Cyberknife was able to reduce normal tissue dose in high doses region while IMRT plans can reduce the dose of the normal tissue at the low dose region. These dosimetric parameters can be used to guide future prospective protocols using SBRT for larynx cancer.

  13. Quality of life and wishes in duchenne muscular dystrophy: the perception of children and their parents - doi:10.5020/18061230.2009.p233

    Directory of Open Access Journals (Sweden)

    Egmar Longo Araújo de Melo

    2012-01-01

    Full Text Available Objective: To assess the agreement between children with Duchenne Muscular Dystrophy (DMD and their parents regarding the perception of quality of life (QOL and the wishes expressed by children. Methods: The study involved 14 patients (median age = 9.9 yearsold followed up in Sarah Rehabilitation Center – Fortaleza, Brazil and their parents. The following instruments were used: AUQEI questionnaire (Autoquestionnaire Qualité de Vie Enfant Imagé and Three Wishes Projective Technique, this being analyzed by Nereo & Hinton’s system of categories (2003. Results: The analysis of AUQEI showed a good agreement with ICC (intraclass correlation coefficient = 0,699 and a positive and significant correlation between scores of both children and their parents (rho = 0.54, p < 0.05. The Three Wishes also showed a good agreement, mainly in the categories of Material Goods and Activities. Conclusions: Despite children with DMD and their parents exhibited similar perceptions of the QOL and wishes, we suggest that both be heard in respect to aspects of the rehabilitation program. This study provides additional data concerning the need for child QOL assessment instruments that include parallel versions directed to the children and their parents.

  14. Influence of Sample Preparation on Assay of Functional Phenolic Phytochemicals (American Chemical Society, 233rd National Meeting & Exposition, March 25-29, 2007, Chicago, IL)

    Science.gov (United States)

    Phenolics are one of the most diverse groups of phytochemicals that are ubiquitously distributed throughout the plant kingdom. Phenolic phytochemicals are known to exhibit a wide range of health protective effects. Approximately 8000 different phenolics compounds have been isolated from natural re...

  15. Interaction and transport of actinides in natural clay rock with consideration of humic substances and clay organics. Characterization and quantification of the influence of clay organics on the interaction and diffusion of uranium and americium in the clay. Joint project

    Energy Technology Data Exchange (ETDEWEB)

    Bernhard, Gert [Helmholtz-Zentrum Dresden-Rossendorf e.V. (Germany). Inst. of Radiochemistry; Schmeide, Katja; Joseph, Claudia; Sachs, Susanne; Steudtner, Robin; Raditzky, Bianca; Guenther, Alix

    2011-07-01

    The objective of this project was the study of basic interaction processes in the systems actinide - clay organics - aquifer and actinide - natural clay - clay organics - aquifer. Thus, complexation, redox, sorption and diffusion studies were performed. To evaluate the influence of nitrogen, phosphorus and sulfur containing functional groups of humic acid (HA) on the complexation of actinides in comparison to carboxylic groups, the Am(III) and U(VI) complexation by model ligands was studied by UV-Vis spectroscopy and TRLFS. The results show that Am(III) is mainly coordinated via carboxylic groups, however, probably stabilized by nitrogen groups. The U(VI) complexation is dominated by carboxylic groups, whereas nitrogen and sulfur containing groups play a minor role. Phosphorus containing groups may contribute to the U(VI) complexation by HA, however, due to their low concentration in HA they play only a subordinate role compared to carboxylic groups. Applying synthetic HA with varying sulfur contents (0 to 6.9 wt.%), the role of sulfur functionalities of HA for the U(VI) complexation and Np(V) reduction was studied. The results have shown that sulfur functionalities can be involved in U(VI) humate complexation and act as redox-active sites in HA for the Np(V) reduction. However, due to the low content of sulfur in natural HA, its influence is less pronounced. In the presence of carbonate, the U(VI) complexation by HA was studied in the alkaline pH range by means of cryo-TRLFS (-120 C) and ATR FT-IR spectroscopy. The formation of the ternary UO{sub 2}(CO{sub 3}){sub 2}HA(II){sup 4-} complex was detected. The complex formation constant was determined with log {beta}{sub 0.1} M = 24.57 {+-} 0.17. For aqueous U(VI) citrate and oxalate species, luminescence emission properties were determined by cryo-TRLFS and used to determine stability constants. The existing data base could be validated. The U(VI) complexation by lactate, studied in the temperature range 7 to 65 C, was found to be endothermic and entropy-driven. In contrast, the complex stability constants determined for U(VI) humate complexation at 20 and 40 C are comparable, however, decrease at 60 C. For aqueous U(IV) citrate, succinate, mandelate and glycolate species stability constants were determined. These ligands, especially citrate, increase solubility and mobility of U(IV) in solution due to complexation. The U(VI) sorption onto crushed Opalinus Clay (OPA, Mont Terri, Switzerland) was studied in the absence and presence of HA or low molecular weight organic acids, in dependence on temperature and CO2 presence using OPA pore water as background electrolyte. Distribution coefficients (K{sub d}) were determined for the sorption of U(VI) and HA onto OPA with (0.0222 {+-} 0.0004) m{sup 3}/kg and (0.129 {+-} 0.006) m{sup 3}/kg, respectively. The U(VI) sorption is not influenced by HA ({<=}50 mg/L), however, decreased by low molecular weight organic acids ({>=} 1 x 10{sup -5} M), especially by citrate and tartrate. With increasing temperature, the U(VI) sorption increases both in the absence and in the presence of clay organics. The U(VI) diffusion in compacted OPA is not influenced by HA at 25 and 60 C. Predictions of the U(VI) diffusion show that an increase of the temperature to 60 C does not accelerate the migration of U(VI). With regard to uranium-containing waste, it is concluded that OPA is suitable as host rock for a future nuclear waste repository since OPA has a good retardation potential for U(VI). (orig.)

  16. Monitored Natural Attenuation of Inorganic Contaminants in Ground Water Volume 3 Assessment for Radionuclides IncludingTritium, Radon, Strontium, Technetium, Uranium, Iodine, Radium, Thorium, Cesium, and Plutonium-Americium

    Science.gov (United States)

    The current document represents the third volume of a set of three volumes that address the technical basis and requirements for assessing the potential applicability of MNA as part of a ground-water remedy for plumes with nonradionuclide and/or radionuclide inorganic contamina...

  17. Study of plutonium and americium contamination in agricultural area, radiological impact caused by consumption of vegetables of this area; Estudio de la contaminacion de plutonio y americio en un area agricola, impacto radiologico ocasionado por consumo de vegetales contaminados

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa, Assuncion; Aragon, Antonio; Cruz, Berta de la; Gutierrez, Jose [Centro de Investigaciones Energeticas Medioambientales y Tecnologicas, Madrid (Spain). Dept. de Impacto Ambiental de la Energia

    2001-07-01

    The transuranide concentration has been studied for 30 years in vegetable production, crops in wide extensions and in private-owned farms, all of them situated within the Pu-contaminated area of Palomares due to an air accident in 1966. Based on these studies, a preliminary estimation of the radiological risk caused by the consumption of these products by the inhabitants was possible. The results show that most of the fruits present a surface contamination, which disappears or is significantly reduced when they are washed. The contamination present in edible parts of the vegetables, as well as the contamination of other products included in the diet, has facilitated the estimation of the effective dose for ingestion and the committed effective dose for 50 years for the inhabitants. The main conclusions are: those plants, whose cultivation period is less than a year, present a low level of contamination; the green parts of the plants have a higher contamination than the fruits; the Pu soil to plant transfer factor is very low. In general, those plants that have remained in the contaminated land for several years present a high contamination level; the ingestion of products from Palomares does not represent an important risk for the population, even in the case that the products were totally consumed by a critical group.( author)

  18. Supported liquid inorganic membranes for nuclear waste separation

    Energy Technology Data Exchange (ETDEWEB)

    Bhave, Ramesh R; DeBusk, Melanie M; DelCul, Guillermo D; Delmau, Laetitia H; Narula, Chaitanya K

    2015-04-07

    A system and method for the extraction of americium from radioactive waste solutions. The method includes the transfer of highly oxidized americium from an acidic aqueous feed solution through an immobilized liquid membrane to an organic receiving solvent, for example tributyl phosphate. The immobilized liquid membrane includes porous support and separating layers loaded with tributyl phosphate. The extracted solution is subsequently stripped of americium and recycled at the immobilized liquid membrane as neat tributyl phosphate for the continuous extraction of americium. The sequestered americium can be used as a nuclear fuel, a nuclear fuel component or a radiation source, and the remaining constituent elements in the aqueous feed solution can be stored in glassified waste forms substantially free of americium.

  19. Highly enriched isotope samples of uranium and transuranium elements for scientific investigation

    Science.gov (United States)

    Vesnovskii, Stanislav P.; Polynov, Vladimir N.; Danilin, Lev. D.

    1992-02-01

    The paper describes the production of highly enriched isotopes of uranium, plutonium, americium and curium by electromagnetic separation for scientific and applied researches in physics, chemistry, geology, medicine, biology and other fields. Using the equipment described, the isotopes are produced in quantities sufficient to set up nuclear physical experiments, to produce nuclear reference materials and standard sources for calibration of radiometrical and mass spectrometrical equipment, in radionuclide metrology, etc. For the following isotopes the indicated degrees of isotopic enrichment were achieved: 233U - 99.97%; 235U - 99.97%; 236U - 98.0%; 238U - 99.997%; 238Pu - 99.6%; 239Pu - 99.9977%; 240Pu - 99.9-100%; 241Pu - 96.998%; 242Pu - 97.8-99.96%; 244Pu - 96.7%; 241Am - 99.6%; 242Am - 73.6%; 243Am - 99.2-99.94%; 243Cm - 99.99%; 245Cm - 99.998%; 246Cm - 99.8%; 247Cm - 90%; 248Cm - 97%. Methods for preparing layers of highly enriched isotopes on various substances are presented: - electrochemical deposition of transuranic elements from aqueous-organic and organic media and vacuum spraying: - the method of foil and coating formation via compounds in the vapour phase; - the method of fabrication of layers of transuranic elements on superthin (1-2 μm) metal substrates with additional isolating polymer-metal coatings (0.2-0.4 μm), that substantially decrease material transfer from the active layer and increase safety of product handling.

  20. Industrial research for transmutation scenarios

    Science.gov (United States)

    Camarcat, Noel; Garzenne, Claude; Le Mer, Joël; Leroyer, Hadrien; Desroches, Estelle; Delbecq, Jean-Michel

    2011-04-01

    This article presents the results of research scenarios for americium transmutation in a 22nd century French nuclear fleet, using sodium fast breeder reactors. We benchmark the americium transmutation benefits and drawbacks with a reference case consisting of a hypothetical 60 GWe fleet of pure plutonium breeders. The fluxes in the various parts of the cycle (reactors, fabrication plants, reprocessing plants and underground disposals) are calculated using EDF's suite of codes, comparable in capabilities to those of other research facilities. We study underground thermal heat load reduction due to americium partitioning and repository area minimization. We endeavor to estimate the increased technical complexity of surface facilities to handle the americium fluxes in special fuel fabrication plants, americium fast burners, special reprocessing shops, handling equipments and transport casks between those facilities.

  1. Chemistry research and development progress report, May-October, 1978

    Energy Technology Data Exchange (ETDEWEB)

    Miner, F. J.

    1979-08-30

    Work in progress includes: calorimetry and thermodynamics of nuclear materials; americium recovery and purification; optimization of the cation exchange process for recovering americium and plutonium from molten salt extraction residues, photochemical separations of actinides; advanced ion exchange materials and techniques; secondary actinide recovery; removal of plutonium from lathe coolant oil; evaluation of tributyl phosphate-impregnated sorbent for plutonium-uranium separations; plutonium recovery in advance size reduction facility; plutonium peroxide precipitation; decontamination of Rocky Flats soil; soil decontamination at other Department of Energy sites; recovery of actinides from combustible wastes; induction-heated, tilt-pour furnace; vacuum melting; determination of plutonium and americium in salts and alloys by calorimetry; plutonium peroxide precipitation process; silica removal study; a comparative study of annular and Raschig ring-filled tanks; recovery of plutonium and americium from a salt cleanup alloy; and process development for recovery of americium from vacuum melt furnace crucibles.

  2. (3aRS,7aSR-7a-Methoxy-2-oxo-2,3,3a,4,5,6,7,7a-octahydro-1-benzofuran-4,4-dicarbonitrile

    Directory of Open Access Journals (Sweden)

    María González

    2012-12-01

    Full Text Available The racemic title compound, C11H12N2O3, contains a [4.3.0]bicyclic unit in which the shared C—C bond adopts a cis configuration. The five- and six-membered rings are in twisted envelope (with the bridgehead C atom bearing the methoxy substituent as the flap and distorted chair conformations, respectively. In the crystal, the molecules are linked via weak C—H...O iteractions, forming ladder-like chains along [010].

  3. Correlation of radioactive waste treatment costs and the environmental impact of waste effluents in the nuclear fuel cycle: reprocessing of high-temperature gas-cooled reactor fuel containing U-233 and thorium

    Energy Technology Data Exchange (ETDEWEB)

    Davis, W. Jr.; Blanco, R.E.; Finney, B.C.; Hill, G.S.; Moore, R.E.; Witherspoon, J.P.

    1976-05-01

    A cost/benefit study was made to determine the cost and effectiveness of various radioactive waste (radwaste) treatment systems for decreasing the release of radioactive materials from a model high-temperature gas-cooled reactor (HTGR) fuel reprocessing plant and to determine the radiological impact (dose commitment) of the released materials on the environment. The study is designed to assist the U. S. Nuclear Regulatory Commission in defining the term as low as reasonably achievable as it applies to this nuclear facility. The base case is representative of conceptual, developing technology of head-end graphite-burning operations and of extensions of solvent-extraction technology of current designs for light-water-reactor (LWR) fuel reprocessing plants. The model plant has an annual capacity of 450 metric tons of heavy metal (MTHM, where heavy metal is uranium plus thorium), as charged to about fifty 1000-MW(e) HTGRs. Additional radwaste treatment systems are added to the base-case plant in a series of case studies to decrease the amounts of radioactive materials released and to reduce the radiological dose commitment to the population in the surrounding area. The capital and annual costs for the added waste treatment operations and the corresponding reductions in dose commitments are calculated for each case. In the final analysis, the cost/benefit of each case, calculated as additional cost of radwaste system divided by the reduction in dose commitment, is tabulated or the dose commitment is plotted with cost as the variable. The status of each of the radwaste treatment methods used in the case studies is discussed.

  4. Correlation of radioactive waste treatment costs and the environmental impact of waste effluents in the nuclear fuel cycle: fabrication of high-temperature gas-cooled reactor fuel containing uranium-233 and thorium

    Energy Technology Data Exchange (ETDEWEB)

    Roddy, J.W.; Blanco, R.E.; Hill, G.S.; Moore, R.E.; Seagren, R.D.; Witherspoon, J.P.

    1976-06-01

    A cost/benefit study was made to determine the cost and effectiveness of various radioactive waste (radwaste) treatment systems for decreasing the release of radioactive materials from model High-Temperature Gas-Cooled (HTGR) fuel fabrication plants and to determine the radiological impact (dose commitment) of the released materials on the environment. The study is designed to assist in defining the term ''as low as reasonably achievable'' as it applies to these nuclear facilities. The base cases of the two model plants, a fresh fuel fabrication plant and a refabrication plant, are representative of current proposed commercial designs or are based on technology that is being developed to fabricate uranium, thorium, and graphite into fuel elements. The annual capacities of the fresh fuel plant and the refabrication plant are 450 and 245 metric tons of heavy metal (where heavy metal is uranium plus thorium), as charged to about fifty 1000-MW(e) HTGRs. Additional radwaste treatment systems are added to the base case plants in a series of case studies to decrease the amounts of radioactive materials released and to reduce the radiological dose commitment to the population in the surrounding area. The capital and annual costs for the added waste treatment operations and the corresponding reductions in dose commitments are calculated for each case. In the final analysis, the cost/benefit of each case, calculated as additional cost of radwaste system divided by the reduction in dose commitment, is tabulated or the dose commitment is plotted with cost as the variable. The status of each of the radwaste treatment methods is discussed. 48 figures, 74 tables.

  5. Structural and mechanistic analysis of trichodiene synthase using site-directed mutagenesis: probing the catalytic function of tyrosine-295 and the asparagine-225/serine-229/glutamate-233-Mg2+B motif.

    Science.gov (United States)

    Vedula, L Sangeetha; Jiang, Jiaoyang; Zakharian, Tatiana; Cane, David E; Christianson, David W

    2008-01-15

    Trichodiene synthase from Fusarium sporotrichioides contains two metal ion-binding motifs required for the cyclization of farnesyl diphosphate: the "aspartate-rich" motif D(100)DXX(D/E) that coordinates to Mg2+A and Mg2+C, and the "NSE/DTE" motif N(225)DXXSXXXE that chelates Mg2+B (boldface indicates metal ion ligands). Here, we report steady-state kinetic parameters, product array analyses, and X-ray crystal structures of trichodiene synthase mutants in which the fungal NSE motif is progressively converted into a plant-like DDXXTXXXE motif, resulting in a degradation in both steady-state kinetic parameters and product specificity. Each catalytically active mutant generates a different distribution of sesquiterpene products, and three newly detected sesquiterpenes are identified. In addition, the kinetic and structural properties of the Y295F mutant of trichodiene synthase were found to be similar to those of the wild-type enzyme, thereby ruling out a proposed role for Y295 in catalysis.

  6. Crystal structure of (2R*,3aR*)-2-phenyl­sulfonyl-2,3,3a,4,5,6-hexa­hydro­pyrrolo­[1,2-b]isoxazole

    Science.gov (United States)

    Hernández, Yaiza; Marcos, Isidro; Garrido, Narciso M.; Sanz, Francisca; Diez, David

    2017-01-01

    The title compound, C12H15NO3S, was prepared by 1,3-dipolar cyclo­addition of 3,4-di­hydro-2H-pyrrole 1-oxide and phenyl vinyl sulfone. In the mol­ecule, both fused five-membered rings display a twisted conformation. In the crystal, C—H⋯O hydrogen bonds link neighbouring mol­ecules, forming chains running parallel to the b axis. PMID:28083143

  7. 3-Benzyl-7-chloro-9-phenyl-2-tosyl-2,3,3a,4,9,9a-hexahydro-1H-pyrrolo[3,4-b]quinoline

    Directory of Open Access Journals (Sweden)

    Hoong-Kun Fun

    2009-12-01

    Full Text Available In the title compound, C31H29ClN2O2S, the pyrrolidine ring adopts an envelope conformation with the methine C atom adjacent to the NH group as the flap atom. The tetrahydropyridine ring has a half-chair conformation. The two rings are trans-fused. The chlorobenzene ring and the adjacent phenyl ring form a dihedral angle of 77.9 (1°. The benzyl phenyl and the tosyl phenyl rings are oriented at a dihedral angle of 88.0 (1°. In the crystal, molecules are linked into chains along the a axis by N—H...Cl and C—H...Cl hydrogen bonds and the adjacent chains are cross-linked via C—H...π interactions.

  8. Crystal Structure and Photochromism in Paint of 1,3,3-Trimethyl-6'-dihydro-indolinyl-spiro[2,3'-[3H]-naphtho[2,1-b][1,4

    Institute of Scientific and Technical Information of China (English)

    TAN Ting-Feng

    2007-01-01

    The title compound 2 (C30H27N3O, Mr = 445.55) has been synthesized and its structure was determined by X-ray crystallography method. The crystal is of monoclinic, space group P21/c with a = 17.520(15), b = 8.640(7), c = 15.439(13) (A), ( = 98.642(14)(, V = 2310(3) (A)3, Dc = 1.281 g/cm3, ( = 0.780 mm(1, F(000) = 944, Z = 4, the final R = 0.0671 and wR = 0.1790 for 1952 observed reflections with Ⅰ > 2σ(Ⅰ). X-ray analysis revealed that the interatomic distance of C(20)(O(1) is 1.464(4) (A), longer than that of the normal C(O bond (1.41~1.43(A)) in the six-membered heterocycle, but this kind of change coincides with other spiro compounds. The six-membered heterocycle containing spiro Csp3(O is nonplanar. The UV-vis spectra of the title compound in polymer films showed that it exhibits excellent photochromic property.

  9. (S-4-[(3aR,4S,7aR-4-Methoxy-6-methyl-3-methylene-2-oxo-2,3,3a,4,7,7a-hexahydrobenzofuran-5-yl]pentyl Acetate

    Directory of Open Access Journals (Sweden)

    Xin Guo

    2016-03-01

    Full Text Available A new etherified 1-O-acetylbritannilactone (ABL analogue 2 was semi-synthesized by a mild etherification reaction. The structure of the newly synthesized analogue was identified by 1H-NMR, 13C-NMR and HR-ESI-MS analysis. 2 exhibited similar cytotoxicity against HCT116, SGC-7901 and HeLa human cancer cell lines with ABL.

  10. DE MIGUEL GONZÁLEZ, R. y DONERT, K. (EDITORES (2014 Innovative Learning Geography in Europe: New Challenges for the 21st Century. Cambridge Scholars Publishing. 233 pp. ISBN (13: 978-1-4438-5508-2.

    Directory of Open Access Journals (Sweden)

    María Luisa Gómez Ruiz

    2014-12-01

    Full Text Available   Este libro editado por los profesores Rafael de Miguel y Karl Donert muestra un gran abanico de posibilidades para aprender geografía desarrollando métodos y técnicas innovadoras propias de las oportunidades que ofrece el siglo XXI. El alcance de todas ellas es cada vez más amplio gracias a las nuevas y emergentes tecnologías que favorecen cada vez más el acceso a la información geográfica o geoinformación y a los recursos geo-media. 

  11. JUAN M. LOPE BLANCH. El habla de Diego de Ordaz. Contribución a la historia del español americano. México, UNAM. 1985. 233 p.

    Directory of Open Access Journals (Sweden)

    J. L. R.

    1988-06-01

    Full Text Available Este libro reúne los trabajos publicados por Lope Blanch en revistas especializadas y homenajes académicos acerca del idiolecto de este importante americano nacido en tierras leonesas hacia 1480, colonizador de las Antillas, expedicionario a Tierra Firme y a Cuba, conquistador de México y explorador del Orinoco. La base documental está constituida por siete cartas autógrafasque L.B. publica al final del libro en una cuidadosa transcripción que corrige defectos de una edición anterior.

  12. The behaviour of Eu, Pu, Am radionuclide at burning radioactive graphite in an oxygen atmosphere. Computer experiments

    Directory of Open Access Journals (Sweden)

    Kolbin T.S.

    2015-01-01

    Full Text Available Be means of the method of computer thermodynamic simulation we studied the behaviour of the europium, plutonium and americium from the combustion of radioactive graphite in oxygen. Europe is in the form of condensed EuOCl, Eu2O3 and vapour EuO. Pluto is in the form of condensed vapour PuO2 and PuO2. Americium is a condensed AmO2, Am2O3 and vapour Am. The basic reactions occurring compounds with europium, plutonium and americium. Equilibrium constants of the reactions have been determined.

  13. Rubbia proposes a speedier voyage to Mars and back

    CERN Multimedia

    Abbott, A

    1999-01-01

    Carlo Rubbia has designed a propulsion engine that uses fission fragments of americium to directly heat a propulsion gas. He estimates it would allow a manned trip to Mars and back in around a year (8 paragraphs).

  14. Filgrastim (Neupogen)

    Science.gov (United States)

    ... CRC) Simulation Tools Isotopes Americium-241 (Am-241) Cesium-137 (Cs-137) Radioisotope Brief Toxicology FAQs Cobalt- ... a drug that has been used successfully for cancer patients to stimulate the growth of the white ...

  15. Literatuuronderzoek plutoniumanalyses

    NARCIS (Netherlands)

    Glastra P; Kwakman PJM; LSO

    1997-01-01

    Dit rapport beschrijft de laatste ontwikkelingen in de radiochemische bepaling van plutonium in monstermatrices zoals luchtstoffilters, regenwater, gras en bodem. De radiochemische scheiding van plutonium van storende alfastralers, zoals americium en curium, is door de recente ontwikkeling van spec

  16. Study of the properties of the Am-O system in view of the transmutation of Am 241 in fast reactors; Etude des proprietes du systeme Am-O en vue de la transmutation de l`americium 241 en reacteur a neutrons rapides

    Energy Technology Data Exchange (ETDEWEB)

    Casalta, S.

    1996-04-01

    To reduce the long term toxicity of Am 241 it was considered to transmute this isotope in fast reactor. The first part of this thesis is an introduction at this problem. In the second part we give the experimental techniques used for the realisation of an AmO{sub 2}-MgO target (powder metallurgy under inert, oxidizing or reducing atmosphere). The properties of the Am-O system has been analyzed by X diffraction, thermodynamic and ceramography, in the Am{sub 2}O{sub 3}-AmO{sub 2} field. In the third part we study the external exposure risk created by the manufacturing of this target and in the last part the behavior of this target in a fast reactor. 66 refs., 28 figs., 25 tabs., 1 append.

  17. Methodology for the Inventory and Assessment of Americium Contamination Level in 1987 in an Area of Palomares Contaminated with Plutonium Weapon Grade; Estimacion del Contenido de Americio Existente en el Ano 1987 en una Zona de Palomares Contaminada en 1966 por Material de Plutonio Grado Bomba

    Energy Technology Data Exchange (ETDEWEB)

    Espinosa, A.; Aragon, A.; Cruz de la, B.

    2001-07-01

    This paper presents a methodology applied for the assessment of the ''241 Am coming from the decay of ''241 Pu isotope content in a contaminated area of Palomares, where the clean-up work done in 1966, given the negligible agricultural importance of such area at the time and its geographical characteristics, was not of the same magnitude as for the rest of the region. (Author) 4 refs.

  18. AM(VI) partitioning studies. FY14 final report

    Energy Technology Data Exchange (ETDEWEB)

    Mincher, Bruce J. [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2014-10-01

    The use of higher oxidation states of americium in partitioning from the lanthanides is under continued investigation by the sigma team. This is based on the hypothesis that Am(VI) can be produced and remain stable in irradiated first cycle raffinate solution long enough to perform solvent extraction for separations. The stability of Am(VI) to autoreduction was measured using millimolar americium concentrations in a 1-cm cell with a Cary 6000 UV/Vis spectrophotometer for data acquisition. At millimolar americium concentrations, Am(VI) is stable enough against its own autoreduction for separations purposes. A second major accomplishment during FY14 was the hot test. Americium oxidation and extraction was performed using a centrifugal contactor-based test bed consisting of an extraction stage and two stripping stages. Sixty-three percent americium extraction was obtained in one extraction stage, in agreement with batch contacts. Promising electrochemical oxidation results have also been obtained, using terpyridine ligand derivatized electrodes for binding of Am(III). Approximately 50 % of the Am(III) was oxidized to Am(V) over the course of 1 hour. It is believed that this is the first demonstration of the electrolytic oxidation of americium in a non-complexing solution. Finally, an initial investigation of Am(VI) extraction using diethylhexylbutyramide (DEHBA) was performed.

  19. Application of a gamma spectroscopy system to the measurement of neutron cross sections necessary to the development of nuclear energy; Mise au point d'un systeme de spectroscopie pour mesurer des sections efficaces neutroniques applicables a un possible developpement du nucleaire comme source d'energie

    Energy Technology Data Exchange (ETDEWEB)

    Deruelle, O

    2002-09-01

    This work concerns the development of nuclear energy and nuclear waste management in particular. Two parts of this study can be distinguished. In the first part (theoretical), a thorium-plutonium fuel based on MOX and dedicated for PWR was investigated in order to transmute plutonium in a potentially low waste fuel cycle. It was shown that this type of fuel is not regenerative but could be used for a transition to the industrial thorium fuel cycle without building new reactors. Thanks to moderated neutron spectra and high loaded actinide mass in the core, U-233 is quickly created ({approx}300 kg/y) for a loss of about {approx}1200 kg of fissile plutonium. In the second part (experimental), we have developed and built a new reaction chamber to measure neutron cross sections of actinides by alpha-gamma spectroscopy. This experimental device (in principle transportable) was commissioned in the high flux reactor of ILL Grenoble. Neutron flux was measured by gamma spectroscopy of irradiated Al and Co samples and was found to be of the order of 6,0. 10{sup 14} n.cm{sup -2}.s{sup -1} (4%). By the irradiation of 11{mu}g of Am-243 and Pu-242, corresponding capture cross sections were measured in the thermal neutron flux at 50 deg C. These are the results: {sup 243}Am(n,{gamma}) {sup 244fond.}Am = 4,72{+-}1,42b; {sup 243}Am(n,{gamma}) {sup 244total}Am = 74,8{+-}3,25b; {sup 242}Pu (n,{gamma}){sup 243}Pu = 22,7{+-}1,09b. Uncertainties of the measurements are mostly due to the determination of the neutron flux, efficiency of the electronics and ambiguities related to the definition of the area under {alpha}-{gamma} spectra. Although our measured cross sections deviate (by 10-30%) from the corresponding values widely used in evaluated data libraries such as ENDF, JEF and JENDL, in this work we have demonstrated the feasibility and principle of our experimental method. Furthermore, the value for the 243-americium capture cross-section is in very good agreement with the last two

  20. On the transmutation of Am in a fast lead-cooled system

    Indian Academy of Sciences (India)

    B P Kochurov; V N Konev; A Yu Kwaretzkheli

    2007-02-01

    Characteristics of the equilibrium fuel cycle for the core or a blanket of ADS having the structure of the core of a fast lead-cooled reactor of type BREST (Russian abbreviation for `Bystryy Reaktor so Svintsovym Teplonositelem') in a mode of americium transmutation are calculated. Americium loading was taken 5% of heavy atoms. Keeping the average multiplication factor the same as in a standard equilibrium cycle, reactivity swing over 1 year's microcycle is about 1%, that demands partial fuel reloading with a periodicity of about one month. For one year of operation, 61 kg of americium is destroyed, and due to increased 238Pu content, americium is mainly converted to fission products. Thus in a system of 1 GWt (thermal), 87 kg of americium can be transmuted yearly. The estimate of the reactivity void effect has shown that it increases to 0.6% almost linearly with the void fraction increasing up to 25% and reaches its maximum of 0.7% at a void fraction of about 50%. Application of similar strategy for ADS with a sub-criticality level ≈ 0.96–0.98 can essentially relax safety problems related to positive void effects.

  1. Porous metal oxide microspheres from ion exchange resin

    Science.gov (United States)

    Picart, S.; Parant, P.; Caisso, M.; Remy, E.; Mokhtari, H.; Jobelin, I.; Bayle, J. P.; Martin, C. L.; Blanchart, P.; Ayral, A.; Delahaye, T.

    2015-07-01

    This study is devoted to the synthesis and the characterization of porous metal oxide microsphere from metal loaded ion exchange resin. Their application concerns the fabrication of uranium-americium oxide pellets using the powder-free process called Calcined Resin Microsphere Pelletization (CRMP). Those mixed oxide ceramics are one of the materials envisaged for americium transmutation in sodium fast neutron reactors. The advantage of such microsphere precursor compared to classical oxide powder is the diminution of the risk of fine dissemination which can be critical for the handling of highly radioactive powders such as americium based oxides and the improvement of flowability for the filling of compaction chamber. Those millimetric oxide microspheres incorporating uranium and americium were synthesized and characterizations showed a very porous microstructure very brittle in nature which occurred to be adapted to shaping by compaction. Studies allowed to determine an optimal heat treatment with calcination temperature comprised between 700-800 °C and temperature rate lower than 2 °C/min. Oxide Precursors were die-pressed into pellets and then sintered under air to form regular ceramic pellets of 95% of theoretical density (TD) and of homogeneous microstructure. This study validated thus the scientific feasibility of the CRMP process to prepare bearing americium target in a powder free manner.

  2. Facilities for preparing actinide or fission product-based targets

    CERN Document Server

    Sors, M

    1999-01-01

    Research and development work is currently in progress in France on the feasibility of transmutation of very long-lived radionuclides such as americium, blended with an inert medium such as magnesium oxide and pelletized for irradiation in a fast neutron reactor. The process is primarily designed to produce ceramics for nuclear reactors, but could also be used to produce targets for accelerators. The Actinide Development Laboratory is part of the ATALANTE complex at Marcoule, where the CEA investigates reprocessing, liquid and solid waste treatment and vitrification processes. The laboratory produces radioactive sources; after use, their constituents are recycled, notably through R and D programs requiring such materials. Recovered americium is purified, characterized and transformed for an experiment known as ECRIX, designed to demonstrate the feasibility of fabricating americium-based ceramics and to determine the reactor transmutation coefficients.

  3. Gclust Server: 167302 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 167302 Bsu_BSU37430=albG Cluster Sequences - 233 antilisterial bacteriocin (subtilo...lbG Link to cluster sequences Cluster Sequences Link to related sequences - Sequence length 233 Representative annotation antilisteri

  4. GETDB: 113397 [GETDB

    Lifescience Database Archive (English)

    Full Text Available titute of Genetics. FM7c Link to clone table - 1 233 Link to cluster table 233 1 Request - interesting epi s...lusters 1 Stock Request Request - Embryonic Expression interesting epi stripes (S

  5. Recovery of trans-plutonium elements; Recuperation des elements transplutoniens

    Energy Technology Data Exchange (ETDEWEB)

    Espie, J.Y.; Poncet, B.; Simon, A. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

    1970-07-01

    The object of this work is to study the recovery of americium and curium from the fission-product solution obtained from the processing of irradiated fuel elements made of natural metallic uranium alloyed with aluminium, iron and silicon; these elements have been subjected to an average irradiation of 4000 MW days/ton in a gas-graphite type reactor having a thermal power of 3.7 MW/ton of uranium. The process used consists of 3 extraction cycles and one americium-curium separation: - 1) extraction cycle in 40 per cent TBP: extraction of actinides and lanthanides; elimination of fission products; - 2) extraction cycle in 8 per cent D2EHPA: decontamination from the fission products, decontamination of actinides from lanthanides; - 3) extraction cycle in 40 per cent TBP: separation of the complexing agent and concentration of the actinides; - 4) americium-curium separation by precipitation. (authors) [French] Cette etude a pour objet, la recuperation de l'americium et du curium de la solution de produits de fission provenant du traitement de combustibles irradies a base d'uranium naturel metallique allie a l'aluminium, le fer, et le silicium, et ayant subi une irradiation moyenne de 4000 MWj/t dans une pile du type graphite-gaz, dont la puissance thermique est de 3.7 MW/t d'uranium. Le procede utilise comprend 3 cycles d'extraction et une separation americium-curium: - 1. cycle d'extraction dans le TBP a 40 pour cent: extraction des actinides et des lanthanides, elimination des produits de fission; - 2. cycle d'extraction dans le D2EHPA a 8 pour cent: decontamination en produits de fission, decontamination des actinides en lanthanides; - 3. cycle d'extraction dans le TBP a 40 pour cent: separation du complexant et concentration des actinides; - 4. separation americium-curium par precipitation. (auteurs)

  6. Colloid formation during waste form reaction: implications for nuclear waste disposal

    Science.gov (United States)

    Bates, J. K.; Bradley, J.; Teetsov, A.; Bradley, C. R.; ten Brink, Marilyn Buchholtz

    1992-01-01

    Insoluble plutonium- and americium-bearing colloidal particles formed during simulated weathering of a high-level nuclear waste glass. Nearly 100 percent of the total plutonium and americium in test ground water was concentrated in these submicrometer particles. These results indicate that models of actinide mobility and repository integrity, which assume complete solubility of actinides in ground water, underestimate the potential for radionuclide release into the environment. A colloid-trapping mechanism may be necessary for a waste repository to meet long-term performance specifications.

  7. Book Review of: FRANCESCO BERTO. There's Something about Godel. Malden, Mass., and Oxford: Wiley-Blackwell, 2009. ISBN 978-1-4051-9766-3 (hbk); 978-1-4051-9767-0 (pbk). Pp. xx + 233. English translation of Tutti pazzi per Godel! (Rome: Gius, Laterza & Figli, 2008)

    OpenAIRE

    McGee, Vann

    2011-01-01

    There's Something about Godel is a bargain: two books in one. The first half is a gentle but rigorous introduction to the incompleteness theorems for the mathematically uninitiated. The second is a survey of the philosophical, psychological, and sociological consequences people have attempted to derive from the theorems, some of them quite fantastical.

  8. Canadian Healthcare Practitioners’ Access to Evidence Based Information Is Inequitable. A Review of: Chatterley, T., Storie, D., Chambers, T., Buckingham, J., Shiri, A., & Dorgan, M. (2012. Health information support provided by professional associations in Canada. Health Information & Libraries Journal, 29(3, 233-241.

    Directory of Open Access Journals (Sweden)

    Maria Melssen

    2013-06-01

    Full Text Available Objective – To determine what services and resources are available to health professionals through national Canadian and Alberta based health professional associations and licensing colleges and if those resources and services are being used. Also, to assess the associations’ perceptions of what resources and services Canadian health professionals actually need and if those needs are being met, membership satisfaction with the resources and services provided, and challenges the associations have with providing resources and services.Design – Structured telephone interview.Setting – Health professional associations and licensing colleges in Canada.Subjects – 23 health professional associations: 9 Alberta-based associations and 14 national-level professional associations and licensing colleges.Methods – A librarian, communications officer, or another individual in a comparable position at each association was invited via email to participate in the study. Individuals willing to participate in the interview were emailed the interview questions in advance. Telephone interviews were conducted in July and August of 2009. For those who did not respond to the email request or who did not wish to participate in the interviews, information was collected from the association’s website.Main Results – Of the 23 contacted associations 12 agreed to be interviewed: less than 50% response rate. Data was collected from websites of seven associations that either declined to be interviewed or did not respond to the authors’ email request. Data were unavailable for four associations due to data being in members only sections of the websites. Data were analyzed both qualitatively and quantitatively.Resources and services provided by the associations and licensing colleges range from none to reference services provided by a librarian and access to licensed databases.None of the three licensing colleges or the two provincial associations interviewed maintains usage statistics or surveys their members. Nor do they grant access to licensed databases or offer information services, such as having a librarian or other information professional available to answer reference questions or to perform mediated literature searches. The two provincial associations and the three licensing colleges interviewed do supply information pertinent to health professionals, for example insurance information and funding.Seven national associations were interviewed: two permit access to databases developed by that association and three grant access to licensed databases such as Medline. All seven national associations provide access to journals (four of the seven only provide access to their own association’s journal and five offer information services. Four maintain usage statistics and five survey their members.Of the seven associations not interviewed, none grant access to licensed databases and one permits access to databases developed by that association. Five provide access to their own association’s journal and one provides book loans. Only one offers information services. Cost and the priority to provide resources to staff over members are barriers when trying to provide association members’ services and resources.Conclusion – Health professionals’ access to health information varies depending on the professional’s area of specialization, location in Canada, and particular association memberships. There is no consistency as to what health information is available to all health professionals in Canada, specifically Alberta. The majority of the associations do not provide resources and services, nor do they survey members to assess their usage, desires, needs, or satisfaction with resources and services. Usage rates are low for the associations that do track resource and service usage.A resource list of freely available online health information should be generated to mitigate existing disparities without accruing additional cost factors. Also, a partnership between hospital and academic libraries with various ass

  9. A visibilidade e representação social das religiões nos selos postais brasileiros (The visibility and social representations of religions in Brazil postage stamps.DOI: 10.5752/P.2175-5841.2012v10n25p233

    Directory of Open Access Journals (Sweden)

    Diego Andres Salcedo

    2012-03-01

    Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 Este trabalho analisa a forma com a qual o selo postal brasileiro contribuiu para a construção de representações da religião católica em relação a outras práticas religiosas. Foi considerado, para isso, a concepção deste artefato enquanto media, texto semiótico e sua estreita relação com o discurso religioso. O corpus é composto por selos postais comemorativos brasileiros emitidos durante o século XX. A sua identificação e análise foi feita a partir do catálogo RHM. Entre o ano de 1900 e 2000, os Correios emitiram 2354 selos postais do tipo comemorativo. A partir da observação e identificação de recorrências religiosas foram compilados 222 selos postais comemorativos. O estudo correlacionou a recorrente temática religiosa com o contexto histórico brasileiro, considerando o declínio do catolicismo como maioria religiosa no país e às representações das práticas religiosas nas mídias. A conclusão indica a influência da Conferência Nacional dos Bispos do Brasil, junto ao Ministério das Comunicações e dos Correios do Brasil, consagrando e enaltecendo a visibilidade de personalidades, eventos e a práxis católica, como um discurso único e superior às demais práticas religiosas. Normal 0 21 false false false MicrosoftInternetExplorer4 Abstract This paper analyses the way in which postal Brazilian stamps have contributed to the construction of representations of the catholic religion regarding other religious practices. In this sense, the conception of these stamps was taken into account as media, semioptical texts in close relation with the religious speech. The corpus is composed by postal commemorative Brazilian stamps issued during the twentieth century. The identification and analyzes of the stamps were made through RHM catalogue.  Between the year of 1900 and 2000, the Brazilian post offices issued 2.354 commemorative postage stamps. From the observation and identification of religious recurrences 222 commemorative stamps were compiled. The study correlated the recurring religious theme with the historical Brazilian context, taking into account the decline of the Catholicism as the major religion in Brazil and also the representations of the religious practices in the media. The conclusion of this paper indicates the influence of the National Conference of the Bishops of Brazil regarding the Ministry of the Communications, establishing and enforcing the visibility of Brazilian personalities, events, and also of catholic practices taken as special and superior in comparison with other religious practices.Key-words: Brazil; Religion; Postage Stamps; Social Representation; Visibility.

  10. International Electronic Journal of Elementary Educ ation, 2013, 5(3, 233-248. ISSN:1307 9298 Copyright © IEJEE www.iejee.com Relationship among Students’ Attitudes, Intentions and Behaviors towards the Inclusion of Peers with Disabilities, in Mainstream Physical Education Classes

    Directory of Open Access Journals (Sweden)

    Evangelos BEBETSOS

    2013-07-01

    Full Text Available Students’ attitudes, intentions and behaviours towards their peers with disabilities are important to their mutual co existence and development. The aim of this study was to investigate a whetherstudents’ attitudes and intentions towards their schoolmates with disabilities are related to their general and modified behavior in mainstream physical education classes, and b if the former variables could serve as predictors of the latter. The participants, 172 children without disabilities(Mage=11.15,SD=.70, completed the revised version of the Planned Behavior Theory questionnaire(PBT and the Children’s’ Attitudes towards Inclusion in Physical Education – Revised questionnaire(CAIPE R. Although results revealed several correlations among the variables under study, only general attitudes accounted for both general and modified behavior, and attitudes for modified behavior. These findings could assist in educating students to develop and perform appropriate behaviours towards their peers in order to facilitate their co existence, and their mutual developmentand learning.

  11. meso-4,4′-Dimethoxy-2,2′-{[(3aR,7aS-2,3,3a,4,5,6,7,7a-octahydro-1H-benzimidazole-1,3-diyl]bis(methylene}diphenol

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2013-07-01

    Full Text Available The title compound, C23H30N2O4, a di-Mannich base derived from 4-methoxyphenol and cis-1,2-diaminecyclohexane, has a perhydrobenzimidazolidine nucleus, in which the cyclohexane ring adopts a chair conformation and the heterocyclic ring has a half-chair conformation with a C—N—C—C torsion angles of −48.14 (15 and −14.57 (16°. The mean plane of the heterocycle makes dihedral angles of 86.29 (6 and 78.92 (6° with the pendant benzene rings. The molecular structure of the title compound shows the presence of two interactions between the N atoms of the imidazolidine ring and the hydroxyl groups through intramolecular O—H...N hydrogen bonds with graph-set motif S(6. The unobserved lone pairs of the N atoms are presumed to be disposed in a syn conformation, being only the second example of an exception to the typical `rabbit-ears' effect in 1,2-diamines.

  12. 4,4′-Diiodo-2,2′-[(3aR,7aR-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diylbis(methylene]diphenol

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2011-09-01

    Full Text Available In the crystal structure of the title compound, C21H24I2N2O2, the two N atoms of the imidazolidine moiety are linked to the hydroxy groups by intramolecular O—H...N hydrogen-bonding interactions. The cyclohexane ring adopts a chair conformation and the heterocyclic ring to which it is fused has a twisted envelope conformation.

  13. Dimethyl 4,4′-dihydroxy-3,3′-{[(3aRS,7aRS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diyl]bis(methylene}dibenzoate

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2011-11-01

    Full Text Available The title compound, C25H30N2O6, has the imidazolidine ring in an envelope conformation. There are two intramolecular O—H...N hydrogen-bond interactions with graph-set motif S(6. The cyclohexane ring adopts a slightly distorted chair conformation. One methyl carboxylate substituent forms a dihedral angle of 12.00 (5° with the plane of the benzene ring, while the other methyl carboxylate group is almost coplanar, making a dihedral angle of 2.26 (9°. In the crystal, pairs of intermolecular C—H...O hydrogen bonds form racemic dimers, corresponding to an R22(18 graph-set motif. Further weak C—H...O interactions generate a chain running along the c axis.

  14. Di-n-propyl 4,4′-dihydroxy-3,3′-{[(3aRS,7aRS-2,3,3a,4,5,6,7,7a-octahydro-1H-benzimidazole-1,3-diyl]bis(methylene}dibenzoate

    Directory of Open Access Journals (Sweden)

    Karla Fejfarová

    2011-10-01

    Full Text Available The title compound, C29H38N2O6, was prepared as model for studying intramolecular hydrogen-bonding interactions. Molecules of the title compound are located on a crystallographic twofold rotation axis, which passes through the C atom linked to the two N atoms on the imidazolidine ring. The molecular structure shows the existence of two intramolecular O—H...N hydrogen-bonding interactions between the two N atoms of the imidazolidine moiety and the hydroxy groups in the aromatic rings. The crystal structure shows the strain of ring fusion in the perhydrobenzimidazole moiety according to the endocyclic bond angles and the torsion angles, which evidence a puckering of the cyclohexane ring with respect to normal tetrahedral bond angles in an ideal chair conformation.

  15. 4,4′-Dimethoxy-2,2′-{[(3aRS,7aRS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diyl]bis(methylene}diphenol

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2011-09-01

    Full Text Available The title compound, C23H30N2O4, is a Mannich base useful for studying the effect of an electron-donating phenol substituent on intramolecular hydrogen bonding. In the molecular structure, the cyclohexane ring adopts a chair conformation and the five-membered ring has a twisted envelope conformation. Each methoxy group is oriented in the same plane of the respective aromatic ring, showing torsion angles below 11.8 (3° and bond angles between the methoxy group and the aromatic ring of 116.6 (2 and 116.6 (1°. The structure shows interactions between two the N atoms of the heterocyclic ring and the hydroxy groups by intramolecular O—H...N hydrogen-bonding interactions. In the crystal, C—H...O interactions are observed. The crystal studied was a racemic mixture of RR and SS enantiomers.

  16. 4,4′-Dichloro-3,3′,5,5′-tetramethyl-2,2′-[(3aR,7aR/3aS,7aS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diylbis(methylene]diphenol

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2011-08-01

    Full Text Available In the title compound, C25H32Cl2N2O2, there are two intramolecular O—H... N hydrogen-bonding interactions between the hydroxy groups on the aromatic rings and the two N atoms of the heterocyclic group. The cyclohexane ring adopts a chair conformation and the imidazolidine unit to which it is fused has a twisted envelope conformation. The asymmetric unit comprises one half-molecule which is completed by a twofold rotation axis. A C—H...O interaction is observed in the crystal structure.

  17. 4,4′-Dibromo-2,2′-{[(3aS,7aS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diyl]bis(methylidene}diphenol

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2011-04-01

    Full Text Available The cyclohexane ring in the title compound, C21H24Br2N2O2, adopts a chair conformation and the five-membered ring to which it is fused has a twisted envelope conformation. The asymmetric unit contains one half-molecule, which is related to the other half by a twofold rotation axis. The two N atoms of the five-membered ring are linked to the hydroxy groups by intramolecular O—H...N hydrogen bonds. In the crystal, intermolecular C—H...O and C—H...π interactions occur.

  18. 4,4′-Dichloro-2,2′-[(3aR,7aR/3aS,7aS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diylbis(methylene]diphenol

    Directory of Open Access Journals (Sweden)

    Michal Dušek

    2010-10-01

    Full Text Available Molecules of the the title compound, C21H24Cl2N2O2, are located on a twofold rotation axis, which passes through the C atom linking the two N atoms. Two intramolecular O—H...N hydrogen bonds were observed. In the crystal, non-classical intermolecular C—H...O hydrogen bonds link the molecules into chains along the a axis. The crystal studied was a racemic twin.

  19. Diethyl 4,4′-dihydroxy-3,3′-{[(3aRS,7aRS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diyl]bis(methylene}dibenzoate

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2011-11-01

    Full Text Available The heterocyclic ring in the title compound, C27H34N2O6, has an envelope conformation on one of the bridgehead C atoms [Q(2 = 0.4487 (19 Å and ϕ = 291.3 (2°]. Two strong intramolecular O—H...N hydrogen bonds stabilize the molecular conformation. The benzoate groups differ in the relative orientations of the ethyl groups, as quantified by the values of the C—O—C—C torsion angles of −86.5 (2 and −178.97 (17°. The carbonyl groups are nearly coplanar with the benzene rings, forming C—C—C—O torsion angles of 0.9 (3 and 3.4 (3°. The crystal structure is stabilized by weak intermolecular C—H...O interactions.

  20. meso-4,4′-Difluoro-2,2′-{[(3aR,7aS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diyl]bis(methylene}diphenol

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2013-02-01

    Full Text Available In the crystal structure of the title compound, C21H24F2N2O2, there are two intramolecular O—H...N hydrogen bonds involving the N atoms of the imidazolidine ring and the hydroxy groups. The crystal studied was a meso compound obtained by the reaction of the aminal (2S,7R,11S,16R-1,8,10,17-tetraazapentacyclo[8.8.1.18,17.02,7.011,16]cosane with 4-fluorophenol. The imidazolidine ring has a twisted conformation with a CH—CH—N—CH2 torsion angle of 44.99 (14° and, surprisingly, the lone pairs of the N atoms are disposed in a syn isomerism, making the title compound an exception to the typical `rabbit-ear effect' in 1,2-diamines. In the crystal, molecules are linked via C—H...F hydrogen bonds, forming chains along the c-axis direction. These chains are linked via another C—H...F hydrogen bond, forming a three-dimensional network.

  1. Di-n-butyl 4,4′-dihydroxy-3,3′-{[(3aRS,7aRS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diyl]bis(methylene}dibenzoate

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2011-09-01

    Full Text Available The complete molecule of the title compound, C31H42N2O6, is generated by crystallographic twofold symmetry, with one C atom lying on the axis. The dihedral angle between the aromatic rings is 57.03 (6°. The central heterocyclic ring adopts a half-chair conformation. The molecular conformation is stabilized by two intramolecular O—H...N hydrogen bonds with the N atoms of the heterocyclic ring as the acceptors. In the crystal, molecules are linked into chains along the c axis by non-classical C—H...O hydrogen bonds.

  2. 4,4′-Difluoro-2,2′-{[(3aRS,7aRS-2,3,3a,4,5,6,7,7a-octahydro-1H-1,3-benzimidazole-1,3-diyl]bis(methylene]}diphenol

    Directory of Open Access Journals (Sweden)

    Augusto Rivera

    2011-06-01

    Full Text Available In the crystal structure of the title compound, C21H24F2N2O2, the two N atoms of the imidazolidine moiety are linked to the hydroxy groups by intramolecular O—H...N hydrogen-bonding interactions. The crystal studied was a racemic mixture of RR and SS enatiomers. The cyclohexane ring adopts a chair conformation and the imidazolidine group to which it is fused has a twisted envelope conformation.

  3. Commentary on "Goodacre R, Timmins ÉM, Rooney PJ, Rowland JJ, Kell DB: Rapid identification of Streptococcus and Enterococcus species using diffuse reflectance-absorbance Fourier transform infrared spectroscopy and artificial neural networks. FEMS Microbiol Lett 1996; 140:233-239", the most cited paper in the Journal for that year.

    Science.gov (United States)

    Goodacre, Royston; Kell, Douglas B

    2017-01-26

    This is an invited review/commentary by the first and last authors of a paper that was the most cited in FEMS Microbiology Letters for 1996, presently showing in excess of 150 citations at Web of Science, and over 200 at Google Scholar. It was the first paper in which diffuse-reflectance-absorbance FT-IR spectroscopy was used with a supervised learning method in the form of artificial neural networks, and showed that this combination could succeed in discriminating a series of closely related, clinically relevant, Gram-positive bacterial strains.

  4. Synthesis and Crystal Structure of (CH2)3(3, 5-Me2Pz)2·[PhBr2Sn(CH2)SnBr2Ph]·2HBr·2H2O (Pz = pyrazole)

    Institute of Scientific and Technical Information of China (English)

    王志宏; 唐良富; 柴建方; 王积涛; 王宏根

    2002-01-01

    The reaction of bis(dibromophenylstannyl)methane with 1, 3-bis(3, 5-dimethyl- pyrazol-1-yl)propane in a 1:1 or 1:2 ratio yields only 1:1 adduct which partly hydrolyzes to the title complex (C26H38Br6N4O2Sn2, Mr = 1155.42) during crystal growing. The title complex is of triclinic, space group P ī with a = 10.886(1), b = 12.508(1), c = 13.879(1) ?, α = 85.762(2), β = 85.159(2), γ = 84.020(2)°, V = 1868.8(4) ?3, Z = 2, Dc = 2.046 g/cm3, λ(MoKα) = 0.71073 ?, μ = 7.778 mm-1, F(000) = 1088, R = 0.0488 and wR = 0.1157 for 7560 observed reflections with I ≥ 2σ(I). The crystal structure analysis indicates that there is no direct interaction between the ligand and bis(dibromophenylstannyl)methane, and two tin atoms are bridged by two bromide atoms from the partial hydrolysis of this adduct.

  5. Dicty_cDB: AFF147 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available laevis retinoblastoma A as... 233 2e-60 (Q9W7I5) RecName: Full=Histone-binding protein RBBP4... Full=Histone-binding protein RBBP4-A; AltName:... 233 2e-60 ( Q09028 ) RecName: ...Full=Histone-binding protein RBBP4; AltName: F... 233 2e-60 (Q5M7K4) RecName: Full=Histone-binding protein RBBP4...; AltName: F... 233 2e-60 (Q6INH0) RecName: Full=Histone-binding protein RBBP4-B; AltName:... 233 2e-60

  6. Analysis Of 2H-Evaporator Scale Wall [HTF-13-82] And Pot Bottom [HTF-13-77] Samples

    Energy Technology Data Exchange (ETDEWEB)

    Oji, L. N.

    2013-09-11

    obtained at two different locations within the evaporator pot the major radioactive components (on a mass basis) in the additional radionuclide analyses were Sr-90, Cs-137 Np-237, Pu-239/240 and Th-232. Small quantities of americium and curium were detected in the blanks used for Am/Cm method for these radionuclides. These trace radionuclide amounts are assumed to come from airborne contamination in the shielded cells drying or digestion oven, which has been replaced. Therefore, the Am/Cm results, as presented, may be higher than the true Am/Cm values for these samples. These results are provided so that SRR can calculate the equivalent uranium-235 concentrations for the NCSA. Results confirm that the uranium contained in the scale remains depleted with respect to natural uranium. SRNL did not calculate an equivalent U-235 enrichment, which takes into account other fissionable isotopes U-233, Pu-239 and Pu-241. The applicable method for calculation of equivalent U-235 will be determined in the NCSA. With a few exceptions, a comparison of select radionuclides measurements from this 2013 2H evaporator scale characterization (pot bottom and wall scale samples) with those measurements for the same radionuclides in the 2010 2H evaporator scale analysis shows that the radionuclide analysis for both years are fairly comparable; the analyses results are about the same order of magnitude.

  7. Radiological analysis of materials sampled on the old nuclear test site of In Ekker (Algeria); Analyses radiologiques de materiaux preleves sur l'ancien site d'essais nucleaires d'In Ekker (Algerie)

    Energy Technology Data Exchange (ETDEWEB)

    Chareyron, Bruno

    2010-02-11

    After having recalled the context of the French nuclear test campaign in Algeria between 1961 and 1966, this document reports and comments radiological measurements performed on the site of In Ekker, and also results of analysis performed in laboratory (contamination by cesium 137, americium 241, plutonium); recommendations are given

  8. Historical Review of Californium-252 Discovery and Development

    Science.gov (United States)

    Stoddard, D. H.

    1985-01-01

    This paper discusses the discovery and history of californium 252. This isotope may be synthesized by irradiating plutonium 239, plutonium 242, americium 243, or curium 244 with neutrons in a nuclear reactor. Various experiments and inventions involving Cf conducted at the Savannah River Plant are discussed. The evolution of radiotherapy using californium 252 is reviewed. (PLG)

  9. Determination of Am-241 in lung and bone by gamma spectrometry with semiconductor detectors LEGe; Determinacion de Am- 241 en pulmon y hueso por espectrometria gamma con detectores de semiconductor LEGe

    Energy Technology Data Exchange (ETDEWEB)

    Perez Lopez, B.

    2014-07-01

    Americium is produced from neutron absorption plutonium atoms within nuclear reactors. The work of dismantling and decontamination of the installations and radioactive waste management makes workers exposed acquire risk of internal exposure and therefore can incorporate Am-241 in his body. (Author)

  10. Experimental findings on actinide recovery utilizing oxidation by peroxydisulfate followed by ion exchange: Fuel cycle research & development

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, D. T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Shehee, T. C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-08-31

    Our research seeks to determine if inorganic ion-exchange materials can be exploited to provide effective minor actinide (Am, Cm) separation from lanthanides. Previous work has established that a number of inorganic and UMOF ion-exchange materials exhibit varying affinities for actinides and lanthanides, which may be exploited for effective separations. During FY15, experimental work focused on investigating methods to oxidize americium in dilute nitric and perchloric acid with subsequent ion-exchange performance measurements of ion exchangers with the oxidized americium in dilute nitric acid. Ion-exchange materials tested included a variety of alkali titanates. Americium oxidation testing sought to determine the influence that other redox active components may have on the oxidation of AmIII. Experimental findings indicated that CeIII, NpV, and RuII are oxidized by peroxydisulfate, but there are no indications that the presence of CeIII, NpV, and RuII affected the rate or extent of americium oxidation at the concentrations of peroxydisulfate being used.

  11. 10 CFR Appendix E to Part 20 - Nationally Tracked Source Thresholds

    Science.gov (United States)

    2010-01-01

    ... Category 1(TBq) Category 1(Ci) Category 2(TBq) Category 2(Ci) Actinium-227 20 540 0.2 5.4 Americium-241 60... 2 54 Strontium-90 1,000 27,000 10 270 Thorium-228 20 540 0.2 5.4 Thorium-229 20 540 0.2 5.4...

  12. Literatuuronderzoek plutoniumanalyses

    NARCIS (Netherlands)

    Glastra P; Kwakman PJM; LSO

    1997-01-01

    This report describes recent developments in the radiochemical determination of plutonium in samples from the environment such as aerosols, rainwater, grass and soil. The radiochemical separation of plutonium from interfering alpha emitters, such as americium and curium, was found to be simplified b

  13. Discovery of Isotopes of the Transuranium Elements with 93 <= Z <= 98

    CERN Document Server

    Fry, C

    2012-01-01

    One hundred and five isotopes of the transuranium elements neptunium, plutonium, americium, curium, berkelium and californium have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  14. Presence and Character of the 5f Electrons in the Actinide Metals

    DEFF Research Database (Denmark)

    Johansson, B.; Skriver, Hans Lomholt; Mårtensson, N.;

    1980-01-01

    The sensitivity of the Image level binding energy to the occupation of the 5f orbital is pointed out and used to demonstrate the presence of 5f electrons in the uranium metal. It is suggested that the valence band spectrum of uranium might contain satellites originating from excitations to locali...... and the critical separation is found to take place between plutonium and americium....

  15. Experimental findings on actinide recovery utilizing oxidation by peroxydisulfate followed by ion exchange: Fuel cycle research & development

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, D. T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Shehee, T. C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-08-31

    Our research seeks to determine if inorganic ion-exchange materials can be exploited to provide effective minor actinide (Am, Cm) separation from lanthanides. Previous work has established that a number of inorganic and UMOF ion-exchange materials exhibit varying affinities for actinides and lanthanides, which may be exploited for effective separations. During FY15, experimental work focused on investigating methods to oxidize americium in dilute nitric and perchloric acid with subsequent ion-exchange performance measurements of ion exchangers with the oxidized americium in dilute nitric acid. Ion-exchange materials tested included a variety of alkali titanates. Americium oxidation testing sought to determine the influence that other redox active components may have on the oxidation of AmIII. Experimental findings indicated that CeIII, NpV, and RuII are oxidized by peroxydisulfate, but there are no indications that the presence of CeIII, NpV, and RuII affected the rate or extent of americium oxidation at the concentrations of peroxydisulfate being used.

  16. The prospect of uranium nitride (UN) and mixed nitride fuel (UN-PuN) for pressurized water reactor

    Science.gov (United States)

    Syarifah, Ratna Dewi; Suud, Zaki

    2015-09-01

    Design study of small Pressurized Water Reactors (PWRs) core loaded with uranium nitride fuel (UN) and mixed nitride fuel (UN-PuN), Pa-231 as burnable poison, and Americium has been performed. Pa-231 known as actinide material, have large capture cross section and can be converted into fissile material that can be utilized to reduce excess reactivity. Americium is one of minor actinides with long half life. The objective of adding americium is to decrease nuclear spent fuel in the world. The neutronic analysis results show that mixed nitride fuel have k-inf greater than uranium nitride fuel. It is caused by the addition of Pu-239 in mixed nitride fuel. In fuel fraction analysis, for uranium nitride fuel, the optimum volume fractions are 45% fuel fraction, 10% cladding and 45% moderator. In case of UN-PuN fuel, the optimum volume fractions are 30% fuel fraction, 10% cladding and 60% coolant/ moderator. The addition of Pa-231 as burnable poison for UN fuel, enrichment U-235 5%, with Pa-231 1.6% has k-inf more than one and excess reactivity of 14.45%. And for mixed nitride fuel, the lowest value of reactivity swing is when enrichment (U-235+Pu) 8% with Pa-231 0.4%, the excess reactivity value 13,76%. The fuel pin analyze for the addition of Americium, the excess reactivity value is lower than before, because Americium absorb the neutron. For UN fuel, enrichment U-235 8%, Pa-231 1.6% and Am 0.5%, the excess reactivity is 4.86%. And for mixed nitride fuel, when enrichment (U-235+Pu) 13%, Pa-231 0.4% and Am 0.1%, the excess reactivity is 11.94%. For core configuration, it is better to use heterogeneous than homogeneous core configuration, because the radial power distribution is better.

  17. Thorium and the Third Fuel

    Energy Technology Data Exchange (ETDEWEB)

    Dukert, Joseph M.

    1970-01-01

    This booklet discusses energy sources for nuclear power plants. Uranium-235 by itself will not be able to handle the energy needs. The two man-made supplements that can be used for nuclear power plants energy sources are plutonium and uranium-233. Uranium-233 is an isotope that appears as a result of radioactive decay after neutrons have been absorbed in thorium-232. This uranium-233 is called the third fuel.

  18. ß-Lysine discrimination by lysyl-tRNA synthetase

    DEFF Research Database (Denmark)

    Gilreath, Marla S; Roy, Hervé; Bullwinkle, Tammy J

    2011-01-01

    guided by the PoxA structure. A233S LysRS behaved as wild type with a-lysine, while the G469A and A233S/G469A variants decreased stable a-lysyl-adenylate formation. A233S LysRS recognized ß-lysine better than wildtype, suggesting a role for this residue in discriminating a- and ß-amino acids. Both...

  19. Domain Modeling: NP_055027.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_055027.1 chr12 Homeodomain d2hoaa_ chr12/NP_055027.1/NP_055027.1_apo_233-294.pdb... d1ahdp_ chr12/NP_055027.1/NP_055027.1_holo_233-294.pdb blast 233R,234K,235K,236R,237C,239Y,255V,256Y,257I,2

  20. Experimental Findings On Minor Actinide And Lanthanide Separations Using Ion Exchange

    Energy Technology Data Exchange (ETDEWEB)

    Hobbs, D. T.; Shehee, T. C.; Clearfield, A.

    2013-09-17

    This project seeks to determine if inorganic or hybrid inorganic ion-exchange materials can be exploited to provide effective americium and curium separations. Specifically, we seek to understand the fundamental structural and chemical factors responsible for the selectivity of the tested ion-exchange materials for actinide and lanthanide ions. During FY13, experimental work focused in the following areas: (1) investigating methods to oxidize americium in dilute nitric acid with subsequent ion-exchange performance measurements of ion exchangers with the oxidized americium and (2) synthesis, characterization and testing of ion-exchange materials. Ion-exchange materials tested included alkali titanates, alkali titanosilicates, carbon nanotubes and group(IV) metal phosphonates. Americium oxidation testing sought to determine the influence that other redox active components may have on the oxidation of Am(III). Experimental findings indicated that Pu(IV) is oxidized to Pu(VI) by peroxydisulfate, but there are no indications that the presence of plutonium affects the rate or extent of americium oxidation at the concentrations of peroxydisulfate being used. Tests also explored the influence of nitrite on the oxidation of Am(III). Given the formation of Am(V) and Am(VI) in the presence of nitrite, it appears that nitrite is not a strong deterrent to the oxidation of Am(III), but may be limiting Am(VI) by quickly reducing Am(VI) to Am(V). Interestingly, additional absorbance peaks were observed in the UV-Vis spectra at 524 and 544 nm in both nitric acid and perchloric acid solutions when the peroxydisulfate was added as a solution. These peaks have not been previously observed and do not correspond to the expected peak locations for oxidized americium in solution. Additional studies are in progress to identify these unknown peaks. Three titanosilicate ion exchangers were synthesized using a microwave-accelerated reaction system (MARS) and determined to have high affinities

  1. Fast Thorium Molten Salt Reactors started with Plutonium

    OpenAIRE

    Merle-Lucotte, E.; Heuer, D.; Le Brun, C.; Mathieu, L.; Brissot, R.; Liatard, E.; Méplan, O.; Nuttin, A.

    2006-01-01

    One of the pending questions concerning Molten Salt Reactors based on the 232Th/233U fuel cycle is the supply of the fissile matter, and as a consequence the deployment possibilities of a fleet of Molten Salt Reactors, since 233U does not exist on earth and is not yet produced in the current operating reactors. A solution may consist in producing 233U in special devices containing Thorium, in Pressurized Water or Fast Neutrons Reactors. Two alternatives to produce 233U are examined here: dire...

  2. Scoping Review of the Zika Virus Literature.

    Directory of Open Access Journals (Sweden)

    Lisa A Waddell

    Full Text Available The global primary literature on Zika virus (ZIKV (n = 233 studies and reports, up to March 1, 2016 has been compiled using a scoping review methodology to systematically identify and characterise the literature underpinning this broad topic using methods that are documented, updateable and reproducible. Our results indicate that more than half the primary literature on ZIKV has been published since 2011. The articles mainly covered three topic categories: epidemiology of ZIKV (surveillance and outbreak investigations 56.6% (132/233, pathogenesis of ZIKV (case symptoms/ outcomes and diagnosis 38.2% (89/233 and ZIKV studies (molecular characterisation and in vitro evaluation of the virus 18.5% (43/233. There has been little reported in the primary literature on ZIKV vectors (12/233, surveillance for ZIKV (13/233, diagnostic tests (12/233 and transmission (10/233. Three papers reported on ZIKV prevention/control strategies, one investigated knowledge and attitudes of health professionals and two vector mapping studies were reported. The majority of studies used observational study designs, 89.7% (209/233, of which 62/233 were case studies or case series, while fewer (24/233 used experimental study designs. Several knowledge gaps were identified by this review with respect to ZIKV epidemiology, the importance of potential non-human primates and other hosts in the transmission cycle, the burden of disease in humans, and complications related to human infection with ZIKV. Historically there has been little research on ZIKV; however, given its current spread through Australasia and the Americas, research resources are now being allocated to close many of the knowledge gaps identified in this scoping review. Future updates of this project will probably demonstrate enhanced evidence and understanding of ZIKV and its impact on public health.

  3. Scoping Review of the Zika Virus Literature.

    Science.gov (United States)

    Waddell, Lisa A; Greig, Judy D

    2016-01-01

    The global primary literature on Zika virus (ZIKV) (n = 233 studies and reports, up to March 1, 2016) has been compiled using a scoping review methodology to systematically identify and characterise the literature underpinning this broad topic using methods that are documented, updateable and reproducible. Our results indicate that more than half the primary literature on ZIKV has been published since 2011. The articles mainly covered three topic categories: epidemiology of ZIKV (surveillance and outbreak investigations) 56.6% (132/233), pathogenesis of ZIKV (case symptoms/ outcomes and diagnosis) 38.2% (89/233) and ZIKV studies (molecular characterisation and in vitro evaluation of the virus) 18.5% (43/233). There has been little reported in the primary literature on ZIKV vectors (12/233), surveillance for ZIKV (13/233), diagnostic tests (12/233) and transmission (10/233). Three papers reported on ZIKV prevention/control strategies, one investigated knowledge and attitudes of health professionals and two vector mapping studies were reported. The majority of studies used observational study designs, 89.7% (209/233), of which 62/233 were case studies or case series, while fewer (24/233) used experimental study designs. Several knowledge gaps were identified by this review with respect to ZIKV epidemiology, the importance of potential non-human primates and other hosts in the transmission cycle, the burden of disease in humans, and complications related to human infection with ZIKV. Historically there has been little research on ZIKV; however, given its current spread through Australasia and the Americas, research resources are now being allocated to close many of the knowledge gaps identified in this scoping review. Future updates of this project will probably demonstrate enhanced evidence and understanding of ZIKV and its impact on public health.

  4. Scoping Review of the Zika Virus Literature

    Science.gov (United States)

    2016-01-01

    The global primary literature on Zika virus (ZIKV) (n = 233 studies and reports, up to March 1, 2016) has been compiled using a scoping review methodology to systematically identify and characterise the literature underpinning this broad topic using methods that are documented, updateable and reproducible. Our results indicate that more than half the primary literature on ZIKV has been published since 2011. The articles mainly covered three topic categories: epidemiology of ZIKV (surveillance and outbreak investigations) 56.6% (132/233), pathogenesis of ZIKV (case symptoms/ outcomes and diagnosis) 38.2% (89/233) and ZIKV studies (molecular characterisation and in vitro evaluation of the virus) 18.5% (43/233). There has been little reported in the primary literature on ZIKV vectors (12/233), surveillance for ZIKV (13/233), diagnostic tests (12/233) and transmission (10/233). Three papers reported on ZIKV prevention/control strategies, one investigated knowledge and attitudes of health professionals and two vector mapping studies were reported. The majority of studies used observational study designs, 89.7% (209/233), of which 62/233 were case studies or case series, while fewer (24/233) used experimental study designs. Several knowledge gaps were identified by this review with respect to ZIKV epidemiology, the importance of potential non-human primates and other hosts in the transmission cycle, the burden of disease in humans, and complications related to human infection with ZIKV. Historically there has been little research on ZIKV; however, given its current spread through Australasia and the Americas, research resources are now being allocated to close many of the knowledge gaps identified in this scoping review. Future updates of this project will probably demonstrate enhanced evidence and understanding of ZIKV and its impact on public health. PMID:27244249

  5. TRUEX Radiolysis Testing Using the INL Radiolysis Test Loop: FY-2012 Status Report

    Energy Technology Data Exchange (ETDEWEB)

    Dean R. Peterman; Lonnie G. Olson; Richard D. Tillotson; Rocklan G. McDowell; Jack D. Law

    2012-09-01

    The INL radiolysis test loop has been used to evaluate the affect of radiolytic degradation upon the efficacy of the strip section of the TRUEX flowsheet for the recovery of trivalent actinides and lanthanides from acidic solution. The nominal composition of the TRUEX solvent used in this study is 0.2 M CMPO and 1.4 M TBP dissolved in n-dodecane and the nominal composition of the TRUEX strip solution is 1.5 M lactic acid and 0.050 M diethylenetriaminepentaacetic acid. Gamma irradiation of a mixture of TRUEX process solvent and stripping solution in the test loop does not adversely impact flowsheet performance as measured by stripping americium ratios. The observed increase in americium stripping distribution ratios with increasing absorbed dose indicates the radiolytic production of organic soluble degradation compounds.

  6. 2014 AFCI Glovebox Event Executive Summary

    Energy Technology Data Exchange (ETDEWEB)

    Campbell, Joseph Lenard [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-01-01

    One of the primary INL missions is to support development of advanced fuels with the goal of creating reactor fuels that produce less waste and are easier to store. The Advanced Fuel Cycle Initiative (AFCI) Glovebox in the Fuel Manufacturing Facility (FMF) is used for several fuel fabrication steps that involve transuranic elements, including americium. The AFCI glove box contains equipment used for fuel fabrication, including an arc melter – a small, laboratory-scale version of an electric arc furnace used to make new metal alloys for research – and an americium distillation apparatus. This overview summarizes key findings related to the investigation into the releases of airborne radioactivity that occurred in the AFCI glovebox room in late August and early September 2014. The full report (AFCI Glovebox Radiological Release – Evaluation, Corrective Actions and Testing, INL/INL-15-36996) provides details of the identified issues, corrective actions taken as well as lessons learned

  7. Technical Improvements to an Absorbing Supergel for Radiological Decontamination in Tropical Environments

    Energy Technology Data Exchange (ETDEWEB)

    Kaminski, Michael D. [Argonne National Lab. (ANL), Argonne, IL (United States); Mertz, Carol J. [Argonne National Lab. (ANL), Argonne, IL (United States); Kivenas, Nadia [Argonne National Lab. (ANL), Argonne, IL (United States); demmer, Rick [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-01-01

    Argonne National Laboratory (Argonne) developed a superabsorbing gel-based process (SuperGel) for the decontamination of cesium from concrete and other porous building materials. Here, we report on results that tested the gel decontamination technology on specific concrete and ceramic formulations from a coastal city in Southeast Asia, which may differ significantly from some U.S. sources. Results are given for the evaluation of americium and cesium sequestering agents that are commercially available at a reasonable cost; the evaluation of a new SuperGel formulation that combines the decontamination properties of cesium and americium; the variation of the contamination concentration to determine the effects on the decontamination factors with concrete, tile, and brick samples; and pilot-scale testing (0.02–0.09 m2 or 6–12 in. square coupons).

  8. Fabrication and Pre-irradiation Characterization of a Minor Actinide and Rare Earth Containing Fast Reactor Fuel Experiment for Irradiation in the Advanced Test Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Timothy A. Hyde

    2012-06-01

    The United States Department of Energy, seeks to develop and demonstrate the technologies needed to transmute the long-lived transuranic actinide isotopes contained in spent nuclear fuel into shorter lived fission products, thereby decreasing the volume of material requiring disposal and reducing the long-term radiotoxicity and heat load of high-level waste sent to a geologic repository. This transmutation of the long lived actinides plutonium, neptunium, americium and curium can be accomplished by first separating them from spent Light Water Reactor fuel using a pyro-metalurgical process, then reprocessing them into new fuel with fresh uranium additions, and then transmuted to short lived nuclides in a liquid metal cooled fast reactor. An important component of the technology is developing actinide-bearing fuel forms containing plutonium, neptunium, americium and curium isotopes that meet the stringent requirements of reactor fuels and materials.

  9. Determination of the first ionization potential of actinides by resonance ionization mass spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Koehler, S. [Institut fuer Kernchemie Universitaet Mainz, Mainz (Germany); Albus, F. [Institu fuer Physik, Universitaet Mainz, Mainz (Germany); Dibenberger, R.; Erdmann, N.; Funk, H. [Institut fuer Kernchemiess Universitaet Mainz, Mainz (Germany); Hasse, H. [Institut fuer Physik, Universitaet Mainz, Mainz (Germany); Herrmann, G. [Institut fuer Kernchemiess Universitaet Mainz, Mainz (Germany); Huber, G.; Kluge, H.; Nunnemann, M.; Passler, G. [Institut fuer Physik, Universitaet Mainz, Mainz (Germany); Rao, P.M. [Bhabha Atomic Research Centre Bombay (India); Riegel, J.; Trautmann, N. [Institut fuer Kernchemie Universitaet Mainz, Mainz (Germany); Urban, F. [Institut fuer Physik, Universitaet Mainz, Mainz (Germany)

    1995-04-01

    Resonance ionization mass spectroscopy (RIMS) is used for the precise determination of the first ionization potential of transuranium elements. The first ionization potentials (IP) of americium and curium have been measured for the first time to IP{sub {ital Am}}=5.9738(2) and IP{sub {ital Cm}}=5.9913(8) eV, respectively, using only 10{sup 12} atoms of {sup 243}Am and {sup 248}Cm. The same technique was applied to thorium, neptunium, and plutonium yielding IP{sub T{sub H}}=6.3067(2), IP{sub N{sub P}}=6.2655(2), and IP{sub {ital Pu}}=6.0257(8) eV. The good agreement of our results with the literature data proves the precision of the method which was additionally confirmed by the analysis of Rydberg seris of americium measured by RIMS. {copyright}American Institute of Physics 1995

  10. Incineration by accelerator; Incineration par accelerateur

    Energy Technology Data Exchange (ETDEWEB)

    Cribier, M.; FIoni, G.; Legrain, R.; Lelievre, F.; Leray, S.; Pluquet, A.; Safa, H.; Spiro, M.; Terrien, Y.; Veyssiere, Ch.

    1997-01-01

    The use MOX fuel allows to hope a stabilization of plutonium production around 500 tons for the French park. In return, the flow of minor actinides is increased to several tons. INCA (INCineration by Accelerator), dedicated instrument, would allow to transmute several tons of americium, curium and neptunium. It could be able to reduce nuclear waste in the case of stopping nuclear energy use. This project needs: a protons accelerator of 1 GeV at high intensity ( 50 m A), a window separating the accelerator vacuum from the reactor, a spallation target able to produce 30 neutrons by incident proton, an incineration volume where a part of fast neutrons around the target are recovered, and a thermal part in periphery with flows at 2.10 {sup 15} n/cm{sup 2}.s; a chemical separation of elements burning in thermal (americium) from the elements needing a flow of fast neutrons. (N.C.). 28 refs.

  11. Electrochemical oxidation of 243Am(III) in nitric acid by a terpyridyl-derivatized electrode

    Energy Technology Data Exchange (ETDEWEB)

    Dares, C. J.; Lapides, A. M.; Mincher, B. J.; Meyer, T. J.

    2015-11-05

    A high surface area, tin-doped indium oxide electrode surface-derivatized with a terpyridine ligand has been applied to the oxidation of trivalent americium to Am(V) and Am(VI) in nitric acid. Potentials as low as 1.8 V vs. the saturated calomel electrode are used, 0.7 V lower than the 2.6 V potential for one-electron oxidation of Am(III) to Am(IV) in 1 M acid. This simple electrochemical procedure provides, for the first time, a method for accessing the higher oxidation states of Am in non-complexing media for developing the coordination chemistries of Am(V) and Am(VI) and, more importantly, for separation of americium from nuclear waste streams.

  12. Translations from the Soviet Journal of Atomic Energy

    Science.gov (United States)

    1962-02-15

    brain and nervous system tumors is accomplished through the use of radio- active isotopes of radon, xenon, and iodine. External irradiation techniques...production of toxic chemicals. The radioactive technique cf obtaining bexachliorane has a number of advantages over the photochemical techni- 1 13 qu. Nuclear...nuclear fuels and contains results of studies on the chemistry of ruth- enium, thorium , uranium, plutoniuin and americium. Also treated are the problems

  13. Extractant Design by Covalency

    Energy Technology Data Exchange (ETDEWEB)

    Gaunt, Andrew James [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Olson, Angela Christine [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Kozimor, Stosh Anthony [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Cross, Justin Neil [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Batista, Enrique Ricardo [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Macor, Joe [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Univ. of Illinois, Urbana-Champaign, IL (United States); Peterman, Dean R. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Grimes, Travis [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2016-01-21

    This project aims to provide an electronic structure-to-function understanding of extractants for actinide selective separation processes. The research entails a multi-disciplinary approach that integrates chemical syntheses, structural determination, K-edge X-ray Absorption Spectroscopy (XAS), and Density Functional Theory (DFT) calculations. In FY15, the project reached the final stage of testing the extraction performance of a new ligand design and preparing an americium-extractant complex for analysis.

  14. Gas-phase energies of actinide oxides -- an assessment of neutral and cationic monoxides and dioxides from thorium to curium

    Energy Technology Data Exchange (ETDEWEB)

    Marcalo, Joaquim; Gibson, John K.

    2009-08-10

    An assessment of the gas-phase energetics of neutral and singly and doubly charged cationic actinide monoxides and dioxides of thorium, protactinium, uranium, neptunium, plutonium, americium, and curium is presented. A consistent set of metal-oxygen bond dissociation enthalpies, ionization energies, and enthalpies of formation, including new or revised values, is proposed, mainly based on recent experimental data and on correlations with the electronic energetics of the atoms or cations and with condensed-phase thermochemistry.

  15. Bibliography of PNL publications in management of radioactive wastes, subject-indexed (alphabetically) and listed chronologically (latest issues first)

    Energy Technology Data Exchange (ETDEWEB)

    Powell, J.A. (ed.)

    1976-07-01

    The citations are arranged under: actinides, alpha particles, americium, beta particles, calcination, cements, ceramics, cesium, containers, decontamination, evaporation, fluidized bed, glass, ground release, high-level wastes, incinerators, liquid wastes, marine disposal, melting, nonradioactive waste disposal, Pu, radiation doses, radiation protection, disposal, processing, radionuclide migration, Ru, safety, separation processes, soils, solidification, solid wastes, stack disposal, temperature, thermal conductivity, transmutation, tritium, underground disposal, U, volatility, and waste disposal/management/processing/storage/transportation. (DLC)

  16. Research in radiobiology. Annual report of work in progress in the internal irradiation program

    Energy Technology Data Exchange (ETDEWEB)

    1979-03-31

    The toxicity, retention, biological effects, distribution, decorporation and measuring techniques of radionuclides are discussed. Calculations of trabecular bone formation rates from tetracycline labeling is included. The characteristics of trabecular bone in the Rhesus monkey are discussed. Studies on the early retention and distribution of radium 224 in beagles are included. Studies on the decorporation of plutonium and americium in dogs by DTPA and salicylic acid are presented.

  17. Evaluation of the neutral comet assay for detection of alpha-particle induced DNA-double-strand-breaks; Evaluation des Comet Assays bei neutralem pH zur Detektion von α-Partikel induzierten DNA-Doppelstrangbruechen

    Energy Technology Data Exchange (ETDEWEB)

    Hofbauer, Daniela

    2010-10-20

    Aim of this study was to differentiate DNA-double-strand-breaks from DNA-single-strand-breaks on a single cell level, using the comet assay after α- and γ-irradiation. Americium-241 was used as a alpha-irradiation-source, Caesium-137 was used for γ-irradiation. Because of technical problems with both the neutral and alkaline comet assay after irradiation of gastric cancer cells and human lymphocytes, no definite differentiation of DNA-damage was possible.

  18. Theoretical and experimental evaluation of waste transport in selected rocks: 1977 annual report of LBL Contract No. 45901AK. Waste Isolation Safety Assessment Program: collection and generation of transport data

    Energy Technology Data Exchange (ETDEWEB)

    Apps, J.A.; Benson, L.V.; Lucas, J.; Mathur, A.K.; Tsao, L.

    1977-09-01

    During fiscal year 1977, the following subtasks were performed. (1) Thermodynamic data were tabulated for those aqueous complexes and solid phases of plutonium, neptunium, americium, and curium likely to form in the environment. (2) Eh-pH diagrams were computed and drafted for plutonium, neptunium, americium and curium at 25/sup 0/C and one atmosphere. (3) The literature on distribution coefficients of plutonium, neptunium, americium, and curium was reviewed. (4) Preliminary considerations were determined for an experimental method of measuring radionuclide transport in water-saturated rocks. (5) The transport mechanisms of radionuclides in water-saturated rocks were reviewed. (6) A computer simulation was attempted of mass transfer involving actinides in water-saturated rocks. Progress in these tasks is reported. Subtasks 1, 2, 3, and 4 are complete. The progress made in subtask 5 is represented by an initial theoretical survey to define the conditions needed to characterize the transport of radionuclides in rocks. Subtask 6 has begun but is not complete.

  19. In situ radiological surveying at the Double Tracks site, Nellis Air Force Range, Tonopah, Nevada

    Energy Technology Data Exchange (ETDEWEB)

    Riedhauser, S.R.; Tipton, W.J.

    1996-04-01

    A team from the Remote Sensing Laboratory conducted a series of in situ radiological measurements at the Double Tracks site on the Nellis Air Force Range just east of Goldfield, Nevada, during the periods of April 10-13 and June 5-9, 1995. The survey team measured the terrestrial gamma radiation at the site to determine the levels of natural and man-made radiation. This site includes the areas covered by previous surveys conducted from 1962 through 1993. The main purpose of the first expedition was to assess several new techniques for characterizing sites with dispersed plutonium. The two purposes of the second expedition were to characterize the distribution of transuranic contamination (primarily plutonium) at the site by measuring the gamma rays from americium-241 and to assess the performance of the two new detector platforms. Both of the new platforms performed well, and the characterization of the americium-241 activity at the site was completed. Several plots compare these ground-based system measurements and the 1993 aerial data. The agreement is good considering the systems are characterized and calibrated through independent means. During the April expedition, several methods for measuring the depth distribution of americium-241 in the field were conducted as a way of quickly and reliably obtaining depth profiles without the need to wait for laboratory analysis. Two of the methods were not very effective, but the results of the third method appear very promising.

  20. Alkali Treatment of Acidic Solution from Hanford K Basin Sludge Dissolution

    Energy Technology Data Exchange (ETDEWEB)

    AA Bessonov; AB Yusov; AM Fedoseev; AV Gelis; AY Garnov; CH Delegard; GM Plavnik; LN Astafurova; MS Grigoriev; NA Budantseva; NN Krot; SI Nikitenko; TP Puraeva; VP Perminov; VP Shilov

    1998-12-22

    Nitric acid solutions will be created from the dissolution of Hanford K Basin sludge. These acidic dissolver solutions must be made alkaline by treatment with NaOH solution before they are disposed to ~ the Tank Waste Remediation System on the Hanford Site. During the alkali treatments, sodium diuranate, hydroxides of iron and aluminum, and radioelements (uranium, plutonium, and americium) will precipitate from the dissolver solution. Laboratory tests, discussed here, were pefiormed to provide information on these precipitates and their precipitation behavior that is important in designing the engineering flowsheet for the treatment process. Specifically, experiments were conducted to determine the optimum precipitation conditions; the completeness of uranium, plutonium, and americium precipitation; the rate of sedimentation; and the physico-chemical characteristics of the solids formed by alkali treatment of simulated acidic dissolver solutions. These experiments also determined the redistribution of uranium, plutonium, and americium flom the sodium di~ate and iron and al&inurn hydroxide precipitates upon contact with carbonate- and EDTA-bearing simulated waste solutions. Note: EDTA is the tetrasodium salt of ethylenediaminetetraacetate.

  1. Drug: D02052 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D02052 Drug Barium sulfate (JP16/USP); Baricon (TN) Ba. SO4 233.857 233.3896 D02052...R:br08301] 7 Agents not mainly for therapeutic purpose 72 Intracorporeal diagnostic agents 721 X-ray contrast media 7212 Barium... salts D02052 Barium sulfate (JP16/USP) CAS: 7727-43-7 PubChem

  2. PROCESS FOR CONTINUOUSLY SEPARATING IRRADIATION PRODUCTS OF THORIUM

    Science.gov (United States)

    Hatch, L.P.; Miles, F.T.; Sheehan, T.V.; Wiswall, R.H.; Heus, R.J.

    1959-07-01

    A method is presented for separating uranium-233 and protactinium from thorium-232 containing compositions which comprises irradiating finely divided particles of said thorium with a neutron flux to form uranium-233 and protactinium, heating the neutron-irradiated composition in a fluorine and hydrogen atmosphere to form volatile fluorides of uranium and protactinium and thereafter separating said volatile fluorides from the thorium.

  3. 77 FR 40380 - Outer Continental Shelf, Gulf of Mexico, Oil and Gas Lease Sales, Western Planning Area Lease...

    Science.gov (United States)

    2012-07-09

    ... Bureau of Ocean Energy Management Outer Continental Shelf, Gulf of Mexico, Oil and Gas Lease Sales, Western Planning Area Lease Sale 233 and Central Planning Area Lease Sale 231 AGENCY: Bureau of Ocean... proposed Western Planning Area (WPA) Lease Sale 233 and Central Planning Area (CPA) Lease Sale 231...

  4. Domain Modeling: NP_001009882.1 [SAHG[Archive

    Lifescience Database Archive (English)

    Full Text Available NP_001009882.1 chr1 Crystal structure of human myristoyl-CoA:protein N-myristoyltra...nsferase. d1rxta_ chr1/NP_001009882.1/NP_001009882.1_apo_91-233.pdb c1rxtc_ chr1/NP_001009882.1/NP_001009882.1_holo_91-233.pdb forte 197E CMO 1 ...

  5. GETDB: 104773 [GETDB

    Lifescience Database Archive (English)

    Full Text Available cells (SG) cns+pns shs2, coxal ring. - lethal - comment1:A, comment2:33E1-E7 d1 d...xal ring. Adult GFP - Lethality lethal Also known as - Original Comments comment1:A, comment2:33E1-E7 Disc (

  6. GETDB: 103756 [GETDB

    Lifescience Database Archive (English)

    Full Text Available # of cells - sg, hg, tr (all) - lethal - comment1:A, comment2:33B1 - - - - Show 1...lity lethal Also known as - Original Comments comment1:A, comment2:33B1 Disc (Image) - Disc (number) 0 Embry

  7. School functioning in 8- to 18-year-old children born after in vitro fertilization

    NARCIS (Netherlands)

    Wagenaar, Karin; Ceelen, Manon; Weissenbruch, van Mirjam; Knol, Dirk; Delemarre-van de Waal, Henriette; Huisman, Jaap

    2008-01-01

    The aim of this study was to examine the school functioning of 8- to 18-year-old children born after in vitro fertilization (IVF). We compared 233 children born after IVF to 233 matched control children born spontaneously from parents with fertility problems on measures of education level, general c

  8. Dicty_cDB: VFJ896 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available sapiens CRR9 mRNA for cisplat... 233 1e-59 (Q5ZKJ0) RecName: Full=Cleft lip and palate transmembrane protei...... 233 1e-59 (Q5R7B1) RecName: Full=Cleft lip and palate transmembrane protei...

  9. Ecology of marine deposit feeders. Ed. by G. Lopez, C. Taghon and J. Levinton

    Digital Repository Service at National Institute of Oceanography (India)

    Royan, J.P

    stream_size 2 stream_content_type text/plain stream_name Indian_J_Mar_Sci_19_233.pdf.txt stream_source_info Indian_J_Mar_Sci_19_233.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  10. NCBI nr-aa BLAST: CBRC-BTAU-01-2984 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-2984 ref|NP_048305.1| ORF MSV233 hypothetical protein [Melanoplus sang...uinipes entomopoxvirus] gb|AAC97745.1| ORF MSV233 hypothetical protein [Melanoplus sanguinipes entomopoxvirus] NP_048305.1 0.005 34% ...

  11. NCBI nr-aa BLAST: CBRC-DDIS-01-0174 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DDIS-01-0174 ref|NP_048305.1| ORF MSV233 hypothetical protein [Melanoplus sang...uinipes entomopoxvirus] gb|AAC97745.1| ORF MSV233 hypothetical protein [Melanoplus sanguinipes entomopoxvirus] NP_048305.1 7e-08 46% ...

  12. NASA/DoD Aerospace Knowledge Diffusion Research Project. Report Number 13. Source Selection and Information Use by U.S. Aerospace Engineers and Scientists: Results of a Telephone Survey

    Science.gov (United States)

    1992-09-01

    Aerospace Knowledge Diffusion Research Project. Government Information Quarterly 8(2), 219- 233. Shuchman, H. L. (1981). Information Transfer in...Research Project. Reprinted from Government Information Quarterly , Volume 8, No. 2 (1991): 219-233. (Available from AIAA 91A35455.) 1 1 Pinelli, Thomas

  13. Engineering Work and Information Use in Aerospace: Results of a Telephone Survey

    Science.gov (United States)

    1992-10-01

    and Rebecca 0. Barclay. "The NASA/DoD Aerospace Knowledge Diffusion Research Project." Government Information Quarterly 8.2 (1991): 219-233. Polanyi...Aerospace Knowledge Diffusion Research Project. Reprinteo .om Government Information Quarterly , Volume 8, No. 2 (1991): 219-233. (Available from AIAA

  14. NASA/DOD Aerospace Knowledge Diffusion Research Project. A Comparison of the Technical Communication Practices of Aerospace Engineers and Scientists in India and the United States

    Science.gov (United States)

    1993-09-01

    34The NASA/DoD Aerospace Knowledge Diffusion Research Project." Government Information Quarterly 8:2 (1991): 219-233. 35 APPENDIX A AEROSPACE KNOWLEDGE... Government Information Quarterly , Volume 8, No. 2 (1991): 219-233. (Available from AIAA 91A35455.) 1 1 Pinelli, Thomas E. and John M. Kennedy. The

  15. Technical Uncertainty and Project Complexity as Correlates of Information Use by U.S. Industry-Affiliated Aerospace Engineers and Scientists: Results of an Exploratory Investigation

    Science.gov (United States)

    1993-09-01

    Barclay. (1991). "The NASA/DoD Aerospace Knowledge Diffusion Research Project." Government Information Quarterly 8:2, 219-233. Randolph, W. Alan. (1978...from Government Information Quarterly , Volume 8, No. 2 (1991): 219-233. (Available from AIAA 91A35455.) 1 1 Pinelli, Thomas E. and John M. Kennedy

  16. GETDB: 113556 [GETDB

    Lifescience Database Archive (English)

    Full Text Available titute of Genetics. FM7c Link to clone table - 1 233 Link to cluster table 233 1 Request - CNS+PNS in stg 15. limited...nic Expression CNS+PNS in stg 15. limited to posterior midline in stg 10 bro. Larval GFP subset of PNS? two

  17. Drug: D10007 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D10007 Drug Faxeladol (USAN/INN) C15H23NO 233.178 233.3492 D10007.gif Analgesic age...nt CAS: 433265-65-7 PubChem: 135626728 LigandBox: D10007 ATOM 17 1 C1a C 20.3000 -24.1500 2 N1c N 21.5124 -2

  18. Summary and conclusions

    Digital Repository Service at National Institute of Oceanography (India)

    Rao, D.G.; Murthy, K.S.R.; Neprochnov, Y.P.; Subrahmanyam, C.

    stream_size 4 stream_content_type text/plain stream_name Mem_Geol_Soc_India_1998_39_233.pdf.txt stream_source_info Mem_Geol_Soc_India_1998_39_233.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...

  19. The mode of operation of CANDU power reactor in thorium self-sufficient fuel cycle

    Directory of Open Access Journals (Sweden)

    Bergelson Boris R.

    2008-01-01

    Full Text Available This paper presents the results of calculations for CANDU reactor operation in the thorium fuel cycle. The calculations were performed to estimate feasibility of operation of a heavy-water thermal neutron power reactor in the self-sufficient thorium cycle. The parameters of the active core and the scheme of fuel reloading were considered to be the same as for the standard operation in the uranium cycle. Two modes of operation are discussed in the paper: the mode of preliminary accumulation of 233U and the mode of operation in the self-sufficient cycle. For calculations for the mode of accumulation of 233U, it was assumed that plutonium was used as the additional fissile material to provide neutrons for 233U production. Plutonium was placed in fuel channels, while 232Th was located in target channels. The maximum content of 233U in the target channels was about 13 kg/t of ThO2. This was achieved by six year irradiation. The start of reactor operation in the self-sufficient mode requires content of 233U not less than 12 kg/t. For the mode of operation in the self-sufficient cycle, it was assumed that all the channels were loaded with the identical fuel assemblies containing ThO2 and a certain amount of 233U. It was shown that the non-uniform distribution of 233U in a fuel assembly is preferable.

  20. α谱法测定低微量铀、钍含量的研究

    Institute of Scientific and Technical Information of China (English)

    夏明; 周秀云

    1982-01-01

    Alpha-spectrometric technique is described as an independent method of determining micro-content of U233 and Th233. This method is based on the comparison of U234 and Th233 alpha spectral activity in geological samples with U232 and Th233 spectral activity contributed by the spike of known concentration. The experiment procedure consists in dissolving fine powdered sample with acid and adding a given amount of U232-Th223 spike. The uranium and thorium are then separated by ion exchange. After purification each fraction is mounted on a separate stainless steel disk for measurement by alpha spectrometer which consist essentially of a surface barrier deterctor and a low noise amplification system connected to a multichannel analyser. After correcting for background, tail and other factors, the desired U232 and Th232 concentrations can be calculated. The data obtained by the alpha-spectrometric method using U232-Th223 spike are compared with colorimetric determination. Excellent agreement is obtained between the two sets of results. The coefficient of correlation is about 0.98 for U234 and 0.97 for Th232. The accuracy of uranium and thorium analyses by this method depends primarily upon the counting statistics of U233, U232, Th233 and Th223 and, to a lesser extent, upon the calibration of U233-Th238 spike. Errors of uranium and thorium concentration by this method are generally 2 to 5 per cent.

  1. Operation of CANDU power reactor in thorium self-sufficient fuel cycle

    Indian Academy of Sciences (India)

    B R Bergelson; A S Gerasimov; G V Tikhomirov

    2007-02-01

    This paper presents the results of calculations for CANDU reactor operation in thorium fuel cycle. Calculations are performed to estimate the feasibility of operation of heavy-water thermal neutron power reactor in self-sufficient thorium cycle. Parameters of active core and scheme of fuel reloading were considered to be the same as for standard operation in uranium cycle. Two modes of operations are discussed in the paper: mode of preliminary accumulation of 233U and mode of operation in self-sufficient cycle. For the mode of accumulation of 233U it was assumed for calculations that plutonium can be used as additional fissile material to provide neutrons for 233U production. Plutonium was placed in fuel channels, while 232Th was located in target channels. Maximum content of 233U in target channels was estimated to be ∼ 13 kg/t of ThO2. This was achieved by irradiation for six years. The start of the reactor operation in the self-sufficient mode requires 233U content to be not less than 12 kg/t. For the mode of operation in self-sufficient cycle, it was assumed that all channels were loaded with identical fuel assemblies containing ThO2 and certain amount of 233U. It is shown that nonuniform distribution of 233U in fuel assembly is preferable.

  2. Critical role of intestinal interleukin-4 modulating regulatory T cells for desensitization, tolerance, and inflammation of food allergy

    Science.gov (United States)

    Fujimura, Yoko; Takeyama, Jun; Hiraide, Erika; Kikuchi, Akira; Murakami, Hitoshi; Hosono, Akira; Nochi, Tomonori; Wakatsuki, Yoshio; Shimojo, Naoki; Kaminogawa, Shuichi; Sato, Ryuichiro; Kiyono, Hiroshi; Hachimura, Satoshi

    2017-01-01

    Background and objective The mechanism inducing either inflammation or tolerance to orally administered food allergens remains unclear. To investigate this we analyzed mouse models of food allergy (OVA23-3) and tolerance (DO11.10 [D10]), both of which express ovalbumin (OVA)-specific T-cell receptors. Methods OVA23-3, recombination activating gene (RAG)-2-deficient OVA23-3 (R23-3), D10, and RAG-2-deficient D10 (RD10) mice consumed a diet containing egg white (EW diet) for 2–28 days. Interleukin (IL)-4 production by CD4+ T cells was measured as a causative factor of enteropathy, and anti-IL-4 antibody was used to reveal the role of Foxp3+ OVA-specific Tregs (aiTreg) in this process. Results Unlike OVA23-3 and R23-3 mice, D10 and RD10 mice did not develop enteropathy and weight loss on the EW diet. On days 7–10, in EW-fed D10 and RD10 mice, splenic CD4+ T cells produced significantly more IL-4 than did those in the mesenteric lymph nodes (MLNs); this is in contrast to the excessive IL-4 response in the MLNs of EW-fed OVA23-3 and R23-3 mice. EW-fed R23-3 mice had few aiTregs, whereas EW-fed RD10 mice had them in both tissues. Intravenous injections of anti-IL-4 antibody recovered the percentage of aiTregs in the MLNs of R23-3 mice. On day 28, in EW-fed OVA23-3 and R23-3 mice, expression of Foxp3 on CD4+ T cells corresponded with recovery from inflammation, but recurrence of weight loss was observed on restarting the EW diet after receiving the control-diet for 1 month. No recurrence developed in D10 mice. Conclusions Excessive IL-4 levels in the MLNs directly inhibited the induction of aiTregs and caused enteropathy. The aiTregs generated in the attenuation of T cell-dependent food allergic enteropathy may function differently than aiTregs induced in a tolerance model. Comparing the two models enables to investigate their aiTreg functions and to clarify differences between inflammation with subsequent desensitization versus tolerance. PMID:28234975

  3. Gclust Server: 94051 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available sequences Cluster Sequences Link to related sequences Related Sequences(233) Sequence length 379 Representative...tering threshold 9.98e-01 Plants and algae (7species) (%) 0.0 Other Bikonts (Chromalveolata, Excavata) (9spe

  4. Tritium Facilities Modernization and Consolidation Project Process Waste Assessment (Project S-7726)

    Energy Technology Data Exchange (ETDEWEB)

    Hsu, R.H. [Westinghouse Savannah River Company, AIKEN, SC (United States); Oji, L.N.

    1997-11-14

    Under the Tritium Facility Modernization {ampersand} Consolidation (TFM{ampersand}C) Project (S-7726) at the Savannah River Site (SS), all tritium processing operations in Building 232-H, with the exception of extraction and obsolete/abandoned systems, will be reestablished in Building 233-H. These operations include hydrogen isotopic separation, loading and unloading of tritium shipping and storage containers, tritium recovery from zeolite beds, and stripping of nitrogen flush gas to remove tritium prior to stack discharge. The scope of the TFM{ampersand}C Project also provides for a new replacement R&D tritium test manifold in 233-H, upgrading of the 233- H Purge Stripper and 233-H/234-H building HVAC, a new 234-H motor control center equipment building and relocating 232-H Materials Test Facility metallurgical laboratories (met labs), flow tester and life storage program environment chambers to 234-H.

  5. System Requirements Document for the Molten Salt Reactor Experiment

    Energy Technology Data Exchange (ETDEWEB)

    Aigner, R.D.

    2000-04-01

    The purpose of the conversion process is to convert the {sup 233}U fluoride compounds that are being extracted from the Molten Salt Reactor Experiment (MSRE) equipment to a stable oxide for long-term storage at Bldg. 3019.

  6. Clinical Evaluation of the Joints of Patients with Hemophilia

    Directory of Open Access Journals (Sweden)

    Sezai Ozkan

    2014-08-01

    Conclusion: Treatment and monitoring of patients with hemophilia requires a multidisciplinary approach. Early diagnosis, treatment, rehabilitation and a constant monitoring will be effective in preventing arthropaty. [Arch Clin Exp Surg 2014; 3(4.000: 233-239

  7. Gender dysphoria

    Science.gov (United States)

    ... concept Gender dysphoria is not the same as homosexuality. Identity conflicts need to continue over time to ... ed. Philadelphia, PA: Elsevier Saunders; 2016:chap 233. Review Date 2/21/2016 Updated by: Timothy Rogge, ...

  8. Concealed Leather and Fur Finds from Kempten/ Allgäu (Germany)

    DEFF Research Database (Denmark)

    Atzbach, Rainer

    2002-01-01

    , in: Guido Helmig, Barbara Scholkmann, Matthias Untermann (Hgg.), Centre-Region-Periphery, Medieval Europe 2002 Preprinted Papers Vol. 3 (Hertingen 2002) 233-238. Online-Version der Posterpräsentation...

  9. Drug: D03207 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available YSP DTKVLDICVS LLMGEQFLVS WC (Glycosylation sites: 140, 233, 390, 652, 882, 925) Peptide Treatment of Pompe's disease [enzyme replace...ment therapy] Therapeutic category: 3959 ATC code: A16AB

  10. Kinetics Formulations for ICM-Lite: A Tool to Predict and Quantify Ecosystem Benefits in Aquatic Systems

    Science.gov (United States)

    2015-07-01

    2.3.3 Vertical transport ........................................................................................................ 8 2.3.4 Summary of...17 3.5.3 Nutrients ...3.5.5 Combining the effects of light, nutrients , and temperature ................................... 20 3.5.6 Respiration

  11. Organization and management of the treatment for the wounded in 8.12 Tinjin Port Explosion, China

    Institute of Scientific and Technical Information of China (English)

    Xiao-Xia Guo; Zhi-Jun Li; Hui Li; Zhi-Xiang Zhang; Cong-Zhe Xu; Bin Zhu

    2015-01-01

    Tianjin Medical University General Hospital treated 233 wounded in 8.12 Tinjin Port explosion.Here we would like to analyze the treatment process for the wounded, and share the experiences of organization and management for emergency rescue operation.

  12. Seitse retke isamaale : mälestuslikud esseed / Hellar Grabbi ; [toimetanud Urmas Tõnisson ; kaanekujundus: Mari Ainso ; esikaane foto: Helmuth Neider

    Index Scriptorium Estoniae

    Grabbi, Hellar, 1929-

    2010-01-01

    Mälestusteraamatus meenutatakse ka kohtumisi Toomas Hendrik Ilvesega raadiojaamas "Vaba Euroopa" töötamise ajal (lk. 233, 285-286), 1988. a. Münchenis ilmunud almanahhis Põrp! ilmunud esseed "Niikuinii" (lk. 207)

  13. Bestimmung und Deutung von Angebotskurven Ein Beispiel

    NARCIS (Netherlands)

    J. Tinbergen (Jan)

    1930-01-01

    textabstractIn English: Determination and Interpretation of Supply Curves: an example In: David F. Hendry and Mary S. Morgan (Eds), The Foundations of Econometric Analysis, Cambridge University Press, New York, 1995, pp. 233-245

  14. 29 CFR 2.32 - Equal participation of religious organizations.

    Science.gov (United States)

    2010-07-01

    ... governments administering DOL support from accommodating religion in a manner consistent with the..., and expression of its religious beliefs, subject to the provisions of § 2.33 of this subpart....

  15. Chondroblastoma

    Science.gov (United States)

    ... 25 years old. The tumors are very rare, accounting for only about 1 percent of all bone ... Orthop Surg 2013; 21: 225-233. Computerized tomography (CT) scans. More detailed than a plain x-ray, ...

  16. Drug: D08709 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available 08301] 2 Agents affecting individual organs 23 Digestive organ agents 233 Stomachics and digestives 2339 Others D08709 Picrasma wood - sodium bicarbonate mixt PubChem: 96025392 ...

  17. A Collaborative Virtual Environment for Situated Learning of Car Driving

    NARCIS (Netherlands)

    Miao, Yongwu; Pinkwart, Niels; Hoppe, Ulrich

    2007-01-01

    Miao, Y., Pinkwart, N., and Hoppe, H.U. (2006). "A Collaborative Virtual Environment for Situated Learning of Car Driving". International Journal on Advanced Technology for Learning (ATL), 3(4), 233-240.

  18. Children and Adults with Attention-Deficit/Hyperactivity Disorder

    Science.gov (United States)

    ... All Rights Reserved. Press Privacy Attention Magazine Archives Advertise with CHADD Contact Us Site Map Report a Problem For help call: 800-233-4050 Follow CHADD on Facebook Follow CHADD on Twitter

  19. Kohtuvõimu sõltumatus Euroopa Liiduga ühinemise protsessis. Kohtute sõltumatus Eestis / tõlkinud õigustõlkebüroo Interlex OÜ ... [jt.] ; Avatud Ühiskonna Instituut, Euroopa Liiduga liitumise seireprogramm

    Index Scriptorium Estoniae

    2001-01-01

    Eesti osa autor: Jaan Ginter. - Originaali tiitel: Judicial independence in Estonia : [elektrooniline teavik] // Monitoring the EU accession process: judicial independence. Open Society Institute, 2001 - http://www.eumap.org/reports/content/20/233/html

  20. Chronic Liver Disease and Asian Americans/Pacific Islanders

    Science.gov (United States)

    ... Childhood Trauma Grants HIV/AIDS Grants Lupus Grants Justice and Health Grants State Partnership Grants Violence Prevention ... Vietnamese, 33.9 for Koreans, 23.3 for Chinese, 16.8 for Filipino and 9.3 for ...