WorldWideScience

Sample records for americium 233

  1. Preparation of americium amalgam

    International Nuclear Information System (INIS)

    The authors describe a method for the electrochemical preparation of an americium amalgam from americium dioxide and americium 241 and 243 for use in determining the physicochemical properties of the alloy. Moessbauer spectra were made using neptunium dioxide, in the neptunium 237 form, as an absorber. Results show that electrolysis produces a homogeneous amalgam that gives an unoxidized product on vacuum distillation at 200 degrees C

  2. Americium recovery from reduction residues

    Science.gov (United States)

    Conner, W.V.; Proctor, S.G.

    1973-12-25

    A process for separation and recovery of americium values from container or bomb'' reduction residues comprising dissolving the residues in a suitable acid, adjusting the hydrogen ion concentration to a desired level by adding a base, precipitating the americium as americium oxalate by adding oxalic acid, digesting the solution, separating the precipitate, and thereafter calcining the americium oxalate precipitate to form americium oxide. (Official Gazette)

  3. Preparation of americium amalgam

    International Nuclear Information System (INIS)

    Using the method of NGR-spectroscopy with the aid of 241Am isotope chemical state of transuranium elements in the volume and on the surface of amalgams is studied. Amalgam preparation was realized in a simplified electrolytic cell. It is shown that in the process of amalgam preparation the first order of reaction as to actinide is observed; americium is distributed gradually over the volume and it is partially sorbed by the surface of glass capillary. NGR spectrum of dry residue after mercury distillation at 200 deg C points to the presence of americium-mercury intermetal compounds

  4. Chemistry of americium

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.

    1976-01-01

    Essential features of the descriptive chemistry of americium are reviewed. Chapter titles are: discovery, atomic and nuclear properties, collateral reading, production and uses, chemistry in aqueous solution, metal, alloys, and compounds, and, recovery, separation, purification. Author and subject indexes are included. (JCB)

  5. Americium-241 - ED 4308

    International Nuclear Information System (INIS)

    This sheet presents the characteristics of Americium-241, its origin, and its radio-physical and biological properties. It briefly describes its use in nuclear medicine. It indicates its dosimetric parameters for external exposure, cutaneous contamination, and internal exposure due to acute contamination or to chronic contamination. It indicates and comments the various exposure control techniques: ambient dose rate measurement, surface contamination measurement, atmosphere contamination. It addresses the means of protection: premise design, protection against external exposure and against internal exposure. It describes how areas are delimited and controlled within the premises: regulatory areas, controls to be performed. It addresses the personnel classification, training and medical survey. It addresses the issue of wastes and effluents. It briefly recalls the administrative procedures related to the authorization and declaration of possession and use of sealed and unsealed sources. It indicates regulatory aspects related to the road transport of Americium-241, describes what is to be done in case of incident or accident (for the different types of contamination or exposure)

  6. The Biokinetic Model of Americium

    Institute of Scientific and Technical Information of China (English)

    2011-01-01

    To improve in vivo measurements for detecting internal exposure from transuranium radio nuclides, such as neptunium, plutonium, americium, the bioknetic model was studied. According to ICRP report (1993, 1995, 1997) and other research, the

  7. Americium product solidification and disposal

    International Nuclear Information System (INIS)

    The americium product from the TRUEX processing plant needs to be converted into a form suitable for ultimate disposal. An evaluation of the disposal based on safety, number of process steps, demonstrated operability of the processes, production of low-level alpha waste streams, and simplicity of maintenance with low radiation exposures to personnel during maintenance, has been made. The best process is to load the americium on a cation exchange resin followed by calcination or oxidation of the resin after loading

  8. Science and Technology for Americium Transmutation

    International Nuclear Information System (INIS)

    Americium could be seen as the most troublesome element that is present in nuclear fuel. This thesis offers different points of view on the possibility of americium transmutation. The first point of view elaborates simulations of americium-bearing facilities, namely nuclear data, a popular computational code and modeling techniques. The second point of view is focused on practical usage of the simulations to examine upper limit of americium in a specific reactor

  9. Transmutation of Americium in Fast Neutron Facilities

    OpenAIRE

    Zhang, Youpeng

    2011-01-01

    In this thesis, the feasibility to use a medium sized sodium cooled fast reactor fully loaded with MOX fuel for efficient transmutation of americium is investigated by simulating the safety performance of a BN600-type fast reactor loaded with different fractions of americium in the fuel, using the safety parameters obtained with the SERPENT Monte Carlo code. The focus is on americium mainly due to its long-term contribution to the radiotoxicity of spent nuclear fuel and its deterioration on c...

  10. Monte Carlo modeling of spallation targets containing uranium and americium

    International Nuclear Information System (INIS)

    Neutron production and transport in spallation targets made of uranium and americium are studied with a Geant4-based code MCADS (Monte Carlo model for Accelerator Driven Systems). A good agreement of MCADS results with experimental data on neutron- and proton-induced reactions on 241Am and 243Am nuclei allows to use this model for simulations with extended Am targets. It was demonstrated that MCADS model can be used for calculating the values of critical mass for 233,235U, 237Np, 239Pu and 241Am. Several geometry options and material compositions (U, U + Am, Am, Am2O3) are considered for spallation targets to be used in Accelerator Driven Systems. All considered options operate as deep subcritical targets having neutron multiplication factor of k∼0.5. It is found that more than 4 kg of Am can be burned in one spallation target during the first year of operation

  11. Production of americium isotopes in France

    International Nuclear Information System (INIS)

    The program of productions of americium 241 and 243 isotopes is based respectively on the retreatment of aged plutonium alloys or plutonium dioxide and on the treatment of plutonium targets irradiated either in CELESTIN reactors for Pu-Al alloys or OSIRIS reactor for plutonium 242 dioxide. All the operations, including americium final purifications, are carried out in hot cells equipped with remote manipulators. The chemical processes are based on the use of extraction chromatography with hydrophobic SiO2 impregnated with extracting agents. Plutonium targets and aged plutonium alloys are dissolved in nitric acid using conventional techniques while plutonium dioxide dissolutions are performed routine at 300 grams scale with electrogenerated silver II in 4M HNO3 at room temperature. The separation between plutonium and americium is performed by extraction of Pu(IV) either on TBP/SiO2 or TOAHNO3/SiO2 column. Americium recovery from waste streams rid of plutonium is realized by chromatographic extraction of Am(III) using mainly TBP and episodically DHDECMP as extractant. The final purification of both americium isotopes uses the selective extraction of Am(VI) on HDDiBMP/SiO2 column at 60 grams scale. Using the overall process a total amount of 1000 grams of americium 241 and 100 grams of americium 243 has been produced nowadays and the AmO2 final product indicates a purity better than 98.5%

  12. Study of americium sorption by humic acids

    International Nuclear Information System (INIS)

    The results of investigation of influence of the cation content and acidity of soil solution on americium sorption by the humic acids have been shown. The most influence on the interphase distribution coefficient in the system 'humic acid - model soil solution' is caused by the presence of the iron (III), calcium ions and acidity of the solution. The increase of the sodium ions concentration in the solution makes an insignificant impact on the americium sorption. (Authors)

  13. Recovery of thorium along with uranium 233 from Thorex waste solution employing Chitosan

    International Nuclear Information System (INIS)

    The low level waste solution, generated from Thorex process during the processing of U233, contains thorium along with traces of Th228 and U233. Chitosan, a natural bio-polymer derived from Chitin, was earlier used to recover the uranium and americium. The studies were extended to find out its thorium sorption characteristics. Chitosan exhibited very good absorption of thorium (350 mg/g). Chitosan was equilibrated directly with the low level waste solution at different pH after adjusting its pH, for 60 minutes with a Chitosan to aqueous ratio of 1:100 and the raffinates were filtered and analysed. The results showed more than 99% of thorium and U233 could be recovered by Chitosan between pH 4 and 5. Loaded thorium and uranium could be eluted from the Chitosan by 1M HNO3 quantitatively. (author)

  14. Thermal Stabilization of 233UO2, 233UO3, and 233U3O8

    International Nuclear Information System (INIS)

    This report identifies an appropriate thermal stabilization temperature for 233U oxides. The temperature is chosen principally on the basis of eliminating moisture and other residual volatiles. This report supports the U. S. Department of Energy (DOE) Standard for safe storage of 233U (DOE 2000), written as part of the response to Recommendation 97-1 of the Defense Nuclear Facilities Safety Board (DNFSB), addressing safe storage of 233U

  15. Spectrochemical analysis of curium and americium samples

    International Nuclear Information System (INIS)

    Spectrochemical procedures have been developed to determine impurities in americium and curium samples. The simultaneous separation of many impurity elements from the base material (americium and curium) is carried out with extraction and extraction-chromatographic methods using di-2-ethylhexylphosphoric acid. It is shown that part of the elements are separated with extraction or sorption of americium and curium; the other part with the Talspeak process. Two fractions in the extraction chromatography and three fractions in the extraction separation of americium and curium, containing impurities, are analyzed separately by a.c. or d.c. arc spectrography. To increase the sensitivity of the spectrographic analysis and accelerate the burn-up of impurities from the crater of the carbon electrode bismuth fluoride and sodium chloride were used as chemically active substances. The extraction of impurities from weighed quantities of americium and curium samples of 5 to 10 mg permits the lower limit of determined impurity concentrations to be extended to 1 x 10-4 to 5 x 10-3% m/m. (author)

  16. Aqueous Chloride Operations Overview: Plutonium and Americium Purification/Recovery

    Energy Technology Data Exchange (ETDEWEB)

    Kimball, David Bryan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Skidmore, Bradley Evan [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2016-06-22

    Acqueous Chloride mission is to recover plutonium and americium from pyrochemical residues (undesirable form for utilization and storage) and generate plutonium oxide and americium oxide. Plutonium oxide is recycled into Pu metal production flowsheet. It is suitable for storage. Americium oxide is a valuable product, sold through the DOE-OS isotope sales program.

  17. Pyrochemical technology of plutonium and americium preparation and purification

    International Nuclear Information System (INIS)

    Pyrochemical tecnology of metallic plutonium and americium preparation and purification is considered. Investigations into plutonium dioxide reduction up to metal; plutonium electrolytic refining in molten salts; plutonium extraction from the molten salts and preparation of americium dioxide and metallic americium from its tetrafluoride are described

  18. Formation of americium and europium humate complexes

    International Nuclear Information System (INIS)

    Binding constants of americium and europium with a humic acid were determined to study if complex formation of trivalent actinide-humates affects dissolved species of the actinides in hydrosphere. The purified humic acid was characterized by means of UV-vis, IR, and pH titration, indicating high carboxylate capacity and low aromaticity. Binding constants of americium and europium humates were determined at pH 4.6 and 6.0 by solvent extraction using 241Am or 152Eu as a tracer. The binding constants for americium-humate obtained preliminarily suggest that complexes with humic acid are not negligible in speciation of trivalent actinides in hydrosphere. The obtained binding constants were nearly identical with those determined previously by the same procedures, but with humic acids of different origin and compositions. (author)

  19. Preparation of americium source for smoke detector

    International Nuclear Information System (INIS)

    This report describes the method developed for the preparation of 241Am source for smoke detector. Americium was electrodeposited from iso-propyl alcohol medium on silver backing. Thin layer of gold (few hundred micro gram thick) was plated on the americium source to make it safe for handling. The thickness of plated gold was such that the alpha radiations from the 241Am source could escape out of the gold layer and cause ionisation in the surrounding air. The performance of the prepared sources were checked in a smoke detector and was found to be satisfactory and comparable to the imported sources. (author). 1 refs., 2 figs., 1 tab

  20. Excited levels of Pa-233; Niveles excitados del Pa-233

    Energy Technology Data Exchange (ETDEWEB)

    Vara Cuadrado, J. M.

    1969-07-01

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T{sub 1}) detectors. (Author) 54 refs.

  1. Recovery of americium-241 from raffinates of plutonium purification columns

    International Nuclear Information System (INIS)

    Recovery and purification of americium from ion exchange raffinates generated during purification of aged plutonium is described. The method consists of the following stages: (i) co-precipitation of americium with kilogramme quantities of rare earth oxalates, (ii) destruction of oxalate and removal of residual plutonium from nitric acid medium using anion exchange process, (iii) preliminary separation of americium making use of its preferential uptake on an anion exchange column from thiocyanate medium and (iv) extraction of americium and remaining rare earths into di-(2-ethyl hexyl) phosphoric acid followed by preferential back washing of americium by lactic acid medium containing DTPA. (author)

  2. Disposition Options for Uranium-233

    International Nuclear Information System (INIS)

    The U.S. Department of Energy (DOE) Fissile Materials Disposition Program (MD), in support of the U.S. arms-control and nonproliferation policies, has initiated a program to disposition surplus weapons-usable fissile material by making it inaccessible and unattractive for use in nuclear weapons. Weapons-usable fissile materials include plutonium, high-enriched uranium (HEU), and uranium-233 (sup 233)U. In support of this program, Oak Ridge National Laboratory led DOE's contractor efforts to identify and characterize options for the long-term storage and disposal of excess (sup 233)U. Five storage and 17 disposal options were identified and are described herein

  3. 1976 Hanford americium exposure incident: psychological aspects

    International Nuclear Information System (INIS)

    Accidents involving exposure to radiation or radioactive materials may involve an unusual degree of emotional trauma. Methods that may be employed in dealing with such trauma are discussed in relation to a specific accident in which a radiation worker was injured and seriously contaminated with americium-241

  4. Americium separations from high salt solutions

    International Nuclear Information System (INIS)

    Americium (III) exhibits an unexpectedly high affinity for anion-exchange material from the high-salt evaporator bottoms solutions--an effect which has not been duplicated using simple salt solutions. Similar behavior is observed for its lanthanide homologue, Nd(III), in complex evaporator bottoms surrogate solutions. There appears to be no single controlling factor--acid concentration, total nitrate concentration or solution ionic strength--which accounts for the approximately 2-fold increase in retention of the trivalent ions from complex solutions relative to simple solutions. Calculation of species activities (i.e., water, proton and nitrate) in such concentrated mixed salt solutions is difficult and of questionable accuracy, but it is likely that the answer to forcing formation of anionic nitrate complexes of americium lies in the relative activities of water and nitrate. From a practical viewpoint, the modest americium removal needs (ca. 50--75%) from nitric acid evaporator bottoms allow sufficient latitude for the use of non-optimized conditions such as running existing columns filled with older, well-used Reillex HPQ. Newer materials, such as HPQ-100 and the experimental bifunctional resins, which exhibit higher distribution coefficients, would allow for either increased Am removal or the use of smaller columns. It is also of interest that one of the experimental neutral-donor solid-support extractants, DHDECMP, exhibits a similarly high level of americium (total alpha) removal from EV bottoms and is much less sensitive to total acid content than commercially-available material

  5. Excited levels of Pa-233

    International Nuclear Information System (INIS)

    A study of Pa-233 excited levels from the alpha decay of Np-237 and from beta decay of Th-233 has been performed. The alpha decay spectrum was measured with a semiconductor spectrometer of 18 keV effective resolution (FWHM). Over 13 new lines were identified. The gamma ray spectra of Np-237 and Th-233 were obtained with a Ge-Li detector low and medium range energy lines, and with Si-Li detector for the low energy region. A continuous purification method of Np-237 from its comparatively short-lived daughter Pa-233 was applied. A high number of new lines were identified in both spectra. The gamma-gamma coincidence spectra were obtained with INa(T1) detectors. (Author) 54 refs

  6. Decontaminaion of metals containing plutonium and americium

    International Nuclear Information System (INIS)

    Melt-slagging (melt-refining) techniques were evaluated as a decontamination and consolidation step for metals contaminated with oxides of plutonium and americium. Experiments were performed in which mild steel, stainless steel, and nickel contaminated with oxides of plutonium and americium were melted in the presence of silicate slags of various compositions. The metal products were low in contamination, with the plutonium and americium strongly fractionated to the slags. Partition coefficients (plutonium in slag/plutonium in steel) of 7 x 106 were measured with boro-silicate slag and of 3 x 106 with calcium, magnesium silicate slag. Decontamination of metals containing as much as 14,000 ppM plutonium appears to be as efficient as for metals with plutonium levels of 400 ppM. Staged extraction, that is, a remelting of processed metal with clean slag, results in further decontamination of the metal. The second extraction is effective with either resistance-furnace melting or electric-arc melting. Slag adhering to the metal ingots and in defects within the ingots is in the important contributors to plutonium retained in processed metals. If these sources of plutonium are controlled, the melt-refining process can be used on a large scale to convert highly contaminated metals to homogeneous and compact forms with very low concentrations of plutonium and americium. A conceptual design of a melt-refining process to decontaminate plutonium- and americium-contaminated metals is described. The process includes single-stage refining of contaminated metals to produce a metal product which would have less than 10 nCi/g of TRU-element contamination. Two plant sizes were considered. The smaller conceptual plant processes 77 kg of metal per 8-h period and may be portable.The larger one processes 140 kg of metal per 8-h period, is stationary, and may be near te maximum size that is practical for a metal decontamination process

  7. 8 CFR 233.1 - Contracts.

    Science.gov (United States)

    2010-01-01

    ... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Contracts. 233.1 Section 233.1 Aliens and Nationality DEPARTMENT OF HOMELAND SECURITY IMMIGRATION REGULATIONS CONTRACTS WITH TRANSPORTATION LINES § 233.1 Contracts. The contracts with transportation lines referred to in section 233(c) of the Act may...

  8. Status of Americium-241 recovery at Rocky Flats Plant

    International Nuclear Information System (INIS)

    This paper is presented in two parts: Part I, Molten Salt Extraction of Americium from Molten Plutonium Metal, and Part II, Aqueous Recovery of Americium from Extraction Salts. The Rocky Flats recovery process used for waste salts includes (1) dilute hydrochloric acid dissolution of residues; (2) cation exchange to convert from the chloride to the nitrate system and to remove gross amounts of monovalent impurities; (3) anion exchange separation of plutonium; (4) oxalate precipitation of americium; and (5) calcination of the oxalate at 6000C to yield americium oxide. The aqueous process portion describes attempts to improve the recovery of americium. The first part deals with modifications to the cation exchange step; the second describes development of a solvent extractions process that will recovery americium from residues containing aluminium as well as other common impurities. Results of laboratory work are described. 3 figures, 6 tables. (DP)

  9. Plutonium and americium in soil organic matter

    International Nuclear Information System (INIS)

    A gley soil from west Cumbria, with specific activities in its surface horizon of 5-10 kBq kg-1239,240Pu and comparable 241Am levels, has been used as a source of actinide-enriched organic fractions. Humic and fulvic acids were isolated by conventional alkali extraction and investigated by gel filtration, treatment with organic solvents and differential flocculation procedures. All these techniques are capable of resolving the organics into two or more fractions, with specific activities up to 80 kBq kg-239,240Pu. There is evidence for differentiation of plutonium and americium, with americium being concentrated, to some extent, in the lower molecular weight fractions from gel filtration. (author)

  10. Incentives for transmutation of americium in thermal reactors

    International Nuclear Information System (INIS)

    This report describes possible benefits when americium is irradiated in a thermal reactor. If all plutonium is partitioned from spent fuel, americium is the main contributor to the radiotoxicity of spent fuel upto several thousands of years of storage. It is shown that americium can be transmuted to other nuclides upon irradiation in a thermal reactor, leading to a 50% reduction of the radiotoxicity of neptunium, which can be an important contributor to the dose due to leakage of nuclides after one million years of storage. The radiotoxicity of americium can be reduced considerably after irradiation for 3 to 6 years in a thermal reactor with thermal neutron flux of 1014 cm-2s-1. The strongly α and neutron emitting transmutation products can most probably not be recycled again, so a transmutation process is suggested in which americium is irradiated for 3 to 6 years and then put to final storage. It is shown that the radiotoxicity of the transmuation products after a storage time of about one hundred years can be considerably reduced compared to the radiotoxicity of the initial americium. The same holds for the α activity and heat emission of the transmutation products. Because plutonium in spent fuel contributes for about 80% to the radiotoxicity upto 105 years of storage, recycling and transmutation of plutonium has first priority. Transmutation of americium is only meaningful when the radiotoxicity of plutonium is reduced far below the radiotoxicity of americium. (orig.)

  11. Americium transfer studies using hollow fiber/extractant membranes

    International Nuclear Information System (INIS)

    Americium can be removed from low acid/high nitrate feeds using hollow fiber membrane modules. Americium can be concentrated in the stripping solution. (Maximum observed concentration was a factor of 3.1). Accurel hollow fibers are less prone to leakage problems

  12. 7 CFR 58.233 - Skim milk.

    Science.gov (United States)

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Skim milk. 58.233 Section 58.233 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards... Materials § 58.233 Skim milk. The skim milk shall be separated from whole milk meeting the requirements...

  13. 45 CFR 233.70 - Blindness.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Blindness. 233.70 Section 233.70 Public Welfare... FINANCIAL ASSISTANCE PROGRAMS § 233.70 Blindness. (a) State plan requirements. A State plan under title X or XVI of the Social Security Act must: (1) Contain a definition of blindness in terms of...

  14. 40 CFR 233.71 - New Jersey.

    Science.gov (United States)

    2010-07-01

    ... Director of the Federal Register in accordance with 552(a) and 1 CFR part 51. Material is incorporated as... 40 Protection of Environment 24 2010-07-01 2010-07-01 false New Jersey. 233.71 Section 233.71... REGULATIONS Approved State Programs § 233.71 New Jersey. The applicable regulatory program for discharges...

  15. 49 CFR 233.13 - Criminal penalty.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Criminal penalty. 233.13 Section 233.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION SIGNAL SYSTEMS REPORTING REQUIREMENTS § 233.13 Criminal penalty....

  16. 45 CFR 233.80 - Disability.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Disability. 233.80 Section 233.80 Public Welfare... FINANCIAL ASSISTANCE PROGRAMS § 233.80 Disability. (a) State plan requirements. A State plan under title XIV...; and (ii) “Totally” is related to the degree of disability. The following definition is...

  17. 14 CFR 23.3 - Airplane categories.

    Science.gov (United States)

    2010-01-01

    ... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airplane categories. 23.3 Section 23.3... STANDARDS: NORMAL, UTILITY, ACROBATIC, AND COMMUTER CATEGORY AIRPLANES General § 23.3 Airplane categories. (a) The normal category is limited to airplanes that have a seating configuration, excluding...

  18. 22 CFR 23.3 - Refunds.

    Science.gov (United States)

    2010-04-01

    ... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Refunds. 23.3 Section 23.3 Foreign Relations DEPARTMENT OF STATE FEES AND FUNDS FINANCE AND ACCOUNTING § 23.3 Refunds. (a) Rectifications and readjustments. See § 22.6 of this chapter for outline of circumstances under which fees which have...

  19. 49 CFR 233.9 - Reports.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Reports. 233.9 Section 233.9 Transportation Other... TRANSPORTATION SIGNAL SYSTEMS REPORTING REQUIREMENTS § 233.9 Reports. Not later than April 1, 1997 and every 5 years thereafter, each carrier shall file with FRA a signal system status report “Signal System...

  20. 49 CFR 234.233 - Rail joints.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Rail joints. 234.233 Section 234.233..., DEPARTMENT OF TRANSPORTATION GRADE CROSSING SIGNAL SYSTEM SAFETY AND STATE ACTION PLANS Maintenance, Inspection, and Testing Maintenance Standards § 234.233 Rail joints. Each non-insulated rail joint...

  1. 12 CFR 23.3 - Lease requirements.

    Science.gov (United States)

    2010-01-01

    ... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Lease requirements. 23.3 Section 23.3 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY LEASING General Provisions § 23.3 Lease... connection with leasing that property, and may engage in activities incidental thereto, if the...

  2. Electronic structure of compressed americium metal

    Czech Academy of Sciences Publication Activity Database

    Kolorenč, Jindřich; Shick, Alexander; Caciuffo, R.

    Cambridge: Cambridge University Press,, 2012 - (Anderson, D.; Boot, C.; Burns, P.), s. 177-182. (Materials Research Society Symposium Proceedings. 1444). ISBN 978-1-60511-421-7. ISSN 0272-9172. [2012 MRS Spring Meeting. Sacramento (CA), 09.04.2012-13.04.2012] R&D Projects: GA ČR(CZ) GAP204/10/0330; GA AV ČR IAA100100912 Institutional research plan: CEZ:AV0Z10100520 Keywords : americium * X-ray spectroscopy * LDA+DMFT Subject RIV: BM - Solid Matter Physics ; Magnetism http://journals.cambridge.org/article_S1946427412009463

  3. Plutonium and U-233 mines

    International Nuclear Information System (INIS)

    A comparison is made among second generation reactor systems fuelled primarily with fissile plutonium and/or U-233 in uranium or thorium. This material is obtained from irradiated fuel from first generation CANDU reactors fuelled by natural or enriched uranium and thorium. Except for plutonium-thorium reactors, second generation reactors demand similar amounts of reprocessing throughput, but the most efficient plutonium burning systems require a large prior allocation of uranium. Second generation reactors fuelled by U-233 make more efficient use of resources and lead to more flexible fuelling strategies, but require development of first generation once-through thorium cycles and early demonstration of the commercial viability of thorium fuel reprocessing. No early implementation of reprocessing technology is required for these cycles

  4. Electrochemical oxidation of americium in nitric medium: study of reaction mechanisms; Oxydation de l'americium par voie electrochimique: etude des mecanismes

    Energy Technology Data Exchange (ETDEWEB)

    Picart, S.; Chartier, D.; Donnet, L.; Adnet, J.M. [CEA Valrho, (DCC/DRRV/SPHA), 30 - Marcoule (France)

    2000-07-01

    One alternative selected by the CEA for partitioning minor actinides from aqueous solutions containing fission products is the selective extraction of oxidized americium. This is the SESAME process (Selective Extraction and Separation of Americium by Means of Electrolysis) aimed to convert americium to oxidation state (VI) and then extract it with a specific extractant of high valences. This paper presents the study of the electrochemical oxidation of americium in nitric medium which represents an important stage of the process. The reaction can be divided into two main steps: oxidation of americium (III) to americium (IV), and then of americium (IV) to americium (VI). For the first oxidation step, a ligand L is needed to stabilize the intermediate species americium (IV) which disproportionates in its free form into americium (III) and (V). Phospho-tungstate or silico-tungstate are appropriate ligands because they are stable in concentrated nitric acid and show a great affinity for metallic cations at oxidation state (IV) (Table 1 lists the stability constants of americium (IV) complexes). The presence of the lacunary poly-anion lowers the potential of the americium (IV) / americium (Ill) redox pair (see Figure 5 for the diagram of the apparent formal potential of americium versus ligand concentration). This makes it thermodynamically possible to oxidize americium (III) into americium (IV) at the anode of an electrolyzer in nitric acid. For the second oxidation step, a strong oxidant redox mediator, like silver (II), is needed to convert complexed americium at oxidation state (IV) to oxidation state (V). The AmVL complex is then hydrolyzed to yield americyle (V) aqua ion. A spectroscopic Raman study with {sup 18}O labeled species showed that the oxygen atoms of the americyle moiety came from water. This indicates that water hydrolyzes the americium (V) complex to produce americyle (V) aqua ion, AmO{sub 2}{sup +}. This cation reacts with silver (Il) to give

  5. Modelling of americium stripping in the EXAm process

    International Nuclear Information System (INIS)

    The EXAm process aims at recovering americium alone contained in the PUREX raffinate. The americium stripping model has been revised to take into account a change of stripping aqueous phase and up-to-date experimental results conducted within DRCP to improve knowledge about complexes. This work represents a first approximation at modelling americium stripping. The modelling work has led to synthesize the knowledge on chemical phenomenology and adopt assumptions that best reflect experimental results. The modelling has been implemented in PAREX code in order to simulate this step to prepare and understand tests to be carried out in mixer settlers. (authors)

  6. Higher Americium Oxidation State Research Roadmap

    Energy Technology Data Exchange (ETDEWEB)

    Mincher, Bruce J. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Law, Jack D. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Goff, George S. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Moyer, Bruce A. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Burns, Jon D. [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Lumetta, Gregg J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Sinkov, Sergey I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Shehee, Thomas C. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL); Hobbs, David T. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)

    2015-12-18

    The partitioning of hexavalent Am from dissolved nuclear fuel requires the ability to efficiently oxidize Am(III) to Am(VI) and to maintain that oxidation state for a length of time sufficient to perform the separation. Several oxidants have been, or are being developed. Chemical oxidants include Ag-catalyzed ozone, Ag-catalyzed peroxydisulfate, Cu(III) periodate, and sodium bismuthate. Hexavalent americium has also now successfully been prepared by electrolysis, using functionalized electrodes. So-called auto-reduction rates of Am(VI) are sufficiently slow to allow for separations. However, for separations based on solvent extraction or ion exchange using organic resins, the high valence state must be maintained under the reducing conditions of the organic phase contact, and a holding oxidant is probably necessary. Until now, only Cu(III) periodate and sodium bismuthate oxidation have been successfully combined with solvent extraction separations. Bismuthate oxidation provided the higher DAm, since it acts as its own holding oxidant, and a successful hot test using centrifugal contactors was performed. For the other oxidants, Ag-catalyzed peroxydisulfate will not oxidize americium in nitric acid concentrations above 0.3 M, and it is not being further investigated. Peroxydisulfate in the absence of Ag catalysis is being used to prepare Am(V) in ion exchange work, discussed below. Preliminary work with Ag-catalyzed ozone has been unsuccessful for extractions of Am(VI) from 6.5 M HNO3, and only one attempt at extraction, also from 6.5 M HNO3, using the electrolytic oxidation has been attempted. However, this high acid concentration was based on the highest Am extraction efficiency using the bismuthate oxidant; which is only sparingly soluble, and thus the oxidation yield is based on bismuthate solubility. Lower acid concentrations may be sufficient with alternative oxidants and work with Ag-ozone, Cu(III) and electrolysis is on-going. Two non

  7. Mixed chelation therapy for removal of plutonium and americium

    International Nuclear Information System (INIS)

    Iron-binding compounds, 2,3-dihydroxybenzoic acid (DHBA), 2-hydroxybenzoic acid (HBA), and 2-(acetyloxy)benzoic acid (ABA), were tested for their ability to remove americium and plutonium from rats following intraperitioneal injection of the radionuclides as citrates (pH 5). Treatments, 2 mmol/kg, were given on days 3, 6, 10, 12 and 14 following the actinide injection. DHBA and HBA caused about a 20% decrease in liver retention of americium compared to the control value, and DHB caused a similar effect for plutonium. The above agents, co-administered with 0.5 mmol polyaminopolycarboxylic acid (PAPCA)-type chelons, did not change tissue retention of americium and plutonium from that due to the PAPCAs alone. Administration of americium and plutonium to the same rats is useful for studying removal agents since the two actinides behave independently in their biological disposition and response to removal

  8. Plutonium and Americium Geochemistry at Hanford: A Site Wide Review

    Energy Technology Data Exchange (ETDEWEB)

    Cantrell, Kirk J.; Felmy, Andrew R.

    2012-08-23

    This report was produced to provide a systematic review of the state-of-knowledge of plutonium and americium geochemistry at the Hanford Site. The report integrates existing knowledge of the subsurface migration behavior of plutonium and americium at the Hanford Site with available information in the scientific literature regarding the geochemistry of plutonium and americium in systems that are environmentally relevant to the Hanford Site. As a part of the report, key research needs are identified and prioritized, with the ultimate goal of developing a science-based capability to quantitatively assess risk at sites contaminated with plutonium and americium at the Hanford Site and the impact of remediation technologies and closure strategies.

  9. Americium/Curium Disposition Life Cycle Planning Study

    International Nuclear Information System (INIS)

    At the request of the Department of Energy Savannah River Office (DOE- SR), Westinghouse Savannah River Company (WSRC) evaluated concepts to complete disposition of Americium and Curium (Am/Cm) bearing materials currently located at the Savannah River Site (SRS)

  10. 12 CFR 233.4 - Exemptions.

    Science.gov (United States)

    2010-01-01

    ... FUNDING OF UNLAWFUL INTERNET GAMBLING (REGULATION GG) § 233.4 Exemptions. (a) Automated clearing house... business are exempt from this regulation's requirements for establishing written policies and...

  11. Gamma-sources on the basis of metallic americium-241

    International Nuclear Information System (INIS)

    A batch of gamma-radiation sources has been manufactured from metallic americium-241 of isotopic purity, its activity varying from 0.08 to 0.93 GBq. The cores of the sources are high-purity americium metal condensate on a tantalum or stainless steel substrate prepared by thermal decomposition of 241Pu-241Am alloy in a high vacuum. 7 refs., 1 tab

  12. Pyrochemical investigations into recovering plutonium from americium extraction salt residues

    International Nuclear Information System (INIS)

    Progress into developing a pyrochemical technique for separating and recovering plutonium from spent americium extraction waste salts has concentrated on selective chemical reduction with lanthanum metal and calcium metal and on the solvent extraction of americium with calcium metal. Both techniques are effective for recovering plutonium from the waste salt, although neither appears suitable as a separation technique for recycling a plutonium stream back to mainline purification processes. 17 refs., 13 figs., 2 tabs

  13. 1976 Hanford americium-exposure incident: external decontamination procedures

    International Nuclear Information System (INIS)

    An accident resulted in the deposition on an injured workman's skin surfaces, in acid-burned areas and in lacerations, of something in excess of 6 mCi americium-241. The external decontamination procedures used, the change in americium content of the skin during the course of treatment, and some of the unusual problems encountered from the extrusion of foreign material and flaking of skin and scar tissue are described

  14. Dicty_cDB: SLB233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLB233 (Link to dictyBase) slb233 - - Contig-U16290-1 SLB233P ...(Link to Original site) SLB233F 697 SLB233Z 631 SLB233P 1328 - - Show SLB233 Library SL (Link to library) Clone ID SLB...233 (Link to dictyBase) Atlas ID slb233 NBRP ID - dictyBase ID - Link to Contig Contig-U16290-1 Or...iginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLB2-B/SLB233Q.Seq.d/ R...epresentative seq. ID SLB233P (Link to Original site) Representative DNA sequence >SLB233 (SLB233Q) /CSM/SL/SLB2-B/SLB

  15. Dicty_cDB: SLD233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available SL (Link to library) SLD233 (Link to dictyBase) sld233 - - Contig-U15622-1 SLD233P ...(Link to Original site) SLD233F 296 SLD233Z 383 SLD233P 679 - - Show SLD233 Library SL (Link to library) Clone ID SLD2...33 (Link to dictyBase) Atlas ID sld233 NBRP ID - dictyBase ID - Link to Contig Contig-U15622-1 Ori...ginal site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLD2-B/SLD233Q.Seq.d/ Re...presentative seq. ID SLD233P (Link to Original site) Representative DNA sequence >SLD233 (SLD233Q) /CSM/SL/SLD2-B/SLD2

  16. 48 CFR 233.215 - Contract clause.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Contract clause. 233.215....215 Contract clause. Use Alternate I of the clause at FAR 52.233-1, Disputes, when— (1) The... (v) Tracked combat vehicles (vi) Related electronic systems; (2) The contracting officer...

  17. Electrochemical oxidation of americium in nitric medium: study of reaction mechanisms

    International Nuclear Information System (INIS)

    One alternative selected by the CEA for partitioning minor actinides from aqueous solutions containing fission products is the selective extraction of oxidized americium. This is the SESAME process (Selective Extraction and Separation of Americium by Means of Electrolysis) aimed to convert americium to oxidation state (VI) and then extract it with a specific extractant of high valences. This paper presents the study of the electrochemical oxidation of americium in nitric medium which represents an important stage of the process. The reaction can be divided into two main steps: oxidation of americium (III) to americium (IV), and then of americium (IV) to americium (VI). For the first oxidation step, a ligand L is needed to stabilize the intermediate species americium (IV) which disproportionates in its free form into americium (III) and (V). Phospho-tungstate or silico-tungstate are appropriate ligands because they are stable in concentrated nitric acid and show a great affinity for metallic cations at oxidation state (IV) (Table 1 lists the stability constants of americium (IV) complexes). The presence of the lacunary poly-anion lowers the potential of the americium (IV) / americium (Ill) redox pair (see Figure 5 for the diagram of the apparent formal potential of americium versus ligand concentration). This makes it thermodynamically possible to oxidize americium (III) into americium (IV) at the anode of an electrolyzer in nitric acid. For the second oxidation step, a strong oxidant redox mediator, like silver (II), is needed to convert complexed americium at oxidation state (IV) to oxidation state (V). The AmVL complex is then hydrolyzed to yield americyle (V) aqua ion. A spectroscopic Raman study with 18O labeled species showed that the oxygen atoms of the americyle moiety came from water. This indicates that water hydrolyzes the americium (V) complex to produce americyle (V) aqua ion, AmO2+. This cation reacts with silver (Il) to give americyle (VI) ion. Figure

  18. Complexation of americium with humic acid

    International Nuclear Information System (INIS)

    As a part of the interlaboratory comparison exercise for the complexation of humic acid and colloid generation (COCO-Club activities) in the CEC project MIRAGE-II, the complexation of americium with humic acid has been studied in our laboratory. Two humic acids were used for the study: Aldrich-HA(H+) which is a reference humic acid of the COCO-Club and Bradford-HA(H+) from Lake Bradford, Florida. A wide concentration range of humic acid and different ratios of Am to humic acid have been investigated between pH 5 and 6 with the ionic strength of 0.1 M and 1.0 M. The complexation has been studied by UV-spectroscopy, Laser-induced Photoacoustic Spectroscopy (LPAS) and ultrafiltration. LPAS is used for the submicromolar concentration range where the sensitivity of UV spectroscopy is not accessible. Ultrafiltration is used for low Am to humic acid ratios where both spectroscopic methods are not applicable. Varying the humic acid concentration over three orders of magnitude, only a 1:1 type of binding is observed. No significant variation of the stability constant is found in the investigated range of pH and ionic strength. However, the precipitation tendency and the loading capacity of humic acid are found to depend sensitively on pH and ionic strength. The complexation study provides a deep insight into the influence of humic acid on the migration behaviour of fission products and actinides in the geosphere. (orig.)

  19. Analysis of BWR lattices to recycle americium

    International Nuclear Information System (INIS)

    This study was carried out to assess the ability to eliminate meaningful quantities of americium in a primarily thermal neutron flux by 'spiking' modern BWR fuel with this minor actinide (MA). The studies carried out so far include the simulation of modern 10 x 10 BWR lattices employing the Westinghouse lattice physics code PHOENIX-4 alongside validation studies using MCNP5 models of the same lattices that were spatially depleted via the MONTEBURNS code coupling to ORIGEN. When considering the total inventory of minor actinides in Am-spiked pins, excluding isotopes of uranium and plutonium, the results indicate that a reduction of approximately 50% or more in the total mass inventory of these minor actinides is viable within the selected pins. Therefore, these preliminary results have encouraged the extension of this work to the development of improved lattice designs to help optimize the transmutation rates as well as absolute MA inventory reductions. The ultimate goal being to design batches of these advanced BWR bundles alongside multi-cycle core reload strategies. (authors)

  20. Applicability of insoluble tannin to treatment of waste containing americium

    International Nuclear Information System (INIS)

    The applicability of insoluble tannin adsorbent to the treatment of aqueous waste contaminated with americium has been investigated. Insoluble tannin is considered highly applicable because it consists of only carbon, hydrogen and oxygen and so its volume can be easily reduced by incineration. This report describes measurements of the americium distribution coefficient in low concentration nitric acid. The americium distribution coefficients were found to decrease with increasing concentration of nitric acid and sodium nitrate, and with increasing temperature. At 25 C in 2.0 x 10-3 M HNO3, the distribution coefficient was found to be 2000 ml g-1. The adsorption capacity was determined by column experiments using europium as a simulant of americium, and found to be 7 x 10-3 mmol g-1-dried tannin in 0.01 M HNO3 at 25 C, which corresponds to approximately 1.7 mg-241Am/g-adsorbent(dried). The prospect of applying the adsorbent to the treatment of aqueous waste contaminated with americium appears promising. (orig.)

  1. Preserving high-purity 233U

    International Nuclear Information System (INIS)

    The MARC X Conference hosted a workshop for the scientific community to communicate needs for high-purity 233U and its by-products in order to preserve critical items otherwise slated for downblending and disposal. Currently, only small portions of the U.S. holdings of separated 233U are being preserved. However, many additional kilograms of 233U (>97 % pure) still are destined to be disposed, and it is unlikely that this material will ever be replaced due to a lack of operating production capability. Summaries of information conveyed at the workshop and feedback obtained from the scientific community are presented herein. (author)

  2. A TRUEX-based separation of americium from the lanthanides

    Energy Technology Data Exchange (ETDEWEB)

    Bruce J. Mincher; Nicholas C. Schmitt; Mary E. Case

    2011-03-01

    Abstract: The inextractability of the actinide AnO2+ ions in the TRUEX process suggests the possibility of a separation of americium from the lanthanides using oxidation to Am(V). The only current method for the direct oxidation of americium to Am(V) in strongly acidic media is with sodium bismuthate. We prepared Am(V) over a wide range of nitric acid concentrations and investigated its solvent extraction behavior for comparison to europium. While a separation is achievable in principal, the presence of macro amounts of cerium competes for the sparingly soluble oxidant and the oxidant itself competes for CMPO complexation. These factors conspire to reduce the Eu/Am separation factor from ~40 using tracer solutions to ~5 for extractions from first cycle raffinate simulant solution. To separate pentavalent americium directly from the lanthanides using the TRUEX process, an alternative oxidizing agent will be necessary.

  3. Salvage of plutonium-and americium-contaminated metals

    International Nuclear Information System (INIS)

    Melt-slagging techniques were evaluated as a decontamination and consolidation step for metals contaminated with oxides of plutonium and americium. Experiments were performed in which mild steel, stainless steel, and nickel metals contaminated with oxides of plutonium and americium were melted in the presence of silicate slags of various compositions. The metal products were low in contamination, with the plutonium and americium strongly fractionated to the slags. Partition coefficients (plutonium in slag/plutonium in steel) of 7*10/sup 6/ with borosilicate slag and 3*10/sup 6/ for calcium, magnesium silicate slag were measured. Decontamination of metals containing as much as 14,000 p.p.m. plutonium appears to be as efficient as that of metals with plutonium levels of 400 p.p.m. Staged extraction, that is, a remelting of processed metal with clean slag, results in further decontamination of the metal. 10 refs

  4. 49 CFR 233.3 - Application.

    Science.gov (United States)

    2010-10-01

    ... TRANSPORTATION SIGNAL SYSTEMS REPORTING REQUIREMENTS § 233.3 Application. (a) Except as provided in paragraph (b... the general railroad system of transportation. (b) This part does not apply to rail rapid...

  5. The Pa-233 fission cross section

    International Nuclear Information System (INIS)

    The energy dependent neutron-induced fission cross section of 233Pa has for the first time been measured directly with mono-energetic neutrons. This isotope is produced in the thorium fuel cycle and serves as an intermediate step between the 232Th source material and the 233U fuel material. Four neutron energies between 1.0 and 3.0 MeV have been measured in a first campaign. Some preliminary results are presented and compared to literature. (author)

  6. Uptake of americium-241 by algae and bacteria

    International Nuclear Information System (INIS)

    The uptake of americium by three algae, scenedesmus obliquus, selenastrum capricomutum and chlorella pyrenosdosa and a bacterium aeromonas hydrophila was studied. Live and fixed cells of each algal species and live bacterial cells were used. it is shown that algae and bacteria concentrate americium 241 to a high degree which makes them important links in the biomagnification phenomenon which may ultimately lead to a human hazard and be potentially important in recycling Am 241 in the water column and mobilization from sediments. Chemical fixation of algal cells caused increased uptake which indicated that uptake is by passive diffusion and probably due to chemical alteration of surface binding sites. (U.K.)

  7. Americium incineration by recycling in target rods using coated particles

    International Nuclear Information System (INIS)

    This paper proposes a type of target rod based on the use of coated particles, for an efficient incineration of americium in nuclear reactors. The analysis takes advantage of the experience gained in the past from long duration irradiation without damage of coated particles with plutonium oxide kernels. A conservative theoretical evaluation of the gas pressure inside the coated particles at the end of irradiation allows comparing the well known conditions of the plutonium oxide particles which were successfully irradiated to high burn-up, with a preliminary design of americium oxide particles. (authors)

  8. Dicty_cDB: SFL233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MKIKIXXPPXRKXXVWIGGXILXSLSTFXQMWXSKX Translated Amino Acid sequence (All Frames) Frame A: iasdfg**rkrfspftki...SF (Link to library) SFL233 (Link to dictyBase) - - - Contig-U16382-1 SFL233P (Link... to Original site) SFL233F 480 SFL233Z 142 SFL233P 622 - - Show SFL233 Library SF (Link to library) Clone ID... SFL233 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16382-1 Original site...xptnvdxxx Frame B: slptsvnnekdfrlllkyfrepks*rqlslff*iglpipktnkln*iknkngw*rcssfs y**rfwyv*srfcw*rcstccfpincws

  9. 1976 Hanford americium exposure incident: overview and perspective

    International Nuclear Information System (INIS)

    Salient features of the 1976 Hanford americium exposure incident are discussed. Comparisons are made with previous human and animal exposure data, and conclusions drawn relative to the injured workman, to health physics practices, and to the adequacy of current exposure limits

  10. Americium retention by the smectite hectorite

    International Nuclear Information System (INIS)

    Document available in extended abstract form only. Clay minerals may play an important role in a high level nuclear waste disposal site. Smectites may be major components of backfill material used to enhance the retention properties of engineered barriers. Furthermore, they have also been detected in the alteration layer of nuclear waste glass corroded in laboratory experiments. For example, the smectite hectorite (Na0.33[Mg2.67Li0.33Si4O10(OH)2]) was identified as phase forming upon waste matrix dissolution and subsequent reprecipitation. Smectites are known to be highly reactive with respect to cations in aqueous systems. Several distinct molecular scale binding mechanisms may operate, but the most effective retention may occur by incorporation in the bulk structure, especially if a (meta)stable solid solution forms. Investigations showed the possibility to incorporate Lu(III) in a clay-like octahedral site in hectorite by coprecipitation. Furthermore, luminescence studies on hectorite synthesized in the presence of Cm(III) or Eu(III) were consistent with an incorporation in the bulk structure. However, structural data such as coordination numbers and bond lengths are still missing for the actinides. In the present study, Am(III) was coprecipitated with and adsorbed on hectorite to decipher the actual retention mechanism(s). Hectorite was synthesized in the presence of Am(III) (sample AmCopHec) from an Am-containing brucite precursor phase. Briefly, brucite was freshly precipitated in the presence of Am(III) (Am:Mg molar ratio of 1:1175) and washed. The resulting sol was aged in a tightly closed vessel in the presence of LiF and silica sol for several days at 90 C. Separately, an Am-containing brucite phase (sample AmCopBru) was prepared under identical conditions as described above, and the americium aqua ions were adsorbed on hectorite (m/V = 2 g/L, [Am(III)]tot = 105 μmol/L, 0.5 mol/L NaClO4, pH = 6.4(1), sample AmSorbHec) and used as reference samples. X

  11. Synthesis and characterization of uranium-americium mixed oxides

    International Nuclear Information System (INIS)

    Americium isotopes represent a significant part of high-level and long-lived nuclear waste in spent fuels. Among the envisaged reprocessing scenarios, their transmutation in fast neutron reactors using uranium-americium mixed-oxide pellets (U1-xAmxO2±δ) is a promising option which would help decrease the ecological footprint of ultimate waste repository sites. In this context, this thesis is dedicated to the study of such compounds over a wide range of americium contents (7.5 at.% ≤ Am/(U+Am) ≤ 70 at.%), with an emphasis on their fabrication from single-oxide precursors and the assessment of their structural and thermodynamic stabilities, also taking self-irradiation effects into account. Results highlight the main influence of americium reduction to Am(+III), not only on the mechanisms of solid-state formation of the U1-xAmxO2±δ solid solution, but also on the stabilization of oxidized uranium cations and the formation of defects in the oxygen sublattice such as vacancies and cub-octahedral clusters. In addition, the data acquired concerning the stability of U1-xAmxO2±δ compounds (existence of a miscibility gap, vaporization behavior) were compared to calculations based on new thermodynamic modelling of the U-Am-O ternary system. Finally, α-self-irradiation-induced structural effects on U1-xAmxO2±δ compounds were analyzed using XRD, XAS and TEM, allowing the influence of americium content on the structural swelling to be studied as well as the description of the evolution of radiation-induced structural defects. (author)

  12. Reduction Rates for Higher Americium Oxidation States in Nitric Acid

    Energy Technology Data Exchange (ETDEWEB)

    Grimes, Travis Shane [Idaho National Lab. (INL), Idaho Falls, ID (United States); Mincher, Bruce Jay [Idaho National Lab. (INL), Idaho Falls, ID (United States); Schmitt, Nicholas C [Idaho National Lab. (INL), Idaho Falls, ID (United States)

    2015-09-30

    The stability of hexavalent americium was measured using multiple americium concentrations and nitric acid concentrations after contact with the strong oxidant sodium bismuthate. Contrary to our hypotheses Am(VI) was not reduced faster at higher americium concentrations, and the reduction was only zero-order at short time scales. Attempts to model the reduction kinetics using zero order kinetic models showed Am(VI) reduction in nitric acid is more complex than the autoreduction processes reported by others in perchloric acid. The classical zero-order reduction of Am(VI) was found here only for short times on the order of a few hours. We did show that the rate of Am(V) production was less than the rate of Am(VI) reduction, indicating that some Am(VI) undergoes two electron-reduction to Am(IV). We also monitored the Am(VI) reduction in contact with the organic diluent dodecane. A direct comparison of these results with those in the absence of the organic diluent showed the reduction rates for Am(VI) were not statistically different for both systems. Additional americium oxidations conducted in the presence of Ce(IV)/Ce(III) ions showed that Am(VI) is reduced without the typical growth of Am(V) observed in the systems sans Ce ion. This was an interesting result which suggests a potential new reduction/oxidation pathway for Am in the presence of Ce; however, these results were very preliminary, and will require additional experiments to understand the mechanism by which this occurs. Overall, these studies have shown that hexavalent americium is fundamentally stable enough in nitric acid to run a separations process. However, the complicated nature of the reduction pathways based on the system components is far from being rigorously understood.

  13. Workshop on Preserving High Purity Uranium-233

    Energy Technology Data Exchange (ETDEWEB)

    Krichinsky, Alan M [ORNL; Giaquinto, Joseph [ORNL; Canaan, R Douglas {Doug} [ORNL

    2016-01-01

    A workshop was held on at the MARC X conference to provide a forum for the scientific community to communicate needs for high-purity 233U and its by-products in order to preserve critical items otherwise slated for downblending and disposal. Currently, only a small portion of the U.S. holdings of separated 233U is being preserved. However, many additional kilograms of 233U (>97% pure) still are destined to be downblended which will permanently destroy their potential value for many other applications. It is not likely that this material will ever be replaced due to a lack of operating production capability. Summaries of information conveyed at the workshop and feedback obtained from the scientific community are presented herein.

  14. Benchmark testing of 233U evaluations

    International Nuclear Information System (INIS)

    In this paper we investigate the adequacy of available 233U cross-section data (ENDF/B-VI and JENDL-3) for calculation of critical experiments. An ad hoc revised 233U evaluation is also tested and appears to give results which are improved relative to those obtained with either ENDF/B-VI or JENDL-3 cross sections. Calculations of keff were performed for ten fast benchmarks and six thermal benchmarks using the three cross-section sets. Central reaction-rate-ratio calculations were also performed

  15. Star formation in the S233 region

    CERN Document Server

    Ladeyschikov, D A; Parfenov, S Yu; Alexeeva, S A; Bieging, J H

    2015-01-01

    The main objective of this paper is to study the possibility of triggered star formation on the border of the HII region S233, which is formed by a B-star. Using high-resolution spectra we determine the spectral class of the ionizing star as B0.5 V and the radial velocity of the star to be -17.5(1.4) km/s. This value is consistent with the velocity of gas in a wide field across the S233 region, suggesting that the ionizing star was formed from a parent cloud belonging to the S233 region. By studying spatial-kinematic structure of the molecular cloud in the S233 region, we detected an isolated clump of gas producing CO emission red-shifted relative to the parent cloud. In the UKIDSS and WISE images, the clump of gas coincides with the infrared source containing a compact object and bright-rimmed structure. The bright-rimmed structure is perpendicular to the direction of the ionizing star. The compact source coincides in position with IRAS source 05351+3549. All these features indicate a possibility of triggeri...

  16. 233-S plutonium concentration facility hazards assessment

    International Nuclear Information System (INIS)

    This document establishes the technical basis in support of Emergency Planning activities for the 233-S Plutonium Concentration Facility on the Hanford Site. The document represents an acceptable interpretation of the implementing guidance document for DOE ORDER 5500.3A. Through this document, the technical basis for the development of facility specific Emergency Action Levels and the Emergency Planning Zone is demonstrated

  17. Preserving Ultra-Pure Uranium-233

    Energy Technology Data Exchange (ETDEWEB)

    Krichinsky, Alan M [ORNL; Goldberg, Dr. Steven A. [DOE SC - Chicago Office; Hutcheon, Dr. Ian D. [Lawrence Livermore National Laboratory (LLNL)

    2011-10-01

    Uranium-233 ({sup 233}U) is a synthetic isotope of uranium formed under reactor conditions during neutron capture by natural thorium ({sup 232}Th). At high purities, this synthetic isotope serves as a crucial reference material for accurately quantifying and characterizing uranium-bearing materials assays and isotopic distributions for domestic and international nuclear safeguards. Separated, high purity {sup 233}U is stored in vaults at Oak Ridge National Laboratory (ORNL). These materials represent a broad spectrum of {sup 233}U from the standpoint of isotopic purity - the purest being crucial for precise analyses in safeguarding uranium. All {sup 233}U at ORNL is currently scheduled to be disposed of by down-blending with depleted uranium beginning in 2015. This will reduce safety concerns and security costs associated with storage. Down-blending this material will permanently destroy its potential value as a certified reference material for use in uranium analyses. Furthermore, no credible options exist for replacing {sup 233}U due to the lack of operating production capability and the high cost of restarting currently shut down capabilities. A study was commissioned to determine the need for preserving high-purity {sup 233}U. This study looked at the current supply and the historical and continuing domestic need for this crucial isotope. It examined the gap in supplies and uses to meet domestic needs and extrapolated them in the context of international safeguards and security activities - superimposed on the recognition that existing supplies are being depleted while candidate replacement material is being prepared for disposal. This study found that the total worldwide need by this projection is at least 850 g of certified {sup 233}U reference material over the next 50 years. This amount also includes a strategic reserve. To meet this need, 18 individual items totaling 959 g of {sup 233}U were identified as candidates for establishing a lasting supply of

  18. 34 CFR 668.233 - Student eligibility.

    Science.gov (United States)

    2010-07-01

    ... Intellectual Disabilities § 668.233 Student eligibility. A student with an intellectual disability is eligible... intellectual disability, as described in paragraph (1) of the definition of a student with an intellectual... intellectual disability, such as— (1) A documented comprehensive and individualized...

  19. 12 CFR 233.7 - Regulatory enforcement.

    Science.gov (United States)

    2010-01-01

    ... PROHIBITION ON FUNDING OF UNLAWFUL INTERNET GAMBLING (REGULATION GG) § 233.7 Regulatory enforcement. The... regulators, with respect to the designated payment systems and participants therein that are subject to the... Commission, with respect to designated payment systems and participants therein not otherwise subject to...

  20. 28 CFR 23.3 - Applicability.

    Science.gov (United States)

    2010-07-01

    ... Administration DEPARTMENT OF JUSTICE CRIMINAL INTELLIGENCE SYSTEMS OPERATING POLICIES § 23.3 Applicability. (a) These policy standards are applicable to all criminal intelligence systems operating through support...-647). (b) As used in these policies: (1) Criminal Intelligence System or Intelligence System means...

  1. Liquid-liquid extraction separation and determination of plutonium and americium

    International Nuclear Information System (INIS)

    A procedure is described for the determination of plutonium and americium after their initial separation on barium sulfate. The barium sulfate is dissolved in perchloric acid and the antinides and lanthanides are extracted into bis(2-ethylhexyl)phosphoric acid (HDEHP). Americium along with other tervalent actinides and lanthanides is stripped from HDEHP with nitric acid. The lanthanides are removed on a column of HDEHP supported on Teflon powder, and the americium and other tervalent actinides are electrodeposited for their determination by α spectrometry. The plutonium is stripped with nitric acid after reduction to the tervalent state with 2,5-di-tert-butylhydroquinone and electrodeposited for α spectrometry. Decontamination factors for plutonium and americium from each other and from other α emitters are 104 to 105. Two hours are required for the liquid-liquid extraction separations of plutonium and americium from eight samples. Recoveries of americium and plutonium through the HDEHP separatons are 99% and 95%, respectively

  2. Calculational study on irradiation of americium fuel samples in the Petten High Flux Reactor

    International Nuclear Information System (INIS)

    A calculational study on the irradiation of americium samples in the Petten High Flux Reactor (HFR) has been performed. This has been done in the framework of the international EFTTRA cooperation. For several reasons the americium in the samples is supposed to be diluted with a neutron inert matrix, but the main reason is to limit the power density in the sample. The low americium nuclide density in the sample (10 weight % americium oxide) leads to a low radial dependence of the burnup. Three different calculational methods have been used to calculate the burnup in the americium sample: Two-dimensional calculations with WIMS-6, one-dimensional calculations with WIMS-6, and one-dimensional calculations with SCALE. The results of the different methods agree fairly well. It is concluded that the radiotoxicity of the americium sample can be reduced upon irradiation in our scenario. This is especially the case for the radiotoxicity between 100 and 1000 years after storage. (orig.)

  3. Neptunium and americium control for international non-proliferation regime

    International Nuclear Information System (INIS)

    It was decided in the IAEA Board of Governors Meeting held in Sept. 1999 that Neptunium and Americium could be diverted for manufacturing nuclear weapon or explosives, so that appropriate measures should be taken for the prevention of proliferation of these materials. It is expected to take relatively long time for settling down the aligned system dealing with the above materials because the present regulatory statement was prepared on the basis of voluntary offers from the States concerned. The necessity of preventive measures is being convinced among Member States, but it would not be easy to take voluntary participation in detail because of their respective interests. It is expected that this paper could contribute to the effective response as to the international commitments as well as for protecting the domestic nuclear industry and R and D area through analysis on the IAEA's approach on Neptunium and Americium

  4. Thermophysical properties of americium-containing barium plutonate

    International Nuclear Information System (INIS)

    Polycrystalline specimens of americium-containing barium plutonate have been prepared by mixing the appropriate amounts of (Pu0.91Am0.09)O2 and BaCO3 powders followed by reacting and sintering at 1600 K under the flowing gas atmosphere of dry-air. The sintered specimens had a single phase of orthorhombic perovskite structure and were crack-free. Elastic moduli were determined from longitudinal and shear sound velocities. Debye temperature was also determined from sound velocities and lattice parameter measurements. Thermal conductivity was calculated from measured density at room temperature, literature values of heat capacity and thermal diffusivity measured by laser flash method in vacuum. Thermal conductivity of americium-containing barium plutonate was roughly independent of temperature and registered almost the same magnitude as that of BaPuO3 and BaUO3. (author)

  5. 1976 Hanford americium-exposure incident: decontamination and treatment facility

    International Nuclear Information System (INIS)

    An injured worker, contaminated with over 6 mCi of americium-241, required special treatment and housing for 4 months. This paper is a description of the design and management of the facility in which most of the treatment and housing occurred. The problems associated with contamination control, waste handling, supplies, and radiological concerns during the two-stage transfer of the patient from a controlled situation to his normal living environment are discussed in detail

  6. Recycling heterogeneous americium targets in a boiling water reactor

    International Nuclear Information System (INIS)

    One of the limiting contributors to the heat load constraint for a long term spent fuel repository is the decay of americium-241. A possible option to reduce the heat load produced by Am-241 is to eliminate it via transmutation in a light water reactor thermal neutron environment, in particular, by taking advantage of the large thermal fission cross section of Am-242 and Am-242m. In this study we employ lattice loading optimization techniques to define the loadings and arrangements of fuel pins with blended americium and uranium oxide in boiling water reactor bundles, specifically, by defining the incineration of pre-loaded americium as an objective function to maximize americium transmutation. Subsequently, the viability of these optimized lattices is tested by assembling them into bundles with Am-spiked fuel pins and by loading these bundles into realistic three-dimensional BWR core-wide simulations that model multiple reload cycles and observe standard operational constraints. These simulations are possible via our collaboration with the Westinghouse Electric Co. which facilitates the use of industrial-caliber design tools such as the PHOENIX-4/POLCA-7 sequence and the Core Master 2 GUI work environment for fuel management. The resulting analysis confirms the ability to axially uniformly eliminating roughly 90% of the pre-loaded inventory of recycled Am-241 in BWR bundles with heterogeneous target pins. This high level of incineration was achieved within three to four 18-month operational cycles, which is equivalent to a typical in-core residence time of a BWR bundle.

  7. Ingestion Pathway Transfer Factors for Plutonium and Americium

    Energy Technology Data Exchange (ETDEWEB)

    Blanchard, A.

    1999-07-28

    Overall transfer factors for major ingestion pathways are derived for plutonium and americium. These transfer factors relate the radionuclide concentration in a given foodstuff to deposition on the soil. Equations describing basic relationships consistent with Regulatory Guide 1.109 are followed. Updated values and coefficients from IAEA Technical Reports Series No. 364 are used when a available. Preference is given to using factors specific to the Savannah River Site.

  8. Gut uptake factors for plutonium, americium and curium

    International Nuclear Information System (INIS)

    Data on estimates of the absorption of plutonium, americium and curium from the human gut based on measurements of uptake in other mammalian species are reviewed. It is proposed that for all adult members of the public ingesting low concentrations of plutonium in food and water, 0.05% would be an appropriate value of absorption except when the conditions of exposure are known and a lower value can be justified. For dietary intakes of americium and curium, the available data do not warrant a change from the ICRP value of 0.05%. For newborn children ingesting americium, curium and soluble forms of plutonium, a value of 1% absorption is proposed for the first 3 months of life during which the infant is maintained on a milk diet. It is proposed that a value of 0.5% should be used for the first year of life to take account of the gradual maturation of the gut. In considering the ingestion of insoluble oxides of plutonium by infants, it is proposed that absorption is taken as 0.1% for the first 3 months and 0.05% for the first year. (author)

  9. Dicty_cDB: CHR233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHR233 (Link to dictyBase) - - - Contig-U16471-1 - (Link to Original site) - - CHR...233Z 789 - - - - Show CHR233 Library CH (Link to library) Clone ID CHR233 (Link to dicty...iol.tsukuba.ac.jp/CSM/CH/CHR2-B/CHR233Q.Seq.d/ Representative seq. ID - (Link to ...Original site) Representative DNA sequence >CHR233 (CHR233Q) /CSM/CH/CHR2-B/CHR233Q.Seq.d/ XXXXXXXXXXTATATGA...DNA Score E Sequences producing significant alignments: (bits) Value SHB457 (SHB457Q) /CSM/SH/SHB4-C/SHB457Q.Seq.d/ 747 0.0 CHR

  10. Characterization of uranium, plutonium, neptunium, and americium in HLW supernate for LLW certification

    International Nuclear Information System (INIS)

    The 1S Manual requires that High Level Waste (HLW) implement a waste certification program prior to sending waste packages to the E-Area vaults. To support the waste certification plan, the HLW supernate inventory of uranium, plutonium, neptunium and americium have been characterized. This characterization is based on the chemical, isotopic and radiological properties of these elements in HLW supernate. This report uses process knowledge, solubility data, isotopic inventory data and sample data to determine if any isotopes of the aforementioned elements will exceed the minimum reportable quantity (MRQ) for waste packages contaminated with HLW supernate. If the MRQ can be exceeded for a particular nuclide, then a method for estimating the waste package content is provided. Waste packages contaminated from HLW supernate do not contain sufficient U-233, U-234, U-235, U-236, U-238, Pu-239, Pu-240, Pu-241, Pu-242 or Am-241 to warrant separate reporting on the shipping manifest. Calculations show that, on average, more than 100 gallons of supernate is required to exceed the PAC (package acceptance criteria) for each of these nuclides. Thus it is highly unlikely that the PAC would be exceeded for these nuclides and unlikely that the MRQ would be exceeded. These nuclides should be manifested as zero for waste packages contaminated with HLW supernate. The only actinide isotopes that may exceed the MRQ are Np-237 and Pu-238. The recommended method to calculate the amount of these two isotopes in waste packages contaminated with HLW supernate is to ratio them to the measured Cs-137 activity

  11. 17 CFR 256.233 - Notes payable to associate companies.

    Science.gov (United States)

    2010-04-01

    ... companies. 256.233 Section 256.233 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) UNIFORM SYSTEM OF ACCOUNTS FOR MUTUAL SERVICE COMPANIES AND SUBSIDIARY SERVICE COMPANIES, PUBLIC UTILITY HOLDING COMPANY ACT OF 1935 7. Current and Accrued Liabilities § 256.233 Notes payable...

  12. 40 CFR 233.4 - Conflict of interest.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Conflict of interest. 233.4 Section 233.4 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN DUMPING 404 STATE PROGRAM REGULATIONS General § 233.4 Conflict of interest. Any public officer or employee who has a...

  13. 45 CFR 233.52 - Overpayment to aliens.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Overpayment to aliens. 233.52 Section 233.52... ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.52 Overpayment to aliens. A State Plan under title IV-A of the Social Security Act, shall provide that: (a) Any sponsor of an alien and the alien shall...

  14. 45 CFR 233.36 - Monthly reporting (AFDC).

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Monthly reporting (AFDC). 233.36 Section 233.36... ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.36 Monthly reporting (AFDC). (a) Except as provided in paragraph (b) of this section, a State plan for AFDC shall require the caretaker relative, or another...

  15. 45 CFR 233.90 - Factors specific to AFDC.

    Science.gov (United States)

    2010-10-01

    ... meet the needs of the unborn child. (Refer to Medicaid regulations at 42 CFR 435.115 for Medicaid... 45 Public Welfare 2 2010-10-01 2010-10-01 false Factors specific to AFDC. 233.90 Section 233.90... ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.90 Factors specific to AFDC. (a) State plan requirements....

  16. 45 CFR 233.31 - Budgeting methods for AFDC.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Budgeting methods for AFDC. 233.31 Section 233.31... ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.31 Budgeting methods for AFDC. (a) Requirements for State plans. A State plan for AFDC shall specify that all factors of eligibility shall be...

  17. Airborne plutonium-239 and americium-241 concentrations measured from the 125-meter Hanford Meteorological Tower

    International Nuclear Information System (INIS)

    Airborne plutonium-239 and americium-241 concentrations and fluxes were measured at six heights from 1.9 to 122 m on the Hanford meteorological tower. The data show that plutonium-239 was transported on nonrespirable and small particles at all heights. Airborne americium-241 concentrations on small particles were maximum at the 91 m height

  18. Effect of 241-americium on bone marrow stroma

    International Nuclear Information System (INIS)

    The regulation of haemopoiesis occurs via complex interactions between the stroma and the haemopoietic cells. An attempt to further clarifying the mechanisms and the exact role of the stroma in the regulation was made in a study. Results revealed that the murine bone marrow stromal cells are highly radiosensitive after injection with 241-americium and can thus be considered as a target population after internal contamination. In addition, observations are made which may be important for risk estimation for the developing animal and during pregnancy. Contamination in utero and by lactation shows persistent damage up to 1 year after contamination at an average annual dose of 5 cGy. (author)

  19. Recovery of americium-241 from aged plutonium metal

    International Nuclear Information System (INIS)

    After separation and purification, both actinides were precipitated as oxalates and calcined. A large-scale process was developed using dissolution, separation, purification, precipitation, and calcination. Efforts were made to control corrosion, to avoid product contamination, to keep the volume of process and waste solutions manageable, and to denitrate solutions with formic acid. The Multipurpose Processing Facility (MPPF), designed for recovery of transplutonium isotopes, was used for the first time for the precipitation and calcination of americium. Also, for the first time,, large-scale formic acid denitration was performed in a canyon vessel at SRP

  20. Preferential decorporation of americium by pulmonary administration of DTPA dry powder after inhalation of aged PuO2 containing americium in rats

    International Nuclear Information System (INIS)

    After inhalation of plutonium oxides containing various percentages of americium in rats, we identified an acellular transient pulmonary compartment, the epithelial lining fluid (ELF), in which a fraction of actinide oxides dissolve prior to absorption and subsequent extrapulmonary deposit. Chelation therapy is usually considered to be poorly efficient after inhalation of actinide oxides. However, in the present study, prompt pulmonary administration of diethylenetriaminepentaacetic acid (DTPA) as a dry powder led to a decrease in actinide content in ELF together with a limitation of bone and liver deposits. Because americium is more soluble than plutonium, higher amounts of americium were found in ELF, extrapulmonary tissues and urine. Our results also demonstrated that the higher efficacy of DTPA on americium compared to plutonium in ELF induced a preferential inhibition of extrapulmonary deposit and a greater urinary excretion of americium compared to plutonium. All together, our data justify the use of an early and local DTPA treatment after inhalation of plutonium oxide aerosols in which americium can be in high proportion such as in aged compounds. (authors)

  1. Performance analysis of 233U for fixed bed nuclear reactors

    International Nuclear Information System (INIS)

    Criticality and burn up behavior of the Fixed Bed Nuclear Reactor (FBNR) are investigated for the mixed fuel 233UO2/ThO2 as an alternative to low enriched 235UO2 fuel. CERMET fuel with a zirconium matrix and cladding has been used throughout the study. The main results of the study can be summarized as follows: Reactor criticality is already achieved by ∝2% 233UO2 with the mixed 233UO2/ThO2 fuel. At higher 233U fractions, reactor criticality rises rapidly and exceeds keff > 1.5 already by 9% 233UO2. With 100% 233UO2, start up criticality can reach keff = 2.0975. Time dependent reactor criticality keff and fuel burn up have been investigated for two different mixed fuel 233UO2/ThO2 compositions, namely: 4% 233UO2 + 96% ThO2 for a reactor power of 40 MWel (120 MWth) and 9% 233UO2 + 91% ThO2 for a reactor power of 70 MWel (210 MWth). Sufficient reactor criticality (keff > 1.06) for continuous operation without fuel change can be sustained during ∝ 5 and 12 years with 4% and 9% 233UO2 fractions in the mixed fuel, leading to burn ups of ∝ 36000 and > 105000 MWD/t, respectively. Thorium based fuel produces no prolific uranium. Plutonium production remains negligible. (orig.)

  2. Update of 233U, 229-232Th and 230-233Pa Fission Data

    International Nuclear Information System (INIS)

    The influence of the 235U(n,f) and 239Pu(n,f) prompt fission neutron spectra (PFNS) on modeling of integral benchmarks was estimated to be significant. For 233U(n,f) PFNS similar sensitivities could be envisaged. For the variety of Th/U fuels and systems, ranging from metal fast to deep thermal solutions, large positive/negative swings in calculated Keff can be expected. Th/U fuelled core criticality calculations would be sensitive to the modelled soft tail of fission neutrons or deficiency of hard tail fission neutrons, as revealed for U and Pu fuels. The deficiency of the 233U(nth,f) PFNS, adopted for the ENDF/B-VII.0. could be traced back to the 'propagation' of calculated 235U(nth,f) PFNS shape at En= 0.5 MeV. At higher energies, average energies of PFNS coincide only at ∼5 MeV, at other En the average energies and spectra shapes are drastically different. However, it might be argued that the response of the criticality benchmark calculations for the 233U thermal and fast systems would be similar to that observed for the PFNS of 239Pu. Our approach allowed to solve the longstanding problem of inconsistency of 235U integral data testing and differential prompt fission neutron spectra data, a similar approach may hold for 233U. Using modified PFNS, we may avoid arbitrary tweaking of neutron cross sections or neutron multiplicities for Th/U fuel-cycle related nuclides (233U, 229,230,231,232Th and 230,231,232,233Pa) to compensate the ill-defined shape of 233U PFNS. For metal fast benchmarks much would depend on the inelastic scattering cross section of 233U, which should be considered rather uncertain at the moment. The unrealistic evaluations of poorly investigated cross sections related to the Th/U fuel cycle could be excluded by consistent analysis of the available fission data base. The evaluation of 229,230,231,232Th(n,f) and 230,231,232,233Pa(n,f) cross sections could be supplemented by description of surrogate and ratio surrogate fission data, coming from

  3. Uranium-233 analysis of biological samples

    International Nuclear Information System (INIS)

    Two liquid scintillation techniques were compared for 233U analysis: a two-phase extraction system (D2EHPA) developed by Keough and Powers, 1970, for Pu analysis; and a single-phase emulsion system (TT21) that holds the total sample in suspension with the scintillator. The first system (D2EHPA) was superior in reducing background (two- to threefold) and in accommodating a larger sample volume (fivefold). Samples containing > 50 mg/ml of slats were not extracted quantitatively by D2EHPA

  4. Neutron data evaluation of 233Pa

    International Nuclear Information System (INIS)

    Consistent evaluation of 233 Pa measured data base is performed. Hauser-Feshbach-Moldauer theory, coupled channel model and double-humped fission barrier model are employed. Total, differential scattering, fission and (n,xn) data are calculated, using fission cross section data description as a major constraint. The direct excitation of ground state band levels is calculated within rigid rotator model. Average resonance parameters are provided, which reproduce evaluated cross sections in the range of 16.5-70.9 keV. This work is performed under the Project Agreement B-404 with the International Science and Technology Center (Moscow). The Financing Party for the Project is Japan. (author)

  5. Analytical performance of radiochemical method for americium determination in urine

    International Nuclear Information System (INIS)

    This paper presents an analytical method developed and adapted for separation and analysis of Plutonium (Pu) isotopes and Americium (Am) in urine samples. The proposed method will attend the demand of internal exposure monitoring program for workers involved mainly with dismantling rods and radioactive smoke detectors. In this experimental procedure four steps are involved as preparation of samples, sequential radiochemical separation, preparation of the source for electroplating and quantification by alpha spectrometry. In the first stage of radiochemical separation, plutonium is conventionally isolated employing the anion exchange technique. Americium isolation is achieved sequentially by chromatographic extraction (Tru.spec column) from the load and rinse solutions coming from the anion exchange column. The 243Am tracer is added into the sample as chemical yield monitors and to correct the results improving the precision and accuracy. The mean recovery obtained is 60%, and the detection limit for 24h urine sample is 1.0 mBq L-1 in accordance with the literature. Based in the preliminary results, the method is appropriate to be used in monitoring programme of workers with a potential risk of internal contamination. (author)

  6. Placental transfer of americium and plutonium in mice

    International Nuclear Information System (INIS)

    Actinide element release to the environment and subsequent transfer through food chains to pregnant women may present a radiation hazard to fetuses in utero. To measure americium incorporation, four groups of pregnant mice were intravenously dosed with four concentrations of 243Am citrate in late pregnancy. Concentrations of 243Am in fetuses, placentas, and maternal femur, liver, carcass and pelt were determined 48 hr after injection. Doses were chosen so that the number of atoms of 243Am in each injected dose was equal to the number of atoms of 239Pu used in an earlier study of transplacental movement. Results indicate that, atom for atom, americium is incorporated into fetal tissue in lesser amounts (10-25 times) than is plutonium when intravenously administered to pregnant mice in equal atom amounts. Tissue analyses indicated that, at low dose levels, the average fraction of the dose incorporated into the fetuses decreased as the dose to the pregnant mouse was increased. A similar pattern was noted for placentas and maternal femurs. Data indicate that one must make extrapolations from low dose data only to make reasonable and realistic estimates of the transplacental movement and fetal incorporation of environmental levels of actinide elements in man and other species. (author)

  7. Development of separation techniques of americium from reprocessing solution

    International Nuclear Information System (INIS)

    Americium(Am) and neptunium(Np) finally transfer to the waste stream in the current PUREX reprocessing process. As an option, some methods have been developed to recover Am and Np from the waste stream to decrease long-term toxicity of the high level waste. The most stable valence state of Am is III, but TBP (tri-n-butyl phosphate) which is an extractant used in the PUREX reprocessing does not extract Am(III). Therefore, some special extractants have been developed to recover Am(III). However, they also extract rare-earth elements(REs), which necessitates the separation process for Am from REs. We have been developing a separation process which consists of valence control of Am to the VI state and its extraction with TBP. This process allows Am recovery from reprocessing solution and Am separation from REs simultaneously. Americium(III) is oxidized to Am(VI) by electrochemical oxidation and chemical oxidation using peroxodisulfate ammonium and silver nitrate. The latter was adopted here because the chemical oxidation reaction proceeds faster than the electrochemical method. Reaction mechanisms of oxidation and extraction were investigated. Based on the mechanisms, we found that extraction efficiency could be improved and waste generation could be minimized. (author)

  8. Solubility of Plutonium (IV) Oxalate During Americium/Curium Pretreatment

    Energy Technology Data Exchange (ETDEWEB)

    Rudisill, T.S.

    1999-08-11

    Approximately 15,000 L of solution containing isotopes of americium and curium (Am/Cm) will undergo stabilization by vitrification at the Savannah River Site (SRS). Prior to vitrification, an in-tank pretreatment will be used to remove metal impurities from the solution using an oxalate precipitation process. Material balance calculations for this process, based on solubility data in pure nitric acid, predict approximately 80 percent of the plutonium in the solution will be lost to waste. Due to the uncertainty associated with the plutonium losses during processing, solubility experiments were performed to measure the recovery of plutonium during pretreatment and a subsequent precipitation process to prepare a slurry feed for a batch melter. A good estimate of the plutonium content of the glass is required for planning the shipment of the vitrified Am/Cm product to Oak Ridge National Laboratory (ORNL).The plutonium solubility in the oxalate precipitation supernate during pretreatment was 10 mg/mL at 35 degrees C. In two subsequent washes with a 0.25M oxalic acid/0.5M nitric acid solution, the solubility dropped to less than 5 mg/mL. During the precipitation and washing steps, lanthanide fission products in the solution were mostly insoluble. Uranium, and alkali, alkaline earth, and transition metal impurities were soluble as expected. An elemental material balance for plutonium showed that greater than 94 percent of the plutonium was recovered in the dissolved precipitate. The recovery of the lanthanide elements was generally 94 percent or higher except for the more soluble lanthanum. The recovery of soluble metal impurities from the precipitate slurry ranged from 15 to 22 percent. Theoretically, 16 percent of the soluble oxalates should have been present in the dissolved slurry based on the dilution effects and volumes of supernate and wash solutions removed. A trace level material balance showed greater than 97 percent recovery of americium-241 (from the beta dec

  9. Solubility of Plutonium (IV) Oxalate During Americium/Curium Pretreatment

    International Nuclear Information System (INIS)

    Approximately 15,000 L of solution containing isotopes of americium and curium (Am/Cm) will undergo stabilization by vitrification at the Savannah River Site (SRS). Prior to vitrification, an in-tank pretreatment will be used to remove metal impurities from the solution using an oxalate precipitation process. Material balance calculations for this process, based on solubility data in pure nitric acid, predict approximately 80 percent of the plutonium in the solution will be lost to waste. Due to the uncertainty associated with the plutonium losses during processing, solubility experiments were performed to measure the recovery of plutonium during pretreatment and a subsequent precipitation process to prepare a slurry feed for a batch melter. A good estimate of the plutonium content of the glass is required for planning the shipment of the vitrified Am/Cm product to Oak Ridge National Laboratory (ORNL).The plutonium solubility in the oxalate precipitation supernate during pretreatment was 10 mg/mL at 35 degrees C. In two subsequent washes with a 0.25M oxalic acid/0.5M nitric acid solution, the solubility dropped to less than 5 mg/mL. During the precipitation and washing steps, lanthanide fission products in the solution were mostly insoluble. Uranium, and alkali, alkaline earth, and transition metal impurities were soluble as expected. An elemental material balance for plutonium showed that greater than 94 percent of the plutonium was recovered in the dissolved precipitate. The recovery of the lanthanide elements was generally 94 percent or higher except for the more soluble lanthanum. The recovery of soluble metal impurities from the precipitate slurry ranged from 15 to 22 percent. Theoretically, 16 percent of the soluble oxalates should have been present in the dissolved slurry based on the dilution effects and volumes of supernate and wash solutions removed. A trace level material balance showed greater than 97 percent recovery of americium-241 (from the beta dec

  10. Americium Transmutation Feasibility When Used as Burnable Absorbers - 12392

    International Nuclear Information System (INIS)

    The use of plutonium in Mixed Oxide (MOX) fuel in traditional Pressurized Water Reactor (PWR) assemblies leads to greater americium production which is not addressed in MOX recycling. The transuranic nuclides (TRU) contribute the most to the radiotoxicity of nuclear waste and a reduction of the TRU stockpile would greatly reduce the overall radiotoxicity of what must be managed. Am-241 is a TRU of particular concern because it is the dominant contributor of total radiotoxicity for the first 1000 years in a repository. This research explored the feasibility of transmuting Am-241 by using varying amounts in MOX rods being used in place of burnable absorbers and evaluated with respect to the impact on incineration and transmutation of transuranics in MOX fuel as well as the impact on safety. This research concludes that the addition of americium to a non-uniform fuel assembly is a viable method of transmuting Am-241, holding down excess reactivity in the core while serving as a burnable poison, as well as reducing the radiotoxicity of high level waste that must be managed. The use of Am/MOX hybrid fuel assemblies to transmute americium was researched using multiple computer codes. Am-241 was shown in this study to be able to hold down excess reactivity at the beginning of cycle and shape the power distribution in the core with assemblies of varying americium content loaded in a pattern similar to the traditional use of assemblies with varying amounts of burnable absorbers. The feasibility, safety, and utility of using americium to create an Am/MOX hybrid non-uniform core were also evaluated. The core remained critical to a burnup of 22,000 MWD/MTM. The power coefficient of reactivity as well as the temperature and power defects were sufficiently negative to provide a prompt feedback mechanism in case of a transient and prevent a power excursion, thus ensuring inherent safety and protection of the core. As shown here as well as many other studies, this non

  11. Evaluation of resonance parameters of U-233

    International Nuclear Information System (INIS)

    Compilation of nuclear data is in progress in Japan, and the second edition of Japanese Evaluated Nuclear Data Library (JENDL-2) will be published. The evaluation of the resonance parameters of U-233, which will be included in JENDL-2, has been made. The measured values of the resonance parameters after the publication of BNL-325 (second edition) were collected, and searched by using CINDA-78. The data by Blons, Kolar, Ryabov, and Bergen were used for the present evaluation. Complete set of the data was made for each measurement. Fission and capture areas integrated over energy intervals were obtained. The total, fission and capture cross-sections of U-233 were calculated from the various sets of complete resonance parameters, and shown in figures. The calculated values of total, fission and capture cross-sections based on the parameters by Blons were compared with the measured values. Correction of the resonance parameters with poor reproducibility was able to be made with the NDES system by Nakagawa. The final parameters which will be included in JENDL are shown in tables. (Kato, T.)

  12. 27 CFR 24.233 - Addition of spirits to wine.

    Science.gov (United States)

    2010-04-01

    ... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Addition of spirits to wine. 24.233 Section 24.233 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS WINE Spirits § 24.233 Addition of spirits to wine. (a) Prior to the addition of spirits. Wine will be...

  13. Removal of americium from effluent generated during the purification of plutonium by anion exchange

    Energy Technology Data Exchange (ETDEWEB)

    Noronha, Donald M.; Pius, Illipparambil C.; Chaudhury, Satyajeet [Bhabha Atomic Research Centre, Mumbai (India). Fuel Chemistry Div.

    2015-07-01

    Studies have been carried out on removal of americium from the effluent generated during anion exchange purification of plutonium. Americium 241, generated by the beta decay of Plutonium-241, is the major source of a activity in this highly acidic effluent and its removal would render the waste easily disposable. A simple and effective co-precipitation method, using thorium oxalate has been investigated for the treatment of this alpha active aqueous waste. Experiments have been carried out to identify optimum conditions to obtain high percentage co-precipitation with minimum amount of co-precipitant. Efforts were carried out to correlate the optimum conditions of co-precipitation of americium obtained in these experiments with solubility of thorium oxalate and americium oxalate calculated from solubility products of these compounds, stability constants of thorium and americium oxalate complexes taken from literature. The saturation capacity of thorium oxalate for Am(III) was also calculated by analyzing the K{sub d} value data using Langmuir adsorption equation. The strong tendency of americium to get co-precipitated and the high capacity exhibited by thorium oxalate for the uptake of americium indicate feasibility of using this method for the treatment of anion exchange effluent.

  14. Removal of americium from effluent generated during the purification of plutonium by anion exchange

    International Nuclear Information System (INIS)

    Studies have been carried out on removal of americium from the effluent generated during anion exchange purification of plutonium. Americium 241, generated by the beta decay of Plutonium-241, is the major source of a activity in this highly acidic effluent and its removal would render the waste easily disposable. A simple and effective co-precipitation method, using thorium oxalate has been investigated for the treatment of this alpha active aqueous waste. Experiments have been carried out to identify optimum conditions to obtain high percentage co-precipitation with minimum amount of co-precipitant. Efforts were carried out to correlate the optimum conditions of co-precipitation of americium obtained in these experiments with solubility of thorium oxalate and americium oxalate calculated from solubility products of these compounds, stability constants of thorium and americium oxalate complexes taken from literature. The saturation capacity of thorium oxalate for Am(III) was also calculated by analyzing the Kd value data using Langmuir adsorption equation. The strong tendency of americium to get co-precipitated and the high capacity exhibited by thorium oxalate for the uptake of americium indicate feasibility of using this method for the treatment of anion exchange effluent.

  15. Selective leaching studies of deep-sea sediments loaded with americium, neptunium and plutonium

    International Nuclear Information System (INIS)

    A series of selective leaching experiments were undertaken to investigate the solid phase speciation and distribution of americium, neptunium and plutonium which had been experimentally loaded onto different marine sediment types. The chemical leaches employed showed rather poor selectivity but certain trends were evident. Adsorption was not by ion exchange. Americium showed a preferential affinity for carbonate and plutonium for organic matter. Neptunium appeared to have no preferential affinities. Americium was sorbed by acetic acid residues (CaCO3 removed) and by unleached carbonate-rich sediments with equal efficiency. This indicates that it is able to diversify its solid phase affinity/distribution depending upon which solid phases are available. (author)

  16. Nuclear data evaluation for Pa-233

    International Nuclear Information System (INIS)

    In this report the evaluation of main neutron nuclear data for 233Pa, namely neutron cross sections (total, elastic, inelastic, radiative capture, fission, (n,2n), (n,3n)), as well as the elastic and inelastic angular distributions, and energy distributions of secondary neutrons from inelastic scattering, (n,2n), (n,3n) and fission reactions, is described. In the same time, radioactive decay data and average number of neutrons per fission are given. For the resolved and unresolved resonance energy range, the Breit-Wigner single level parameters have been estimated. The data cover the energy range between 10-5eV and 20MeV. The final set of evaluated data is given in ENDF/B format and have been checked against physical consistency and format correctness. Many of the data have been calculated using theoretical models. (author)

  17. Solubility of americium collected on an aerosol filter

    International Nuclear Information System (INIS)

    Kinetics of dissolution of undefined americium aerosol in simulated serum ultrafiltrate was studied. 241Am was present in aerosol collected at a workplace, where an intake of 241Am had occurred formerly. Dissolution experiments in four parts of an aerosol filter were carried out either in ambient air or under CO2 and pH was kept within physiological range. Two?phase kinetics was found in both cases with dissolution half?times for rapid and slow phases ranging from 0.16 to 0.23 d and from 150 to 500 d, respectively. Regardless data dispersion, found half?times justify use of class M model in intake assessment. (author)

  18. The 1976 Hanford Americium Accident: Then and Now

    Energy Technology Data Exchange (ETDEWEB)

    Carbaugh, Eugene H.

    2013-10-02

    The 1976 chemical explosion of an 241Am ion exchange column at a Hanford Site waste management facility resulted in the extreme contamination of a worker with 241Am, nitric acid and debris. The worker underwent medical treatment for acid burns, as well as wound debridement, extensive personal skin decontamination and long-term DTPA chelation therapy for decorporation of americium-241. Because of the contamination levels and prolonged decontamination efforts, care was provided for the first three months at the unique Emergency Decontamination Facility with gradual transition to the patient’s home occurring over another two months. The medical treatment, management, and dosimetry of the patient have been well documented in numerous reports and journal articles. The lessons learned with regard to patient treatment and effectiveness of therapy still form the underlying philosophy of treatment for contaminated injuries. Changes in infrastructure and facilities as well as societal expectations make for interesting speculation as to how responses might differ today.

  19. Separation of americium from curium by oxidation and ion exchange.

    Science.gov (United States)

    Burns, Jonathan D; Shehee, Thomas C; Clearfield, Abraham; Hobbs, David T

    2012-08-21

    Nuclear energy has the potential to be a clean alternative to fossil fuels, but in order for it to play a major role in the US, many questions about the back end of the fuel cycle must be addressed. One of these questions is the difficult separation of americium from curium. Here, we report the oxidation of Am in two systems, perchloric acid and nitric acid and the affect of changing the acid has on the oxidation. K(d) values were observed and a direct separation factor was calculated and was seen to be as high as 20 for four metal(IV) pillared phosphate phosphonate inorganic organic hybrid ion exchange materials. These ion exchangers are characterized by very low selectivity for cations with low charge but extremely high uptake of ions of high charge. PMID:22827724

  20. Pretreatment of americium/curium solutions for vitrification

    International Nuclear Information System (INIS)

    Vitrification will be used to stabilize an americium/curium (Am/Cm) solution presently stored in F-Canyon for eventual transport to the heavy isotope programs at Oak Ridge National Laboratory. Prior to vitrification, an in-tank oxalate precipitation and a series of oxalic/nitric acid washes will be used to separate these elements and lanthanide fission products from the bulk of the uranium and metal impurities present in the solution. Pretreatment development experiments were performed to understand the behavior of the lanthanides and the metal impurities during the oxalate precipitation and properties of the precipitate slurry. The results of these experiments will be used to refine the target glass composition allowing optimization of the primary processing parameters and design of the solution transfer equipment

  1. Plutonium and americium in sediments of Lithuanian lakes

    International Nuclear Information System (INIS)

    The assessment of contribution of the global and the Chernobyl NPP (Nuclear Power Plant) accident plutonium and americium to plutonium pollution in sediments of Lithuanian lakes is presented. Theoretical evaluation of activity ratios of 238Pu/239+240Pu and 241Pu/239+240Pu in the reactor of unit 4 of the Chernobyl NPP before the accident was performed by means of the ORIGEN-ARP code from the SCALE 4.4A program package. Non-uniform distribution of radionuclides in depositions on the Lithuanian territory after nuclear weapon tests and the Chernobyl NPP accident is experimentally observed by measuring the lake sediment pollution with actinides. The activity concentration of sediments polluted with plutonium ranges from 2.0 ± 0.5 Bq/kg d.w. (dry weight) in Lake Asavelis to 14 ± 2 Bq/kg d.w. in Lake Juodis. The ratio of activity concentrations of plutonium isotopes 238Pu/239+240Pu measured by α-spectrometry in the 10-cm-thick upper layer of bottom sediment varies from 0.03 in Lake Juodis to 0.3 in Lake Zuvintas. The analysis of the ratio values shows that the deposition of the Chernobyl origin plutonium is prevailing in southern and south-western regions of Lithuania. Plutonium of nuclear weapon tests origin in sediments of lakes is observed on the whole territory of Lithuania, and it is especially distinct in central Lithuania. The americium activity due to 241Pu decay after the Chernobyl NPP accident and global depositions in bottom sediments of Lithuanian lakes has been evaluated to be from 0.9 to 5.7 Bq/kg. (author)

  2. 40 CFR 233.61 - Determination of Tribal eligibility.

    Science.gov (United States)

    2010-07-01

    .... 233.61 Section 233.61 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) OCEAN..., such as, but not limited to, the exercise of police powers affecting (or relating to) the health... environmental or public health programs administered by the Tribal governing body, and a copy of related...

  3. 45 CFR 233.51 - Eligibility of sponsored aliens.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Eligibility of sponsored aliens. 233.51 Section... CONDITIONS OF ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.51 Eligibility of sponsored aliens... affidavit(s) of support or similar agreement on behalf of an alien (who is not the child of the sponsor...

  4. 17 CFR 201.233 - Depositions upon oral examination.

    Science.gov (United States)

    2010-04-01

    ... examination. 201.233 Section 201.233 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... upon oral examination. (a) Procedure. Any party desiring to take the testimony of a witness by.... Examination and cross-examination of deponents may proceed as permitted at a hearing. The witness...

  5. 49 CFR 238.233 - Interior fittings and surfaces.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Interior fittings and surfaces. 238.233 Section... I Passenger Equipment § 238.233 Interior fittings and surfaces. (a) Each seat in a passenger car... determined by the railroad: (1) Longitudinal: 8g; (2) Vertical: 4g; and (3) Lateral: 4g. (c) Other...

  6. 48 CFR 952.233-2 - Service of protest.

    Science.gov (United States)

    2010-10-01

    ... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.233-2 Service of protest. As prescribed in 933.106(a), add the following to the end of the provision at 48 CFR 52.233-2: (c) Another copy... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Service of protest....

  7. 45 CFR 233.32 - Payment and budget months (AFDC).

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Payment and budget months (AFDC). 233.32 Section... CONDITIONS OF ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.32 Payment and budget months (AFDC). A State shall specify in its plan for AFDC the time period covered by the payment (payment month) and the...

  8. Kinetic parameters of transformation of americium and plutonium physicochemical forms in podsol soils

    International Nuclear Information System (INIS)

    Kinetic parameters of transformation of americium and plutonium physicochemical forms have been estimated and the prognosis of fixing and remobilization of these nuclides in podsol soils have been made on that basis in the work. (authors)

  9. Calibration procedures for in vivo sodium iodide spectrometry of plutonium and americium in the human lung

    International Nuclear Information System (INIS)

    This paper describes the calibration techniques and associated error analysis for the in vivo measurement by NaI spectrometry of heavy elements in the lung, specifically plutonium and americium. A very brief description of the instrumentation system is included

  10. Relativistic density functional theory modeling of plutonium and americium higher oxide molecules

    Science.gov (United States)

    Zaitsevskii, Andréi; Mosyagin, Nikolai S.; Titov, Anatoly V.; Kiselev, Yuri M.

    2013-07-01

    The results of electronic structure modeling of plutonium and americium higher oxide molecules (actinide oxidation states VI through VIII) by two-component relativistic density functional theory are presented. Ground-state equilibrium molecular structures, main features of charge distributions, and energetics of AnO3, AnO4, An2On (An=Pu, Am), and PuAmOn, n = 6-8, are determined. In all cases, molecular geometries of americium and mixed plutonium-americium oxides are similar to those of the corresponding plutonium compounds, though chemical bonding in americium oxides is markedly weaker. Relatively high stability of the mixed heptoxide PuAmO7 is noticed; the Pu(VIII) and especially Am(VIII) oxides are expected to be unstable.

  11. Distribution of uranium, americium and plutonium in the biomass of freshwater macrophytes

    Energy Technology Data Exchange (ETDEWEB)

    Zotina, T.A.; Kalacheva, G.S.; Bolsunovsky, A.YA. [Institute of Biophysics SB RAS, Akademgorodok, Krasnoyarsk (Russian Federation)

    2010-07-01

    Accumulation of uranium ({sup 238}U), americium ({sup 241}Am) and plutonium ({sup 242}Pu) and their distribution in cell compartments and biochemical components of the biomass of aquatic plants Elodea canadensis, Ceratophyllum demersum, Myrioplyllum spicatum and aquatic moss Fontinalis antipyretica have been investigated in laboratory batch experiments. Isotopes of uranium, americium and plutonium taken up from the water by Elodea canadensis apical shoots were mainly absorbed by cell walls, plasmalemma and organelles. A small portion of isotopes (about 6-13 %) could be dissolved in cytoplasm. The major portion (76-92 %) of americium was bound to cell wall cellulose-like polysaccharides of Elodea canadensis, Myriophyllum spicatum, Ceratophyllum demersum and Fontinalis antipyretica, 8-23 % of americium activity was registered in the fraction of proteins and carbohydrates, and just a small portion (< 1%) in lipid fraction. The distribution of plutonium in the biomass fraction of Elodea was similar to that of americium. Hence, americium and plutonium had the highest affinity to cellulose-like polysaccharides in Elodea biomass. Distribution of uranium in the biomass of Elodea differed essentially from that of transuranium elements: a considerable portion of uranium was recorded in the fraction of protein and carbohydrates (51 %). From our data we can assume that uranium has higher affinity to carbohydrates than proteins. (authors)

  12. Separation of curium and americium microquantities by chromatographic method with introduction of separating ions. 2. Effect of cadmium ion quantity and method of it introduction in the system on efficiency of curium and americium separation

    International Nuclear Information System (INIS)

    Effect of fractionating cadmium ion and a method of it introduction in the system on efficiency of separation of curium and americium with the use of NTA solutions as an eluent is investigated. It is established that in contrast to mutual sorption of curium, americium and cadmium their selective sorption contributes more complete separation of curium and americium. It is shown that growth of quantity of introduced cadmium increased efficiency of separation. Elution rate not products effect on separation process

  13. Americium(3) solvent extraction by oxides of dialkyl(diaryl)[dialkylcarbamoylmethyl]phosphines (CMPO) from perchloric acid solutions

    International Nuclear Information System (INIS)

    Extraction of americium(3) from perchloric acid solutions by CMPO was investigated. It is shown that americium(3) is much more effectively extracted from perchloric acid solutions, than from nitric acid ones, and increase in americium distribution coefficient depends considerably on reagent nature. As a consequence, anomalous aryl effect increases significantly in perchloric acid solutions. The value of anomalous aryl effect depends directly on stoichiometry of extracted complexes in nitric acid and perchloric acid media. Conditions for extractional concentration of americium up to the 100-fold one with small reagent consumption were suggested

  14. 232 Th - 233 Pa separation by extraction chromatography

    International Nuclear Information System (INIS)

    Thorium and protactinium behavior in extraction chromatography systems is presented, aiming its separation by selective retention of the micro constituent on the column. TBP/alumina, TBP/voltalef UF 300, TOA/alumina and TOA/voltalef UF 300 systems were verified. Column preparation as well the 233 Pa removal conditions were settled. The best 232 Th separation from its irradiation product, 233 Pa, has been achieved by using TBP/voltalef UF 300 system. 233 Pa was selectively retained on column from 10 M HCl solutions and eluted with 3 M HCl. (author)

  15. Feasibility to produce uranium-233 from thorium in PHWR

    International Nuclear Information System (INIS)

    Uranium-233 is a fissile isotope of uranium that is bred from thorium-232 as part of the thorium fuel cycle. It is used as fuel in nuclear reactor. 233U is produced by irradiating thorium in fast reactor or thermal reactor. In this paper feasibility to produce 233U by irradiation of fuel bundles of thorium mixed with plutonium or irradiation of thorium bundles along with slightly enriched Uranium bundles in 220 MWe and 540 MWe PHWRs has been studied. Study shows that production of 233U is possible by irradiating few fuel bundles of PuTh or Thorium bundles along with SEU bundles without affecting the power operation and the safety related parameters. (author)

  16. 12 CFR 233.5 - Policies and procedures required.

    Science.gov (United States)

    2010-01-01

    ... SYSTEM PROHIBITION ON FUNDING OF UNLAWFUL INTERNET GAMBLING (REGULATION GG) § 233.5 Policies and... otherwise refuses to honor a transaction, shall not be liable to any party for such action if— (1)...

  17. 16 CFR 233.5 - Miscellaneous price comparisons.

    Science.gov (United States)

    2010-01-01

    ... DECEPTIVE PRICING § 233.5 Miscellaneous price comparisons. The practices covered in the provisions set forth... principles. For example, retailers should not advertise a retail price as a “wholesale” price. They...

  18. 12 CFR 233.3 - Designated payment systems.

    Science.gov (United States)

    2010-01-01

    ... PROHIBITION ON FUNDING OF UNLAWFUL INTERNET GAMBLING (REGULATION GG) § 233.3 Designated payment systems. The... remotely from a location other than a physical office of the money transmitting business; and (e)...

  19. Extraction of Americium(III) by diglycolamides in ionic liquids

    International Nuclear Information System (INIS)

    In the present work, the extraction behavior of Am(lII) in the three isomeric DGAs, TODGA, DEHDODGA and TEHDGA in two ionic liquids, 1-butyl-3-methylimidazolium bis(triflouromethane sulphonyl)imide (C4mimNTf2) and 1-butyl-1-methylpyrrolidinium bis(triflouromethanesulphonyl)imide (C4mpyNTf2) is compared. The distribution ratio of americium was determined at various acidities ranging from 1M to 8M. The distribution values were found to decrease with increase in aqueous phase acidity upto 3M. The DAm values then marginally increased with increase of acidity from 3 to 4M followed by a decrease in distribution values. The distribution ratio obtained for various DGAs followed the order TEHDGA < TODGA < DEHDODGA at aqueous phase acidities ranging from 1-4 M. When the aqueous nitric acid concentration was higher than 4M, the distribution values followed the order DEHDODGA < TEHDGA < TODGA. The anomalous behaviour of unsymmetrical diglycolamide in ionic liquid medium was investigated by IR spectroscopy. The study revealed that the unprotonated fraction of DGA (i.e. the free DGA) increased in the order TEHDGA < TODGA < DEHDODGA, which seems to be responsible for the observed anomalous extraction trend in DEHDODGA in ionic liquid medium

  20. Extraction of americium and europium by CMPO-substituted adamantylcalixarenes

    International Nuclear Information System (INIS)

    Eight p-adamantylcalix[4]arene derivatives, bearing four CMPO-like functions [-(CH2)n-NH-C(O)-CH2-P(O)Ph2] at the wide (4a,b, n = 0, 1) or narrow (5a-c and 6a-c, n = 2-4) rims were synthesized for the first time. Studies of the extraction of americium(III) and europium(III) from 3 M HNO3 solutions to organic phases (dichloromethane, m-nitro-trifluoromethylbenzene) showed: (i) The extraction ability for all the adamantylcalixarene ligands is much better than for their monomeric analogues -N-(1-adamantyl)-, N-(1-adamantylmethyl)- and N,N-(dibutyl)carbamoylmethyldiphenylphosphine oxides 7a, 7b, 8; (ii) The extraction percentage increases strongly with increasing length of the spacer for all types of ligands 4-6, and best extraction results were found for 4b (n = 1) and 5c (n = 4); (iii) The separation coefficient DAm/DEu for the investigated compounds did not exceed 2, which is close to the narrow rim CMPO calixarenes, studied earlier; (iv) Variation of the spacer length between CMPO groups attached to the 1,3- and 2,4-positions of the calixarene platform in 6 did not lead to appreciably improved extractants, neither with respect to the extraction abilities (D) nor to the selectivities (DAm/DEu). (orig.)

  1. Effect of americium-241 on luminous bacteria. Role of peroxides

    Energy Technology Data Exchange (ETDEWEB)

    Alexandrova, M., E-mail: maka-alexandrova@rambler.r [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Rozhko, T. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Vydryakova, G. [Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation); Kudryasheva, N. [Siberian Federal University, Svobodny 79, 660041 Krasnoyarsk (Russian Federation); Institute of Biophysics SB RAS, Akademgorodok 50, 660036 Krasnoyarsk (Russian Federation)

    2011-04-15

    The effect of americium-241 ({sup 241}Am), an alpha-emitting radionuclide of high specific activity, on luminous bacteria Photobacterium phosphoreum was studied. Traces of {sup 241}Am in nutrient media (0.16-6.67 kBq/L) suppressed the growth of bacteria, but enhanced luminescence intensity and quantum yield at room temperature. Lower temperature (4 {sup o}C) increased the time of bacterial luminescence and revealed a stage of bioluminescence inhibition after 150 h of bioluminescence registration start. The role of conditions of exposure the bacterial cells to the {sup 241}Am is discussed. The effect of {sup 241}Am on luminous bacteria was attributed to peroxide compounds generated in water solutions as secondary products of radioactive decay. Increase of peroxide concentration in {sup 241}Am solutions was demonstrated; and the similarity of {sup 241}Am and hydrogen peroxide effects on bacterial luminescence was revealed. The study provides a scientific basis for elaboration of bioluminescence-based assay to monitor radiotoxicity of alpha-emitting radionuclides in aquatic solutions. - Highlights: {yields} Am-241 in water solutions (A = 0.16-6.7 kBq/L) suppresses bacterial growth.{yields} Am-241 (A = 0.16-6.7 kBq/L) stimulate bacterial luminescence. {yields} Peroxides, secondary radiolysis products, cause increase of bacterial luminescence.

  2. Dicty_cDB: VSJ233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available itfmvdmfanksq vadavakmydvkvkrvntlitprgekkafvtlspefeaadvankigli...fsli **kk Frame B: agkkvksntpkqdlsvskskltsikapaaaikakaaasavkkgvsnkstrkvrtsvifrr pvtlnnpkkpayprrsvnkitkmdqfrilkaplttesatqkiegsnt...e E Sequences producing significant alignments: (bits) Value VSJ233 (VSJ233Q) /CS...-B/SLC129Q.Seq.d/ 1021 0.0 own update 2001.11.29 Homology vs DNA Score E Sequences producing significant alignments: (bits....6 1 dna update 2003. 7.18 Homology vs Protein Score E Sequences producing significant alignments: (bits) Va

  3. Repository criticality control for 233U using depleted uranium

    International Nuclear Information System (INIS)

    The US is evaluating methods for the disposition of excess weapons-usable 233U, including disposal in a repository. Isotopic dilution studies were undertaken to determine how much depleted uranium (DU) would need to be added to the 233U to minimize the potential for nuclear criticality in a repository. Numerical evaluations were conducted to determine the nuclear equivalence of different 235U enrichments to 233U isotopically diluted with DU containing 0.2 wt% 235U. A homogeneous system of silicon dioxide, water, 233U, and DU, in which the ratio of each component was varied, was used to determine the conditions of maximum nuclear reactivity. In terms of preventing nuclear criticality in a repository, there are three important limits from these calculations. 1. Criticality safe in any nonnuclear system: The required isotopic dilution to ensure criticality under all conditions, except in the presence of man-made nuclear materials (beryllium, etc.), is ≅1.0% 235U in 238U. The equivalent 233U enrichment level is 0.53 wt% 233U in DU. 2. Critically safe in natural systems: The lowest 235U enrichment found in a natural reactor at shutdown was approximately1.3%. French studies, based on the characteristics of natural uranium ore bodies, indicate that a minimum enrichment of approximately1.28% 235U is required for criticality. These data suggest that nuclear criticality from migrating uranium is not realistic unless the 235U enrichments exceed approximately1.3%, which is a result that is equivalent to 0.72% 233U in DU. 3. Criticality safety equivalent to light water reactor (LWR) spent nuclear fuel (SNF): The 233U can be diluted with DU so that the uranium criticality characteristics match SNF uranium. Whatever repository criticality controls are used for SNF can then be used for 233U. The average LWR SNF assay (after decay of plutonium isotopes to uranium isotopes) is 1.5% 235U equivalent in 238U. This is equivalent to diluting 233U to 0.81% in DU

  4. Separation and determination of americium in low-level alkaline waste of NPP origin

    Science.gov (United States)

    Todorov, B.; Djingova, R.; Nikiforova, A.

    2006-01-01

    The aim of this work is to develop a short and cost-saving procedure for the determination of 241Am in sludge sample of the alkaline low-level radioactive waste (LL LRAW) collected from Nuclear Power Plant “Kozloduy”. The determination of americium was a part of a complex analytical approach, where group actinide separation was achieved. An anion exchange was used for separation of americium from uranium, plutonium and iron. For the separation of americium extraction with diethylhexyl phosphoric acid (DEHPA) was studied. The final radioactive samples were prepared by micro co-precipitation with NdF3, counted by alpha and gamma spectrometry. The procedure takes 2 hours. The recovery yield of the procedure amounts to (95 ± 1.5)% and the detection limit is 53 mBq/kg 241Am (t=150 000 s). The analytical procedure was applied for actual liquid wastes and results were compared to standard procedure.

  5. Americium 241 in vegetation of natural biocenoses and agrocenoses on Belarus territories contaminated with Chernobyl fall-out

    International Nuclear Information System (INIS)

    As a result of beta-decay of plutonium 241 the content of americium 241 increases progressively in soils, contaminated with Chernobyl trans uranium elements. Americium 241 displayed higher (0,5 - 1,5-fold) biological mobility than isotopes of plutonium 239, 240. Activity of americium 241 in surface phyto mass of wild and cultural plants varies from 0,04 to 5,9 Bq/kg of dry weight. Americium 241 contribution to the total trans uranium elements contamination of plants made up 60 - 80% in 1996 - 1998. Investigation of trials from the areas adjacent to the 30-km zone showed that mobility of americium 241 and plutonium was 5 - 15 times as high as in the zone

  6. Isotopic and elemental composition of plutonium/americium oxides influence pulmonary and extra-pulmonary distribution after inhalation in rats

    International Nuclear Information System (INIS)

    The biodistribution of plutonium and americium has been studied in a rat model after inhalation of two PuO2 powders in lungs and extra-pulmonary organs from 3 d to 3 mo. The main difference between the two powders was the content of americium (approximately 46% and 4.5% of total alpha activity). The PuO2 with a higher proportion of americium shows an accelerated transfer of activity from lungs to blood as compared to PuO2 with the lower americium content, illustrated by increased urinary excretion and higher bone and liver actinide retention. The total alpha activity measured reflects mostly the americium biological behavior. The activity contained in epithelial lining fluid, recovered in the acellular phase of broncho-alveolar lavages, mainly contains americium, whereas plutonium remains trapped in macrophages. Epithelial lining fluid could represent a transitional pulmonary compartment prior to translocation of actinides to the blood and subsequent deposition in extra-pulmonary retention organs. In addition, differential behaviors of plutonium and americium are also observed between the PuO2 powders with a higher dissolution rate for both plutonium and americium being obtained for the PuO2 with the highest americium content. Our results indicate that the biological behavior of plutonium and americium after translocation into blood differ two-fold: (1) for the two actinides for the same PuO2 aerosol, and (2) for the same actinide from the two different aerosols. These results highlight the importance of considering the specific behavior of each contaminant after accidental pulmonary intake when assessing extra-pulmonary deposits from the level of activity excreted in urine or for therapeutic strategy decisions. (authors)

  7. Determination of trace concentration of uranium in americium oxide samples by ICP-AES

    International Nuclear Information System (INIS)

    A solvent extraction method has been developed for the determination of uranium (200-2000 ppm) in americium oxide samples. The method involves the quantitative separation of uranium from americium matrix using mixed solvent comprising 1.1M tri-n-butyl phosphate (TBP) +1% trialkyl phosphine oxide (TRPO) + 0.3 M tertiary butyl hydroquinone (TBHQ) in n-dodecane. Uranium from the organic is stripped into the aqueous phase with 0.8 M oxalic acid and determined by ICP-AES. The reliability of the method was ascertained by analytical recovery, which is found to be nearly 100%. (author)

  8. Testing of 233U evaluations with criticality benchmarks

    International Nuclear Information System (INIS)

    To validate and improve the quality of the complete set of evaluated nuclear reaction data for 233U, criticality benchmarks with fast, epithermal and thermal spectra from ICSBEP handbook were selected to test 233U evaluations from CENDL-3.1, ENDF/B-Ⅶ.0, JENDL-3.3 and JENDL-4.0. The effective multiplication factors keff of selected benchmarks were calculated with the Monte Carlo code MCNP5 and compared with the benchmark values. The results were analyzed with trend against energy spectrum index and sensitivity analysis. In present validation, the underestimation of keff for benchmarks with thermal, epithermal or some of fast spectra is the main problem existed in the tested evaluations. From the view of thermal reactors design, the 233U evaluation from ENDF/B-Ⅶ.0 shows better performance than other file tested, but still overestimates the contribution of capture reaction in resonance region. (authors)

  9. Experimental 233U nondestructive assay with a random driver

    International Nuclear Information System (INIS)

    Nondestructive assay (NDA) of 233U in quantities up to 15 grams containing 7 ppM 232U age 2 years was investigated with a random driver. A passive singles counting technique showed a reproducibility within 0.2% at the 95% confidence level. This technique would be applicable throughout a process in which all of the 233U had the same 232U content at the same age. Where the 232U content varies, determination of 233U fissile content would require active NDA. Active coincidence counting utilizing a 238Pu, Li neutron source and a plastic scintillator detector system showed a reproducibility limit within 15% at the 95% confidence limit. The active technique was found to be very dependent on the detector system resolving time in order to make proper random coincidence corrections associated with the high gamma activity from the 232U decay chain

  10. Adsorption-desorption characteristics of plutonium and americium with sediment particles in the estuarine environment: studies using plutonium-237 and americium-241

    International Nuclear Information System (INIS)

    The particle formation of plutonium and americium, their adsorption onto fresh water sediments and the desorption from the sediments in sea water were studied in the Laboratory under simulated river-estuary conditions, using γ-emitting plutonium-237 and americium-241. The results of the experiments show that the particle formation of plutonium depends on its valence states, on pH and on the salinity of the medium. For river water at pH4, some 25%, 20% and 30% of the added 237Pu was in particulate form, larger than 0.45 μm, for Pu (III), Pu (IV) and Pu (VI), respectively, while 65%, 90% and 50% of the respective valence states was associated with particles at pH 8. In sea water the general pattern remains similar, although Pu (VI) is more soluble in sea water owing to higher ligand concentrations for carbonate and bicarbonate complexes. The pH-dependency of particle formation of Am (III) is more steep than that of plutonium and seems to be influenced by colloidal substances occurring in the experimental media. The adsorption-desorption characteristics of plutonium and americium with the sediment in river water as well as sea water reflect the characteristics of their particle formation, being dependent upon such properties as valence states, the pH and salinity of the medium. A sewage effluent added to the media has small but measurable effects on the adsorption-desorption processes of plutonium. (author)

  11. Decontamination of the 233-S building loadout hood

    International Nuclear Information System (INIS)

    This paper concerns the decontamination experience gained during the decontamination and decommissioning (DandD) operations on the Loadout Hood within the 233-S Building. The retired 233-S Building (Plutonium Concentration Facility) is being decommissioned as a demonstration project to develop baseline cost, technology, and operational data for DandD of alpha contaminated facilities. The Loadout Hood within the facility is a plutonium nitrate loadout system highly contaminated with transuranics. The paper consists of a brief description of the facility and Loadout Hood, a summary of the engineering and field work performed, and an evaluation of the technology and methods used

  12. Impact of ionic liquids on europium and americium extraction by an upper rim phosphorylated calixarene

    International Nuclear Information System (INIS)

    The solvent extraction of europium and americium using the calixarene 5,11,17,23-tetrakis[dipropylphosphinylmethyl] 25,26,27,28-tetrapropoxycalix[4]arene (conical conformation) in the presence of ionic liquids with different natures was studied. It was shown that upper rim phosphorylated calixarene is able to extract europium and americium from nitric acid to dichloroethane by forming a 1:1 complex without the addition of ionic liquids. The distribution coefficients of americium are higher than those of europium in this case, but the isolation degrees of both elements are insufficient for this system to be useful in extraction technologies. The addition of the ionic liquid trihexyl(tetradecyl)phosphonium hexafluorophosphate increases the europium distribution coefficient by values ranging from twofold to more than two orders of magnitude at ionic liquid concentrations of 1 and 50 %, respectively. The values of the distribution coefficients for americium are increased by approximately 25-fold after a 50 % addition of the ionic liquid. (author)

  13. Understanding the Chemistry of Uncommon Americium Oxidation States for Application to Actinide/Lanthanide Separations

    Energy Technology Data Exchange (ETDEWEB)

    Leigh Martin; Bruce J. Mincher; Nicholas C. Schmitt

    2007-09-01

    A spectroscopic study of the stability of Am(V) and Am(VI) produced by oxidizing Am(III) with sodium bismuthate is presented, varying the initial americium concentration, temperature and length of the oxidation was seen to have profound effects on the resultant solutions.

  14. Speciation and bioavailability of plutonium and americium in the Irish Sea and other marine ecosystems

    International Nuclear Information System (INIS)

    Since the late 1960s, the Irish Sea has become a repository for a variety of radio-elements originating mainly in discharges from the British Nuclear Fuels (BNF) plc. Sellafield reprocessing complex located on the Cumbrian coast. In particular, transuranium nuclides such as plutonium, americium and curium (the main constituents of the α-emitting discharges) have become incorporated into every marine compartment by a variety of mechanisms, many of which are not well understood. Although extensive studies have been carried out in the near-field (eastern Irish Sea, especially in the vicinity of the discharge point and collateral muddy sediments), comparatively little had been done to assess the long-term behaviour and bioavailability of plutonium and americium in the far-field, e.g., the western Irish Sea, prior to the present study. In this dissertation, the results of an extensive research programme, undertaken in order to improve and refine our understanding of the behaviour of plutonium and americium in the marine environment, are presented. Specifically, the thesis details the results of (and conclusions deduced from) a series of experiments in which the physical and chemical speciation, colloidal association, mobility and bioavailability of plutonium and americium were examined in diverse environments including the Irish Sea and the Mediterranean. (author)

  15. Evaluation of the readsorption of plutonium and americium in dynamic fractionations of environmental solid samples

    DEFF Research Database (Denmark)

    Petersen, Roongrat; Hou, Xiaolin; Hansen, Elo Harald

    2008-01-01

    extractions. The degree of readsorption in dynamic and conventional batch extraction systems are compared and evaluated by using a double-spiking technique. A high degree of readsorption of plutonium and americium (>75%) was observed in both systems, and they also exhibited similar distribution patterns...

  16. Extraction chromatographic recovery of americium from acidic raffinate solutions using CMPO adsorbed on Chromosorb-102

    International Nuclear Information System (INIS)

    Microgram amounts of americium have been separated and purified from large amounts of uranium present in effluent solutions resulting from the anion-exchange columns during the purification and recovery of plutonium by using TBP extraction followed by extraction chromatography using CMPO adsorbed on Chromosorb-102. (author). 4 refs., 1 tab

  17. Cesium-137 and americium-241 distribution by granulometric fractions of soil at Azgir test site grounds

    International Nuclear Information System (INIS)

    In measurements of radionuclide specific content in surface soil layer of contaminated territories it is important to determine in what agglomerations of soil particles there is the highest radionuclide concentration. For this purpose granulometric composition of soil at Azgir test site was studied and cesium-137 and americium-241 distribution by soil fractions was researched. (author)

  18. Development of analytical methods for the separation of plutonium, americium, curium and neptunium from environmental samples

    OpenAIRE

    Salminen, Susanna

    2009-01-01

    In this work, separation methods have been developed for the analysis of anthropogenic transuranium elements plutonium, americium, curium and neptunium from environmental samples contaminated by global nuclear weapons testing and the Chernobyl accident. The analytical methods utilized in this study are based on extraction chromatography. Highly varying atmospheric plutonium isotope concentrations and activity ratios were found at both Kurchatov (Kazakhstan), near the former Semipalatinsk...

  19. Determination of specific activity of americium and plutonium in selected environmental samples

    International Nuclear Information System (INIS)

    The aim of this work was development of method for determination of americium and plutonium in environmental samples. Developed method was evaluated on soil samples and after they was applied on selected samples of fishes (smoked mackerel, herring and fillet from Alaska hake). The method for separation of americium is based on liquid separation with Aliquate-336, precipitation with oxalic acid and using of chromatographic material TRU-SpecTM.The intervals of radiochemical yields were from 13.0% to 80.9% for plutonium-236 and from 10.5% to 100% for americium-241. Determined specific activities of plutonium-239,240 were from (2.3 ± 1.4) mBq/kg to (82 ± 29) mBq/kg, the specific activities of plutonium-238 were from (14.2 ± 3.7) mBq/kg to (708 ± 86) mBq/kg. The specific activities of americium-241 were from (1.4 ± 0.9) mBq/kg to (3360 ± 210) mBq/kg. The fishes from Baltic Sea as well as from North Sea show highest specific activities then fresh-water fishes from Slovakia. Therefore the monitoring of alpha radionuclides in foods imported from territories with nuclear testing is recommended

  20. Application of hollow fiber supported liquid membrane for the separation of americium from the analytical waste

    International Nuclear Information System (INIS)

    Americium from analytical solid waste containing U and metallic impurities was separated using hollow fiber supported liquid membrane (HFSLM) technique impregnated with DHOA-TODGA from nitric acid medium. An aliquot of 5 g of the solid waste containing Am (19.95 mg) as minor actinide and of U (2,588 mg), Fe (1,360 mg), Ca (1,810 mg) and Na (3,130 mg) as major impurities was processed. The feed solution obtained after the dissolution of the residue in ∼4 M HNO3 was passed through HFSLM module. In the first stage using 1 M DHOA-dodecane was used for the separation of Am from other impurities. Though, majority of the elements were separated in this cycle, Ca was co extracted along with the americium. CMPO extraction chromatographic technique was used for further separation of americium from Ca. Significant decontamination factors were achieved in this three step separation process with respect to U, Fe, Na and Ca with ∼77 % recovery of americium. (author)

  1. Determination of α-emitters (plutonium, americium, curium ...) in feces and urine ashes

    International Nuclear Information System (INIS)

    A description is given of the methods used to determine a number of radionuclides to be found in feces and urine, and obtain samples thin enough for counting and α-spectrometry. These methods can be applied to plutonium, americium and curium especially

  2. Upper Limits to Americium Concentration in Medium Size Sodium Cooled Fast Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y.P.; Wallenius, J. [Royal Institute of Technology (KTH), AlbaNova University Centre, S-106 91, Stockholm (Sweden)

    2009-06-15

    The fastest way to realize transmutation of minor actinides would be using existing reactor types, adding some proper modifications to allow for insertion of MA in the fuel. According to calculations by Fazio and co-workers, the consumption rate of TRU in a low conversion ratio fast reactor may reach 70-75 % of that of an ADS with uranium free fuel [1]. However, americium introduction brings a negative influence on several safety parameters such as {beta}{sub eff}, Doppler coefficient, coolant temperature coefficient and void worth. Therefore the upper limit of americium that can be included into the fuel needs to be carefully evaluated. In this paper, fast reactor fuels with various minor actinide fractions are loaded into a SAS4A model of the semi-commercial BN600 reactor. Unprotected loss of flow (ULOF) and transient over power (UTOP) accidents are modelled using safety parameters obtained from Monte Carlo simulations as well as from the deterministic calculations published by Fazio et al. Applying the latter parameters (obtained with VARI3D), the upper limit to MA concentration in the fuel of a medium sized SFR of BN-600 type appears at 12%, corresponding to 8% of americium. We note however that the Doppler constants displayed by Fazio et al for MA concentrations above 10% have a considerably larger magnitude than those obtained with MCNP. Applying the safety parameters obtained with Monte Carlo simulations and updated nuclear data evaluations, we find that the upper limit to the americium concentration allowing to survive a ULOF is about half of that inferred by the use of parameters from VARI-3D. Since such a difference has a major impact on the predicted americium transmutation capability of SFR, it is of high priority to analyse the reasons for the apparent discrepancies. We note here that the major contribution to the Doppler feedback comes from capture resonance in U-238 and Pu-240 residing below the sodium scattering resonance located at 3 keV, and that

  3. Effect of bone-status on retention and distribution of americium-241 in bones of small rodents

    International Nuclear Information System (INIS)

    Forced physical exercise before and after application of americium-241 resulted in only small changes in bone-structure and behaviour of the radionuclide in bone. Feeding of a low phosphorus or low calcium diet resulted in an increased excretion of americium from bone, whereby Zn-DTPA as chelating agent removed an additional fraction of the radionuclide from bone. Low calcium diet and simultaneous continuous infusion of pharmacological doses of vitamin D-hormones didn't increase the excretion of americium more than the low calcium diet alone. (orig.)

  4. 7 CFR 1209.233 - Regional caucus chairpersons.

    Science.gov (United States)

    2010-01-01

    ... chairpersons will coordinate the entire nomination process. In conducting the nominations process, each... PROMOTION, RESEARCH, AND CONSUMER INFORMATION ORDER Rules and Regulations Nomination Procedures § 1209.233..., and voting for importer nominees is limited to importers; and (2) Producer candidates for...

  5. 46 CFR 108.233 - Location and size.

    Science.gov (United States)

    2010-10-01

    ... COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) A-MOBILE OFFSHORE DRILLING UNITS DESIGN AND EQUIPMENT Construction and Arrangement Helicopter Facilities § 108.233 Location and size. (a) Each helicopter deck must be— (1) At least the size of the rotor diameter of the largest single main...

  6. 48 CFR 1852.233-70 - Protests to NASA.

    Science.gov (United States)

    2010-10-01

    ... 1852.233-70 Protests to NASA. As prescribed in 1833.106-70, insert the following provision: Protests to NASA (OCT 2002) Potential bidders or offerors may submit a protest under 48 CFR part 33 (FAR part 33... 48 Federal Acquisition Regulations System 6 2010-10-01 2010-10-01 true Protests to NASA....

  7. 45 CFR 233.20 - Need and amount of assistance.

    Science.gov (United States)

    2010-10-01

    ... eligible child by applying the stepparent deeming formula at 45 CFR 233.20(a)(3)(xiv). (vii) If the State... Orange Product liability litigation, M.D.L. No. 381 (E.D.N.Y.). (t) Student financial assistance made..., items such as depreciation, personal business and entertainment expenses, personal...

  8. Dicty_cDB: VHJ233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHJ233 (Link to dictyBase) - - - Contig-U16440-1 - (Link to Original site) ... camonas acidamino... 34 3.2 (Q8TS91) RecName: Full=Imidazole ... glycerol phosphate synthase sub... 33 4.2 AF191043 ...

  9. 48 CFR 1452.233-2 - Service of Protest.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Service of Protest. 1452... Protest. As prescribed in 1433.106, the provision at FAR 52.233-2, Service of Protest, shall be modified...: “Service of Protest Department of the Interior (JUL 1996) (Deviation)”; and adding the following...

  10. 48 CFR 52.233-2 - Service of Protest.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Service of Protest. 52.233... Service of Protest. As prescribed in 33.106(a), insert the following provision: Service of Protest (SEP 2006) (a) Protests, as defined in section 33.101 of the Federal Acquisition Regulation, that are...

  11. 48 CFR 52.233-3 - Protest After Award.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Protest After Award. 52....233-3 Protest After Award. As prescribed in 33.106(b), insert the following clause: Protest After Award (AUG 1996) (a) Upon receipt of a notice of protest (as defined in FAR 33.101) or a...

  12. 48 CFR 852.233-71 - Alternate protest procedure.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Alternate protest... § 852.233-71 Alternate protest procedure. As prescribed in 833.106, insert the following provision: Alternate Protest Procedure (JAN 1998) As an alternative to filing a protest with the contracting...

  13. 48 CFR 952.233-5 - Agency protest review.

    Science.gov (United States)

    2010-10-01

    ... level. The Department of Energy's agency protest procedures, set forth in 48 CFR 933.103, elaborate on... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Agency protest review. 952... SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 952.233-5 Agency protest review....

  14. The 233Pa fission cross-section measurement and evaluation

    International Nuclear Information System (INIS)

    233Pa is a conspicuous example of strongly discrepant data in the accepted nuclear data evaluations. The precise knowledge of the neutron-induced reaction cross-section of this highly β-active nuclide (T1/2 = 27.0 d) is essential for the successful implementation of the thorium-based fuel cycle in advanced nuclear applications. The reactions involving 233Pa are responsible for the balance of nuclei as well as the average number of prompt fission neutrons in a contemplated reactor scenario. In an IAEA report, it is stated that there is a need to know the 233Pa(n, f) cross-section with an accuracy of 20%. The different evaluated neutron data libraries show, however, a difference of a factor of two for this cross-section. It has previously been deemed not feasible to measure this reaction directly due to its short half-life, high radioactivity and the in-growth of the daughter product 233U. Hence, the entries in the neutron libraries are based on theoretical predictions, which explains the large discrepancies. As reported recently the neutron-induced fission cross-section of 233Pa has been measured for the first time directly with mono-energetic neutrons from 1.0 to 3.0 MeV at the Van-de-Graaff facility of the IRMM. In the meantime, during two further measurement campaigns, the energy range has been extended up to 8.5 MeV. The experimental results will be presented together with recent model calculations of the fission cross-section applying the statistical model code STATIS, which improve the cross-section evaluation up to the second chance fission threshold. (authors)

  15. Interaction and diffusion transport of americium in soils

    International Nuclear Information System (INIS)

    The final disposal of High Level Radioactive Wastes (HLRW) is based on its long-term storage in underground facilities located in geological stable sites with a multi-barrier system, the so called Deep Geological Repositories (DGR), that will keep HLRW confined for >10.000 years. After this period of time, leachates rich in long-live radioisotopes might escape from DGR and start to transport towards the biosphere. There is still a lack of information concerning the interaction and transport in soils of some radionuclides present in HLRW, especially for radionuclides that present a high sorption, such as americium (Am). Having reliable information about the mobility of radionuclides in soils is crucial in order to develop risk assessment models and to take proper decisions in case of soil contamination. The aim of the present work was, by means of laboratory scale experiments, to study the interaction and, for first time, to evaluate the diffusion transport of 241Am in soils. The 241Am interaction in soils was assessed by applying sorption batch assays to 20 soil samples with contrasted edaphic properties which allowed us to quantify the solid-liquid distribution coefficient (Kd) and desorption percentage. Kd (Am) values ranged from 103 to 105 L kg-1 and desorption percentages were always less than 2% which denoted a high capacity of the soil to incorporate the Am and a low reversibility of the sorption process. The influence of soil properties in 241Am interaction was studied by means of multiple linear and multivariate regressions. Although a single correlation between Kd (Am) values and a soil property was not found, the main properties affecting 241Am interaction in soils were soil pH, carbonate and organic matter contents in the soil. Finally, additional batch assays at different controlled pH were done to study Am sorption as a function of the contact solution pH. A variation of the Am sorption capacity was observed in all soils due to the dissolution of soil

  16. Interaction and diffusion transport of americium in soils

    Energy Technology Data Exchange (ETDEWEB)

    Ramirez-Guinart, Oriol; Rigol, Anna; Vidal, Miquel [Analytical Chemistry department, Faculty of Chemistry, University of Barcelona, Marti i Franques 1-11, 08028, Barcelona (Spain)

    2014-07-01

    The final disposal of High Level Radioactive Wastes (HLRW) is based on its long-term storage in underground facilities located in geological stable sites with a multi-barrier system, the so called Deep Geological Repositories (DGR), that will keep HLRW confined for >10.000 years. After this period of time, leachates rich in long-live radioisotopes might escape from DGR and start to transport towards the biosphere. There is still a lack of information concerning the interaction and transport in soils of some radionuclides present in HLRW, especially for radionuclides that present a high sorption, such as americium (Am). Having reliable information about the mobility of radionuclides in soils is crucial in order to develop risk assessment models and to take proper decisions in case of soil contamination. The aim of the present work was, by means of laboratory scale experiments, to study the interaction and, for first time, to evaluate the diffusion transport of {sup 241}Am in soils. The {sup 241}Am interaction in soils was assessed by applying sorption batch assays to 20 soil samples with contrasted edaphic properties which allowed us to quantify the solid-liquid distribution coefficient (K{sub d}) and desorption percentage. K{sub d} (Am) values ranged from 10{sup 3} to 10{sup 5} L kg{sup -1} and desorption percentages were always less than 2% which denoted a high capacity of the soil to incorporate the Am and a low reversibility of the sorption process. The influence of soil properties in {sup 241}Am interaction was studied by means of multiple linear and multivariate regressions. Although a single correlation between K{sub d} (Am) values and a soil property was not found, the main properties affecting {sup 241}Am interaction in soils were soil pH, carbonate and organic matter contents in the soil. Finally, additional batch assays at different controlled pH were done to study Am sorption as a function of the contact solution pH. A variation of the Am sorption

  17. SKIN DOSIMETRY IN CONDITIONS OF ITS CONSTANT SURFACE CONTAMINATION WITH SOLUTIONS OF PLUTONIUM-239 AND AMERICIUM-241

    Directory of Open Access Journals (Sweden)

    E. B. Ershov

    2012-01-01

    Full Text Available The article considers, on the basis of experimental data, the issue of assessing dose burdens to the skin basal layer in conditions of its permanent contamination with solutions of plutonium-239 and americium-241 and subsequent decontamination.

  18. Metabolism of americium-241 in man: an unusual case of internal contamination of a child and his father

    International Nuclear Information System (INIS)

    The metabolism of americium-241 was studied during an 8-yr period of an adult male and his son who, at the ages of 50 and 4, respectively, were accidentally and unknowingly contaminated within their home by means of inhalation. Chelation therapy with Na3(Ca-DTPA) was more effective in enhancing the removal of americium-241 from the child than from his father

  19. 47 CFR 51.233 - Significant degradation of services caused by deployment of advanced services.

    Science.gov (United States)

    2010-10-01

    ... presumption that it is acceptable for deployment under § 51.230, the degraded service shall not prevail... deployment of advanced services. 51.233 Section 51.233 Telecommunication FEDERAL COMMUNICATIONS COMMISSION... § 51.233 Significant degradation of services caused by deployment of advanced services. (a) Where...

  20. 39 CFR 233.5 - Requesting financial records from a financial institution.

    Science.gov (United States)

    2010-07-01

    ... 39 Postal Service 1 2010-07-01 2010-07-01 false Requesting financial records from a financial institution. 233.5 Section 233.5 Postal Service UNITED STATES POSTAL SERVICE ORGANIZATION AND ADMINISTRATION INSPECTION SERVICE AUTHORITY § 233.5 Requesting financial records from a financial institution....

  1. 48 CFR 5452.233-9001 - Disputes: Agreement To Use Alternative Dispute Resolution (ADR).

    Science.gov (United States)

    2010-10-01

    ... Alternative Dispute Resolution (ADR). 5452.233-9001 Section 5452.233-9001 Federal Acquisition Regulations... of Provisions and Clauses 5452.233-9001 Disputes: Agreement To Use Alternative Dispute Resolution... Alternative Dispute Resolution (ADR) (APR 2001)—DLAD (a) The parties agree to negotiate with each other to...

  2. 48 CFR 2852.233-70 - Protests filed directly with the Department of Justice.

    Science.gov (United States)

    2010-10-01

    ... with the Department of Justice. 2852.233-70 Section 2852.233-70 Federal Acquisition Regulations System DEPARTMENT OF JUSTICE Clauses and Forms SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 2852.233-70 Protests filed directly with the Department of Justice. As prescribed in...

  3. 48 CFR 52.233-4 - Applicable Law for Breach of Contract Claim.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 2 2010-10-01 2010-10-01 false Applicable Law for Breach of Contract Claim. 52.233-4 Section 52.233-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION (CONTINUED) CLAUSES AND FORMS SOLICITATION PROVISIONS AND CONTRACT CLAUSES Text of Provisions and Clauses 52.233-4 Applicable Law...

  4. 48 CFR 1352.233-71 - GAO and Court of Federal Claims protests.

    Science.gov (United States)

    2010-10-01

    ....233-71 GAO and Court of Federal Claims protests. As prescribed in 48 CFR 1333.104-70(a), insert the following provision: GAO and Court of Federal Claims Protests (APR 2010) (a) A protest may be filed with... Claims protests. 1352.233-71 Section 1352.233-71 Federal Acquisition Regulations System DEPARTMENT...

  5. 45 CFR 233.37 - How monthly reports are treated and what notices are required (AFDC).

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false How monthly reports are treated and what notices are required (AFDC). 233.37 Section 233.37 Public Welfare Regulations Relating to Public Welfare... § 233.37 How monthly reports are treated and what notices are required (AFDC). (a) What happens if...

  6. 45 CFR 233.38 - Waiver of monthly reporting and retrospective budgeting requirements; AFDC.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Waiver of monthly reporting and retrospective budgeting requirements; AFDC. 233.38 Section 233.38 Public Welfare Regulations Relating to Public Welfare... § 233.38 Waiver of monthly reporting and retrospective budgeting requirements; AFDC. (a) States...

  7. Influence of biofilms on migration of uranium, americium and europium in the environment; Einfluss von Biofilmen auf das Migrationsverhalten von Uran, Americium und Europium in der Umwelt

    Energy Technology Data Exchange (ETDEWEB)

    Baumann, Nils; Zirnstein, Isabel; Arnold, Thuro

    2015-07-01

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  8. Liquid-liquid extraction separation and sequential determination of plutonium and americium in environmental samples by alpha-spectrometry

    International Nuclear Information System (INIS)

    A procedure is described by which plutonium and americium can be determined in environmental samples. The sample is leached with nitric acid and hydrogen peroxide, and the two elements are co-precipitated with ferric hydroxide and calcium oxalate. The calcium oxalate is incinerated at 4500 and the ash is dissolved in nitric acid. Plutonium is extracted with tri-n-octylamine solution in xylene from 4M nitric acid and stripped with ammonium iodide/hydrochloric acid. Americium is extracted with thenoyltrifluoroacetone solution in xylene at pH 4 together with rare-earth elements and stripped with 1M nitric acid. Americium and the rare-earth elements thus separated are sorbed on Dowex 1 x 4 resin from 1M nitric acid in 93% methanol, the rare-earth elements are eluted with 0.1M hydrochloric acid/0.5M ammonium thiocyanate/80% methanol and the americium is finally eluted with 1.5M hydrochloric acid in 86% methanol. Plutonium and americium in each fraction are electro-deposited and determined by alpha-spectrometry. Overall average recoveries are 81% for plutonium and 59% for americium. (author)

  9. Dicty_cDB: VSA233 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 4231 |BF294231.1 001PbG02 Pb cDNA #17, Tommaso Pace, Marta Ponzi, and Clara Frontali Plasmodium berghei cDNA...t: 0.00 m3a: 0.00 m3b: 0.00 m_ : 1.00 52.0 %: cytoplasmic 24.0 %: nuclear 8.0 %: cytoskeletal 4.0 %: Golgi 4.0 %: mitochondrial...VS (Link to library) VSA233 (Link to dictyBase) - - - Contig-U15040-1 VSA233Z (Link to Original...tlfiyrnikqylml*yn snraklsp Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Val...1. 8 Homology vs DNA Score E Sequences producing significant alignments: (bits) Value N AZ522056 |AZ522056.1

  10. Fast and Thermal Data Testing of U-233 Critical Assemblies

    International Nuclear Information System (INIS)

    Data testing has been performed for U-233 fast and thermal benchmarks. Results are presented for both ENDF/B-VI and a modified JENDL-3.2 evaluation. The revised JENDL-3.2 evaluation is summarized and comparisons with ENDF/B-VI and measured values are discussed. Calculated results using both cross section sets are presented for 10 fast benchmarks (reflected and unreflected U-233 metal) and 38 thermal benchmarks (uranyl-nitrate solutions in spherical and cylindrical geometry). Using the revised JENDL-3.2 evaluation, very good results are obtained for the calculated k-effs for almost all of the 48 benchmarks considered in this study. Possible future work is discussed briefly

  11. Updated and revised neutron reaction data for 233U

    Institute of Scientific and Technical Information of China (English)

    YU Bao-Sheng; CHEN Guo-Chang; ZHANG Hua; CAO Wen-Tian; TANG Guo-You; TAO Xi

    2013-01-01

    A complete set of n+233U neutron reaction data from 10-5 eV-20 MeV is updated and revised based on the evaluated experimental data and the feedback information of various benchmark tests.The main revised quantities are nubars,cross sections as well as angular distributions,etc.The benchmark tests indicate that the present evaluated data achieve very promising results.

  12. Nuclear fuel cycle based on thorium and uranium-233

    International Nuclear Information System (INIS)

    The analysis of activities carried out in this country and abroad on a complex solution of principal problems of nuclear power advance. Demonstration of the potentiality of the above problems solution on the basis of conventional reactor plant development (light water cooled reactors and BN-type fast reactors) within the framework of nuclear fuel cycle using uranium-235, plutonium and uranium-233. 28 refs.; 1 fig.; 8 tabs

  13. Electrodeposition of americium on a liquid cadmium cathode from a molten salt bath

    International Nuclear Information System (INIS)

    A high-activity experiment involving the electrode position of americium on a liquid cadmium cathode from a LiCl-KCl eutectic with about 3 g of AmO2 was conducted in a shielded cell in the ATALANTE complex. After describing the electrolyzer and the experimental conditions, the authors discuss the preparation of the LiCl-KCl-AmCl3 solution and briefly review its electrochemical properties. It was clearly confirmed that Am(III) reduction on an inert solid cathode occurs in two steps forming Am(II) before Am(0), whereas only one reduction step was observed on liquid cadmium. The main results of this study concern americium electrode position on the liquid cadmium cathode (recovery yields, current densities, problems encountered). The solvent properties of cadmium for actinide/lanthanide separation are discussed. (authors)

  14. Experimental Insight into the Radiation Resistance of Zirconia-Based Americium Ceramics

    International Nuclear Information System (INIS)

    Our works shows that the americium pyrochlore 241Am2Zr2O7 undergoes a phase transition to a defect-fluorite structure along with an unusual volume contraction when subjected to internal radiation from α-emitting actinides. Disorder relaxation proceeds through the simultaneous formation of cation anti sites and oxygen Frenkel pairs. X-ray absorption spectroscopy at the Am-LII and the Zr-K edges reveals that Am-O polyhedra show an increasing disorder with increasing exposure. In contrast, the Zr-O polyhedral units remain highly ordered, while rotating along edges and corners, thereby reducing the structural strain imposed by the growing disorder around americium. We believe it is this particular property of the compound that provides the remarkable resistance to radiation (≥9.4 * 1018) α-decay events g-1 or 0.80 dpa). (authors)

  15. Influence of some organic additives on the extractive separation of americium(III) by sulfoxides

    International Nuclear Information System (INIS)

    The solvent extraction behavior of americium(III) from aqueous nitrate media by two long-chain aliphatic sulfoxides has been examined systematically in the presence of several water-miscible organic solvents to study their possible synergistic effect on metal ion extraction. Methanol, ethanol, n- and isopropanol, n-butanol, dioxane, acetone, as well as acetonitrile, were employed as the organic component of the mixed (polar) phase. These additives affected the extraction to varying degrees. Extractability of Am increased 5 to 10-fold with increasing concentration of some of these additives, with the maximum enhancement being observed in the presence of acetone or acetonitrile. However, alcohols are generally very poor in this respect. Possible reasons for such behavior are briefly discussed. The distribution of several common contaminants was also investigated at the optimum condition for americium extraction

  16. Transmutation of americium and curium incorporated in zirconia-based host materials

    International Nuclear Information System (INIS)

    Presented are studies involving the incorporation of americium and curium in zirconia-based materials. First explored was the pseudo ternary system AmO2-ZrO2-Y2O3. It was determined that selected Y-CSZ materials can incorporate significant quantities of americium oxide and remain cubic single-phase. The cell parameters of these fluorite-type products were established to be linear with the AmO2 content. The Cm2O3-ZrO2 system was also investigated. It was found that at 25 mol% of CmO1.5, the Cm(III) stabilized zirconia in its cubic form (a = 5.21 ±0.01 Angstrom). At higher and lower concentrations, diphasic materials were encountered. At 50 mol% of CmO1.5, a pyrochlore oxide - Cm2Zr2O7 - is formed (a = 10.63 ±0.02 Angstrom). (author)

  17. Americium and samarium determination in aqueous solutions after separation by cation-exchange

    International Nuclear Information System (INIS)

    The concentration of trivalent americium and samarium in aqueous samples has been determined by means of alpha-radiometry and UV-Vis photometry, respectively, after chemical separation and pre-concentration of the elements by cation-exchange using Chelex-100 resin. Method calibration was performed using americium (241Am) and samarium standard solutions and resulted in a high chemical recovery for cation-exchange. Regarding, the effect of physicochemical parameters (e.g. pH, salinity, competitive cations and colloidal species) on the separation recovery of the trivalent elements from aqueous solutions by cation-exchange has also been investigated. The investigation was performed to evaluate the applicability of cation-exchange as separation and pre-concentration method prior to the quantitative analysis of trivalent f-elements in water samples, and has shown that the method could be successfully applied to waters with relatively low dissolved solid content. (author)

  18. Analysis of americium-beryllium neutron source composition using the FRAM code

    Energy Technology Data Exchange (ETDEWEB)

    Hypes, P. A. (Philip A.); Bracken, D. S. (David S.); Sampson, Thomas E.; Taylor, W. A. (Wayne A.)

    2002-01-01

    The FRAM code was originally developed to analyze high-resolution gamma spectra from plutonium items. Its capabilities have since been expanded to include analysis of uranium spectra. The flexibility of the software also enables a capable spectroscopist to use FRAM to analyze spectra in which neither plutonium nor uranium is present in significant amounts. This paper documents the use of FRAM to determine the {sup 239}Pu/{sup 241}Am, {sup 243}Am/{sup 241}Am, {sup 237}Np/{sup 241}Am, and {sup 239}Np/{sup 241}Am ratios in americium-beryllium neutron sources. The effective specific power of each neutron source was calculated from the ratios determined by FRAM in order to determine the americium mass of each of these neutron sources using calorimetric assay. We will also discuss the use of FRAM for the general case of isotopic analysis of nonplutonium, nonuranium items.

  19. Influence of environmental factors on the gastrointestinal absorption of plutonium and americium

    International Nuclear Information System (INIS)

    The absorption of plutonium and americium from the gastrointestinal tract was studied, using adult hamsters and rabbits. Both actinides were administered as inorganic compounds, as organic complexes with naturally occurring chelating agents, and in a biologically incorporated form in liver tissues. The absorption of the tetravalent and hexavalent forms of plutonium were compared and the effect of protracted administration at very low concentrations was investigated. In addition, plutonium uptake from contaminated sediments and grass, collected near a nuclear-fuel reprocessing plant, was measured. The results of these studies suggest that chronic exposure of man to plutonium and americium in food and water will not lead to any substantial increase in their gastrointestinal absorption above the values currently recommended by the International Commission on Radiological Protection to define the occupational exposure of workers

  20. Contemporary state of plutonium and americium in the soils of Palesse state radiation-ecological reserve

    International Nuclear Information System (INIS)

    Full text: At present, the most important alpha-emitting radionuclides of Chernobyl origin are Pu 238, Pu 239, Pu 240 and Am 241. They are classified as the most dangerous group of radionuclides in view of the long half-lives and high radiotoxicity. The main part of alpha-emitted radionuclides is located within the Palesse State Radiation-Ecological Reserve. One of the most important factors determining the radioecological situation in the contaminated ecosystems is the physicochemical forms of radionuclides in a soil medium. Radionuclide species determine the radionuclide entrance into the soil solutions, their redistribution in soil profiles and the 'soil - plant' and the 'soil - surface, ground or underground water' systems as well as spreading beyond the contaminated area. The present work is devoted to investigation of state and migration ability of plutonium and americium in soils of the Palesse state radiation-ecological reserve after more than 20 years from the Chernobyl accident. The objects of investigation were mineral and organic soils sampled in 2008 with the step of 5 cm to the depth of 25-30 cm. The forms of plutonium and americium distinguishing by association with the different components of soil and by potential for migration in the soil medium were studied using the method of sequential selective extraction according to the modified Tessier scheme. Activities of Pu 238, Pu 239, Pu 240 and Am 241 in the samples were determined by the method of radiochemical analysis with alpha-spectrometer radionuclide identification. The dominant part of plutonium and americium in the soils is in immobile forms. Nowadays, radionuclide portions in water soluble and reversibly bound forms do not exceed 9.4 % of radionuclide content in the soil. In mineral soil samples, the radionuclide portions in these fractions exceed the corresponding portions in organic ones. In both mineral and organic soils, the portions of mobile americium are higher than plutonium. The

  1. Standard test method for quantitative determination of americium 241 in plutonium by Gamma-Ray spectrometry

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    1994-01-01

    1.1 This test method covers the quantitative determination of americium 241 by gamma-ray spectrometry in plutonium nitrate solution samples that do not contain significant amounts of radioactive fission products or other high specific activity gamma-ray emitters. 1.2 This test method can be used to determine the americium 241 in samples of plutonium metal, oxide and other solid forms, when the solid is appropriately sampled and dissolved. 1.3 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  2. Fabrication of neptunium, plutonium, americium and curium metals for fuel research

    International Nuclear Information System (INIS)

    The techniques for the fabrication of actinide metals; neptunium, americium and curium called as minor actinides, and plutonium, are surveied in a viewpoint of the preparation of starting materials for fuel property measurements. In this report, the processes of the conversion to metals, purification et al. are reviewed. The concept related to the apparatus design is also proposed and the considerable subjects are discussed. (author)

  3. Final Radiological Assessment of External Exposure for CLEAR-Line Americium Recovery Operations

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Adam C. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Belooussova, Olga N. [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Hetrick, Lucas Duane [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-11-12

    Los Alamos National Laboratory is currently planning to implement an americium recovery program. The americium, ordinarily isotopically pure 241Am, would be extracted from existing Pu materials, converted to an oxide and shipped to support fabrication of americium oxide-beryllium neutron sources. These operations would occur in the currently proposed Chloride Extraction and Actinide Recovery (CLEAR) line of glove boxes. This glove box line would be collocated with the currently-operational Experimental Chloride Extraction Line (EXCEL). The focus of this document is to provide an in-depth assessment of the currently planned radiation protection measures and to determine whether or not further design work is required to satisfy design-goal and ALARA requirements. Further, this document presents a history of americium recovery operations in the Department of Energy and high-level descriptions of the CLEAR line operations to provide a basis of comparison. Under the working assumptions adopted by this study, it was found that the evaluated design appears to mitigate doses to a level that satisfies the ALARA-in-design requirements of 10 CFR 835 as implemented by the Los Alamos National Laboratory procedure P121. The analyses indicate that extremity doses would also meet design requirements. Dose-rate calculations were performed using the radiation transport code MCNP5 and doses were estimated using a time-motion study developed in consort with the subject matter expert. A copy of this report and all supporting documentation are located on the Radiological Engineering server at Y:\\Rad Engineering\\2013 PROJECTS\\TA-55 Clear Line.

  4. Strategy for the future use and disposition of uranium-233: Technical information

    International Nuclear Information System (INIS)

    This document provides a summary of technical information on the synthetic radioisotope 233U. It is one of a series of four reports that map out a national strategy for the future use and disposition of 233U. The technical information on 233U in this document falls into two main areas. First, material characteristics are presented along with the contrasts of 233U to the more well known strategic fissile materials, 235U and plutonium (Pu). Second, information derived from the scientific information, such as safeguards, waste classifications, material form, and packaging, is presented. Throughout, the effects of isotopically diluting 233U with nonfissile, depleted uranium (DU) are examined

  5. Fabrication of uranium–americium mixed oxide pellet from microsphere precursors: Application of CRMP process

    International Nuclear Information System (INIS)

    Highlights: • Dust free process for (U,Am)O2 transmutation target fabrication. • Synthesis of U0.9Am0.1O2 mixed oxide microspheres from ion exchange resin. • Fabrication of dense U0.9Am0.1O2 pellet with 95% TD from mixed oxide microspheres. - Abstract: Mixed uranium–americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Recently, several processes have been developed in order to validate fabrication flowchart in terms of material specifications such as density and homogeneity but also to suggest simplifications for lowering industrial costs and hazards linked to dust generation of highly contaminating and irradiating compounds. This study deals with the application of an innovative route using mixed oxide microspheres obtained from metal loaded resin bead calcination, called Calcined Resin Microsphere Pelletization (CRMP). The synthesis of mixed oxide microsphere precursor of U0.9Am0.1O2±δ is described as well as its characterisation. The use of this free-flowing precursor allows the pressing and sintering of one pellet of U0.9Am0.1O2±δ. The ceramic obtained was characterised and results showed that its microstructure is dense and homogeneous and its density attains 95% of the theoretical density. This study validates the scientific feasibility of the CRMP process applied to the fabrication of uranium and americium-containing materials

  6. Influence of dissolved organic substances in groundwater on sorption behavior of americium and neptunium

    International Nuclear Information System (INIS)

    Groundwaters typically contain dissolved organic carbon consisting largely of high molecular weight compounds of humic and fulvic acids. To evaluate whether these dissolved organic substances can enhance the tranport of radionuclides through the groundwater system, experiments were conducted to examine the sorption of americium and neptunium onto crushed basalt in the presence of dissolved humic- and fulvic-acid organic carbon introduced into synthetic groundwater. The partitioning experiments with synthetic groundwater show that increasing the concentration of either humic or fulvic acid in the water has a significant inhibiting effect on sorption of both americium and neptunium. At 220C, adsorption of these radionuclides, as measured by distribution ratios (the ratio of nuclide sorbed onto the solid to nuclide in solution at the end of the experiment), decreased by 25% to 50% by addition of as little as 1 mg/L dissolved organic carbon and by one to two orders of magnitude by addition of 100 to 200 mg/L dissolved organic carbon. Distribution ratios measured in solutions reacted at 900C similarly decreased with the addition of dissolved organic carbon but generally ranged from one to two orders of magnitude higher than those determined in the 220C experiment. These results suggest that organic carbon dissolved in deep groundwaters may significantly enhance the mobility of radionuclides of americium and neptunium. 23 references, 5 figures, 11 tables

  7. Bidentate organophosphorus extraction of americium and plutonium from Hanford Plutonium Reclamation Facility waste

    Energy Technology Data Exchange (ETDEWEB)

    Schulz, W.W.

    1974-09-01

    Applicability of bidentate organiphosphorus reagents to recovery of americium and plutonium from Hanford's Plutonium Reclamation Facility acid (approx. 2M HNO/sub 3/) waste stream (CAW solution) was studied. A solvent extraction process which employs a 30% DHDECMP (dihexyl-N, N-diethylcarbamylmethylene phosphonate)-CCl/sub 4/ extractant was devised and successfully tested in mixer-settler runs with actual CAW solution. Substitution of DHDECMP for DBBP eliminates the need to perform careful neutralization of unbuffered CAW soluton and increases overall americium recovery from the present 60 to 80% level to greater than or equal to 90%. Disadvantages to such substitution include the high cost (approx. $50/liter) of DHDECMP and the need to purify it (by acid (6M HCl) hydrolysis and alkaline washing) from small amounts of an unidentified impurity which prevents stripping of americium with dilute HNO/sub 3/. Distribution data obtained in this study confirm Siddall's earlier contention that bidentate organophosphorus regents can be used to remove actinides from concentrated high-level Purex process acid waste; a conceptual flowsheet for such an extraction process is given.

  8. Selective recovery of americium alone from PUREX or COEXTM raffinate by the EXAm process

    International Nuclear Information System (INIS)

    Americium is the main contributor to the long-term radiotoxicity and to the heat generation of glasses used for the HLW conditioning. To decrease both impact on the ultimate waste and to avoid the difficult recycling of curium, the CEA has developed the EXAm process for the the separation and the recovery of the sole americium directly from PUREX or COEXTM raffinates. The principle of the EXAm process is to extract americium and light lanthanides from high nitric acid media, leaving curium and heavy lanthanides in the raffinate. A water-soluble amide molecule, TEDGA, is added in aqueous phase to increase Am/Cm and Am/heavy lanthanides selectivity, because of the preferential complexation of curium and heavy lanthanides by this diglycolamide. Many experimental data have been acquired mainly at the extraction-scrubbing step (Am/Cm separation) and were used for the development of a phenomenological model implemented in the PAREX process simulation code. The scientific feasibility demonstration of the EXAm process was then performed on a genuine PUREX raffinate in Atalante CBP hot cell in 2010. (author)

  9. Uptake and effects of americium-241 on a brackish-water amphipod

    International Nuclear Information System (INIS)

    The present paper reports the results of experimental work undertaken using the brackish-water amphipod Gammarus duebeni duebeni and the transuranium nuclide americium-241. Data on the accumulation of this actinide showed that the larger fraction of the total body burden is associated with the exoskeleton. It was found that the body burden remained constant in the range pH 8.0-6.5 even though the water concentration changed markedly. It would thus appear that the concept of a concentration factor should be re-examined and it is proposed that a factor should be defined in terms of environmental and chemical parameters which represent the bioavailable fraction of the actinide. The effect of americium on survival and moulting was studied at two activity concentrations; the dose rates and absorbed doses under the experimental conditions employed have been estimated. The differences in survival rates between the control and irradiated groups were statistically analyzed and the significant difference at the higher concentration is believed to be due to a synergism between physiological stress and radiotoxicity of americium rather than the chemical toxicity of the element. (orig.)

  10. About the reaction between uranium-americium mixed oxides and sodium

    International Nuclear Information System (INIS)

    The recycling and fission of the highly toxic minor actinides neptunium and americium is only possible in a liquid metal cooled fast breeder reactor, for nuclear physical reasons. The present work is part of a research program dealing with the fuel-coolant interaction. Fuel pellets with equal parts of americium and uranium and varying oxygen-metal ratio were investigated. A behaviour comparable to that of uranium-plutonium mixed oxides was suggested as a first approach. The reaction of sodium with (U0.5Am0.5)O2-x results in a complete desintegration of the sintered pellet whereas (U, Pu)O2-x pellets show a small increase in volume. A first explanation of the strong reaction of uranium-americium mixed oxides compared to (U, Pu)O2-x or (U, Np)O2-x could be provided by the less negative oxygen potential of the former. Ternary and polynary oxides which are possible products of the fuel-coolant reaction were prepared and characterised by X-ray diffraction. Their oxygen potentials were measured using a solid state e.m.f. cell. Neither Na2AmO3 nor Na3AmO4 can coexist with sodium metal. The measured ΔGO2 values of the Am(IV) and Am (V)-compounds are much higher than those of the sodium uranates(VI) or sodium neptunates(VI). Only Na2O seems to be likely as product of the fuel-coolant interactions. It could be determined in reacted samples by X-ray diffraction. The relatively high oxygen potentials of (U0.5Am0.5)O2-x that are responsible for the reaction could be explained by a binding model which is based on an americium valency state of + 3 and U5+. The existence of both valency states could be proved by XPS measurements. Due to the similar behaviour of neptunium and uranium the problems that are expected for the recycling of Np are much smaller than for americium

  11. History of Uranium-233(233U)Processing at the Rocky Flats Plant. In support of the RFETS Acceptable Knowledge Program

    International Nuclear Information System (INIS)

    This report documents the processing of Uranium-233 at the Rocky Flats Plant (Rocky Flats Environmental Technology Site). The information may be used to meet Waste Isolation Pilot Plant (WIPP) Waste Acceptance Criteria (WAC)and for determining potential Uranium-233 content in applicable residue waste streams

  12. Th/U-233 multi-recycle in PWRs.

    Energy Technology Data Exchange (ETDEWEB)

    Yun, D.; Kim, T. K.; Taiwo, T. A.; Nuclear Engineering Division

    2010-09-07

    The use of thorium in current or advanced light water reactors (LWRs) has been of interest in recent years. These interests have been associated with the need to increase nuclear fuel resources and the perceived non-proliferation advantages of the utilization of thorium in the fuel cycle. Various options have been considered for the use of thorium in the LWR fuel cycle including: (1) its use in a once-through fuel cycle to replace non-fissile uranium or to extend fuel burnup due to its attractive fertile material conversion, (2) its use for fissile plutonium burning in limited recycle cores, and (3) its advantage in limiting the transuranic elements to be disposed off in a repository (if only Th/U-233 fuel is used). The possibility for thorium utilization in multirecycle system has also been considered by various researchers, primarily because of the potential for near breeders with Th/U-233 in the thermal energy range. The objective of this project is to evaluate the potential of the Th/U-233 fuel multirecycle in current LWRs, with focus this year on pressurized water reactors (PWRs). In this work, approaches for ensuring a sustainable multirecycle without the need for external source of makeup fissile material have been investigated. The intent is to achieve a design that allows existing PWRs to be used with minimal modifications. In all cases including homogeneous and heterogeneous assembly designs, the assembly pitch is kept consistent with that of the current PWRs (21.5 cm used). Because of design difficulties associated with using the same geometry and dimensions as a PWR core, the potential modifications (other than assembly pitch) that would be needed for PWRs to ensure a sustainable multirecycle system have been investigated and characterized. Additionally, the implications of the use of thorium on the LWR fuel cycle are discussed. In Section 2, background information on studies evaluating the use of thorium in the fuel cycle is provided, but focusing on

  13. Passive neutron survey of the 233-S Plutonium Concentration Facility

    International Nuclear Information System (INIS)

    A passive neutron survey was performed at the 233-S Plutonium Concentration Facility (located at the Hanford Site in Richland, Washington) during late 1994 and early 1995. Four areas were surveyed: an abandoned filter box and pipe trench, column laydown trench, load-out hood, and process hood. The primary purpose of the survey was to identify locations that had plutonium to help direct decontamination and decommissioning activities. A secondary purpose of the survey was to determine the quantity of material when its presence was identified

  14. Safety analysis for the 233-S decontamination and decommissioning project

    International Nuclear Information System (INIS)

    Decommissioning of the 233-S Plutonium Concentration Facility (REDOX) is a proposed expedited response action that is regulated by the Comprehensive Environmental Response Compensation and Liability Act of 1980 and the Hanford Federal Facility Agreement and Consent Order. Due to progressive physical deterioration of this facility, a decontamination and decommissioning plan is being considered for the immediate future. This safety analysis describes the proposed actions involved in this D ampersand D effort; identifies the radioactive material inventories involved; reviews site specific environmental characteristics and postulates an accident scenario that is evaluated to identify resultant effects

  15. Americium(3) coordination chemistry: An unexplored diversity of structure and bonding

    Energy Technology Data Exchange (ETDEWEB)

    Fedosseev, A.M.; Grigoriev, M.S.; Budantseva, N.A. [A.N. Frumkin Institute of Physical Chemistry and Electrochemistry, Moscow (Russian Federation); Guillaumont, D.; Den Auwer, Ch.; Moisy, Ph. [CEA Marcoule, Nuclear Energy Division, RadioChemistry and Processes Department, 30 (France); Le Naour, C.; Simoni, E. [CNRS, University Paris-11 Orsay, IPN, 91 - Orsay (France)

    2010-06-15

    The comparison of the physicochemical behavior of the actinides with that of the lanthanides can be justified by the analogy of their electronic structure, as each of the series is made up of elements corresponding to the filling of a given (n)f atomic shell. However relatively few points of comparison are available, given the lack of available structure for trans-plutonium(III) elements and the additional difficulty of stabilizing coordination complexes of uranium(III) to plutonium(III). This contribution is a focal point of trans-plutonium(III) chemistry and, more specifically, of some americium compounds that have been recently synthesized, all related with hard acid oxygen donor ligands that may be involved in the reprocessing chain of nuclear fuel. After a brief review of the solid hydrates and aquo species for the lanthanide and actinide families, we discuss two types of ligands that have in common three carboxylic groups, namely the amino-tri-acetic acid and the citric acid anions. The additional roles of the nitrogen atom for the first one and of the hydroxy function for the second one are discussed. Accordingly, five new complexes with either americium or lanthanides elements are described: [Co(NH{sub 3}){sub 6}][M(NTA){sub 2}(H{sub 2}O)].8H{sub 2}O with M Nd, Yb and Am, and [Co(NH{sub 3}){sub 6}]{sub 2}K[M{sub 3}(Cit){sub 4}(H{sub 2}O){sub 3}].18H{sub 2}O with Nd and Am cations. In all cases the americium complexes are isostructural with their lanthanide equivalents. (authors)

  16. Americium(3) coordination chemistry: An unexplored diversity of structure and bonding

    International Nuclear Information System (INIS)

    The comparison of the physicochemical behavior of the actinides with that of the lanthanides can be justified by the analogy of their electronic structure, as each of the series is made up of elements corresponding to the filling of a given (n)f atomic shell. However relatively few points of comparison are available, given the lack of available structure for trans-plutonium(III) elements and the additional difficulty of stabilizing coordination complexes of uranium(III) to plutonium(III). This contribution is a focal point of trans-plutonium(III) chemistry and, more specifically, of some americium compounds that have been recently synthesized, all related with hard acid oxygen donor ligands that may be involved in the reprocessing chain of nuclear fuel. After a brief review of the solid hydrates and aquo species for the lanthanide and actinide families, we discuss two types of ligands that have in common three carboxylic groups, namely the amino-tri-acetic acid and the citric acid anions. The additional roles of the nitrogen atom for the first one and of the hydroxy function for the second one are discussed. Accordingly, five new complexes with either americium or lanthanides elements are described: [Co(NH3)6][M(NTA)2(H2O)].8H2O with M Nd, Yb and Am, and [Co(NH3)6]2K[M3(Cit)4(H2O)3].18H2O with Nd and Am cations. In all cases the americium complexes are isostructural with their lanthanide equivalents. (authors)

  17. Speciation of americium in seawater and accumulation in the marine sponge Aplysina cavernicola.

    Science.gov (United States)

    Maloubier, Melody; Michel, Hervé; Solari, Pier Lorenzo; Moisy, Philippe; Tribalat, Marie-Aude; Oberhaensli, François R; Dechraoui Bottein, Marie Yasmine; Thomas, Olivier P; Monfort, Marguerite; Moulin, Christophe; Den Auwer, Christophe

    2015-12-21

    The fate of radionuclides in the environment is a cause of great concern for modern society, seen especially in 2011 after the Fukushima accident. Among the environmental compartments, seawater covers most of the earth's surface and may be directly or indirectly impacted. The interaction between radionuclides and the marine compartment is therefore essential for better understanding the transfer mechanisms from the hydrosphere to the biosphere. This information allows for the evaluation of the impact on humans via our interaction with the biotope that has been largely undocumented up to now. In this report, we attempt to make a link between the speciation of heavy elements in natural seawater and their uptake by a model marine organism. More specifically, because the interaction of actinides with marine invertebrates has been poorly studied, the accumulation in a representative member of the Mediterranean coralligenous habitat, the sponge Aplysina cavernicola, was investigated and its uptake curve exposed to a radiotracer (241)Am was estimated using a high-purity Ge gamma spectrometer. But in order to go beyond the phenomenological accumulation rate, the speciation of americium(III) in seawater must be assessed. The speciation of (241)Am (and natural europium as its chemically stable surrogate) in seawater was determined using a combination of different techniques: Time-Resolved Laser-Induced Fluorescence (TRLIF), Extended X-ray Absorption Fine Structure (EXAFS) at the LIII edge, Attenuated Total Reflectance Fourier Transform Infrared (ATR-FTIR) spectroscopy and Scanning Electron Microscopy (SEM) and the resulting data were compared with the speciation modeling. In seawater, the americium(III) complex (as well as the corresponding europium complex, although with conformational differences) was identified as a ternary sodium biscarbonato complex, whose formula can be tentatively written as NaAm(CO3)2·nH2O. It is therefore this chemical form of americium that is

  18. Fabrication of uranium–americium mixed oxide pellet from microsphere precursors: Application of CRMP process

    Energy Technology Data Exchange (ETDEWEB)

    Remy, E. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Picart, S., E-mail: sebastien.picart@cea.fr [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Delahaye, T. [Fuel Cycle Technology Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Jobelin, I. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Lebreton, F.; Horlait, D. [Fuel Cycle Technology Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Bisel, I. [Radiochemistry and Processes Department, CEA, Nuclear Energy Division, F-30207 Bagnols-sur-Cèze (France); Blanchart, P. [Heterogeneous Materials Research Group, Centre Européen de la Céramique, F-87068 Limoges (France); Ayral, A. [Institut Européen des Membranes, CNRS-ENSCM-UM2, CC47, University Montpellier 2, F-34095 Montpellier cedex 5 (France)

    2014-10-15

    Highlights: • Dust free process for (U,Am)O{sub 2} transmutation target fabrication. • Synthesis of U{sub 0.9}Am{sub 0.1}O{sub 2} mixed oxide microspheres from ion exchange resin. • Fabrication of dense U{sub 0.9}Am{sub 0.1}O{sub 2} pellet with 95% TD from mixed oxide microspheres. - Abstract: Mixed uranium–americium oxides are one of the materials envisaged for Americium Bearing Blankets dedicated to transmutation in fast neutron reactors. Recently, several processes have been developed in order to validate fabrication flowchart in terms of material specifications such as density and homogeneity but also to suggest simplifications for lowering industrial costs and hazards linked to dust generation of highly contaminating and irradiating compounds. This study deals with the application of an innovative route using mixed oxide microspheres obtained from metal loaded resin bead calcination, called Calcined Resin Microsphere Pelletization (CRMP). The synthesis of mixed oxide microsphere precursor of U{sub 0.9}Am{sub 0.1}O{sub 2±δ} is described as well as its characterisation. The use of this free-flowing precursor allows the pressing and sintering of one pellet of U{sub 0.9}Am{sub 0.1}O{sub 2±δ}. The ceramic obtained was characterised and results showed that its microstructure is dense and homogeneous and its density attains 95% of the theoretical density. This study validates the scientific feasibility of the CRMP process applied to the fabrication of uranium and americium-containing materials.

  19. Americium characterization by X-ray fluorescence and absorption spectroscopy in plutonium uranium mixed oxide

    International Nuclear Information System (INIS)

    Plutonium uranium mixed oxide (MOX) fuels are currently used in nuclear reactors. The actinides in these fuels need to be analyzed after irradiation for assessing their behaviour with regard to their environment and the coolant. In this work the study of the atomic structure and next-neighbour environment of Am in the (Pu,U)O2 lattice in an irradiated (60 MW d kg−1) MOX sample was performed employing micro-X-ray fluorescence (µ-XRF) and micro-X-ray absorption fine structure (µ-XAFS) spectroscopy. The chemical bonds, valences and stoichiometry of Am (∼0.66 wt%) are determined from the experimental data gained for the irradiated fuel material examined in its peripheral zone (rim) of the fuel. In the irradiated sample Am builds up as Am3+ species within an [AmO8]13− coordination environment (e.g. >90%) and no (III XAFS spectra recorded for the irradiated MOX sub-sample in the rim zone for a 300 μm×300 μm beam size area investigated over six scans of 4 h. The records remain constant during multi-scan. The analysis of the XAFS signal shows that Am is found as trivalent in the UO2 matrix. This analytical work shall open the door of very challenging analysis (speciation of fission product and actinides) in irradiated nuclear fuels. - Highlights: • Americium was characterized by microX-ray absorption spectroscopy in irradiated MOX fuel. • The americium redox state as determined from XAS data of irradiated fuel material was Am(III). • In the sample, the Am3+ face an AmO813− coordination environment in the (Pu,U)O2 matrix. • The americium dioxide is reduced by the uranium dioxide matrix

  20. Recovery of Americium-241 from lightning rod by the method of chemical treatment

    International Nuclear Information System (INIS)

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 (241Am), fewer and Radium 226 (226Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of 241Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The 241Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel 241Am technique was used electrodeposition. (author)

  1. Report of scouting study on precipitation of strontium, plutonium, and americium from Hanford complexant concentrate waste

    International Nuclear Information System (INIS)

    A laboratory scouting test was conducted of precipitation methods for reducing the solubility of radionuclides in complexant concentrate (CC) waste solution. The results show that addition of strontium nitrate solution is effective in reducing the liquid phase activity of 90Sr (Strontium) in CC waste from tank 107-AN by 94% when the total strontium concentration is adjusted to 0.1 M. Addition of ferric nitrate solution effective in reducing the 241Am (Americium) activity in CC waste by 96% under the conditions described in the report. Ferric nitrate was also marginally effective in reducing the solubility of 239/240Pu (Plutonium) in CC waste

  2. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning;

    1986-01-01

    Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were...... plutonium from the latter to Spitsbergen waters. Fallout plutonium in Arctic waters has a residence time of the order of several years, while for Pu from Sellafield we estimate mean residence times of 11–15 months in Scottish waters and, tentatively, 1·5-3 y during transport from the North Channel (north...

  3. Americium and curium heterogeneous transmutation in moderated S/ A in the framework of CNE scenarios studies

    International Nuclear Information System (INIS)

    This paper presents the transmutation of Americium and Curium in a heterogeneous mode in the framework of the 1991 French Law concerning waste management. Two scenarios with moderated targets are presented: a 100% frit reactor (EFR) scenario multi-recycling Pu+Np with targets of Am+Cm placed in core and a mixed PWR (UOX fuel) and fast reactor (50% of EFR) multi-recycling Pu+Np and containing targets in core and in the blanket region. The design of the target is based on classical fast fuel S/A technology (pins, spacer wires,...) and should reach the goal of 90% fission rate. (authors)

  4. Laboratory investigation of the role of desorption kinetics on americium transport associated with bentonite colloids.

    Science.gov (United States)

    Dittrich, Timothy Mark; Boukhalfa, Hakim; Ware, Stuart Douglas; Reimus, Paul William

    2015-10-01

    Understanding the parameters that control colloid-mediated transport of radionuclides is important for the safe disposal of used nuclear fuel. We report an experimental and reactive transport modeling examination of americium transport in a groundwater-bentonite-fracture fill material system. A series of batch sorption and column transport experiments were conducted to determine the role of desorption kinetics from bentonite colloids in the transport of americium through fracture materials. We used fracture fill material from a shear zone in altered granodiorite collected from the Grimsel Test Site (GTS) in Switzerland and colloidal suspensions generated from FEBEX bentonite, a potential repository backfill material. The colloidal suspension (100 mg L(-1)) was prepared in synthetic groundwater that matched the natural water chemistry at GTS and was spiked with 5.5 × 10(-10) M (241)Am. Batch characterizations indicated that 97% of the americium in the stock suspension was adsorbed to the colloids. Breakthrough experiments conducted by injecting the americium colloidal suspension through three identical columns in series, each with mean residence times of 6 h, show that more than 95% of the bentonite colloids were transported through each of the columns, with modeled colloid filtration rates (k(f)) of 0.01-0.02 h(-1). Am recoveries in each column were 55-60%, and Am desorption rate constants from the colloids, determined from 1-D transport modeling, were 0.96, 0.98, and 0.91 h(-1) in the three columns, respectively. The consistency in Am recoveries and desorption rate constants in each column indicates that the Am was not associated with binding sites of widely-varying strengths on the colloids, as one binding site with fast kinetics represented the system accurately for all three sequential columns. Our data suggest that colloid-mediated transport of Am in a bentonite-fracture fill material system is unlikely to result in transport over long distance scales because

  5. Purification of used scintillation liquids containing the alpha emitters americium and plutonium

    International Nuclear Information System (INIS)

    In Sweden, alpha radioactive waste liquids with an activity over some kBq per waste container cannot be sent for final storage. Therefore, in this work, a method for a purification of alpha active scintillation cocktails was developed. Until today (March, 2013) more than 20 L of scintillation liquids have successfully been purified from americium and plutonium. The products of the process are a solid fraction that can be sent to final storage and a practically non-radioactive liquid fraction that can be sent to municipal incineration. (author)

  6. Comparison of acid leachate and fusion methods to determine plutonium and americium in environmental samples

    International Nuclear Information System (INIS)

    The Analytical Chemistry Laboratory at Argonne National Laboratory performs radiochemical analyses for a wide variety of sites within the Department of Energy complex. Since the chemical history of the samples may vary drastically from site to site, the effectiveness of any analytical technique may also vary. This study compares a potassium fluoride-pyrosulfate fusion technique with an acid leachate method. Both normal and high-fired soils and vegetation samples were analyzed for both americium and plutonium. Results show both methods work well, except for plutonium in high-fired soils. Here the fusion method provides higher accuracy

  7. Plutonium and americium in arctic waters, the North Sea and Scottish and Irish coastal zones

    DEFF Research Database (Denmark)

    Hallstadius, L.; Aarkrog, Asker; Dahlgaard, Henning; Holm, E.; Boelskifte, S.; Duniec, S.; Persson, B.

    1986-01-01

    Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were...... plutonium from the latter to Spitsbergen waters. Fallout plutonium in Arctic waters has a residence time of the order of several years, while for Pu from Sellafield we estimate mean residence times of 11–15 months in Scottish waters and, tentatively, 1·5-3 y during transport from the North Channel (north of...

  8. Influence of biofilms on migration of uranium, americium and europium in the environment

    International Nuclear Information System (INIS)

    The report on the influence of biofilms on migration of uranium, americium and europium in the environment deals with the contamination problems of uranium mines such as SDAG WISMUT in Saxonia and Thuringia. In mine waters microorganisms form a complex microbiological biocoenosis in spite of low pH values and high heavy metal concentrations including high uranium concentrations. The analyses used microbiological methods like confocal laser scanning microscopy and molecular-biological techniques. The interactions of microorganism with fluorescent radioactive heavy metal ions were performed with TRLFS (time resolved laser-induced fluorescence spectroscopy).

  9. Isotopic dilution of 233U with depleted uranium for criticality safety in processing and disposal

    International Nuclear Information System (INIS)

    The disposal of excess 233U as waste is being considered. Because 233U is a fissile material, a key requirement for processing 233U to a final waste form and disposing of it is the avoidance of nuclear criticality. For many processing and disposal options, isotopic dilution is the most feasible and preferred option to avoid nuclear criticality. Isotopic dilution is dilution of fissile 233U with nonfissile 238U. The use of isotopic dilution removes any need to control nuclear criticality in process or disposal facilities through geometry or chemical composition. Isotopic dilution allows the use of existing waste management facilities that are not designed for significant quantities of fissile materials to be used for processing and disposing of 233U. The amount of isotopic dilution required to reduce criticality concerns to reasonable levels was determined in this study to be approximately 0.53 wt % 233U. The numerical calculations used to define this limit consisted of a homogeneous system of silicon dioxide (SiO2), water (H2O), 233U and depleted uranium (DU) in which the ratio of each component was varied to learn the conditions of maximum nuclear reactivity. About 188 parts of DU (0.2 wt % 235U) are required to dilute 1 part of 233U to this limit in a water-moderated system with no SiO2 present. Thus for the U.S. inventory of 233U, several hundred metric tons of DU would be required for isotopic dilution

  10. Numerical simulation for concentration profiles of americium and lanthanides in the CMPO-TBP solvent extraction system

    International Nuclear Information System (INIS)

    A numerical simulation code is developed to predict the extraction behavior of americium and lanthanides in the TRUEX (TRansUranium EXtraction)process. This code gives the concentration profiles of the components at steady state. The stage efficiency is included in this code as a parameter in order to simulate the extraction behavior of the components accurately. Concentration profiles of americium and typical lanthanides in some counter current experiments are calculated by means of the present code. The calculated concentration profiles are compared with the experimental results. The efficiency value for the mixer-settlers, which gives good agreement between the calculated and the experimental profiles, is evaluated. (author)

  11. Numerical simulation for concentration profiles of americium and lanthanides in the CMPO-TBP solvent extraction system

    International Nuclear Information System (INIS)

    A numerical simulation code for the TRUEX (TRansUranium EXtraction) process is developed to predict the extraction behavior of americium and lanthanides. This code gives the concentrations of the components at the steady state of the TRUEX process. The stage efficiency is applied to this code in order to simulate the extraction behavior of the components accurately. Concentration profiles of americium and typical lanthanides in some counter current experiments are calculated by means of the present code. The calculated profiles are compared with the experimental ones. The efficiency value for the mixer-settlers, which gives the best agreement between the two profiles, is investigated

  12. Study of the extraction and the purification of americium and trivalent actinides contained in effluents with supported liquid membranes

    International Nuclear Information System (INIS)

    The supported liquid membrane technique is studied and developed for americium recovery from uranium or plutonium matrices and decontamination of liquid radioactive wastes. First tests on uranium-nickel solutions with a flat membrane showed the easiness of the operation and the efficiency of the process. Acid-resistant (10 N), interchangeable elements with hollow fibers, are developed and also a computerized automatic device. The different tests on americium solutions demonstrate the feasibility and the reliability of the system. Influence of various parameters on transfer kinetics is investigated

  13. Experimental and in situ investigations on americium, curium and plutonium behaviour in marine benthic species: transfer from water or sediments

    International Nuclear Information System (INIS)

    The tranfer of transuranic elements -americium, curium and plutonium- from the sediments containing them to some marine benthic species (endofauna and epifauna) was studied with a twofold approach - laboratory and in-situ investigation. The experimental investigations, divided into three parts, made it possible to specify concentration factors (F.C.), transfer factors (F.T.) and to understand the process involved for 5 benthic species. The result were refined by an in-situ study that brought new data on the marine distribution of the transuranic elements released by the La Hague plant. Finally, the localization of americium and plutonium in the tissues and cells of these species was determined by autoradiography

  14. Study on the adsorption of 233Pa in glass

    International Nuclear Information System (INIS)

    It is intended to examine the adsorption of protactinium on glass in relation to pH, presence of complexing agents concentration and type of electrolytes. The study was made by using carrier-free 233Pa solution and Pyrex glass tube was selected as adsorbent glass material surface. The adsorption curve of protactinium on glass surface as a function of the pH of the tracer solution showed the existence of two pronounced adsorption regions. It was found that this adsorption can be reduced by using electrolytes or complexing agents. Desorption of protactinium previously adsorbed on the Pyrex glass tube was also studied. Hidrochloric, oxalic and hydrofluoric acid solutions were used for the desorption experiments. (Author)

  15. Vitrification of F-area americium/curium: feasibility study and preliminary process recommendation

    International Nuclear Information System (INIS)

    Work was performed to identify a process to vitrify the contents of F- canyon Tank 17.1. Tank 17.1 contains the majority of americium (Am) and curium (Cm) contained in the DOE Complex. Oak Ridge National Laboratory (ORNL) has made a formal request for this material as fuel for production of Cf252 and other transplutonium actinides. The Am and Cm (and associated lanthanide fission products) are currently in nitric acid solution. Transportation of the intensely radioactive Am/Cm in liquid form is not considered possible. As a result, the material will either be solidified and shipped to ORNL or discarded to the Tank Farm. Nuclear Materials Processing Technology (NMPT), therefore, requested Defense Waste Processing Technology (DWPT) to determine if the Tank 17.1 material could be vitrified, and if it was vitrified could the americium and curium be successfully recovered. Research was performed to determine if the Tank 17.1 contents could indeed be mixed with glass formers and vitrified. Additional studies identified critical process parameters such as heat loading, melter requirements, off-gas evolution, etc. Discussions with NMPT personnel were initiated to determine existing facilities where this work could be accomplished safely. A process has been identified which will convert the Am/Cm material into approximately 300kg of glass

  16. Transfer of radiocaesium, plutonium and americium to sheep after ingestion of contaminated soil

    International Nuclear Information System (INIS)

    A dual isotope method has been used to study the transfer of 137Cs, 239/240Pu and 241Am to sheep following ingestion of contaminated soil. Two soils were used; an alluvial gley contaminated by Sellafield discharges, and an organic soil, artificially contaminated in a lysimeter. Values of the true absorption coefficient of radiocaesium of 0.19 +/- 0.03 and 0.03 +/- 0.01 respectively were obtained for these soils. This implies an availability factor for soil-associated radiocaesium of up to about 20 pc compared to radiocaesium ingested in soluble form. The absorption of plutonium and americium was not significantly different for the two soils tested. Absorption of both plutonium and americium was in the range 10-5 - 10-4, with mean values of 7 x 10-5 and 4 x 10-5 obtained respectively. These values imply availability factors of around 10 pc, compared to the value of 5 x 10-4 recommended by ICRP for plutonium ingested in a comparatively available form. These results are compared with estimates of availability made using an in-vitro approach

  17. Transfer of radiocaesium, plutonium and americium to sheep after ingestion of contaminated soil

    Energy Technology Data Exchange (ETDEWEB)

    Cooke, A.I.; Weekes, T.E.C. [Newcastle upon Tyne Univ. (United Kingdom). Dept. of Biological and Nutritional Sciences; Rimmer, D.L. [Newcastle upon Tyne Univ. (United Kingdom). Dept. of Agricultural and Environmental Science; Green, N.; Wilkins, B.T. [National Radiological Protection Board, Chilton (United Kingdom)

    1997-12-31

    A dual isotope method has been used to study the transfer of {sup 137}Cs, {sup 239/240}Pu and {sup 241}Am to sheep following ingestion of contaminated soil. Two soils were used; an alluvial gley contaminated by Sellafield discharges, and an organic soil, artificially contaminated in a lysimeter. Values of the true absorption coefficient of radiocaesium of 0.19 +/- 0.03 and 0.03 +/- 0.01 respectively were obtained for these soils. This implies an availability factor for soil-associated radiocaesium of up to about 20 pc compared to radiocaesium ingested in soluble form. The absorption of plutonium and americium was not significantly different for the two soils tested. Absorption of both plutonium and americium was in the range 10{sup -5} - 10{sup -4}, with mean values of 7 x 10{sup -5} and 4 x 10{sup -5} obtained respectively. These values imply availability factors of around 10 pc, compared to the value of 5 x 10{sup -4} recommended by ICRP for plutonium ingested in a comparatively available form. These results are compared with estimates of availability made using an in-vitro approach

  18. Americium and europium extraction from carbonate solutions by 1-phenyl-3-methyl-4-benzoylpyrazolone -5

    International Nuclear Information System (INIS)

    Trivalent TPEs and REEs are extractable from carbonate solutions by 1-pheny-3-methyl-4-benzoylpyrazolone-5 (PMBP). The effect of concentration of KHCO3 and K2CO3, extractant, metal, and other factors on the extent of extraction of the elements has been clarified. The kinetics of extraction of the elements from carbonate solutions has been studied. It has been shown that in the KHCO3 concentration range 0.2-2.0 M americium and europium are extracted by PMBP solutions in different diluents with distribution coefficients lying within n x 102-n x 103. From K2CO3 solutions the elements are extracted better by PMBP solutions in methyl isobutyl ketone (MIBK). It has been shown that metal concentration in the range 1x10-5. 5x10-3 g-ion x liter-1 does not affect extraction (log E = 3). Extracts based on PMBP with a metal content higher than 5x10-3g-ion x liter-1 were obtained by absolute concentrating method and were used for the study of 13C NMR spectra. The composition of thecompounds extracted by PMBP from carbonate solutions was determined by 13C NMR spectroscopy and extraction. The conditions of europium and americium reextraction from extracts based on PMBP by complexones, their mixtures with alkalis and other substances were studied. The scopes for using the system PMBP-carbonate solutions to separate and concentrate TPEs and REEs has been examined

  19. Evaluation of americium-241 toxicity influence on the microbial growth of organic wastes

    International Nuclear Information System (INIS)

    Available in abstract form only. Full text of publication follows: Since the licenses for using radioactive sources in radioactive lightning rods were lifted by the Brazilian national nuclear authority, in 1989, the radioactive devices have been replaced by Franklin type and collected as radioactive waste. However, only 20 percent of the estimated total number of installed rods was delivered to Brazilian Nuclear Commission. This situation causes concern, due to, first, the possibility of the rods being disposed as domestic waste, and second, the americium, the most commonly employed radionuclide, is classified as a high-toxicity element. In the present study, Am-241 migration experiments were performed by a lysimeter system, in order to evaluate the risk of contamination caused by radioactive lightning rods disposed as a common solid waste. Besides the risk evaluation, it is important to know the mechanism of the Am-241 release or retention in waste as well as its influence in the waste decomposition processes. Many factors are involved, but microorganisms present in the waste play an important role in its degradation, which control the physical and chemical processes. The objective of this work was to evaluate the Am-241 influence on the microbial population by counting number of cells in lysimeters leachate. Preliminary results suggest that americium may influence significantly the bacteria growth in organic waste, evidenced by culture under aerobiosis and an-aerobiosis and the antimicrobial resistance test. (authors)

  20. Contribution to the prediction of americium, plutonium and neptunium behaviour in the geosphere: chemical data

    International Nuclear Information System (INIS)

    An exhaustive bibliographic review on hydrolysis of americium gives the stability constants, at zero ionic strength. No evidence of Am(OH)4- formation was found by solubility studies up to pH 2 (CO3)3 characterised by its X-ray diffraction pattern is studied at a high ionic strength. All the published results on Am in carbonate media are reinterpreted using these stability constants (Am-OH-CO3 complexes are not needed). No evidence of Am(CO3)45- formation was found by spectrophotometry up to 3M. Literature results are used to determine the formal redox potentials at pH = 9.4 and to calculate the formation constants, at zero ionic strength. The formation of complexes between americium and humic materials (purified fulvic and humic acids) has been studied by a spectrophotometric technique. The results are interpreted by the formation of a 1:1 complexe. Solubility of the solid PuO2(CO3) is measured in bicarbonate media at high ionic strength, to obtain the solubility product and formation constants of the PuO2(CO3)i2-2i complexes

  1. Final Oak Ridge National Laboratory Site Assessment Report on the Storage of 233U

    International Nuclear Information System (INIS)

    This assessment characterizes the 233U inventories and storage facility at Oak Ridge National Laboratory (ORNL). This assessment is a commitment in the U.S. Department of Energy (DOE) Implementation Plan (IP), ''Safe Storage of Uranium-233,'' in response to the Defense Nuclear Facilities Safety Board's Recommendation 97-1

  2. 9 CFR 2.33 - Attending veterinarian and adequate veterinary care.

    Science.gov (United States)

    2010-01-01

    ... animal health, behavior, and well-being is conveyed to the attending veterinarian; (4) Guidance to... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Attending veterinarian and adequate veterinary care. 2.33 Section 2.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION...

  3. 24 CFR 5.233 - Mandated use of HUD's Enterprise Income Verification (EIV) System.

    Science.gov (United States)

    2010-04-01

    ...) Project-based Voucher program under 24 CFR part 983; (v) Project-based Section 8 programs under 24 CFR... noncompliance. Failure to use the EIV system in its entirety may result in the imposition of sanctions and/or... Income Verification (EIV) System. 5.233 Section 5.233 Housing and Urban Development Office of...

  4. 45 CFR 233.106 - Denial of AFDC benefits to strikers.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Denial of AFDC benefits to strikers. 233.106... COVERAGE AND CONDITIONS OF ELIGIBILITY IN FINANCIAL ASSISTANCE PROGRAMS § 233.106 Denial of AFDC benefits... refuse to seek or accept, employment. (2)(i) Provide for the denial of AFDC benefits to any family...

  5. 45 CFR 233.33 - Determining eligibility prospectively for all payment months (AFDC).

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Determining eligibility prospectively for all payment months (AFDC). 233.33 Section 233.33 Public Welfare Regulations Relating to Public Welfare OFFICE....33 Determining eligibility prospectively for all payment months (AFDC). (a) The State plan for...

  6. 46 CFR 10.233 - Obligations of the holder of a merchant mariner credential.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 1 2010-10-01 2010-10-01 false Obligations of the holder of a merchant mariner credential. 10.233 Section 10.233 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY MERCHANT MARINE OFFICERS AND SEAMEN MERCHANT MARINER CREDENTIAL General Requirements for All Merchant Mariner...

  7. EURADOS intercomparison on measurements and Monte Carlo modelling for the assessment of Americium in a USTUR leg phantom

    International Nuclear Information System (INIS)

    A collaboration of the EURADOS working group on 'Internal Dosimetry' and the United States Transuranium and Uranium Registries (USTUR) has taken place to carry out an intercomparison on measurements and Monte Carlo modelling determining americium deposited in the bone of a USTUR leg phantom. Preliminary results and conclusions of this intercomparison exercise are presented here. (authors)

  8. An economic analysis of a light and heavy water moderated reactor synergy: burning americium using recycled uranium

    International Nuclear Information System (INIS)

    An economic analysis is presented for a proposed synergistic system between 2 nuclear utilities, one operating light water reactors (LWR) and another running a fleet of heavy water moderated reactors (HWR). Americium is partitioned from LWR spent nuclear fuel (SNF) to be transmuted in HWRs, with a consequent averted disposal cost to the LWR operator. In return, reprocessed uranium (RU) is supplied to the HWRs in sufficient quantities to support their operation both as power generators and americium burners. Two simplifying assumptions have been made. First, the economic value of RU is a linear function of the cost of fresh natural uranium (NU), and secondly, plutonium recycling for a third utility running a mixed oxide (MOX) fuelled reactor fleet has been already taking place, so that the extra cost of americium recycling is manageable. We conclude that, in order for this scenario to be economically attractive to the LWR operator, the averted disposal cost due to partitioning americium from LWR spent fuel must exceed 214 dollars per kg, comparable to estimates of the permanent disposal cost of the high level waste (HLW) from reprocessing spent LWR fuel. (authors)

  9. Effects of Hanford high-level waste components on sorption of cobalt, strontium, neptunium, plutonium, and americium on Hanford sediments

    Energy Technology Data Exchange (ETDEWEB)

    Delegard, C H; Barney, G S

    1983-03-01

    To judge the feasibility of continued storage of high-level waste solutions in existing tanks, effects of chemical waste components on the sorption of hazardous radioelements were determined. Experiments identified the effects of 12 Hanford high-level waste-solution components on the sorption of cobalt, strontium, neptunium, plutonium, and americium on 3 Hanford 200 Area sediments. The degree of sorption of strontium, neptunium, plutonium, and americium on two Hanford sediments was then quantified in terms of the concentrations of the influential waste components. Preliminary information on the influence of the waste components on radioelement solubility was gathered. Of the 12 Hanford waste-solution components studied, the most influential on radioelement sorption were NaOH, NaAlO/sub 2/, HEDTA, and EDTA. The chelating complexants, HEDTA and EDTA, generally decreased sorption by complexation of the radioelement metal ions. The components NaOH and NaAlO/sub 2/ decreased neptunium and plutonium sorption and increased cobalt sorption. Americium sorption was increased by NaOH. The three Hanford sediments' radioelement sorption behaviors were similar, implying that their sorption reactions were also similar. Sorption prediction equations were generated for strontium, neptunium, plutonium, and americium sorption reactions on two Hanford sediments. The equations yielded values of the distribution coefficient, K/sub d/, as quadratic functions of waste-component concentrations and showed that postulated radioelement migration rates through Hanford sediment could change by factors of 13 to 40 by changes in Hanford waste composition.

  10. Effects of Hanford high-level waste components on sorption of cobalt, strontium, neptunium, plutonium, and americium on Hanford sediments

    International Nuclear Information System (INIS)

    To judge the feasibility of continued storage of high-level waste solutions in existing tanks, effects of chemical waste components on the sorption of hazardous radioelements were determined. Experiments identified the effects of 12 Hanford high-level waste-solution components on the sorption of cobalt, strontium, neptunium, plutonium, and americium on 3 Hanford 200 Area sediments. The degree of sorption of strontium, neptunium, plutonium, and americium on two Hanford sediments was then quantified in terms of the concentrations of the influential waste components. Preliminary information on the influence of the waste components on radioelement solubility was gathered. Of the 12 Hanford waste-solution components studied, the most influential on radioelement sorption were NaOH, NaAlO2, HEDTA, and EDTA. The chelating complexants, HEDTA and EDTA, generally decreased sorption by complexation of the radioelement metal ions. The components NaOH and NaAlO2 decreased neptunium and plutonium sorption and increased cobalt sorption. Americium sorption was increased by NaOH. The three Hanford sediments' radioelement sorption behaviors were similar, implying that their sorption reactions were also similar. Sorption prediction equations were generated for strontium, neptunium, plutonium, and americium sorption reactions on two Hanford sediments. The equations yielded values of the distribution coefficient, K/sub d/, as quadratic functions of waste-component concentrations and showed that postulated radioelement migration rates through Hanford sediment could change by factors of 13 to 40 by changes in Hanford waste composition

  11. Anomalous aryl strengthening of americium and europium complexes during extraction by alkylenediphosphine dioxides from perchloric acid media

    International Nuclear Information System (INIS)

    Extraction of americium and europium from perchlorate environments by solutions of three types of methylenediphosphine dioxides, namely (C6H5)P(O)(CH2)sub(n)(O)P(C6H5)2, (C6H5)2P(O)CH2(O)P(C8H17)2 and (C8H17)2P(O)(CH2)sub(n)(O)P(C8H17)2 has been studied (n is 1 or 2 ) The diluents used have been dichlorethane and chloroform. In perchlorate environments the distribuiton coefficients of americium and europium have proved to be by about 3 orders of magnitude higher than in nitric acid environments, i.e. in perchlorate media the complexes are far more stable. Separation coefficients of americium and REE in perchloric acid soutions are much higher than in nitrate environments. The average value of Am/Eu separation coeffecient at 1-5 M acidity was about 6 (with dichlorethane as diluent) or about 7 (with chloroform as diluent). The complexes essentially exist as trisolvated. Americium complexes display anomalous stability increase upon being diluted: by about 2 orders of magnitude with dichlorethane and by up to 3 orders of magnitude with chloroform used as diluent

  12. Investigations of neutron characteristics for salt blanket models; integral fission cross section measurements of neptunium, plutonium, americium and curium isotopes

    International Nuclear Information System (INIS)

    Neutron characteristics of salt blanket micromodels containing eutectic mixtures of sodium, zirconium, and uranium fluorides were measured on FKBN-2M, BIGR and MAKET facilities. The effective fission cross sections of neptunium, plutonium, americium, and curium isotopes were measured on the neutron spectra formed by micromodels. (author)

  13. The distribution of plutonium-239 and americium-241 in the Syrian hamster following its intravenous administration as citrate

    International Nuclear Information System (INIS)

    Actinide distribution in various tissues and the skeleton of hamsters by liquid scintillation counting or isotope dilution. For plutonium 57% of activity was concentrated in the skeleton and more than 90% in the liver and skeleton after seven days. For americium the liver retained more than 50% of total activity and 25% was excreted in urine within seven days. (U.K.)

  14. Separation and estimation of 229Th and 233U by alpha and gamma ray spectrometric technique

    International Nuclear Information System (INIS)

    The individual estimation of 233U and 229Th in a plancheted source made out of liquid sample were done by using an alpha and γ-ray spectrometric techniques. Estimation of 229Th in the plancheted source was done by γ-ray spectrometry and 233U by alpha spectrometry after subtracting the estimated amount of 229Th. In spite of the same alpha energy of 4.8 MeV, the individual estimation of 233U and 229Th based on present technique is superior to conventional techniques and important in the 232Th-233U fuel reprocessing cycle of AHWR and ADSs. The activity of 229Th was also radiochemically separated from its parent activity of 233U by using an ion exchange resin and the purity was checked by the above mentioned technique. (author)

  15. Application of ion-exchange chromatography to eliminate the curium from americium by his determination by the method of liquid scintillation spectrometry

    International Nuclear Information System (INIS)

    The aim of this work is to eliminate curium in determining of americium by the method of liquid scintillation spectrometry. The paper introduces a method that has been done to eliminate curium from americium by determining of americium with liquid scintillation spectrometry method. In the research we used ion-exchange chromatography and ion-exchange sorbents DOWEX. We also observed the effect of geometry organization of column on the separation course. Resources for alpha spectrometry were prepared by micro-precipitation with neodymium chloride. High radiochemical yields were achieved, but separation did not take place according to a pre-separation scheme. (authors)

  16. Purification of scintillation cocktails containing the alpha emitters americium and plutonium

    International Nuclear Information System (INIS)

    One efficient way of measuring alpha emitters is by the usage of liquid scintillation counting (LSC). A liquid sample is placed in a vial containing a scintillation cocktail. The alpha particles excite electrons in the surrounding liquid, and when they are de-excited photons are emitted. The photons are detected and the activity can be quantified. LSC has a high efficiency for alpha radiation and is therefore a fast and easy way for measuring alpha emitting samples. One drawback is that it does not differentiate very well between alpha energies; measurements of for example curium and plutonium simultaneously are impossible and demand other techniques. Another drawback is the production of a liquid alpha active waste. In Sweden alpha radioactive waste liquids with an activity over some kBq per waste container cannot be sent for final storage. If, however, the activity of the liquids could be reduced by precipitation of the actinides, it would be possible to send away the liquid samples to municipal incineration. In this work a method for a purification of alpha active scintillation cocktails was developed. The method was first tried on a lab scale, and then scaled up. Until today (March, 2013) more than 20 liters of scintillation liquids have successfully been purified from americium and plutonium at Chalmers University of Technology in Sweden. The four scintillation cocktails used were Emulsifier Safe®, Hionic-Fluor®, Ultima Gold AB® and Ultima Gold XR®. The scintillation cocktails could all be purified from americium with higher yield than 95%. The yield was kept when the liquids were mixed. Also plutonium could be precipitated with a yield over 95% in all cocktails except in Hionic-Fluor® (>55%). However, that liquid in particular could be purified (>95%) by mixing it with the three other cocktails. Up-scaling was performed to a batch size of 6-8 L of scintillation cocktail. In neither the americium nor the plutonium system, adverse effects of increasing the

  17. A 233 km Tunnel for Lepton and Hadron Colliders

    CERN Document Server

    Summers, D J; Datta, A; Duraisamy, M; Luo, T; Lyons, G T

    2012-01-01

    A decade ago, a cost analysis was conducted to bore a 233 km circumference Very Large Hadron Collider (VLHC) tunnel passing through Fermilab. Here we outline implementations of $e^+e^-$, $p \\bar{p}$, and $\\mu^+ \\mu^-$ collider rings in this tunnel using recent technological innovations. The 240 and 500 GeV $e^+e^-$ colliders employ Crab Waist Crossings, ultra low emittance damped bunches, short vertical IP focal lengths, superconducting RF, and low coercivity, grain oriented silicon steel/concrete dipoles. Some details are also provided for a high luminosity 240 GeV $e^+ e^-$ collider and 1.75 TeV muon accelerator in a Fermilab site filler tunnel. The 40 TeV $p \\bar{p}$ collider uses the high intensity Fermilab $\\bar{p}$ source, exploits high cross sections for $p \\bar{p}$ production of high mass states, and uses 2 Tesla ultra low carbon steel/YBCO superconducting magnets run with liquid neon. The 35 TeV muon ring ramps the 2 Tesla superconducting magnets at 9 Hz every 0.4 seconds, uses 250 GV of superconduct...

  18. A 233 km tunnel for lepton and hadron colliders

    Energy Technology Data Exchange (ETDEWEB)

    Summers, D. J.; Cremaldi, L. M.; Datta, A.; Duraisamy, M.; Luo, T.; Lyons, G. T. [Dept. of Physics and Astronomy, University of Mississippi-Oxford, University, MS 38677 (United States)

    2012-12-21

    A decade ago, a cost analysis was conducted to bore a 233 km circumference Very Large Hadron Collider (VLHC) tunnel passing through Fermilab. Here we outline implementations of e{sup +}e{sup -}, pp-bar , and {mu}{sup +}{mu}{sup -} collider rings in this tunnel using recent technological innovations. The 240 and 500 GeV e{sup +}e{sup -} colliders employ Crab Waist Crossings, ultra low emittance damped bunches, short vertical IP focal lengths, superconducting RF, and low coercivity, grain oriented silicon steel/concrete dipoles. Some details are also provided for a high luminosity 240 GeV e{sup +}e{sup -} collider and 1.75 TeV muon accelerator in a Fermilab site filler tunnel. The 40 TeV pp-bar collider uses the high intensity Fermilab p-bar source, exploits high cross sections for pp-bar production of high mass states, and uses 2 Tesla ultra low carbon steel/YBCO superconducting magnets run with liquid neon. The 35 TeV muon ring ramps the 2 Tesla superconducting magnets at 9 Hz every 0.4 seconds, uses 250 GV of superconducting RF to accelerate muons from 1.75 to 17.5 TeV in 63 orbits with 71% survival, and mitigates neutrino radiation with phase shifting, roller coaster motion in a FODO lattice.

  19. Statistical analysis of 233 cases in cerebovascular Diseases

    Institute of Scientific and Technical Information of China (English)

    Hu Hao-Yu; Zhejiang; Jlnhua

    2000-01-01

    Objection:Monitoring Clinical in-patient constituent ratio in cerebral vasscular diseases. Methods: we monitored 233 cases of CVD in clinical in--patient 13170 cases for three years with unique registry card accroding to ICD--9. These pepole′s data was putted in computer. Age, sex, constituent ratio of each disease in CVD was observed and number of death and rank order of cases of death as well. Results: In our data, number of male is more than female(1.75:I). Constituent ratio of age is increasing at 40 years old. Main part of CH is middle age and senility, but CI age is senility. Constituent ratio of each disease is following :CI 67.74%, CH 22.13%, CT 6.06%, SAH 3.79% respectlvly. The rank order of death in CVD is third later in cardiovascular diseases and tumors. Conclusions: Our materials revealsed that it is improtant that intensiv′e care and treatment group in pead population of CVD and prevention high risk facters of CVD and health care education

  20. Imitators of plutonium and americium in a mixed uranium- plutonium nitride fuel

    Science.gov (United States)

    Nikitin, S. N.; Shornikov, D. P.; Tarasov, B. A.; Baranov, V. G.; Burlakova, M. A.

    2016-04-01

    Uranium nitride and mix uranium nitride (U-Pu)N is most popular nuclear fuel for Russian Fast Breeder Reactor. The works in hot cells associated with the radiation exposure of personnel and methodological difficulties. To know the main physical-chemical properties of uranium-plutonium nitride it necessary research to hot cells. In this paper, based on an assessment of physicochemical and thermodynamic properties of selected simulators Pu and Am. Analogues of Pu is are Ce and Y, and analogues Am - Dy. The technique of obtaining a model nitride fuel based on lanthanides nitrides and UN. Hydrogenation-dehydrogenation- nitration method of derived powders nitrides uranium, cerium, yttrium and dysprosium, held their mixing, pressing and sintering, the samples obtained model nitride fuel with plutonium and americium imitation. According to the results of structural studies have shown that all the samples are solid solution nitrides rare earth (REE) elements in UN.

  1. Recovery of plutonium and americium from chloride salt wastes by solvent extraction

    International Nuclear Information System (INIS)

    Plutonium and americium can be recovered from aqueous waste solutions containing a mixture of HCl and chloride salt wastes by the coupling of two solvent extraction systems: tributyl phosphate (TBP) in tetrachloroethylene (TCE) and octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) in TCE. In the flowsheet developed, the salt wastes are dissolved in HCl, the Pu(III) is oxidized to the IV state with NaClO2 and recovered in the TBP-TCE cycle, and the Am is then removed from the resultant raffinate by the CMPO-TCE cycle. The consequences of the feed solution composition and extraction behavior of these species on the process flowsheet design, the Pu-product purity, and the decontamination of the aqueous raffinate from transuranic elements are discussed. 16 refs., 6 figs

  2. Recovery of plutonium and americium from chloride salt wastes by solvent extraction

    International Nuclear Information System (INIS)

    Plutonium and americium can be recovered from aqueous waste solutions containing a mixture of HCl and chloride salt wastes by the coupling of two solvent extraction systems: tributyl phosphate (TBP) in tetrachloroethylene (TCE) and octyl(phenyl)-N,N-diisobutyl-carbamoylmethylphosphine oxide (CMPO) in TCE. In the flowsheet developed, the salt wastes are dissolved in HCl, the Pu(III) is oxidized to the IV state with NaClO2 and recovered in the TBP-TCE cycle, and the Am is then removed from the resultant raffinate by the CMPO-TCE cycle. The consequences of the feed solution composition and extraction behavior of these species on the process flowsheet design, the Pu-product purity, and the decontamination of the aqueous raffinate from transuranic elements are discussed

  3. The uptake of plutonium-239, 240, americium-241, strontium-90 into plants

    International Nuclear Information System (INIS)

    This report describes the results of measurements on the uptake of plutonium, americium, strontium-90 and caesium-137 into peas, beet, oats, sweet corn, tomatoes and vegetable marrow grown in tubs containing radioactively-contaminated silts. The silts had been taken from an area of West Cumbria commonly referred to as the Ravenglass estuary. The experiments are categorised as being carried out under non-standard conditions because of the manner in which the radioactivity came to be incorporated into the growth medium. The growth medium was representative of conditions which could arise when the estuarine silt moves inland under the influence of wind and tide and mixes with the adjacent farm land. The silt had been contaminated by radioactive effluents from the nuclear fuels reprocessing plant at Sellafield and this contamination had been brought about by natural means. (Auth.)

  4. Mutual separation of americium(III) and europium(III) using glycolamic acid and thioglycolamic acid

    International Nuclear Information System (INIS)

    The extractants, bis(2-ethylhexyl)diglycolamicacid (HDEHDGA) and bis(2-ethylhexy)thiodiglycolamic acid (HDEHSDGA) were synthesized and characterized by 1H and 13C NMR, mass and IR spectroscopy. The extraction behaviour of (152+154)Eu(III) and 241Am(III) from nitric acid medium by a solution of HDEHDGA (or HDEHSDGA) in n-dodecane (n-DD) was studied for the mutual separation of actinides and lanthanides. The effect of various parameters such as the pH, concentrations of HDEHDGA, HDEHSDGA, sodium nitrate, N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (TPEN) and diethylenetriaminepentaacetic acid (DTPA) on the separation factor (SF) of americium(III) over europium(III) and vice versa was studied, and the conditions needed for the preferential separation were optimised. The results show that HDEHDGA exhibits higher extraction for (152+154)Eu(III) and HDEHSDGA shows the superior selectivity for 241Am(III). (orig.)

  5. Laboratory investigation of the role of desorption kinetics on americium transport associated with bentonite colloids

    International Nuclear Information System (INIS)

    Understanding the parameters that control colloid-mediated transport of radionuclides is important for the safe disposal of used nuclear fuel. We report an experimental and reactive transport modeling examination of americium transport in a groundwater–bentonite–fracture fill material system. A series of batch sorption and column transport experiments were conducted to determine the role of desorption kinetics from bentonite colloids in the transport of americium through fracture materials. We used fracture fill material from a shear zone in altered granodiorite collected from the Grimsel Test Site (GTS) in Switzerland and colloidal suspensions generated from FEBEX bentonite, a potential repository backfill material. The colloidal suspension (100 mg L−1) was prepared in synthetic groundwater that matched the natural water chemistry at GTS and was spiked with 5.5 × 10−10 M 241Am. Batch characterizations indicated that 97% of the americium in the stock suspension was adsorbed to the colloids. Breakthrough experiments conducted by injecting the americium colloidal suspension through three identical columns in series, each with mean residence times of 6 h, show that more than 95% of the bentonite colloids were transported through each of the columns, with modeled colloid filtration rates (kf) of 0.01–0.02 h−1. Am recoveries in each column were 55–60%, and Am desorption rate constants from the colloids, determined from 1-D transport modeling, were 0.96, 0.98, and 0.91 h−1 in the three columns, respectively. The consistency in Am recoveries and desorption rate constants in each column indicates that the Am was not associated with binding sites of widely-varying strengths on the colloids, as one binding site with fast kinetics represented the system accurately for all three sequential columns. Our data suggest that colloid-mediated transport of Am in a bentonite-fracture fill material system is unlikely to result in transport over long distance

  6. Comparative study of plutonium and americium bioaccumulation from two marine sediments contaminated in the natural environment

    International Nuclear Information System (INIS)

    Plutonium and americium sediment-animal transfer was studied under controlled laboratory conditions by exposure of the benthic polychaete Nereis diversicolor (O. F. Mueller) to marine sediments contaminated by a nuclear bomb accident (near Thule, Greenland) and nuclear weapons testing (Enewetak Atoll). In both sediment regimes, the bioavailability of plutonium and 241Am was low, with specific activity in the tissues 241Am occurred and 241Am uptake from the Thule sediment was enhanced compared to that from lagoon sediments of Enewetak Atoll. Autoradiography studies indicated the presence of hot particles of plutonium in the sediments. The results highlight the importance of purging animals of their gut contents in order to obtain accurate estimates of transuranic transfer from ingested sediments into tissue. It is further suggested that enhanced transuranic uptake by some benthic species could arise from ingestion of highly activity particles and organic-rich detritus present in the sediments. (author)

  7. A thermodynamic study of actinide oxide targets/fuels for americium transmutation

    International Nuclear Information System (INIS)

    A thermodynamic study was performed on the systems Am-O, AmOx-MgO, AmOx-MgAl2O4, Pu-Mg-O and U-Mg-O. Both experimental work (X-ray analyses, oxygen potential measurements etc.) and calculations on the phase diagrams involved were made. The reaction between americium oxide and spinel is expected to form the compound AmAlO3. Isothermal sections have been calculated for AmOx-(MgO, Al2O3), Pu-Mg-O and U-Mg-O at 2000 K using the software package ''Thermo-Calc''. Thermodynamic equilibrium data were used to predict the behaviour of actinide oxides in a reactor. The implication of the results for the technological application is discussed, with emphasis on the effects of the high oxygen potential of AmO2 as compared to the conventional fuel, i.e. UO2. (author)

  8. EURADOS action for determination of americium in skull measures in vivo and Monte Carlo simulation

    International Nuclear Information System (INIS)

    From the Group of WG7 internal dosimetry of the EURADOS Organization (European Radiation Dosimetry group, e.V.) which It coordinates CIEMAT, international action for the vivo measurement of americium has been conducted in three mannequins type skull with detectors of Germanium by gamma spectrometry and simulation by Monte Carlo methods. Such action has been raised as two separate exercises, with the participation of institutions in Europe, America and Asia. Other actions similar precede this vivo intercomparison of measurement and modeling Monte Carlo1. The preliminary results and associated findings are presented in this work. The laboratory of the body radioactivity (CRC) of service counter of dosimetry staff internal (DPI) of the CIEMAT, it has been one of the participants in vivo measures exercise. On the other hand part, the Group of numerical dosimetry of CIEMAT is participant of the Monte Carlo2 simulation exercise. (Author)

  9. Ab initio modelling of the behaviour of helium in americium and plutonium oxides

    International Nuclear Information System (INIS)

    By means of an ab initio plane wave pseudo potential method, plutonium dioxide and americium dioxide are modelled, and the behaviour of helium in both these materials is studied. We first show that a pseudo potential approach in the Generalized Gradient Approximation (GGA) can satisfactorily describe the cohesive properties of PuO2 and AmO2. We then calculate the formation energies of point defects (vacancies and interstitials), as well as the incorporation and solution energies of helium in PuO2 and AmO2. The results are discussed according to the incorporation site of the gas atom in the lattice and to the stoichiometry of PuO2±x and AmO2±x. (authors)

  10. Removal of plutonium and americium from hydrochloric acid waste stream using extraction chromatography

    International Nuclear Information System (INIS)

    Extraction chromatography is under development as a method to lower actinide activity levels in hydrochloric acid (HCl) effluent streams. Successful application of this technique would allow recycle of the largest portion of HCl, while lowering the quantity and improving the form of solid waste generated. The extraction of plutonium and americium from HCl solutions was examined for several commercial and similar laboratory-produced resins coated with n-octyl(phenyl)-N,N-diisobutylcarbamoylmethyphosphine oxide (CMPO) and either tributyl phosphate (TBP), or diamyl amylphosphonate (DAAP). Distribution coefficients for Pu and Am were measured by contact studies in hydrochloric acid solutions over the range of 0.1 - 10.0 N HCl, whole varying REDOX conditions, actinide loading levels, and contact time intervals. Significant differences in the actinide distribution coefficients, and in the kinetics of actinide removal were observed as a function of resin formulation. The usefulness of these resins for actinide removal from HCl effluent streams is discussed

  11. Complex formation of trivalent americium with salicylic acid at very low concentrations

    International Nuclear Information System (INIS)

    For the first time, the complexation of americium(III) with salicylic acid was studied at trace metal concentrations using a 2.0 m Long Path Flow Cell for UV-vis spectroscopy. The detection limit of Am(III) in aqueous solution at pH 3.0 was found to be 5 x 10-9 M. Two Am(III)-salicylate complexes were formed at pH 5.0 in 0.1 M NaClO4, indicated by a clear red shift of the absorption maximum. The absorption spectra obtained from spectrophotometric titration were analyzed by means of factor analysis and complex stabilities were calculated to be log β110 = 2.56 ± 0.08 and log β120 = 3.93 ± 0.19. (author)

  12. Standard practice for The separation of americium from plutonium by ion exchange

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2001-01-01

    1.1 This practice describes the use of an ion exchange technique to separate plutonium from solutions containing low concentrations of americium prior to measurement of the 241Am by gamma counting. 1.2 This practice covers the removal of plutonium, but not all the other radioactive isotopes that may interfere in the determination of 241Am. 1.3 This practice can be used when 241Am is to be determined in samples in which the plutonium is in the form of metal, oxide, or other solid provided that the solid is appropriately sampled and dissolved (See Test Methods C758, C759, and C1168). 1.4 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  13. Transportability Class of Americium in K Basin Sludge under Ambient and Hydrothermal Processing Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Delegard, Calvin H.; Schmitt, Bruce E.; Schmidt, Andrew J.

    2006-08-01

    This report establishes the technical bases for using a ''slow uptake'' instead of a ''moderate uptake'' transportability class for americium-241 (241Am) for the K Basin Sludge Treatment Project (STP) dose consequence analysis. Slow uptake classes are used for most uranium and plutonium oxides. A moderate uptake class has been used in prior STP analyses for 241Am based on the properties of separated 241Am and its associated oxide. However, when 241Am exists as an ingrown progeny (and as a small mass fraction) within plutonium mixtures, it is appropriate to assign transportability factors of the predominant plutonium mixtures (typically slow) to the Am241. It is argued that the transportability factor for 241Am in sludge likewise should be slow because it exists as a small mass fraction as the ingrown progeny within the uranium oxide in sludge. In this report, the transportability class assignment for 241Am is underpinned with radiochemical characterization data on K Basin sludge and with studies conducted with other irradiated fuel exposed to elevated temperatures and conditions similar to the STP. Key findings and conclusions from evaluation of the characterization data and published literature are summarized here. Plutonium and 241Am make up very small fractions of the uranium within the K Basin sludge matrix. Plutonium is present at about 1 atom per 500 atoms of uranium and 241Am at about 1 atom per 19000 of uranium. Plutonium and americium are found to remain with uranium in the solid phase in all of the {approx}60 samples taken and analyzed from various sources of K Basin sludge. The uranium-specific concentrations of plutonium and americium also remain approximately constant over a uranium concentration range (in the dry sludge solids) from 0.2 to 94 wt%, a factor of {approx}460. This invariability demonstrates that 241Am does not partition from the uranium or plutonium fraction for any characterized sludge matrix. Most

  14. Plutonium and americium concentrations and vertical profiles in some Italian mosses used as bioindicators

    International Nuclear Information System (INIS)

    We have examined the uptake of actinide elements Am and Pu by different species of lichen and moss collected in two locations (Urbino, Central Italy; Alps region, North-east Italy). Plutonium and americium were separated and determined by extraction chromatography, electrodeposition and alpha-spectrometry. This paper summarizes our results with a special emphasis on the vertical profiles of these actinides in two different species of mosses. Several 1-2 cm depth sections were obtained and dated by 210Pb method. A typical peak for 239,240Pu and 241Am was found in the very old moss species ('Sphagnum Compactum') at a depth corresponding to the period 1960-1970 which was the period characterized by the maximum nuclear weapon tests. In a younger moss species ('Neckeria Crispa') no peak was observed and the regression curves showed that Am is more mobile than 239,240Pu and 238Pu. (author)

  15. 45 CFR 233.35 - Computing the assistance payment under retrospective budgeting after the initial one or two...

    Science.gov (United States)

    2010-10-01

    ... retrospective budgeting after the initial one or two months (AFDC). 233.35 Section 233.35 Public Welfare... the initial one or two months (AFDC). The State plan for AFDC shall provide: (a) After the initial one or two payment months of assistance under § 233.34, the amount of each subsequent month's...

  16. 20 CFR 404.233 - Adjustment of your guaranteed alternative when you become entitled after age 62.

    Science.gov (United States)

    2010-04-01

    ... when you become entitled after age 62. 404.233 Section 404.233 Employees' Benefits SOCIAL SECURITY... Guaranteed Alternative for People Reaching Age 62 After 1978 But Before 1984 § 404.233 Adjustment of your guaranteed alternative when you become entitled after age 62. (a) If you do not become entitled to...

  17. 231Pa and 233Pa neutron-induced fission up to 20 MeV

    International Nuclear Information System (INIS)

    Consistency of neutron-induced fission cross section data of 231Pa and 233Pa and data extracted from transfer reactions is investigated. Present estimate of 233Pa(n,f) fission cross section is supported by smooth level density parameter systematic, validated in case of 231Pa(n,f) data description up to En=20 MeV. The fission probabilities of Pa, fissioning in 231,233Pa(n,nf) reactions, are defined by fitting (3He,d) or (3He,t) transfer reaction data

  18. Calculation of the neutron-induced fission cross section of 233Pa

    International Nuclear Information System (INIS)

    Since very recently, experimental data for the energy dependence of the 233Pa(n,f) cross section are finally available. This has stimulated a new, self-consistent cross section evaluation for the system n+233Pa in the incident neutron energy range 0.01-6 MeV. The results are quite different compared to earlier evaluation attempts. Since 233Pa is an important intermediary in the thorium based fuel cycle, its neutron reaction cross sections are key parameters in the modeling of future advanced reactor concepts

  19. 5 CFR 532.233 - Preparation for full-scale wage surveys.

    Science.gov (United States)

    2010-01-01

    ... the prevailing rate law for labor and agency representatives to participate in the wage survey process... REGULATIONS PREVAILING RATE SYSTEMS Prevailing Rate Determinations § 532.233 Preparation for full-scale...

  20. Improved AHWR equilibrium core cluster for self sustenance in 233U

    International Nuclear Information System (INIS)

    Advance Heavy Water Reactor (AHWR) is being designed with many advance features like negative coolant void reactivity, heat removal through natural circulation and other passive safety features. The AHWR is a 920 MWth, vertical pressure tube type thorium-based reactor cooled by boiling light water and moderated by heavy water and designed to maximise power production from thorium. The equilibrium fuel cycle is based on the conversion of naturally available thorium into fissile 233U, driven by plutonium as external fissile feed. The basic fuel cycle is based on the fact that the AHWR core should be self-sustaining in 233U. The self sustenance in 233U can be achieved by using two types of equilibrium core clusters. In this paper we have done a study where self sustenance in 233U can be achieved by using only single type of cluster. (author)

  1. 233Pa(2nth, f) cross-section determination using a fission track technique

    International Nuclear Information System (INIS)

    The 233Pa(2nth, f) cross-section has been experimentally determined for the first time using a fission track technique. It was found to be 4834 ± 57 b, which is significantly high and thus is very important for 232Th-233U-based fuel in advanced heavy-water reactors (AHWR) and accelerator-driven sub-critical systems (ADSs). This is because the 233Pa is an important intermediary in the thorium-based fuel cycle and thus its fission cross-section is a key parameter in the modeling of AHWR and ADSs. The 233Pa(2nth, f) cross-section was calculated theoretically using the TALYS computer code and found to be in good agreement with the experimental value after normalization with respect to 241Am(2nth, f). (orig.)

  2. Comparative studies on plutonium and 233U utilization in miniFUJI MSR

    International Nuclear Information System (INIS)

    Molten salt reactor (MSR) has many merits such as safety enhancement and capability to be used for hydrogen production. A comparative evaluation of plutonium and 233U utilization in miniFUJI MSR has been performed. Reactor grade plutonium (RGPu), weapon grade plutonium (WGPu), and super grade plutonium (SGPu) have been utilized in the present study. The reactors can obtain their criticality condition with the 233U concentration in the Th-233U fuel, RGPu concentration in Th-RGPu fuel, WGPu concentration in Th-WGPu fuel, and SGPu concentration in Th-SGPu fuel of 0.52%, 5.76%, 2.16%, and 1.96%, respectively. The Th-233U fuel results in the soft neutron spectra of miniFUJI reactor. The neutron spectra turn into harder with the enlarging of plutonium concentration in loaded fuel where Th-RGPu fuel gives the hardest neutron spectra. (author)

  3. Comparison of 233Pa(2nth, f) cross-section determined by fission track technique with TALYS 1.2

    International Nuclear Information System (INIS)

    In the last decade, an appreciable amount of work has been done in the new concepts of advanced heavy-water reactors (AHWR) and accelerator-driven sub-critical systems (ADSs) in the field of nuclear energy. In AHWR, 232Th - 233U is the primary fuel for power generation in AHWR and ADS. In the 232Th - 233U cycle, the fissile nucleus 233U is generated by two successive β-decays after a neutron capture of the fertile nucleus 232Th. The isotope 233Pa (T1/2 = 26.9 days) governs the production of 233U. Therefore, the neutron induced fission reaction with 233Pa greatly influences the production of 233U. The present work is carried out with the objective to study the 233Pa(2nth, f) reaction cross-section using the well known fission track-technique. The fission cross section has been experimentally found to be 4834 ± 57 barns, which is significantly high and thus is very important for 232Th-233U based fuel in advanced heavy water reactors (AHWR) and accelerator driven sub-critical systems (ADSs). In the present work, the 233Pa(2nth, f) cross-section has also been calculated theoretically using nuclear reaction model based computer code TALYS 1.2. The theoretically calculated 233Pa(2nth, f) cross-section found to be in good agreement with the experimental value after normalization with respect to 241Am(2nth, f). (author)

  4. Initial ORNL site assessment report on the storage of 233U

    International Nuclear Information System (INIS)

    The 233U storage facility at ORNL is Building 3019. The inventory stored in Building 3019 consists of 426.5 kg of 233U contained in 1,387.1 kg of total uranium. The inventory is primarily in the form of uranium oxides; however, uranium metal and other compounds are also stored. Over 99% of the inventory is contained in 1,007 packages stored in tube vaults within the facility. A tank of thorium nitrate solution, the P-24 Tank, contains 0.13 kg of 233U in ∼ 4,000 gal. of solution. The facility is receiving additional 233U for storage from the remediation of the Molten Salt Reactor Experiment (MSRE) at ORNL. Consolidation of material from sites with small holdings is also adding to the 233U inventory. Additionally, small quantities (233U are in other research facilities at ORNL. A risk assessment process was chosen to evaluate the stored material and packages based on available package records. The risk scenario was considered the failure of a package (or a group of similar packages) in the Building 3019 inventory. The probability of such a failure depends on packaging factors such as the age and material of construction of the containers. The consequence of such a failure depends on the amount and form of the material within the packages. One thousand seven packages were categorized with this methodology resulting in 859 low-risk packages, 147 medium-risk packages, and 1 high-risk package. This initial assessment also documents the status of the evaluation of the Building 3019 and its systems for safe storage of 233U. The final assessment report for ORNL storage of 233U is scheduled for June 1999. The report will document the facility assessments, the specific package inspection plan, and the results of initial package inspections

  5. An electrochemical oxidation process of Am (III) into Am (VI) used to separate the americium of spent fuels reprocessing solutions

    International Nuclear Information System (INIS)

    The aim of this invention is to oxidize by an electrochemical process Am (III) to Am (VI). This process can be used to separate the americium of spent fuels reprocessing solutions. The method consists to add to the aqueous nitric solution containing Am (III) an heteropolyanion able to complex the americium (as for instance the potassium tungstophosphate) and the Ag (II) ion. The Ag (II) ion oxidizes the Am (III) and is reduced into an Ag (I) ion. It is then regenerated by the electrolysis of the solution. After the oxidation of Am (III) into Am (VI), this last ion can be extracted by an adapted organic solvent. With this electrochemical method a yield of 100% Am (VI) is obtained in half a hour. (O.M.). 5 refs., 5 figs., 2 tabs

  6. Separation of oxidized americium from lanthanides by use of pillared metal(IV) phosphate-phosphonate hybrid materials

    International Nuclear Information System (INIS)

    Closing the nuclear fuel cycle in the US poses many challenges, one of which is found in the waste streams, which contain both trivalent lanthanides and actinides. The separation of americium from the raffinate will dramatically reduce the long-term radiotoxicity of the waste. The sorption of americium in both the tri- and pentavalent oxidation states was observed for four M(IV) phosphate-phosphonate ion exchange materials in nitric acid at pH 2. High selectivity was observed for reduced Am(III) with Kd values ca. 6 x 105 mL/g, while the Kd values for Am(V) were much lower. A new method of synthesizing and stabilizing AmO2+ to yield a lifetime of at least 24 h in acidic media using a combination of sodium persulfate and calcium hypochlorite will be described.

  7. Effects of impurities on the size and form of crystals of thorium and americium oxalates and oxides

    International Nuclear Information System (INIS)

    The influence of impurity salts and certain surfactants on the shape and size of thorium and americium oxalate crystals, as well as crystals of their dioxides, prepared at thermolysis of oxalate precipitates, has been investigated. It is shown that during thorium oxalate deposition from solutions, containing 0.8 mol/l thorium and 2 mol/l nitric acid at 96 deg C in the presence of ammonium salts or surfactants larger and monodisperse crystals are grown than in the absence of the above-mentioned substances. Addition of ammonium nitrate in the amount of 0.6 mol/l to solution containing 7.6x10-3 mol/l of americium dioxide particles coincides with the shape of oxalate crystals but their size is reduced by (20-25)% as compared with the initial ones

  8. Combined radiochemical procedure for determination of plutonium, americium and strontium-90 in the soil samples from SNTS

    International Nuclear Information System (INIS)

    The results of combined radiochemical procedure for the determination of plutonium, americium and 90Sr (via measurement of 90Y) in the soil samples from SNTS (Semipalatinsk Nuclear Test Site) are presented. The processes of co-precipitation of these nuclides with calcium fluoride in the strong acid solutions have been investigated. The conditions for simultaneous separation of americium and yttrium using extraction chromatography have been studied. It follows from analyses of real soil samples that the procedure developed provides the chemical recovery of plutonium and yttrium in the range of 50-95 % and 60-95 %, respectively. The execution of the procedure requires 3.5 working days including a sample decomposition study. (author)

  9. Uses for Uranium-233: What Should Be Kept for Future Needs?

    International Nuclear Information System (INIS)

    Since the end of the cold war, the United States has been evaluating what fissile materials to keep for potential uses and what fissile materials to declare excess. There are three major fissile materials: high-enriched uranium (HEU), plutonium, and uranium-233 (233U). Both HEU and plutonium were produced in large quantities for use in nuclear weapons and for reactor fuel. Uranium-233 was investigated for use in nuclear weapons and as a reactor fuel; however, it was never deployed in nuclear weapons or used commercially as a nuclear fuel. Uranium-233 has limited current uses, but it could have several future uses. Because of (1) the cost of storing 233U and (2) arms control considerations, the U.S. government must decide how much of the existing 233U inventory should be kept for future use and how much should be disposed of as waste. The objective of this report is to provide technical and economic input to make a use-or-dispose decision

  10. Extraction of americium(III) from nitric acid medium by CMPO-TBP extractants in ionic liquid diluent

    International Nuclear Information System (INIS)

    Extraction of americium(III) from nitric acid medium by a solution of tri-n-butylphosphate (TBP) and n-octyl(phenyl)-N,N-diisobutylcarbamoylmethylphosphine oxide (CMPO) in room temperature ionic liquid, l-butyl-3-methyl-imidazolium bis(trifluoromethanesulfonyl)imide (bmimNTf2), was studied and the results were compared with that obtained with CMPO-TBP in n-doddecane (n-DD). The distribution ratio of 241Am(III) in TBP-CMPO/bmimNTf2 was measured as a function of various parameters such as concentrations of nitric acid, CMPO, bmimNO3, NaNO3 and TBP and temperature. Remarkably large distribution ratios were observed for the extraction of americium(III) when bmimNTf2 acted as diluent and the extraction was insignificant in the absence of CMPO. The stoichiometry of metal-solvate in organic phase was determined by the slope analysis of extraction data and it indicated the formation of 1:3 (Am: CMPO) complex in organic phase. Viscosity of TBP-CMPO/bmimNTf2 at various temperatures and enthalpy change accompanied by the extraction of americium(III) were determined and reported in this paper. (orig.)

  11. The behaviour under irradiation of molybdenum matrix for inert matrix fuel containing americium oxide (CerMet concept)

    Science.gov (United States)

    D'Agata, E.; Knol, S.; Fedorov, A. V.; Fernandez, A.; Somers, J.; Klaassen, F.

    2015-10-01

    Americium is a strong contributor to the long term radiotoxicity of high activity nuclear waste. Transmutation by irradiation in nuclear reactors or Accelerator Driven System (ADS, subcritical reactors dedicated to transmutation) of long-lived nuclides like 241Am is therefore an option for the reduction of radiotoxicity of waste packages to be stored in a repository. In order to safely burn americium in a fast reactor or ADS, it must be incorporated in a matrix that could be metallic (CerMet target) or ceramic (CerCer target). One of the most promising matrix to incorporate Am is molybdenum. In order to address the issues (swelling, stability under irradiation, gas retention and release) of using Mo as matrix to transmute Am, two irradiation experiments have been conducted recently at the High Flux Reactor (HFR) in Petten (The Netherland) namely HELIOS and BODEX. The BODEX experiment is a separate effect test, where the molybdenum behaviour is studied without the presence of fission products using 10B to "produce" helium, the HELIOS experiment included a more representative fuel target with the presence of Am and fission product. This paper covers the results of Post Irradiation Examination (PIE) of the two irradiation experiments mentioned above where molybdenum behaviour has been deeply investigated as possible matrix to transmute americium (CerMet fuel target). The behaviour of molybdenum looks satisfying at operating temperature but at high temperature (above 1000 °C) more investigation should be performed.

  12. Consideration of the effect of lymph-node deposition upon the measurement of plutonium and americium in the lungs

    International Nuclear Information System (INIS)

    Measurement of an inhaled radionuclide by external photon counting includes quantities which may be contained in lymph nodes, as well as quantities in the lungs. An overestimate of the lung burden can result, if a portion of the radionuclide were present in the lymph nodes. This problem is analyzed with respect to the measurement of inhaled plutonium containing plutonium-241 and americium-241, when americium-241 has been used as a tracer for the plutonium. Equations are derived which yield the amounts of americium and of plutonium in the lungs and in the lymph nodes as a function of time after exposure and for various translocation and retention parameters. Count histories (count profiles) of actual exposure cases are compared with calculated count profiles in order to gain insight into possible values of the translocation and retention parameters. Comparison is also made with calculated count profiles using values of translocation and retention parameters recommended by the International Commission on Radiological Protection (ICRP) for use with the Task Group Lung Model. The magnitude of the possible overestimate (error factor) was calculated for combinations o

  13. HELIOS: the new design of the irradiation of U-free fuels for americium transmutation

    Energy Technology Data Exchange (ETDEWEB)

    D' Agata, E. [European Commission, Joint Research Centre, Institute for Energy, P.O. Box 2, 1755 ZG Petten (Netherlands); Klaassen, F.; Sciolla, C. [Nuclear Research and Consultancy Group, Dept. Life Cycle and Innovations, P.O. Box 25 1755 ZG Petten (Netherlands); Fernandez-Carretero, A. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, 76125 Karlsruhe (Germany); Bonnerot, J.M. [Commissariat a l' Energie Atomique, DEC/SESC/LC2I CEA-Cadarache, 13108 St. Paul lez Durance Cedex (France)

    2009-06-15

    Americium is one of the radioactive elements that mostly contribute to the radiotoxicity of the nuclear spent fuel. Transmutation of long-lived nuclides like Americium is an option for the reduction of the mass, the radiotoxicity and the decay heat of nuclear waste. The HELIOS irradiation experiment is the last evolution in a series of experiments on americium transmutation. The previous experiments, EFTTRA-T4 and T4bis, have shown that the release or trapping of helium is the key issue for the design of such kind of target. In fact, the production of helium, which is characteristic of {sup 241}Am transmutation, is quite significant. The experiment is carried out in the framework of the 4-year project EUROTRANS of the EURATOM 6. Framework Programme (FP6). Therefore, the main objective of the HELIOS experiment is to study the in-pile behaviour of U-free fuels such as CerCer (Pu, Am, Zr)O{sub 2} and Am{sub 2}Zr{sub 2}O{sub 7}+MgO or CerMet (Pu, Am)O{sub 2}+Mo in order to gain knowledge on the role of the fuel microstructure and of the temperature on the gas release and on the fuel swelling. The experiment was planned to be conducted in the HFR (High Flux Reactor) in Petten (The Netherlands) starting the first quarter of 2007. Because of the innovative aspects of the fuel, the fabrication has had some delays as well as the final safety analyses of the original design showed some unexpected deviation. Besides, the HFR reactor has been unavailable since August 2008. Due to the reasons described above, the experiment has been postponed. HELIOS should start in the first quarter of 2009 and will last 300 full power days. The paper will cover the description of the new design of the irradiation experiment HELIOS. The experiment has been split in two parts (HELIOS1 and HELIOS2) which will be irradiated together. Moreover, due to the high temperature achieved in cladding and to the high amount of helium produced during transmutation the experiment previously designed for a

  14. Uptake of americium-241 by plants from contaminated Chernobyl exclusive zone test site soils

    International Nuclear Information System (INIS)

    Americium-241 was found to accumulate in soils and biological objects of the environment. Its concentration has increased many times after the Chernobyl disaster and can be expected to increase about 40 times in the future. This research concentrated on the contaminated exclusive Chernobyl zone polluted by trace radionuclides, their behavior and accumulation by various plant species. Special attention is devoted to the bioavailability of 241Am to the plants Galium rivale, G. tinctorium, G. aparine, G. intermedium, Berteroa incana, Artemisia absinthium, A. vulgaris, Centaurea borysthenica, C. arenaria, Cirsium arvense, Succissa pratensis, Solidago virgaurea, Linaria vulgaris, Lepidium ruderale, Stenactis annua, Veronica maxima, Verbascum lychnitis, Euphorbia cyparissias, Genista tinctoria, Erigeron canadensis, Oenothera biennis, Betula pendula and Quercus robur, which were collected from the Chernobyl, Kopachi, and Yanov districts. The plant samples of Oenothera biennis, Betula pendula and Quercus robur were collected from the Yanov district, where the soil contamination by 241Am and 137Cs was at the level of 660 and 27 MBq/m2, respectively. Gamma spectroscopy and radiochemical methods were used to estimate the activity concentration of 137Cs, 90Sr, 238Pu, 239+240Pu, 241Am. The radionuclides were measured in the dry green mass of the plant samples and in the dry soils. The contamination of the Oenothera biennis, Betula pendula and Quercus robur samples by 137Cs was (5.8±1,5)x106, (7.4±1.1)x105, and (2.6±0.2)x106 Bq/kg dry mass, respectively, and contamination by 241Am was 47±5, 45±3 and 3.2±0.2 Bq/kg, respectively. The soil-to-plant transfer ratio for 137Cs ranged lay within the interval of 0.2 to 0.03 Bq/kg : Bq/m2, the the transfer ratio for 241Am did not exceed 7x10-5 Bq/kg : Bq/m2. The coefficient of the relative contents of the 241Am/239+240Pu radionuclides in the various plant samples varied from 3.2 to 8.3, while for soil from the Yanov district this

  15. Anomalous aryl strengthening of complexes at americium and europium extraction with alkylenediphospine dioxide from perchloric media

    International Nuclear Information System (INIS)

    Studied was the extraction of americium(3) and europium(3) from perchlorate solutions(0.001 M) with dioxides of alkylenediphosphines of three types: aryl Ph2P(O)CH2(O)PPh2(briefly 4P), and Ph2P(O)(CH2)2(O)PPh2, mixed Ph2P(O)CH2(O)P(C8H17)2 (or 2Ph2Oct) and alkyl (C8H17)2P(O)CH2(O)P(C8H17)2 (or 4 Oct). Trisolvates of MeS3x(ClO4)3 are predominantly formed but americium disolvates are also present upon dilution with dichloroethane. For 4Ph,2Ph2Oct and 4 Oct the concentration is, respectively, 1015, 2x1014, and 1013; for disolvates by 4 orders of magnitude lower which is, nevertheless, by 2 orders of magnitude higher than for nitric acid solutions. The separation coefficient of β Am/Eu for 4Ph attains 6-8. As in the case of nitrate solutions, an anomalous aryl strengthening of the complexes is observed: an increase in the distribution coefficients and extraction constants in the series of 4 Oct - 2Ph 2 Oct - 4Ph, in spite of the introduction of electronegative aryl substituents into the dioxide molecule, which reduce electron density on oxygen atoms and basicity of dioxides. In contrast to nitric acid solutions, observed is a nonlinear effect of a change in basicity on extraction properties upon dilution with dichloroethane (dioxide of 2Ph2 Oct does not occupy an intermediate position but is close to 4Ph). Upon dilution with chloroform the dependence is linear and anomalous effect rises due to a different nature of interactions of dioxides with chloroform. When the bridge increases up to ethylene, an anomalous strengthening of the complexes disappears. However, the distribution coefficients upon extraction with alkyl dioxide are considerably lower, which can be explained by a stronger extraction of perchloric acid

  16. Compilation of criticality data involving thorium or 233U and light water moderation

    Energy Technology Data Exchange (ETDEWEB)

    Gore, B.F.

    1978-07-01

    The literature has been searched for criticality data for light water moderated systems which contain thorium or /sup 233/U, and data found are compiled herein. They are from critical experiments, extrapolations, and exponential experiments performed with homogeneous solutions and metal spheres of /sup 233/U; with lattices of fuel rods containing highly enriched /sup 235/UO/sub 2/ - ThO/sub 2/ and /sup 233/UO/sub 2/ - ThO/sub 2/; and with arrays of cyclinders of /sup 233/U solutions. The extent of existing criticality data has been compared with that necessary to implement a thorium-based fuel cycle. No experiments have been performed with any solutions containing thorium. Neither do data exist for homogeneous /sup 233/U systems with H/U < 34, except for solid metal systems. Arrays of solution cylinders up to 3 x 3 x 3 have been studied. Data for solutions containing fixed or soluble poisons are very limited. All critical lattices using /sup 233/UO/sub 2/ - ThO/sub 2/ fuels (LWBR program) were zoned radially, and in most cases axially also. Only lattice experiments using /sup 235/UO/sub 2/ - ThO/sub 2/ fuels have been performed using a single fuel rod type. Critical lattices of /sup 235/UO/sub 2/ - ThO/sub 2/ rods poisoned with boron have been measured, but only exponential experiments have been performed using boron-poisoned lattices of /sup 233/UO/sub 2/ - ThO/sub 2/ rods. No criticality data exist for denatured fuels (containing significant amounts of /sup 238/U) in either solution or lattice configurations.

  17. L233P mutation of the Tax protein strongly correlated with leukemogenicity of bovine leukemia virus.

    Science.gov (United States)

    Inoue, Emi; Matsumura, Keiko; Soma, Norihiko; Hirasawa, Shintaro; Wakimoto, Mayuko; Arakaki, Yoshihiro; Yoshida, Takashi; Osawa, Yoshiaki; Okazaki, Katsunori

    2013-12-27

    The bovine leukemia virus (BLV) Tax protein is believed to play a crucial role in leukemogenesis by the virus. BLV usually causes asymptomatic infections in cattle, but only one-third develop persistent lymphocytosis that rarely progress after a long incubation period to lymphoid tumors, namely enzootic bovine leucosis (EBL). In the present study, we demonstrated that the BLV tax genes could be divided into two alleles and developed multiplex PCR detecting an L233P mutation of the Tax protein. Then, in order to define the relationship between the Tax protein and leukemogenicity, we examined 360 tumor samples randomly collected from dairy or breeding cattle in Japan, of which Tax proteins were categorized, for age at the time of diagnosis of EBL. The ages of 288 animals (80.0%) associated with L233-Tax and those of 70 animals (19.4%) with P233-Tax individually followed log-normal distributions. Only the two earliest cases (0.6%) with L233-Tax disobeyed the log-normal distribution. These findings suggest that the animals affected by EBL were infected with the virus at a particular point in life, probably less than a few months after birth. Median age of those with P233-Tax was 22 months older than that with L233-Tax and geometric means exhibited a significant difference (P<0.01). It is also quite unlikely that viruses carrying the particular Tax protein infect older cattle. Here, we conclude that BLV could be divided into two categories on the basis of amino acid at position 233 of the Tax protein, which strongly correlated with leukemogenicity. PMID:24139177

  18. Americium and plutonium in water, biota, and sediment from the central Oregon coast

    International Nuclear Information System (INIS)

    Plutonium-239, 240 and americium-241 were measured in the mussel Mytilus californianus from the region of Coos Bay, OR. The flesh of this species has a plutonium concentration of about 90 fCi/kg, and an Am-241/Pu-239, 240 ratio that is high relative to mixed fallout, ranging between two and three. Transuranic concentrations in sediment, unfiltered water, and filterable particulates were also measured; none of these materials has an Am/Pu ratio as greatly elevated as the mussels, and there is no apparent difference in the Am/Pu ratio of terrestrial runoff and coastal water. Sediment core profiles do not allow accumulation rates or depositional histories to be identified, but it does not appear that material characterized by a high Am/Pu ratio has ever been introduced to this estuary. Other bivalves (Tresus capax and Macoma nasuta) and a polychaete (Abarenicola sp.) do not have an elevated Am/Pu ratio, although the absolute activity of plutonium in the infaunal bivalves is roughly four times that in the mussels

  19. Americium-based oxides: Dense pellet fabrication from co-converted oxalates

    Energy Technology Data Exchange (ETDEWEB)

    Horlait, Denis; Lebreton, Florent [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France); Gauthé, Aurélie [CEA, DEN, DRCP/SERA/LCAR, 30207 Bagnols-sur-Cèze (France); Caisso, Marie [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France); Arab-Chapelet, Bénédicte; Picart, Sébastien [CEA, DEN, DRCP/SERA/LCAR, 30207 Bagnols-sur-Cèze (France); Delahaye, Thibaud, E-mail: thibaud.delahaye@cea.fr [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze (France)

    2014-01-15

    Mixed oxides are used as nuclear fuels and are notably envisaged for future fuel cycles including plutonium and minor actinide recycling. In this context, processes are being developed for the fabrication of uranium–americium mixed-oxide compounds for transmutation. The purpose of these processes is not only the compliance with fuel specifications in terms of density and homogeneity, but also the simplification of the process for its industrialization as well as lowering dust generation. In this paper, the use of a U{sub 0.85}Am{sub 0.15}O{sub 2±δ} powder synthesized by oxalate co-conversion as a precursor for dense fuel fabrications is assessed. This study notably focuses on sintering, which yielded pellets up to 96% of the theoretical density, taking advantage of the high reactivity and homogeneity of the powder. As-obtained pellets were further characterized to be compared to those obtained via processes based on the UMACS (Uranium Minor Actinide Conventional Sintering) process. This comparison highlights several advantages of co-converted powder as a precursor for simplified processes that generate little dust.

  20. Influence of organic additives on the colour reaction between trivalent americium and arsenazo III

    International Nuclear Information System (INIS)

    The colour reaction of Am(III) with arsenazo III in several hydroorganic media has been examined systematically on the addition of certain polar water-miscible organic solvents in the course of a search for improved and simple spectrophotometric methods for the estimation of americium. Addition of these substances resulted in the stabilization of colour and brought about a drastic enhancement in the absorbance values. The organic additives studied include acetone, acetonitrile, dimethylformamide, dioxane and ethanol. Among the many solvents tested, alcohol and dioxane proved to be the most effective, the highest sensitivity is obtained by using a 60% dioxane-ethanol (1:1) mixture. The apparent molar absorptivity based on Am content is 184616+-9931 mol-1 cm-1 at 655 nm which is about 3 times higher than that attained for the reaction in aqueous medium (65178+-1243). Moreover, this is the highest value reported as yet for its determination. Beer's law is obeyed both in mixed and aqueous media. The effects of some experimental variables on colour development have also been studied to optimize the conditions for the assay of Am. (author)

  1. Speciation and bioavailability of Americium-241 in the fresh water environment

    International Nuclear Information System (INIS)

    Due to its anthropogenic origin, the transuranic americium 241 confronts physiologists with the intriguing question, which mechanisms are involved in the incorporation or elimination of such artificial elements in biological cycles. The investigations on the speciation and bioavailability of 241Am in the freshwater environment aim to establish a relation between the behavior of 241Am in freshwater ecosystems and its availability for biota. In the limnic environment, most often characterized by a high organic load and a low conductivity, the effect of complexation of 241Am with humic acids and competition with trivalent cations such as A1 and Fe, were proven to be significant on the speciation of 241Am. Based on the registration of the 241Am uptake by a large number of freshwater organisms, the crayfish Astacus leptodactylus Eschscholtz was chosen to study the whole-body uptake of 241Am, its corresponding organ distribution and its retention in the animal. The share of external fixation and ingestion in the global uptake, and the effect of speciation on it, were studied more carefully. Other aspects in this physiological part were: the kinetics of 241Am in the hemolymph and the hepatopancreas, and its subcellular distribution in the digestive gland. Finally, by comparing the physiology of 241Am with some other metals (240Pu, 64Cu, 198Au) with analogous or contradictional properties, we tried to find out whether the behavior of 241Am in organisms can be explained from its chemical characteristics

  2. Development and Testing of an Americium/Lanthanide Separation Flowsheet Using Sodium Bismuthate

    Energy Technology Data Exchange (ETDEWEB)

    Jack Law; Bruce Mincher; Troy Garn; Mitchell Greenhalgh; Nicholas Schmitt; Veronica Rutledge

    2014-04-01

    The separation of Am from the lanthanides and curium is a key step in proposed advanced fuel cycle scenarios. The partitioning and transmutation of Am is desirable to minimize the long-term heat load of material interred in a future high-level waste repository. A separation process amenable to process scale-up remains elusive. Given only subtle chemistry differences within and between the ions of the trivalent actinide and lanthanide series this separation is challenging ; however, higher oxidation states of americium can be prepared using sodium bismuthate and separated via solvent extraction using diamylamylphosphonate (DAAP) extraction. Among the other trivalent metals only Ce is also oxidized and extracted. Due to the long-term instability of Am(VI) , the loaded organic phase is readily selectively stripped to partition the actinide to a new acidic aqueous phase. Batch extraction distribution ratio measurements were used to design a flowsheet to accomplish this separation. Additionally, crossflow filtration was investigated as a method to filter the bismuthate solids from the feed solution prior to extraction. Results of the filtration studies, flowsheet development work and flowsheet performance testing using a centrifugal contactor are detailed.

  3. Determination of plutonium americium and curium in soil samples by solvent extraction with trioctylphosphine oxide

    International Nuclear Information System (INIS)

    A method of Pu, Am and Cm determination in soil samples, which was developed for analyzing samples from territories subjected to radioactive contamination as a result of the Chernobyl accident is described. After preliminary treatment the samples were leached by solution of 7 mol/l HNO23+0.3 mol/l KBrO3 during heating. Pu was isolated by extraction with 0.05 mol TOPO from 7 mol/l HNO3. 144Ce and partially remaining in water phase isotopes of Zr, U and Th were isolated in an extraction-chromatographic column with TOPO and PbO2. Then Am and Cm were extracted by 0.2 mol/l TOPO from solution 1 mol/l HLact+0.07 mol/l DTPA+1 mol/l Al(NO3)3. Alpha-activity of both extracted products was determined in liquid scintillation counter. Chemical yield of plutonium counted to 85±10%, that of americium and curium -75±10%. 17 refs

  4. Assessment of radiation doses from residential smoke detectors that contain americium-241

    International Nuclear Information System (INIS)

    External dose equivalents and internal dose commitments were estimated for individuals and populations from annual distribution, use, and disposal of 10 million ionization chamber smoke detectors that contain 110 kBq (3 μCi) americium-241 each. Under exposure scenarios developed for normal distribution, use, and disposal using the best available information, annual external dose equivalents to average individuals were estimated to range from 4 fSv (0.4 prem) to 20 nSv (2 μrem) for total body and from 7 fSv to 40 nSv for bone. Internal dose commitments to individuals under post disposal scenarios were estimated to range from 0.006 to 80 μSv (0.0006 to 8 mrem) to total body and from 0.06 to 800 μSv to bone. The total collective dose (the sum of external dose equivalents and 50-year internal dose commitments) for all individuals involved with distribution, use, or disposal of 10 million smoke detectors was estimated

  5. NMR Evidence for the 8.5 K Phase Transition in Americium Dioxide

    Science.gov (United States)

    Tokunaga, Yo; Nishi, Tsuyoshi; Kambe, Shinsaku; Nakada, Masami; Itoh, Akinori; Homma, Yoshiya; Sakai, Hironori; Chudo, Hiroyuki

    2010-05-01

    We report here the first NMR study of americium dioxide (AmO2). More than 30 years ago, a phase transition was suggested to occur in this compound at 8.5 K based on magnetic susceptibility data, while no evidence had been obtained from microscopic measurements. We have prepared a powder sample of 243AmO2 containing 90 at. % 17O and have performed 17O NMR at temperatures ranging from 1.5 to 200 K. After a sudden drop of the 17O NMR signal intensity below 8.5 K, at 1.5 K we have observed an extremely broad spectrum covering a range of ˜14 kOe in applied field. These data provide the first microscopic evidence for a phase transition as a bulk property in this system. In addition, the 17O NMR spectrum has been found to split into two peaks in the paramagnetic state, an effect which has not been reported for actinide dioxides studied up to now. We suggest that the splitting is induced by self-radiation damage from the alpha decay of 243Am.

  6. Study of biosorbents application on the treatment of radioactive liquid wastes with americium-241

    International Nuclear Information System (INIS)

    The use of nuclear energy for many different purposes has been intensified and highlighted by the benefits that it provides. Medical diagnosis and therapy, agriculture, industry and electricity generation are examples of its application. However, nuclear energy generates radioactive wastes that require suitable treatment ensuring life and environmental safety. Biosorption and bioaccumulation represent an emergent alternative for the treatment of radioactive liquid wastes, providing volume reduction and physical state change. This work aimed to study biosorbents for the treatment of radioactive liquid wastes contaminated with americium-241 in order to reduce the volume and change the physical state from liquid to solid. The biosorbents evaluated were Saccharomyces cerevisiae immobilized in calcium alginate beads, inactivated and free cells of Saccharomyces cerevisiae, calcium alginate beads, Bacillus subtilis, Cupriavidus metallidurans and Ochrobactrum anthropi. The results were quite satisfactory, achieving 100% in some cases. The technique presented in this work may be useful and viable for implementing at the Waste Management Laboratory of IPEN - CNEN/SP in short term, since it is an easy and low cost method. (author)

  7. In Vitro Dissolution Tests of Plutonium and Americium Containing Contamination Originating From ZPPR Fuel Plates

    Energy Technology Data Exchange (ETDEWEB)

    William F. Bauer; Brian K. Schuetz; Gary M. Huestis; Thomas B. Lints; Brian K. Harris; R. Duane Ball; Gracy Elias

    2012-09-01

    Assessing the extent of internal dose is of concern whenever workers are exposed to airborne radionuclides or other contaminants. Internal dose determinations depend upon a reasonable estimate of the expected biological half-life of the contaminants in the respiratory tract. One issue with refractory elements is determining the dissolution rate of the element. Actinides such as plutonium (Pu) and Americium (Am) tend to be very refractory and can have biological half-lives of tens of years. In the event of an exposure, the dissolution rates of the radionuclides of interest needs to be assessed in order to assign the proper internal dose estimates. During the November 2011 incident at the Idaho National Laboratory (INL) involving a ZPPR fuel plate, air filters in a constant air monitor (CAM) and a giraffe filter apparatus captured airborne particulate matter. These filters were used in dissolution rate experiments to determine the apparent dissolution half-life of Pu and Am in simulated biological fluids. This report describes these experiments and the results. The dissolution rates were found to follow a three term exponential decay equation. Differences were noted depending upon the nature of the biological fluid simulant. Overall, greater than 95% of the Pu and 93% of the Am were in a very slow dissolving component with dissolution half-lives of over 10 years.

  8. Solution speciation of plutonium and Americium at an Australian legacy radioactive waste disposal site.

    Science.gov (United States)

    Ikeda-Ohno, Atsushi; Harrison, Jennifer J; Thiruvoth, Sangeeth; Wilsher, Kerry; Wong, Henri K Y; Johansen, Mathew P; Waite, T David; Payne, Timothy E

    2014-09-01

    During the 1960s, radioactive waste containing small amounts of plutonium (Pu) and americium (Am) was disposed in shallow trenches at the Little Forest Burial Ground (LFBG), located near the southern suburbs of Sydney, Australia. Because of periodic saturation and overflowing of the former disposal trenches, Pu and Am have been transferred from the buried wastes into the surrounding surface soils. The presence of readily detected amounts of Pu and Am in the trench waters provides a unique opportunity to study their aqueous speciation under environmentally relevant conditions. This study aims to comprehensively investigate the chemical speciation of Pu and Am in the trench water by combining fluoride coprecipitation, solvent extraction, particle size fractionation, and thermochemical modeling. The predominant oxidation states of dissolved Pu and Am species were found to be Pu(IV) and Am(III), and large proportions of both actinides (Pu, 97.7%; Am, 86.8%) were associated with mobile colloids in the submicron size range. On the basis of this information, possible management options are assessed. PMID:25126837

  9. Comparative study of plutonium and americium bioaccumulation from two marine sediments contaminated in the natural environment

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, T.F.; Smith, J.D. (Melbourne Univ., Parkville (Australia). Dept. of Inorganic Chemistry); Fowler, S.W.; LaRosa, J.; Holm, E. (International Atomic Energy Agency, Monaco-Ville (Monaco). Lab. of Marine Radioactivity); Aarkrog, A.; Dahlgaard, H. (Risoe National Lab., Roskilde (Denmark))

    1991-01-01

    Plutonium and americium sediment-animal transfer was studied under controlled laboratory conditions by exposure of the benthic polychaete Nereis diversicolor (O. F. Mueller) to marine sediments contaminated by a nuclear bomb accident (near Thule, Greenland) and nuclear weapons testing (Enewetak Atoll). In both sediment regimes, the bioavailability of plutonium and {sup 241}Am was low, with specific activity in the tissues <1% (dry wt) than in the sediments. Over the first three months, a slight preference in transfer of plutonium over {sup 241}Am occurred and {sup 241}Am uptake from the Thule sediment was enhanced compared to that from lagoon sediments of Enewetak Atoll. Autoradiography studies indicated the presence of hot particles of plutonium in the sediments. The results highlight the importance of purging animals of their gut contents in order to obtain accurate estimates of transuranic transfer from ingested sediments into tissue. It is further suggested that enhanced transuranic uptake by some benthic species could arise from ingestion of highly activity particles and organic-rich detritus present in the sediments. (author).

  10. Interim assessment of the denatured 233U fuel cycle: feasibility and nonproliferation characteristics

    International Nuclear Information System (INIS)

    A fuel cycle that employs 233U denatured with 238U and mixed with thorium fertile material is examined with respect to its proliferation-resistance characteristics and its technical and economic feasibility. The rationale for considering the denatured 233U fuel cycle is presented, and the impact of the denatured fuel on the performance of Light-Water Reactors, Spectral-Shift-Controlled Reactors, Gas-Cooled Reactors, Heavy-Water Reactors, and Fast Breeder Reactors is discussed. The scope of the R, D and D programs to commercialize these reactors and their associated fuel cycles is also summarized and the resource requirements and economics of denatured 233U cycles are compared to those of the conventional Pu/U cycle. In addition, several nuclear power systems that employ denatured 233U fuel and are based on the energy center concept are evaluated. Under this concept, dispersed power reactors fueled with denatured or low-enriched uranium fuel are supported by secure energy centers in which sensitive activities of the nuclear cycle are performed. These activities include 233U production by Pu-fueled transmuters (thermal or fast reactors) and reprocessing. A summary chapter presents the most significant conclusions from the study and recommends areas for future work

  11. Interim assessment of the denatured /sup 233/U fuel cycle: feasibility and nonproliferation characteristics

    Energy Technology Data Exchange (ETDEWEB)

    Abbott, L.S.; Bartine, D.E.; Burns, T.J. (eds.)

    1978-12-01

    A fuel cycle that employs /sup 233/U denatured with /sup 238/U and mixed with thorium fertile material is examined with respect to its proliferation-resistance characteristics and its technical and economic feasibility. The rationale for considering the denatured /sup 233/U fuel cycle is presented, and the impact of the denatured fuel on the performance of Light-Water Reactors, Spectral-Shift-Controlled Reactors, Gas-Cooled Reactors, Heavy-Water Reactors, and Fast Breeder Reactors is discussed. The scope of the R, D and D programs to commercialize these reactors and their associated fuel cycles is also summarized and the resource requirements and economics of denatured /sup 233/U cycles are compared to those of the conventional Pu/U cycle. In addition, several nuclear power systems that employ denatured /sup 233/U fuel and are based on the energy center concept are evaluated. Under this concept, dispersed power reactors fueled with denatured or low-enriched uranium fuel are supported by secure energy centers in which sensitive activities of the nuclear cycle are performed. These activities include /sup 233/U production by Pu-fueled transmuters (thermal or fast reactors) and reprocessing. A summary chapter presents the most significant conclusions from the study and recommends areas for future work.

  12. Characteristics of Modular Fast Reactor SVBR-100 Using Thorium-Uranium (233) Fuel

    International Nuclear Information System (INIS)

    Conclusions: • The performed computations for three different types of fuel (oxide , nitride and metallic), have revealed that maximum of uranium-233 breeding ratio, which equals to 0.9, is achieved when nitride type of fuel is used. • Adding breeding zones or increasing of the core dimensions result in increasing uranium-233 breeding ratio (up to BR = 0,97 or BR = 0,96 respectively). • There is opportunity of using plutonium as initial fissile isotope to implement U-Th-Pu fuel cycle. Breeding ratio is assessed by 0,98 if nitride fuel composition (Th+Pu)N with effective density of 12.5 is used. • The obtained data have demonstrated that both for U-Th FC and U-Th-Pu FC there is an opportunity to achieve a value of U-233 BR to be over unity when using the breeding zones and slightly increased the core dimensions

  13. 231Pa and 233Pa Neutron-Induced Fission Data Analysis

    International Nuclear Information System (INIS)

    The 231Pa and 233Pa neutron-induced fission cross-section database is analyzed within the Hauser-Feshbach approach. The consistency of neutron-induced fission cross-section data and data extracted from transfer reactions is investigated. The fission probabilities of Pa, fissioning in 231,233Pa(n,nf) reactions, are defined by fitting (3He,d) or (3He,t) transfer-reaction data. The present estimate of the 233Pa(n,f) fission cross section above the emissive fission threshold is supported by smooth level-density parameter systematics, validated in the case of the 231Pa(n,f) data description up to En =20 MeV

  14. Evaluation of the fission cross sections for U-233 and U-235

    International Nuclear Information System (INIS)

    Activities of evaluation of nuclear data was started in Japan, 1963, and the results were published as JENDL-1., JENDL-2 and JENDL-3.1. The revised edition, JENDL-3.2 is now under preparation. The evaluation works of the fission cross sections for U-233 and U-235 and the encountered problems are discussed. For the 1 to 7 MeV region of U-233 cross section, the data by Poenitz adopted in JENDL-2 were discarded and finally ratio data by the Tohoku University were adopted in JENDL-3. The resolved resonance parameters for heavy nuclides including U-233 and U-235 are treated with the Reich-Moore formula in JENDL-3.2 instead of the previously used Breit and Wigner formula. (T.H.)

  15. Uranium-233 waste definition: Disposal options, safeguards, criticality control, and arms control

    Energy Technology Data Exchange (ETDEWEB)

    Forsberg, C.W.; Storch, S.N. [Oak Ridge National Lab., TN (United States); Lewis, L.C. [Lockheed Martin Idaho Technology Co., Idaho Falls, ID (United States). Idaho National Engineering and Environmental Lab.

    1998-07-07

    The US investigated the use of {sup 233}U for weapons, reactors, and other purposes from the 1950s into the 1970s. Based on the results of these investigations, it was decided not to use {sup 233}U on a large scale. Most of the {sup 233}U-containing materials were placed in long-term storage. At the end of the cold war, the US initiated, as part of its arms control policies, a disposition program for excess fissile materials. Other programs were accelerated for disposal of radioactive wastes placed in storage during the cold war. Last, potential safety issues were identified related to the storage of some {sup 233}U-containing materials. Because of these changes, significant activities associated with {sup 233}U-containing materials are expected. This report is one of a series of reports to provide the technical bases for future decisions on how to manage this material. A basis for defining when {sup 233}U-containing materials can be managed as waste and when they must be managed as concentrated fissile materials has been developed. The requirements for storage, transport, and disposal of radioactive wastes are significantly different than those for fissile materials. Because of these differences, it is important to classify material in its appropriate category. The establishment of a definition of what is waste and what is fissile material will provide the guidance for appropriate management of these materials. Wastes are defined in this report as materials containing sufficiently small masses or low concentrations of fissile materials such that they can be managed as typical radioactive waste. Concentrated fissile materials are defined herein as materials containing sufficient fissile content such as to warrant special handling to address nuclear criticality, safeguards, and arms control concerns.

  16. Uranium-233 waste definition: Disposal options, safeguards, criticality control, and arms control

    International Nuclear Information System (INIS)

    The US investigated the use of 233U for weapons, reactors, and other purposes from the 1950s into the 1970s. Based on the results of these investigations, it was decided not to use 233U on a large scale. Most of the 233U-containing materials were placed in long-term storage. At the end of the cold war, the US initiated, as part of its arms control policies, a disposition program for excess fissile materials. Other programs were accelerated for disposal of radioactive wastes placed in storage during the cold war. Last, potential safety issues were identified related to the storage of some 233U-containing materials. Because of these changes, significant activities associated with 233U-containing materials are expected. This report is one of a series of reports to provide the technical bases for future decisions on how to manage this material. A basis for defining when 233U-containing materials can be managed as waste and when they must be managed as concentrated fissile materials has been developed. The requirements for storage, transport, and disposal of radioactive wastes are significantly different than those for fissile materials. Because of these differences, it is important to classify material in its appropriate category. The establishment of a definition of what is waste and what is fissile material will provide the guidance for appropriate management of these materials. Wastes are defined in this report as materials containing sufficiently small masses or low concentrations of fissile materials such that they can be managed as typical radioactive waste. Concentrated fissile materials are defined herein as materials containing sufficient fissile content such as to warrant special handling to address nuclear criticality, safeguards, and arms control concerns

  17. Numerical simulations of groundwater flow and solute transport in the Lake 233 aquifer

    International Nuclear Information System (INIS)

    A three-dimensional numerical flow model of the Lake 233 aquifer underlying the site of the proposed Intrusion Resistant Underground Structure (IRUS) for low level waste disposal is developed. A reference hydraulic conductivity distribution incorporating the key stratigraphic units and field estimates of recharge from Lake 233 are used as model input. The model was calibrated against the measured hydraulic head distribution, the flowpath of a historic 90Sr plume in the aquifer and measured groundwater velocities. (author). 23 refs., 4 tabs., 31 figs

  18. Use of radioisotopes in the study of tetracycline analytical application. Extraction of compounds formed between tetracycline and neptunium and americium elements

    International Nuclear Information System (INIS)

    The behavior of tetracycline as complexing agent, in solvent extraction studies of neptunium and americium, using benzyl alcohol as the organic phase, is presented. By using radioactive tracers of 239Np and 241Am the extraction percent of these elements were determined as a function of pH in the absence and in the presence of several masking agents. The influence of shaking time and the use of different types of supporting eletrolytes upon the extraction behavior was also studied. The extraction curves obtained using EDTA as masking agent show that tetracycline can be used for neptunium and americium separation. In this condition neptunium is extracted into the organic phase and americium remains in the aqueous phase. (Author)

  19. Sorption of plutonium and americium on repository, backfill and geological materials relevant to the JNFL low-level radioactive waste repository at Rokkasho-Mura

    International Nuclear Information System (INIS)

    An integrated program of batch sorption experiments and mathematical modeling has been carried out to study the sorption of plutonium and americium on a series of repository, backfill and geological materials relevant to the JNFL low-level radioactive waste repository at Rokkasho-Mura. The sorption of plutonium and americium on samples of concrete, mortar, sand/bentonite, tuff, sandstone and cover soil has been investigated. In addition, specimens of bitumen, cation and anion exchange resins, and polyester were chemically degraded. The resulting degradation product solutions, alongside solutions of humic and isosaccharinic acids were used to study the effects on plutonium sorption onto concrete, sand/bentonite and sandstone. The sorption behavior of plutonium and americium has been modeled using the geochemical speciation program HARPHRQ in conjunction with the HATCHES database

  20. Biosorption of Americium-242 by saccharomyces cerevisiae: preliminary evaluation and mechanism

    International Nuclear Information System (INIS)

    As an important radioisotope in nuclear industry and other fields, americium-241 is one of the most serious contamination concerns duo to its high radiation toxicity and long half-life. In this experiment, the biosorption of 241Am from solution by a fungus, Saccharomyces cerevisiae (S. cerevisiae), and the effects of various experimental conditions on the biosorption and the mechanism were explored. The preliminary results showed that S. cerevisiae is a very efficient biosorbent. An average of more than 99% of the total 241Am could be removed by S. cerevisiae of 2.1g/L (dry weight) from 241Am solutions of 2.22MBq/L -555 MBq/L (Co). The adsorption equilibrium was achieved within 1 hour and the optimum pH ranged 1-3. The culture times of more than 16 hours were suitable and the efficient adsorption of 241Am by the S. cerevisiae could be noted. The biosorption of 241Am by the decomposed cell wall, protoplasm or cell membrane of S. cerevisiae was same efficient as by the intact fungus, but the some components of S. cerevisiae, such as protein and acylation group had obvious effect on adsorption. When the concentrations of coexistent Eu3+, Nd3+ were 100 times more than that of 241Am, the adsorption rates would drop to 65%. However, most of the investigated acidic ions have no significant influence on the 241Am adsorption but minute change of pH value, while the saturated EDTA can strong inhibit the biosorption of 241Am.. (authors)

  1. Some elements for a revision of the americium reference biokinetic model

    International Nuclear Information System (INIS)

    The interpretation of individual activity measurement after a contamination by 241Am or its parent nuclide 241Pu is based on the reference americium (Am) biokinetic model published by the International Commission on Radiological Protection in 1993 [International Commission on Radiological Protection. Age-dependent doses to members of the public from intake of radionuclides: Part 2 Ingestion dose coefficients. ICRP Publication 67. Ann. ICRP 23(3/4) (1993)]. The authors analysed the new data about Am biokinetics reported afterwards to propose an update of the current model. The most interesting results, from the United States Transuranium and Uranium Registries post-mortem measurement database [Filipy, R. E. and Russel, J. J. The United States Transuranium and Uranium Registries as sources for actinide dosimetry and bio-effects. Radiat. Prot. Dosim. 105(1-4), 185-187 (2003)] and the long-term follow-up of cases of inhalation intake [Malatova, I., Foltanova, S., Beckova, V., Filgas, R., Pospisilova, H. and Hoelgye, Z. Assessment of occupational doses from internal contamination with 241Am. Radiat. Prot. Dosim. 105(1-4), 325-328 (2003)], seemed to show that the current model underestimates the retention in the massive soft tissues and overestimates the retention in the skeleton and the late urinary excretion. However, a critical review of the data demonstrated that all were not equally reliable and suggested that only a slight revision of the model, possibly involving a change in the balance of activity between massive soft tissues, cortical and trabecular bone surfaces, may be required. (authors)

  2. The treatment of liquid radioactive waste containing Americium by using a cation exchange method

    International Nuclear Information System (INIS)

    A research in the treatment of a liquid radioactive waste containing americium has been done. The liquid radioactive waste used in this research was standard solution of U dan Ce with the initial activity of 100 ppm. The experimental investigation is aimed at a study of the effects of the waste pH, the column dimension of IR-120 cation exchanger which is expressed as L/D, the flow rate of a liquid waste and the influence of thiocyanate as a complex agent against the efficiency of a decontamination for uranium and cerium element. The experiment was done by passing downward the feed of uranium and cerium solution into an IR-120 type of cation exchanger with the L/D of 11.37. From the experimental parameters done in this research where the influence of waste pH was varied from 3 - 8, the geometric column (L/D) 11.37, the liquid flow rate was from 2.5 - 10 ml/m and the thiocyanate concentration was between 100 ppm-500 ppm can be concluded that the optimum operational condition for the ion exchange achieved were the waste pH for uranium = 4 and the waste pH for cerium = 6, the flow rate = 2.5 ml/men. From the given maximum value of DF for uranium = 24 (DE = 95.83%) and of DF for cerium = 40 (DE = 97.5%), it can also be concluded that this investigation is to be continued in order that the greater value of DF/DE can be achieved

  3. A study of plutonium and americium concentrations in seaspray on the southern Scottish coast

    International Nuclear Information System (INIS)

    Seaspray and seawater have been collected from the southern Scottish coast and, for comparison, Cumbria in northwest England during 1989 and 1991. The occurrence of sea-to-land transfer of the actinides plutonium and americium in seaspray was observed on these coasts using muslin screens (a semi-quantitative technique most efficient for collecting large spray droplets) and high volume conventional air samplers. The actinides and fine particulate in the spray were present in relatively higher concentrations than measured in the adjacent seawater, i.e. the spray was enriched in particulate actinides. The net efficiency of the muslim screens in collecting airborne plutonium isotopes and 241Am generally appeared to be about 20%. A review of earlier published concentrations of 239+240Pu and 241Am measured in aerosol and deposition for over a year several tens of metres inland was carried out. This suggested that airborne activities are up to a factor of 5 times higher in Cumbria than southern Scotland. However, neither the new data collected in 1989 and 1991 nor this older data suggests any enhancement of seaspray actinide enrichment in southern Scotland compared to Cumbria. This finding contrasts with earlier, more limited, comparisons that have been carried out which suggested such a difference. There is clear evidence of considerable localised spatial and temporal variability in aerosol actinide enrichment over the beaches in both areas. Enrichments varies between 20 and 500 relative to the adjacent surf zone waters. However, the average enrichment in spray based on the continuous measurements made further inland is likely to be at the lower end of this range. (author)

  4. Reduction of. systematic error of In-vivo measurement of americium 241 activity in the skull

    International Nuclear Information System (INIS)

    Excretion analysis and in vivo measuring methods are used for estimation of internal contamination by 241Am. In vivo measurements of the lung are suitable in short time after time of intake when the way of the intake is inhalation. In vivo measurements of the activity in the liver or in the skeleton could be performed at a later time. Detection of radionuclide activity in the liver is quite difficult because it is necessary to distinguish liver activity from the activity of surrounding tissues i.e. lung and skeleton. The skull or knees are the most suitable., for activity assessment in the skeleton. The skull is the most appropriate for measurements because it represents about 15% of total skeleton mass and contributions to measured activity of surrounding tissues are small. Americium activity in the skull could be measured with different instrumentation and in various geometries. Setting of two semiconductors detectors placed 3 cm over temporal region of the skull is used in NRPI. Calibration of the system was done by several head phantoms, in this process was observed that detection efficiencies depend on size of the phantoms. The aim of the paper is to express character of the efficiency as function of the size of skull in order to obtain more accurate value of the activity and decrees its uncertainty. Simulations of head by simplified geometric shapes, i.e. spheres and rotary ellipsoids, is in coherence with phantoms of big size (UCIN, BPAM-0001), but for small phantoms occurred quite serious discrepancy. Activity of real cases determined by calibration with phantom BPAM-0001 (reference phantom) is reduced from 9 to 44 %, when eq. 2 is used and relative uncertainty is reduced from 32% to maximum 12%. (authors)

  5. Transport of plutonium, americium, and curium from soils into plants by roots

    International Nuclear Information System (INIS)

    For assessing the dose from radionuclides in agricultural products by ingestion it is necessary to know the soil to plant transfer factors. The literature was entirely investigated, in order to judge the size of the soil to plant transfer factors. In total, 92 publications - from 1948 to 1978 -have been evaluated. As result, transfer factors from 10-9 to 10-3 have been found for Plutonium, and from 10-6 to 1 for Americium. For Curium only few data are available in literature. The considerable variation of the measured transfer factors is based on the dependence of these transfer factors from the ion exchange capacity of soils, from the amount of organic materials, from the pH-value, and from the mode of contamination. There are, in any case, contradictory data, although there has been detected a dependence of the transfer factors from these parameters. Chelating agenst increase the transfer factors to approximately 1300. As well, fertilizers have an influence on the size of the transfer factors - however, the relationships have been scarcely investigated. The distribution of actinides within the individual parts of plants has been investigated. The highest concentrations are in the roots; in the plant parts above ground the concentration of actinides decreases considerably. The most inferior transfer factors were measured for the respective seed or fruits. The soil to plant transfer factors of actinides are more dependend on the age of the plants within one growing period. At the beginning of the period, the transfer factor is considerably higher than at the end of this period. With respect to plants with a growing period of several years, correlations are unknown. (orig.)

  6. Inert matrices, uranium-free plutonium fuels and americium targets. Synthesis of CAPRA, SPIN and EFTTRA studies

    International Nuclear Information System (INIS)

    A first selection of inert-matrix materials, actinide support alone (Pu and Am based), and compound materials, U free plutonium burning fuels and heterogeneous americium targets are discussed. Basic properties, fabrication, and reprocessing studies, European in-pile and out-of-pile tests, performed recently in the framework of CAPRA, SPIN and EFTTRA programs, are reviewed here. Taking into account these studies and on the bases of the different requirements to be met in each of the fuels and targets, a number of materials have been selected as 'promising candidates'. Trends for further research on these materials are established. (author)

  7. Final Report on the Demonstration of Disposal of Americium and Curium Legacy Material Through the High Level Waste System

    International Nuclear Information System (INIS)

    This report provides the results of experimental demonstrations related to processing of a legacy solution containing americium and curium through the High Level Waste (HLW) system. The testing included eight experiments covering the baseline, mitigation, and enhanced nitrate processing studies. In general, each experiment studied the mixtures generated over a period of time to emulate the lifecycle of actual sludge in the High Level Waste system. While the data in previous reports remain valid, this report supercedes all the previous reports and provides a collective overview of the work

  8. Effect of a long-term release of plutonium and americium into an estuarine and coastal sea ecosystem

    International Nuclear Information System (INIS)

    This paper discusses the general problem of speciation of plutonium and americium in aquatic ecosystems and the implications relative to their fate in those systems. The following conclusions were reached: several oxidation states of plutonium coexist in the natural environment; the effect of environmental changes such as pH and Esub(h) values and complexes are probably the cause of these various oxidation states; a clearer definition of the 'concentration factor' should be given in view of the important role the sediments play in supplying plutonium for transfer through the food web. (author)

  9. Microstructure and elemental distribution of americium-containing MOX fuel under the short-term irradiation tests

    International Nuclear Information System (INIS)

    In order to investigate the effect of americium addition to MOX fuels on the irradiation behavior, the 'Am-1' program is being conducted in JAEA. The Am-1 program consists of two short-term irradiation tests of 10-minute and 24-hour irradiations and a steady-state irradiation test. The short-term irradiation tests were successfully completed and the post irradiation examinations (PIEs) are in progress. The PIEs for Am-containing MOX fuels focused on the microstructural evolution and redistribution behavior of Am at the initial stage of irradiation and the results to date are reported. (author)

  10. Development of a methodology for the determination of americium and thorium by ICP-AES and their inter-element effect

    International Nuclear Information System (INIS)

    Due to the scarcity of good quality uranium resources, the growth of nuclear technology in India is dependent on the utilization of the vast thorium resources. Therefore, Advance Heavy Water Reactor is going to acquire significant role in the scenario of Indian nuclear technology, where (Th, Pu)O2 will be utilized as fuel in the outermost ring of the reactor core. This will lead to a complex matrix containing thorium as well as americium, which is formed due to β-decay of plutonium. The amount of americium is dependent on the burn up and the storage time of the Pu based fuels. In the present case, attempt was made to develop a method for the determination of americium as well as thorium by ICP-AES. Two emission lines of americium were identified and calibration curves were established for determination of americium. Though the detection limit of 283.236 nm line (5 ng mL-1) of americium was found to be better than that of 408.930 nm (11 ng mL-1), the former line is significantly interfered by large amount of thorium. Three analytical lines (i.e. 283.242, 283.730 and 401.913 nm) of thorium were identified and calibration curves were established along with their detection limits. It was observed that 283.242 and 401.913 nm line are having similar detection limits (18 and 13 ng mL-1, respectively) which are better than that of 283.730 nm (60 ng mL-1). This can be attributed to the high background of 283.273 nm channel of thorium. The spectral interference study revealed that even small amount of americium has significant contribution on 283.242 nm channel of thorium while the other two channels remain practically unaffected. Considering both these facts, spectral interference and analytical performance (detection limits and sensitivity), it was concluded that 401.913 nm line is the best analytical line out of the three lines for determination of thorium in presence of americium. (author)

  11. Registration of the Soft Red Winter Wheat Germplasm MD01W233-06-1 Resistant to Fusarium Head Blight

    Science.gov (United States)

    MD01W233-06-1 (Reg. No., PI ) is a soft red winter wheat (SRWW) (Triticum aestivum L.) germplasm line developed at the University of Maryland and released by the Maryland Agricultural Experiment Station in 2009. MD01W233-06-1 was selected from a cross of ‘McCormick’/ ‘Choptank’ made in 2001. McCorm...

  12. Breeding of 233U in the thorium–uranium fuel cycle in VVER reactors using heavy water

    International Nuclear Information System (INIS)

    A method is proposed for achieving optimal neutron kinetics and efficient isotope transmutation in the 233U–232Th oxide fuel of water-moderated reactors with variable water composition (D2O, H2O) that ensures breeding of the 233U and 235U isotopes. The method is comparatively simple to implement

  13. 16 CFR 23.3 - Misuse of the terms “hand-made,” “hand-polished,” etc.

    Science.gov (United States)

    2010-01-01

    ... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Misuse of the terms âhand-made,â âhand-polished,â etc. 23.3 Section 23.3 Commercial Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE...-made,” “hand-polished,” etc. (a) It is unfair or deceptive to represent, directly or by...

  14. Breeding of 233U in the thorium-uranium fuel cycle in VVER reactors using heavy water

    Science.gov (United States)

    Marshalkin, V. E.; Povyshev, V. M.

    2015-12-01

    A method is proposed for achieving optimal neutron kinetics and efficient isotope transmutation in the 233U-232Th oxide fuel of water-moderated reactors with variable water composition (D2O, H2O) that ensures breeding of the 233U and 235U isotopes. The method is comparatively simple to implement.

  15. Breeding of {sup 233}U in the thorium–uranium fuel cycle in VVER reactors using heavy water

    Energy Technology Data Exchange (ETDEWEB)

    Marshalkin, V. E., E-mail: marshalkin@vniief.ru; Povyshev, V. M. [Russian Federal Nuclear Center All-Russian Research Institute of Experimental Physics (VNIIEF) (Russian Federation)

    2015-12-15

    A method is proposed for achieving optimal neutron kinetics and efficient isotope transmutation in the {sup 233}U–{sup 232}Th oxide fuel of water-moderated reactors with variable water composition (D{sub 2}O, H{sub 2}O) that ensures breeding of the {sup 233}U and {sup 235}U isotopes. The method is comparatively simple to implement.

  16. 77 FR 67394 - Gulf of Mexico (GOM), Outer Continental Shelf (OCS), Western Planning Area (WPA) Lease Sale 233...

    Science.gov (United States)

    2012-11-09

    ... Area (WPA) Lease Sale 233 and Central Planning Area (CPA) Lease Sale 231, Oil and Gas Lease Sales... Supplemental EIS for oil and gas lease sales tentatively scheduled in 2013 and 2014 in the WPA and CPA offshore... environmental and socioeconomic analyses for proposed WPA Lease Sale 233 and proposed CPA Lease Sale 231,...

  17. 45 CFR 233.53 - Support and maintenance assistance (including home energy assistance) in AFDC.

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Support and maintenance assistance (including home... § 233.53 Support and maintenance assistance (including home energy assistance) in AFDC. (a) General. At State option, certain support and maintenance assistance (including home energy assistance) may...

  18. D2.3.3 Evaluation results of the LinkedUp VICI competition

    NARCIS (Netherlands)

    Drachsler, Hendrik

    2014-01-01

    This document D2.3.3 is the final report of Task 2.4 – Evaluation of challenge submissions. Task 2.4 is about the actual assessment of the participating projects within the LinkedUp Veni, Vidi and Vici competition on the basis of the LinkedUp Evaluation Framework (D2.2.1). The main objective of Task

  19. 46 CFR 153.233 - Separation of tanks from machinery, service and other spaces.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 5 2010-10-01 2010-10-01 false Separation of tanks from machinery, service and other... Design and Equipment Cargo Containment Systems § 153.233 Separation of tanks from machinery, service and... joint: (1) Machinery spaces. (2) Service spaces. (3) Accommodation spaces. (4) Spaces for...

  20. Investigations on production of 233U using few pin thoria in existing PHWRs

    International Nuclear Information System (INIS)

    Thorium is not a fissile material and cannot be used to either start or sustain the chain reaction. Therefore, a reactor using thorium would also need either enriched uranium or plutonium to sustain the chain reaction until enough of the thorium has converted to fissile 233U. In order to retrieve and reprocess the irradiated fuel, the bundle is designed with few thoria pins and rest SEU pins. In the present study, different pin configurations of thoria in 19 and 37 element fuel clusters of Indian PHWRs have been considered. The lattice calculations have been done using the multi-group transport theory code CLUB. The variations of k∞ versus burn up are depicted in the paper. The production of 233U (considering also the decay of 233Pa into 233U) is also shown. Average discharge burn ups of the order 20 and 17 GWd/Te can be achieved with the use of thoria pins in 19 and 37 element fuel clusters respectively with appropriate bundle shift scheme. Derating of power is required during operation because of bundle power restrictions. It is found that 1 pin thoria configuration is preferable from the point of view of fuel requirements and power reduction consideration. Since 37 element fuel cluster used in 540 MWe PHWR fuel has large margins in bundle power, the restriction in power operation is much less than 19 element fuel cluster used in 220 MWe PHWR

  1. 78 FR 18232 - Amendment of VOR Federal Airway V-233, Springfield, IL

    Science.gov (United States)

    2013-03-26

    ... depiction of the airway. When V- 233 was amended in the Federal Register of August 8, 2005 (70 FR 45527... Department of Transportation (DOT) Regulatory Policies and Procedures (44 FR 11034; February 26, 1979); and..., 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p. 389. Sec. 71.1 0 2. The...

  2. 16 CFR 233.2 - Retail price comparisons; comparable value comparisons.

    Science.gov (United States)

    2010-01-01

    ... GUIDES AGAINST DECEPTIVE PRICING § 233.2 Retail price comparisons; comparable value comparisons. (a... fountain pens at $10, it is not dishonest for retailer Doe to advertise: “Brand X Pens, Price Elsewhere $10... here would be deceptive, since the price charged by the small suburban outlets would have no...

  3. Recovery of 233U from waste and minimization of modifier with supercritical fluid extraction

    International Nuclear Information System (INIS)

    The supercritical fluid extraction (SFE) method was used to remove 233U from a real time tissue paper waste generated in our laboratory and resulted in about 97% of extraction efficiency. Optimization of modifier flow rate was carried out to minimize the generation of secondary liquid waste, a significant endeavour in the context of large-scale waste treatment plant. (author)

  4. Sampling and Analysis Plan for the 233-S Plutonium Concentration Facility

    International Nuclear Information System (INIS)

    This Sampling and Analysis Plan (SAP) provides the information and instructions to be used for sampling and analysis activities in the 233-S Plutonium Concentration Facility. The information and instructions herein are separated into three parts and address the Data Quality Objective (DQO) Summary Report, Quality Assurance Project Plan (QAP), and SAP

  5. Measured and calculated fission-product poisoning in neutron-irradiated uranium-233

    International Nuclear Information System (INIS)

    Samples of 233U and of natural thorium have been irradiated in high neutron-flux facilities, in both soft and hard neutron spectra, and for both short and long exposure times. Included are exposures resulting in depletions of more than 90 percent of the 233U in the fissile material and burnups of more than 30,000 MWd/MT in the fertile material. Fission-product poison cross sections in two energy groups (thermal and epithermal) exhibit differences between measurement and calculation that are believed to be attributable to a lack of adequate information on important fission products in the literature. Experimental results for transient absorbers in irradiated 233U give at least 20,000 b for the neutron absorption resonance integral of 149Pm. This is a factor of 15 higher than that obtained by a 1/v extrapolation of the thermal cross sections. For transient 135Xe, the measured absorption is 7.5 percent higher than that calculated using ENDF/B-IV data. Information is also provided concerning such matters as fission yields and neutron absorption of neodymium isotopes, the existence of significant transient fission-product poisons other than 135Xe and 149Sm, and the shielding of 233U by 232Th. Such shielding suggests the need for a change in the energy dependence of the 232Th thermal-neutron cross section

  6. Comparison on decay process of explosive products for 233U and weapon-grade plutonium

    International Nuclear Information System (INIS)

    Comparison on the nuclear explosive products' radioactivity, biological hazard potential , energy deposition after nuclear explosion between the model of 233U and the model of weapon- grade plutonium was made. The detail analysis of the process of above physics quantities in the model of weapon-grade Plutonium was also given

  7. Use of nuclear recoil for separating 228Ra, 224Ra, and 233Pa from colloidal thorium

    International Nuclear Information System (INIS)

    By using α-recoil it is possible to separate by dialysis the α disintegration products (224 Ra; 228 Ra) of thorium from colloidal thorium hydroxide.The use of n, γ recoil allows the separation of 233Pa produced by the neutron irradiation of thorium, on condition that the colloidal thorium hydroxide is irradiated in the presence of a dispersing. (author)

  8. Radiological safety experience in the fabrication of alloy plate fuels bearing 233U/Pu

    International Nuclear Information System (INIS)

    The first incidence of 233U-bearing fuel fabrication in India was the production of aluminum-clad Al-233U alloy fuel for the Kamini research reactor. The reactor physics experiments for this fuel are now being carried out in the Purnima III critical assembly, where Al-Pu alloy plate fuels will also be used. Both types of fuels were fabricated in the radiometallurgy laboratories of Bhabha Atomic Research Centre. The hazard potential of each step, evaluated from the site-specific radiological field data, is summarized. The parameters analyzed for this purpose include external and internal radiation hazards, contamination hazards, age of fuel material (i.e., time after separation), and experimental thermoluminescent detector exposure data. Gamma spectrometric data of the finished fuel plates were also analyzed for their utility in checking the material inventory. The collective dose equivalent from the fabrication operations for 12 subassemblies (9 bearing 233U and 3 bearing plutonium) was 67 mSv, arising from external exposures only. The internal exposure was nil. Fabrication of fuel plates constituted >60% of the total exposure. Fabrication of fuel subassemblies and quality control inspection at all the stages accounted for the remaining radiation exposure. Handling of 233U/Pu-bearing fuels is likely to increase in the years ahead in India. In this context, analysis of radiological field data has yielded useful guidelines for future work

  9. Study of electrodeposition technique to prepare alpha-counting plates of uranium 233

    International Nuclear Information System (INIS)

    The electrodeposition technique to prepare alpha-counting plates of 233U for its determination is presented. To determine the optimum conditions for plating 233U the effects of such parameters as current density, pH of eletrotype, salt concentration, time of electrolysis and distance electrodes were studied. A carrier method was developed to attain a quantitative electrodeposition of 233U from aqueous solutions into alpha counting paltes. A single and incremental addition of natural uranium and thorium as carrier were studied. All samples were prepared using a electrodeposition cell manufactured at the IPEN, especially for use in electroplating tracer actinides. This cell is made of a metal-lucite to contain the electrolyte, which bottom is a polished brass disk coated with a Ni film serving as the cathode. A Pt wire anode is fixed on the top of the cell. The electroplated samples were alpha-counted using a surface barrier detector. A recovery of more than 99% was obtained in specific conditions. The plating procedure produced deposits which were firmly distributed over the plate area. The method was applied to determine tracer amounts of 233U from oxalate and nitrate solutions coming from chemical processing irradiated thorium. (Author)

  10. 48 CFR 852.233-70 - Protest content/alternative dispute resolution.

    Science.gov (United States)

    2010-10-01

    ... 48 Federal Acquisition Regulations System 5 2010-10-01 2010-10-01 false Protest content... Provisions and Clauses § 852.233-70 Protest content/alternative dispute resolution. As prescribed in 833.106, insert the following provision: Protest Content/Alternative Dispute Resolution (JAN 2008) (a) Any...

  11. Effect of radiolysis on leachability of plutonium and americium from 76-101 glass. [Glass containing 2 mole % plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Nash, K.L.; Fried, S.; Friedman, A.M.; Susak, N.; Rickert, P.; Sullivan, J.C.; Karim, D.P.; Lam, D.J.

    1982-01-01

    One aspect of the leachability of actinide-bearing glass which has not been adequately addressed is the effect of radiolysis of the system (glass-water) on the amount of actinides liberated from the glass. In the present study, we have investigated the leaching of plutonium and americium from 76-101 glass samples (containing 2 mole % plutonium) in the presence of a one megaRad/hour gamma-radiation field. The presence of the radiation field was found to increase the leaching rate of both plutonium and americium by a factor of five. Speciation studies of the plutonium in the leachate indicate that the plutonium is present predominantly in the higher oxidation states, Pu(V) and Pu(VI) and that it is significantly associated with colloidal particles. Examination of the glass surfaces with x-ray photoemission spectroscopy, XPS, both before and after leaching was carried out; these studies showed lower surface concentrations of plutonium in the samples of glass leached in the radiation field. 1 figure, 3 tables.

  12. Osteosarcoma induction by plutonium-239, americium-241 and neptunium-237 : the problem of deriving risk estimates for man

    International Nuclear Information System (INIS)

    Spontaneous bone cancer (osteosarcoma) represents only about 0.3% of all human cancers, but is well known to be inducible in humans by internal contamination with radium-226 and radium-224. plutonium-239, americium-241 and neptunium-237 form, or will form, the principal long-lived alpha particle emitting components of high activity waste and burnt-up nuclear fuel elements. These three nuclides deposit extensively in human bone and although, fortunately, no case of a human osteosarcoma induced by any of these nuclides is known, evidence from animal studies suggests that all three are more effective than radium-226 in inducing osteosarcoma. The assumption that the ratio of the risk factors, the number of osteosarcoma expected per 10000 person/animal Gy, for radium-226 and any other bone-seeking alpha-emitter will be independent of animal species has formed the basis of all the important studies of the radiotoxicity of actinide nuclides in experimental animals. The aim of this communication is to review the risk factors which may be calculated from the various animal studies carried out over the last thirty years with plutonium-237, americium-241 and neptunium-237 and to consider the problems which may arise in extrapolating these risk factors to homo sapiens

  13. Plutonium and americium in Arctic waters, the North Sea and Scottish and Irish coastal zones (in Fucus, Mytilus and Patella)

    International Nuclear Information System (INIS)

    Plutonium and americium have been measured in surface waters of the Greenland and Barents Seas and in the northern North Sea from 1980 through 1984. Measurements in water and biota, Fucus, Mytilus and Patella, were carried out in North-English and Scottish waters in 1982 and Fucus samples were collected from the Irish coast in 1983. Fallout is found to dominate as a source of 239+240Pu north of latitude 650N, while for 238Pu a substantial fraction originates from European nuclear fuel reprocessing facilities. The 238Pu/239+240Pu isotope ratio provides clear evidence of the transport of effluent plutonium from the latter to Spitsbergen waters. Fallout plutonium in Arctic waters has a residence time of the order of several years, while for Pu from Sellafield we estimate mean residence times of 11-15 months in Scottish waters and, tentatively, 1.5-3 y during transport from the North Channel (north of the Irish Sea) to Spitsbergen. 241Am found in Arctic waters probably originates from the decay of fallout 241Pu and, like Pu, tentatively has a residence time of the order of several years. Americium from Sellafield has an estimated mean residence time of 4-6 months in Scottish waters. (author)

  14. Experimental Study on Behavior of Americium in Pyrochemical Process of Nitride Fuel Cycle

    International Nuclear Information System (INIS)

    R and D on the transmutation of long-lived minor actinides (MA) by the accelerator-driven system (ADS) using nitride fuels is underway at JAEA. In regard to reprocessing technology, pyrochemical process has several advantages in case of treating spent fuel with large decay heat and fast neutron emission, and recovering highly enriched N-15. In the pyrochemical reprocessing, plutonium and MA are dissolved in LiCl-KCl eutectic melts and selectively recovered into liquid cadmium (Cd) cathode by molten salt electrorefining. The electrochemical behavior in LiCl-KCl eutectic melts and the subsequent nitride formation behavior of plutonium and MA recovered in liquid Cd cathode are investigated. In this paper, recent results on electrochemical study of americium (Am) on electrolyses of AmN in LiCl-KCl eutectic melts and nitride formation of Am recovered in the liquid Cd cathode are presented. Electrochemical behavior of Am on anodic dissolution of AmN and recovery of Am into a liquid Cd cathode by electrolyses in LiCl-KCl eutectic melts was investigated by transient electrochemical techniques. The formal standard potential of Am(III)/Am(0) obtained with the liquid Cd electrode is more positive than that calculated for the solid metal electrode. The potential shift is considered to be attributed to the lowering of the activity of Am by the formation of the intermetallic compound with Cd. Potentiostatic electrolyses of AmN in LiCl-KCl eutectic melts containing AmCl3 at 773 K were carried out. Nitrogen gas generated by the anodic dissolution of AmN was observed, and the current efficiency was obtained from the ratio of the amount of released nitrogen gas and the passed electric charge to be 20 - 28 %. Am was recovered as Am-Cd alloy in the liquid Cd cathode, in which AmCd6 type phase was identified besides Cd phase. The recovered Am was converted to AmN by the nitridation-distillation combined method, in which the Am-Cd alloy was heated in nitrogen gas stream at 973 K. These

  15. Strategy for the future use and disposition of Uranium-233: History, inventories, storage facilities, and potential future uses

    International Nuclear Information System (INIS)

    This document provides background information on the man-made radioisotope 233U. It is one of a series of four reports that map out potential national strategies for the future use and disposition of 233U pending action under the National Environmental Policy Act (NEPA). The scope of this report is separated 233U, where separated refers to nonwaste 233U or 233U that has been separated from fission products. Information on other 233U, such as that in spent nuclear fuel (SNF), is included only to recognize that it may be separated at a later date and then fall under the scope of this report. The background information in this document includes the historical production and current inventory of 233U, the uses of 233U, and a discussion of the available facilities for storing 233U. The considerations for what fraction of the current inventory should be preserved for future use depend on several issues. First, 233U always contains a small amount of the contaminant isotope 232U. The decay products of 232U are highly radioactive and require special handling. The current inventory has a variety of qualities with regard to 232U content, ranging from 1 to about 200 ppm (on a total uranium basis). It is preferable to use 233U with the minimum amount of 232U in all applications. The second issue pertains to other isotopes of uranium mixed in with the 233U, specifically 235U and 238U. A large portion of the inventory has a high quantity of 235U associated with it. The presence of bulk amounts of 235U complicates storage because of the added volume needing safeguards and criticality controls. Isotopic dilution using DU may remove safeguards and criticality concerns, but it increases the overall mass and may limit applications that depend on the fissile nature of 233U. The third issue concerns the packaging of the material. There is no standard packaging (although one is being developed); consequently, the inventory exists in a variety of packages. For some applications, the

  16. Preconcentration of low levels of americium and plutonium from waste waters by synthetic water-soluble metal-binding polymers with ultrafiltration

    International Nuclear Information System (INIS)

    A preconcentration approach to assist in the measurement of low levels of americium and plutonium in waste waters has been developed based on the concept of using water-soluble metal-binding polymers in combination with ultrafiltration. The method has been optimized to give over 90% recovery and accountability from actual waste water. (author)

  17. 45 CFR 233.145 - Expiration of medical assistance programs under titles I, IV-A, X, XIV and XVI of the Social...

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Expiration of medical assistance programs under titles I, IV-A, X, XIV and XVI of the Social Security Act. 233.145 Section 233.145 Public Welfare... FINANCIAL ASSISTANCE PROGRAMS § 233.145 Expiration of medical assistance programs under titles I, IV-A,...

  18. Review of thorium-U233 cycle thermal reactor benchmark studies

    International Nuclear Information System (INIS)

    A survey is made of many existing integral experiments for U233 systems and thorium-uranium based fuel systems. The aim is to understand to what extent they give a consistent test of ENDF/B-IV nuclear data. A principal result is the ENDF/B-IV leads to an underprediction of leakage. Extensive results from testing alternate thorium data sets are presented. For one evaluation due to Leonard they depict a possibly growing discrepance between measured integral parameters such as rho02 and I'232 and the differential data, which underpredicts them. Sensitivities to other nuclear data components, notably the fission neutron spectrum, were determined. A new harder U233 spectrum significantly reduces a bias trend in K/sub eff/ vs. leakage

  19. Review of thorium-U233 cycle thermal reactor benchmark studies (AWBA Development Program)

    International Nuclear Information System (INIS)

    A survey is made of existing integral experiments for U233 systems and thorium-uranium based fuel systems. The aim is to understand to what extent they give a consistent test of ENDF/B-IV nuclear data. A principal result is that ENDF/B-IV leads to an underprediction of neutron leakage. Results from testing alternate thorium data sets are presented. For one evaluation due to Leonard, the results depict a possible growing discrepancy between measured integral parameters such as rho02 and I232 and the differential data, which underpredicts these parameters. Sensitivities to other nuclear data components, notably the fission neutron spectrum, were determined. A new harder U233 spectrum significantly reduces a bias trend in K/sub eff/ vs leakage

  20. Emerging new options for harnessing the Th-233U cycle in India

    International Nuclear Information System (INIS)

    The recent development of the concept of Fusion Breeders especially the invention of the Fission Suppressed Blanket, coupled with parallel rapid strides in fusion technology (particularly of Tokamaks) has given a welcome new boost to the prospects of harnessing the Th-233U cycle. Their studies show that even sub-Lawson Fusion Breeders which are net consumers of electrical energy will be good enough to give adequate growth rates of nuclear generating capacity, provided the fusion bred 233U is used in either fast or thermal breeders of thermal near-breeders having high conversion ratios (>0.98). The paper presents an overview of the main results of studies underway in these areas both at the Bhabha Atomic Research Centre (BARC), Trombay and the Indira Gandhi Centre for Atomic Research (IGCAR), Kalpakkam

  1. Study of the excited levels of 233Pa by the 237Np alpha decay

    International Nuclear Information System (INIS)

    The excited levels in 233Pa following the 237Np alpha decay have been studied, by performing different experiences to complete available data and supply new information. Thus, two direct alpha spectrum measurement, one alpha-gamma bidimensional coincidence experiment, three gamma-gamma and gamma-X ray coincidences and some other measurements of the gamma spectrum, direct and coincident with alpha-particles have been made. These last experiences have allowed to obviate usual radiochemical separation methods, the 233Pa radioactive descendent interferences being eliminated by means of the coincidence technic. As a result, a primary decay scheme has been elaborated, including 15 new gamma transitions and two new levels, not observed in the most recent works. (Author) 60 refs

  2. 233Pa(n, f) cross section up to En=8.5 MeV

    International Nuclear Information System (INIS)

    The energy dependence of the neutron-induced fission cross section of 233Pa has been measured directly for the first time from the fission threshold up to En=8.5 MeV. This reaction plays an important role in the thorium-uranium fuel cycle, and is thus of interest for the design and modeling of advanced reactor and transmutation facilities. The existing information in the ENDF/B-VI and JENDL-3.3 evaluated nuclear data files differ by a factor of two for the 233Pa(n, f) cross section values and show different fission threshold energies. Our new experimental data give lower cross section values than both evaluations and resolves the question about the threshold energy. In addition to the experimental investigation, also a new theoretical calculation of the reaction cross section has been performed with the statistical model code STATIS, showing a good agreement with the experimental data

  3. ALARA Review for the Decontamination, Deactivation and Housekeeping of the 233-S Viewing Room

    International Nuclear Information System (INIS)

    A formal as low as reasonably achievable (ALARA) review is required by BHI-SH-02, Vol. 1, Safety and Health Procedures, Procedure 1.22, 'Planning Radiological Work', when radiological conditions exceed trigger level. The level of contamination inside the viewing room of the 233-S Facility meets this criterion. This ALARA review is for task instructions 1997-03-18-005-8.3.1, 'Instructions for Routine Entries and Minor Maintenance Work at 233-S,' and 8.3.2, 'Instructions for Deactivation, Decon, and Housekeeping in Viewing Room.' The radiological work permit (RWP) request broke the two task instructions into nine separate tasks. The nine tasks identified in the RWP request were used to estimate airborne concentrations and the total exposure

  4. Chemical behaviour of trivalent and pentavalent americium in saline NaCl-solutions. Studies of transferability of laboratory data to natural conditions. Interim report. Reported period: 1.2.1993-31.12.1993; Chemisches Verhalten von drei- und fuenfwertigem Americium in Salinen NaCl-Loesungen. Untersuchung der Uebertragbarkeit von Labordaten auf natuerliche Verhaeltnisse. Zwischenbericht. Berichtszeitraum 1.2.1993-31.12.1993

    Energy Technology Data Exchange (ETDEWEB)

    Runde, W.; Kim, J.I.

    1994-09-15

    In order to clarify the chemical behaviour of Americium in saline aqueous systems relevant for final storage this study deals with the chemical reactions of trivalent and pentavalent Americium in NaCl-solutions under the influence of radiolysis from its own alpha radiation. The focus of the study was on investigating the geologically relevant reactions, such as hydrolysis or carbonate- and chloride complexing in solid-liquid equilibriums. Comprehensive measurements on solubility and spectroscopic studies in NaCl-solutions were carried out in a CO{sub 2}-free atmosphere and 10{sup -2} atm CO{sub 2} partial pressure. Identification and characterisation of the AM (III) and AM(V) solid phases were supplemented by structural research with the chemically analogue EU (III) and Np(V) compounds. The alpha-radiation induced radiolysis in saline NaCl solutions and the redox behaviour of Americium which was influenced thereby were spectroscopically quantified. (orig.) [Deutsch] Zur Klaerung des chemischen Verhaltens von Americium in endlagerrelevanten salinen aquatischen Systemen befasst sich die vorliegende Arbeit mit den chemischen Reaktionen des drei- und fuenfwertigen Americiums in NaCl-Loesungen unter dem Einfluss der Radiolyse durch die eigene {alpha}-Strahlung. Der Schwerpunkt dieser Arbeit lag auf der Untersuchung der geologisch relevanten Reaktionen, wie Hydrolyse sowie Carbonat- und Chloridkomplexierung in fest-fluessig Gleichgewichtssystemen. Hierzu wurden umfassende Loeslichkeitsmessungen und spektroskopische Untersuchungen in NaCl-Loesungen, sowohl unter CO{sub 2}-freier Atmosphaere als auch unter 10{sup -2} atm CO{sub 2}-Partialdruck, durchgefuehrt. Die Identifizierung und Charakterisierung der Am(III)- und Am(V)-Festphasen wurde ergaenzt durch strukturelle Untersuchungen mit den chemisch analogen Eu(III)- und Np(V)-Verbindungen. Die von der {alpha}-Strahlung induzierte Radiolyse in salinen NaCl-Loesungen und das dadurch beeinflusste Redoxverhalten von Americium

  5. Analysis of the BNL ThO2-233U exponential experiments

    International Nuclear Information System (INIS)

    The BNL ThO2--3 w/o 233U light-water-moderated exponential experiments were analyzed to evaluate (1) cross section library sets for 233U and 232Th, and (2) correlations with measured ThO2 resonance integral data. A total of six cross section library sets were evaluated, including ENDF/B-2 and ENDF/B-3 libraries for 232Th, ENDF/B-2 library for 233U, and ThO2 resonance integral correlations based on data by Weitman and Pettus, Hardy and Palowitch, and corrections to the latter data by Steen. A modified version of the LEOPARD code was used throughout this analysis. The principle results of this work are as follows: (1) The library set containing ENDF/B-2 data for 233U and ENDF/B-3 data for 232Th, together with ThO2 resonance integral correlation based on Steen's corrections to the Hardy and Palowitch data, yields the best agreement with measurements, giving an average k/sub eff/ of 0.9975 with a standard deviation of 0.0067 for the 21 analyzed configurations. (2) With respect to this ''best'' set, the ENDF/B-2 232Th data is less reactive than the corresponding ENDF/B-3 data by approximately 0.1 percent Δk. (3) The ThO2 resonance integral correlation based on data by Weitman and Pettus yields resonance integrals that are consistently higher than those produced by the correlation with Steen's values, even though the latter is normalized to an infinitely dilute resonance integral of 85.9 barns (0.5 ev cutoff), while the former is normalized to a corresponding value of 80 barns. Thus, with respect to the ''best'' set, the ThO2 resonance integral correlation based on the Weitman and Pettus data is less reactive by approximately 0.7 percent Δk

  6. Measurement and analysis of anti ν energy dependence for 233U, 238U, 239Pu

    International Nuclear Information System (INIS)

    The energy dependence of the average yield of prompt neutrons per fission (anti ν) for U233, U238 and Pu239 in the incident neutron energy range (Esub(n)) up to 5 MeV has been studied using an electrostatic accelerator. The recommended curves for anti ν (Esub(n)) has been obtained with the help of the polynomial least square method fitting. The resons of deviations from the linear dependence have been analysed

  7. Final purification of 233U from thorium by Dowex 50x4 in Thorex process

    International Nuclear Information System (INIS)

    The 233U product obtained after a single cycle 5% tributyl phosphate/shell sol T extraction, scrubbing and stripping often contains significant amount of thorium as impurity. Further purification is normally carried out using ion exchange. The present paper summarises the results of the studies carried out to find out the various factors responsible for the extraordinary binding of thorium ion at the exchanger site while exploring the possibility of eluting total thorium using HNO3 alone

  8. Core design options for high conversion BWRs operating in Th–233U fuel cycle

    International Nuclear Information System (INIS)

    Highlights: • BWR core operating in a closed self-sustainable Th–233U fuel cycle. • Seed blanket optimization that includes assembly size array and axial dimensions. • Fully coupled MC with fuel depletion and thermo-hydraulic feedback modules. • Thermal-hydraulic analysis includes MCPR observation. -- Abstract: Several options of fuel assembly design are investigated for a BWR core operating in a closed self-sustainable Th–233U fuel cycle. The designs rely on an axially heterogeneous fuel assembly structure consisting of a single axial fissile zone “sandwiched” between two fertile blanket zones, in order to improve fertile to fissile conversion ratio. The main objective of the study was to identify the most promising assembly design parameters, dimensions of fissile and fertile zones, for achieving net breeding of 233U. The design challenge, in this respect, is that the fuel breeding potential is at odds with axial power peaking and the core minimum critical power ratio (CPR), hence limiting the maximum achievable core power rating. Calculations were performed with the BGCore system, which consists of the MCNP code coupled with fuel depletion and thermo-hydraulic feedback modules. A single 3-dimensional fuel assembly having reflective radial boundaries was modeled applying simplified restrictions on the maximum centerline fuel temperature and the CPR. It was found that axially heterogeneous fuel assembly design with a single fissile zone can potentially achieve net breeding, while matching conventional BWR core power rating under certain restrictions to the core loading pattern design

  9. Characteristics of Modular Fast Reactor SVBR-100 Using Thorium-Uranium (233) Fuel

    International Nuclear Information System (INIS)

    Natural reserves of thorium are three times as much as those of uranium. For that reason, thorium is a very promising raw material for manufacturing an artificial fissionable isotope of uranium-233 that is formed when neutrons are absorbed by thorium. Many countries are investigating characteristics of reactors using thorium-uranium (233) fuel. First, breeding ratio (BR) is of interest because only when BR = 1, the reactor can operate in a closed fuel cycle in a mode of fuel self-providing without makeup by other fissionable isotopes. The report presents the results of calculations of neutron-physical and thermal-hydraulic characteristics of SVBR-100 - lead-bismuth cooled small power modular fast reactor using thorium-uranium (233) fuel. Reactor SVBR-100 has specific properties of inherent self-protection and passive safety. The NPP modular power-units, which power equals to a value divisible by 100 MWe, can be constructed on the basis of reactor modules SVBR-100. (author)

  10. ALARA review for the decontamination and decommissioning of the 233-S pipe trench

    International Nuclear Information System (INIS)

    The 233-S Facility was completed in 1955 to expand plutonium production by further concentrating the plutonium nitrate product solution from the Reduction Oxidation (REDOX) Plant. The facility is radiologically contaminated because of operations and accidents. Isolation from REDOX and removal of the product transfer lines from the pipe trench is the second step in the decontamination and decommissioning of the entire 233-S Facility. The work scope is to isolate all piping from REDOX and then to remove all the piping/equipment from the pipe trench. The building is presently a Hazard Category 2 Nuclear Facility. A formal as low as reasonably achievable (ALARA) review is required by BHI-SH-02, Vol. 1, Procedure No. 1.22, Planning Radiological Work, when radiological conditions exceed trigger levels. The level of contamination inside the pipe trench and the process fluid piping is unknown. The potential exists to exceed the level of loose surface contamination, which requires a formal ALARA review when opening the pipe trench and cutting of piping commences. This ALARA review is for task instruction 1997-03-18-009 Revision 1, 233-S Pipe Trench Decon and Pipe Removal

  11. Criticality safety validation: Simple geometry, single unit {sup 233}U systems

    Energy Technology Data Exchange (ETDEWEB)

    Putman, V.L.

    1997-06-01

    Typically used LMITCO criticality safety computational methods are evaluated for suitability when applied to INEEL {sup 233}U systems which reasonably can be modeled as simple-geometry, single-unit systems. Sixty-seven critical experiments of uranium highly enriched in {sup 233}U, including 57 aqueous solution, thermal-energy systems and 10 metal, fast-energy systems, were modeled. These experiments include 41 cylindrical and 26 spherical cores, and 41 reflected and 26 unreflected systems. No experiments were found for intermediate-neutron-energy ranges, or with interstitial non-hydrogenous materials typical of waste systems, mixed {sup 233}U and plutonium, or reflectors such as steel, lead, or concrete. No simple geometry experiments were found with cubic or annular cores, or approximating infinite sea systems. Calculations were performed with various tools and methodologies. Nine cross-section libraries, based on ENDF/B-IV, -V, or -VI.2, or on Hansen-Roach source data, were used with cross-section processing methods of MCNP or SCALE. The k{sub eff} calculations were performed with neutral-particle transport and Monte Carlo methods of criticality codes DANT, MCNP 4A, and KENO Va.

  12. Measurement of 233U fission spectrum-averaged cross sections for some threshold reactions

    International Nuclear Information System (INIS)

    The 233U fission spectrum-averaged cross sections for twelve threshold reactions were measured relative to the average cross section of 0.688 ± 0.040 mb for the 27Al(n,α)24Na reaction. The reference value was obtained by calculation using the energy dependent cross section in the Japanese Evaluated Nuclear Data Library (JENDL) Dosimetry File and the Watt-type fission spectrum in ENDF/B-VI. General agreement was seen between the measured and the calculated fission-spectrum averaged cross sections. However, there exist discrepancies of more than 10% between the measured and the calculated average cross sections for the 24Mg(n,p)24Na, 47Ti(n,p)47Sc, and 64Zn(n,p)64Cu reactions. The tendencies in the calculated-to-measured ratios are similar to those for 235U fission spectrum-averaged cross sections the authors previously measured. The measured average cross sections were also applied for the spectrum adjustment of the 233U fission neutrons using the Neutron Unfolding Package Code (NEUPAC). The adjusted spectrum is close to the Watt-type fission spectrum of 233U within the uncertainties of the obtained spectrum, although there exist some fluctuations in the ratio spectrum of the adjusted to the Watt-type

  13. Influence of an alkoxy group on bis-triazinyl-pyridines for selective extraction of americium(III)

    International Nuclear Information System (INIS)

    The extraction of americium(III), curium(III), and lanthanides(III) from nitric acid by 2,6-bis-(5,6-dimethyl-[1,2,4]-triazin-3-yl)-pyridine and 2,6-bis-(5,6-dimethyl-[1,2,4]-triazin- 3-yl)-4-methoxy-pyridine was studied. The physico-chemical properties of these ligands, such as the protonation and complexation constants, were also determined to describe the influence of different substituent groups. The selectivity of substituted-BTP was confirmed both in complexation and in solvent extraction experiments. The presence of an alkoxy-group in position 4 of the pyridine decreases the BTP selectivity. Influence of a long alkyl chain on protonation and complexation constants was also studied with 2,6-bis-(5,6-dimethyl-[1,2,4]- triazin-3-yl)-4-dodecyloxy-pyridine. (authors)

  14. Solvent extraction of europium and americium into phenyltrifluoromethyl sulfone by using synergistic mixture of hydrogen dicarbollylcobaltate and 'classical' CMPO

    International Nuclear Information System (INIS)

    Extraction of microamounts of europium and americium by a phenyltrifluoromethyl sulfone (FS 13) solution of hydrogen dicarbollylcobaltate (H+B-) in the presence of octyl-phenyl-N,N-diisobutylcarbamoylmethyl phosphine oxide ('classical' CMPO, L) has been investigated. The equilibrium data have been explained assuming that the complexes HL+, HL2+, ML23+, ML33+ and ML43+ (M3+ Eu3+, Am3+) are extracted into the organic phase. The values of extraction and stability constants of the cationic complex species in FS 13 saturated with water have been determined. It was found that the stability constants of the corresponding complexes EuLn3+ and AmLn3+, where n 2, 3, 4 and L is 'classical' CMPO, in water-saturated FS 13 are comparable. (author)

  15. Recovery, purification and concentration of plutonium and americium from the aqueous wastes discharged in the reprocessing process studies

    International Nuclear Information System (INIS)

    For recovering and purifying plutonium and americium from the aqueous wastes occurring in the process studies on reprocessing, a standard procedure has been established for use in the laboratory works, through the preliminary tests of the precipitation as hydroxides and the anion exchange in nitrate media. The procedure was proven in the treatment of actual wastes, of which the results were contributed to determine the process conditions in the plutonium purification and product concentration of the JAERI Reprocessing Test Plant. The preliminary tests also include washing of U and Am recovery from the anion-exchanger in nitrate media, direct ion-exchange recovery of Pu from the TBP phase and elution of Am from the cation-exchanger. (auth.)

  16. Plutonium and americium in fish, shellfish and seaweed in the Irish environment and their contribution to dose

    International Nuclear Information System (INIS)

    Plutonium and americium activity concentrations in fish and shellfish landed in Ireland in the period 1988 to 1997 are presented. Activity concentrations in fish are low and often below detection limits, while those in mussels and oysters sampled on the northeast coast show no significant signs of decline. The estimated doses to hypothetical typical and heavy seafood consumers remain below 1 μSv yr-1 (committed effective dose).Plutonium activity concentrations measured in Fucus vesiculosus around the Irish coastline have not fallen appreciably in the ten year period between 1986 and 1996. Furthermore, the mean 238Pu/239,240Pu ratio of 0.17±0.05 in Fucus vesiculosus from the west coast of Ireland demonstrates the increasing significance of Sellafield-derived plutonium in those waters. (Copyright (c) 1999 Elsevier Science B.V., Amsterdam. All rights reserved.)

  17. The bone volume effect on the dosimetry of plutonium-239 and americium-241 in the skeleton of man and baboon

    International Nuclear Information System (INIS)

    Studies were undertaken using bone removed from young adult baboons, which had been contaminated with plutonium-239 at various times prior to sacrifice, and human bone from adult male (USTR Case 246), who had received an internal deposition of americium-241 as a result of a glove-box explosion 11 years prior to his death. The baboon bone was supplied by the CEA, France, and the human bone by the United States Transuranium registry. The bone samples, examined by qualitative and quantitative autoradiography with CR 39 detectors, demonstrated the rapid redistribution of bone surface-seeking radionuclides in younger primates due to growth and the slower, bone turnover driven redistribution in the adult human bone. In both species, primary and secondary surface deposits of radionuclide remained conspicious despite bone activity; true volumization of radionuclide was seldom seen. The dosimetric implications of these findings are discussed. (author) 21 refs.; 6 figs.; 4 tabs

  18. Neutron inelastic-scattering cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu

    International Nuclear Information System (INIS)

    Differential-neutron-emission cross sections of 232Th, 233U, 235U, 238U, 239Pu and 240Pu are measured between approx. = 1.0 and 3.5 MeV with the angle and magnitude detail needed to provide angle-integrated emission cross sections to approx. 232Th, 233U, 235U and 238U inelastic-scattering values, poor agreement is observed for 240Pu, and a serious discrepancy exists in the case of 239Pu

  19. The calculation of prompt fission neutron spectrum for 233U(n,f) reaction by the semi-empirical method

    OpenAIRE

    Chen, Yong-Jing; Min, Jia; Liu, Ting-Jin; Shu, Neng-Chuan

    2013-01-01

    The prompt fission neutron spectra for neutron-induced fission of 233U for low energy neutrons (below 6 MeV) are calculated using the nuclear evaporation theory with a semi-empirical method, in which the partition of the total excitation energy between the fission fragments for the nth+233U fission reactions are determined with the available experimental and evaluation data. The calculated prompt fission neutron spectra agree well with the experimental data. The proportions of high- energy ou...

  20. The study of 233Pa having the effect on reactivity swings during reactors start up and shutdown

    International Nuclear Information System (INIS)

    233Pa is an important nuclide in the Th-U conversion chain with a long half-life (27.4 d) and has large neutron absorption cross section, which influence the Th-U conversion ratio fuel and the operation of a Th-U fuelled reactor. On the basis of transport diffusion module and burn up module of the Dragon package, which gets the direct ratio relation- ship between 233Th, 233Pa and 233U concentration and the neutron flux levels, and gets the 233Pa having the effect on re activity swings during reactors start up and shutdown. The higher the neutron flux levels, the greater the loss of reactivity after reactors start up and the more significant increase of reactivity after reactors shutdown. Through the study of the 233Pa having the effect on reactivity swings during reactors start up and shutdown, it provides reference data for reactors using Th-U fuel with safe operation when reactors start up and shutdown. (authors)

  1. Comparative XRPD and XAS study of the impact of the synthesis process on the electronic and structural environments of uranium-americium mixed oxides

    Science.gov (United States)

    Prieur, D.; Lebreton, F.; Martin, P. M.; Caisso, M.; Butzbach, R.; Somers, J.; Delahaye, T.

    2015-10-01

    Uranium-americium mixed oxides are potential compounds to reduce americium inventory in nuclear waste via a partitioning and transmutation strategy. A thorough assessment of the oxygen-to-metal ratio is paramount in such materials as it determines the important underlying electronic structure and phase relations, affecting both thermal conductivity of the material and its interaction with the cladding and coolant. In 2011, various XAS experiments on U1-xAmxO2±δ samples prepared by different synthesis methods have reported contradictory results on the charge distribution of U and Am. This work alleviates this discrepancy. The XAS results confirm that, independently of the synthesis process, the reductive sintering of U1-xAmxO2±δ leads to the formation of similar fluorite solid solution indicating the presence of Am+III and U+V in equimolar proportions.

  2. Stability of penta- and hexavalent americium in the solutions of sodium peroxydisulfate and sodium bromate at intensive internal α-irradiation

    International Nuclear Information System (INIS)

    The spectrometric method has been used for studying the dependence of the rates of radiolytic reduction of Am(5) and (6) on the initial concentration of sodium persulfate and bromate, Am(5) and (6), acidity, and the dose rate of inner alpha-irradiation of the solutions. The high dose rates of inner alpha-irradiation of solutions (up to 3.25x1021 eV/lxmin-250Ci/l) have been attained with the aid of curium isotopes. The stability of americium (6) ions towards the action of ionizing radiation in solutions of sodium persulfate and bromate has been shown to be considerable lower than that of americium (5). The chemical difference has been shown in radiolytic behaviour between Am(5) and Am(6) ions in solutions of sodium persulfate and bromate. The equations have been derived showing the dependence of the rates of Am(6) and Am(5) reduction of different variables

  3. M233I Mutation in the β-Tubulin of Botrytis cinerea Confers Resistance to Zoxamide.

    Science.gov (United States)

    Cai, Meng; Lin, Dong; Chen, Lei; Bi, Yang; Xiao, Lu; Liu, Xi-li

    2015-01-01

    Three phenotypes were detected in 161 Botrytis cinerea field isolates, including Zox(S)Car(S) (sensitive to zoxamide and carbendazim), Zox(S)Car(R) (sensitive to zoxamide and resistant to carbendazim), and Zox(R)Car(R) (resistant to zoxamide and carbendazim), but not Zox(R)Car(S) (resistant to zoxamide and sensitive to carbendazim). The baseline sensitivity to zoxamide was determined with a mean EC50 of 0.76 μg/ml. Two stable Zox(R)Car(S) isolates were obtained with a resistance factor of 13.28 and 20.43; there was a fitness penalty in mycelial growth rate, sporulation, virulence and sclerotium production. The results suggest that the resistance risk of B. cinerea to zoxamide is low where benzimidazoles have not been used. E198V, E198K and M233I, were detected in the β-tubulin of Zox(S)Car(R), Zox(R)Car(R), Zox(R)Car(S), respectively. Molecular docking indicated that position 198 in β-tubulin were targets for both zoxamide and carbendazim. The mutations at 198 prevented formation of hydrogen bonds between β-tubulin and carbendazim (E198V/K), and changed the conformation of the binding pocket of zoxamide (E198K). M233I had no effect on the binding of carbendazim but resulted in loss of a hydrogen bond between zoxamide and F200. M233 is suggested to be a unique target site for zoxamide and be very important in the function of β tubulin. PMID:26596626

  4. A Density Functional Study of Atomic Hydrogen and Oxygen Chemisorption on the Relaxed (0001) Surface of Double Hexagonal Close Packed Americium

    OpenAIRE

    Dholabhai, P. P.; Atta-Fynn, R.; A.K. Ray

    2009-01-01

    Ab initio total energy calculations within the framework of density functional theory have been performed for atomic hydrogen and oxygen chemisorption on the (0001) surface of double hexagonal packed americium using a full-potential all-electron linearized augmented plane wave plus local orbitals method. Chemisorption energies were optimized with respect to the distance of the adatom from the relaxed surface for three adsorption sites, namely top, bridge, and hollow hcp sites, the adlayer str...

  5. Distribution, retention and dosimetry of plutonium and americium in the rat, dog and monkey after inhalation of an industrial-mixed uranium and plutonium oxide aerosol

    International Nuclear Information System (INIS)

    This study provides information on patterns of radiation dose in laboratory animals after inhalation exposure to an aerosol of one form of mixed uranium and plutonium oxide. The aerosol contained a mixture of UO2 and 750 deg C heat-treated PuO2 obtained from the ball milling operation in a mixed-oxide fuel fabrication process. Americium-241 from the decay of 241Pu was also present in the PuO2 matrix. Fischer-344 rats, Beagle dogs, and Cynomolgus and Rhesus monkeys inhaled aerosols re-generated from dry mixed oxide powders with particle size distribution characteristics similar to those observed in samples collected at the industrial site. Clearance from the lung and distribution in other tissues of the plutonium from this UO2 + PuO2 admixture was similar to what has been observed for PuO2 from laboratory-produced aerosols. The UO2-PuO2 aerosol was relatively insoluble in the lungs of all species. Monkeys and rats cleared plutonium and americium from their lungs faster than dogs. Very little plutonium or americium translocated within the first 2 yr after exposure to tissues other than tracheobronchial lymph nodes. The greater accumulation of plutonium and americium in the tracheobronchial lymph nodes of dogs as compared to monkeys and rats combined with the more rapid initial clearance of these radionuclides from the lungs of rats and monkeys suggests that errors could result from using data from a single animal species to estimate risk to humans from inhalation of these industrial aerosols. (author)

  6. Experimental study of Americium-241 biokinetics in Homarus Gammarus lobster. Analysis of the accumulation and detoxication mechanisms at the sub-cellular level

    International Nuclear Information System (INIS)

    The Americium 241 radioelement accumulation and elimination rate and mechanisms in the lobster organism have been experimentally studied; incorporation and detoxification capacities of each organ are evaluated. The existence of various biological compartments is shown; the major role of the digestive gland in accumulation of the radioelement, its distribution towards the various organs, and its resorption is comprehensively described, with an analysis at the subcellular and molecular levels. 401 p., 65 fig., 43 tab., 428 ref

  7. A programme of evaluation, processing and testing of nuclear data for Th-232 and U-233

    International Nuclear Information System (INIS)

    As part of the IAEA-NDS sponsored Co-ordinated Research Programme on the intercomparison of evaluations of Actinide Neutron Nucelar Data, a programme has been undertaken at RRC for Th-232 and U-233. This paper presents results highlighting the extent to which evaluations in JENDL-2, INDIAN, ENDF/B-V, ENDL-84, FRENCH SET(1969), INDL/A-83(RUMANIAN), ENDF/B-IV and JENDL-1 files are consistent with the measured value of σ/sub c//σ/sub eta/ for Th-232 at the center of THOR assembly which emphasizes transport of neutrons in the fission source energy range

  8. Simultaneous measurement of the neutron capture and fission yields of {sup 233}U

    Energy Technology Data Exchange (ETDEWEB)

    Berthoumieux, E.; Abbondanno, U.; Aerts, G.; Alvarez, H.A.; Alvarez-Velarde, F.A.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Calvino, F.; Calviani, M.; Cano Ott, D.; Capote, R.; Carrapic, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillmann, I.; Domingo-Pardo, C.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fujii, K.; Furman, W.; Goncalves, I.; Gonzalez-Romero, E.; Gramegna, F.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Jericha, E.; Kappeler, F.; Kadi, Y.; Karadimos, D.; Karamanis, D.; Kerveno, M.; Koehler, P.; Kossionides, E.; Krticka, M.; Lampoudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Martinez, T.; Massimi, C.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; O' Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Pigni, M.T.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Praena, J.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Santos, C.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wiescher, M.; Wisshak, K

    2008-07-01

    We have measured the neutron capture and fission cross section of {sup 233}U at the neutron time-of-flight facility n-TOF at CERN in the energy range from 1 eV to 1 MeV with high accuracy by using a high performance 4{pi} BaF{sub 2} Total Absorption Calorimeter (TAC) as a detection device. The method, based on the shape analysis of the TAC energy response, allowing to disentangle between {gamma}'s originating from fission and capture will be presented as well as the first very preliminary results. (authors)

  9. Simultaneous measurement of the neutron capture and fission yields of 233U

    International Nuclear Information System (INIS)

    We have measured the neutron capture and fission cross section of 233U at the neutron time-of-flight facility n-TOF at CERN in the energy range from 1 eV to 1 MeV with high accuracy by using a high performance 4π BaF2 Total Absorption Calorimeter (TAC) as a detection device. The method, based on the shape analysis of the TAC energy response, allowing to disentangle between γ's originating from fission and capture will be presented as well as the first very preliminary results. (authors)

  10. Gastrointestinal absorption and retention of plutonium-238 and uranium-233 in neonatal swine

    International Nuclear Information System (INIS)

    Newborn swine absorbed as much as one-half of a gavaged dose of 238Pu nitrate within 6 to 12 hr, and another one-fourth of the dose was retained in the stomach for up to 24 hr after intragastric administration. The small intestine accumulated one-third of the dose within 36 hr. Animals gavaged between 5 and 21 days of age absorbed decreasing amounts, especially at 14 and 21 days. Absorption of 233Pu (gavaged as the nitrate) by day-old pigs was similar to that of 238Pu

  11. Fabrication of zero power reactor fuel elements containing 233U3O8 powder

    International Nuclear Information System (INIS)

    Oak Ridge National Laboratory, under contract with Argonne National Laboratory, completed the fabrication of 1743 fuel elements for use in their Zero Power Reactor. The contract also included recovery of 20 kg of 233U from rejected elements. This report describes the steps associated with conversion of purified uranyl nitrate (as solution) to U3O8 powder (suitable for fuel) and subsequent charging, sealing, decontamination, and testing of the fuel elements (packets) preparatory to shipment. The nuclear safety, radiation exposures, and quality assurance aspects of the program are discussed

  12. Comparative XRPD and XAS study of the impact of the synthesis process on the electronic and structural environments of uranium–americium mixed oxides

    Energy Technology Data Exchange (ETDEWEB)

    Prieur, D., E-mail: dam.prieur@gmail.com [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, D-76125 Karlsruhe (Germany); Lebreton, F. [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze cedex (France); Martin, P.M. [CEA, DEN, DEC/SESC/LLCC, 13108 Saint-Paul-Lez-Durance cedex (France); Caisso, M. [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze cedex (France); Butzbach, R. [Helmholtz Zentrum Dresden Rossendorf (HZDR), Institute of Radiochemistry, P.O. Box 10119, 01314 Dresden (Germany); Somers, J. [European Commission, Joint Research Centre, Institute for Transuranium Elements, P.O. Box 2340, D-76125 Karlsruhe (Germany); Delahaye, T. [CEA, DEN, DTEC/SDTC/LEMA, 30207 Bagnols-sur-Cèze cedex (France)

    2015-10-15

    Uranium–americium mixed oxides are potential compounds to reduce americium inventory in nuclear waste via a partitioning and transmutation strategy. A thorough assessment of the oxygen-to-metal ratio is paramount in such materials as it determines the important underlying electronic structure and phase relations, affecting both thermal conductivity of the material and its interaction with the cladding and coolant. In 2011, various XAS experiments on U{sub 1−x}Am{sub x}O{sub 2±δ} samples prepared by different synthesis methods have reported contradictory results on the charge distribution of U and Am. This work alleviates this discrepancy. The XAS results confirm that, independently of the synthesis process, the reductive sintering of U{sub 1−x}Am{sub x}O{sub 2±δ} leads to the formation of similar fluorite solid solution indicating the presence of Am{sup +III} and U{sup +V} in equimolar proportions. - Graphical abstract: Formation of (U{sup IV/V},Am{sup III})O{sup 2} solid solution by sol–gel and by powder metallurgy. - Highlights: • Uranium–americium mixed oxides were synthesized by sol–gel and powder metallurgy. • Fluorite solid solutions with similar local environment have been obtained. • U{sup V} and Am{sup III} are formed in equimolar proportions.

  13. An experimental study of americium-241 biokinetics in the Lobster Homarus Gammarus. Analysis of the accumulation/storage and detoxification processes at the subcellular level

    International Nuclear Information System (INIS)

    An experimental study of americium-241 kinetics has been conducted in the lobster Homarus gammmarus. The investigations were conducted at all the levels from the whole body to the subcellular and molecular levels. The animals were contaminated by a single or chronic ingestion of 241 Am labelled mussels. Assessments of accumulation, elimination and distribution of the radionuclide were established on organisms kept in the laboratory; they made it possible to demonstrate the importance of the digestive gland in the radionuclide transfer pathways. The preliminary results led to structural then ultrastructural investigations of the digestive gland in association with radioautographic studies and cellular extractions methods. Four cellular types were demonstrated, only two of them being implied in the radionuclide retention, the former being responsible for americium intake and the latter for its long-term retention. By means of biochemical techniques, subcellular accumulation was studied and the organelles implied in the nuclide retention were specified. Finally, a method of cellular nuclei dissociation was developed; it made it possible to analyse the molecular nature of americium ligands and to demonstrate the function of the protein nuclear matrix in the nuclide retention

  14. A new method for the determination of plutonium and americium using high pressure microwave digestion and alpha-spectrometry or ICP-SMS

    International Nuclear Information System (INIS)

    Plutonium and americium are radionuclides particularly difficult to measure in environmental samples because they are a-emitters and therefore necessitate a careful separation before any measurement, either using radiometric methods or ICP-SMS. Recent developments in extraction chromatography resins such as EichromR TRU and TEVA have resolved many of the analytical problems but drawbacks such as low recovery and spectral interferences still occasionally occur. Here, we report on the use of the new EichromR DGA resin in association with TEVA resin and high pressure microwave acid leaching for the sequential determination of plutonium and americium in environmental samples. The method results in average recoveries of 83 ± 15% for plutonium and 73 ± 22% for americium (n = 60), and a less than 10% deviation from reference values of four IAEA reference materials and three samples from intercomparisons exercises. The method is also suitable for measuring 239Pu in water samples at the μBq/l level, if ICP-SMS is used for the measurement. (author)

  15. Comparative XRPD and XAS study of the impact of the synthesis process on the electronic and structural environments of uranium–americium mixed oxides

    International Nuclear Information System (INIS)

    Uranium–americium mixed oxides are potential compounds to reduce americium inventory in nuclear waste via a partitioning and transmutation strategy. A thorough assessment of the oxygen-to-metal ratio is paramount in such materials as it determines the important underlying electronic structure and phase relations, affecting both thermal conductivity of the material and its interaction with the cladding and coolant. In 2011, various XAS experiments on U1−xAmxO2±δ samples prepared by different synthesis methods have reported contradictory results on the charge distribution of U and Am. This work alleviates this discrepancy. The XAS results confirm that, independently of the synthesis process, the reductive sintering of U1−xAmxO2±δ leads to the formation of similar fluorite solid solution indicating the presence of Am+III and U+V in equimolar proportions. - Graphical abstract: Formation of (UIV/V,AmIII)O2 solid solution by sol–gel and by powder metallurgy. - Highlights: • Uranium–americium mixed oxides were synthesized by sol–gel and powder metallurgy. • Fluorite solid solutions with similar local environment have been obtained. • UV and AmIII are formed in equimolar proportions

  16. Preliminary results from uranium/americium affinity studies under experimental conditions for cesium removal from NPP ''Kozloduy'' simulated wastes solutions

    International Nuclear Information System (INIS)

    We use the approach described by Westinghouse Savannah River Company using ammonium molybdophosphate (AMP) to remove elevated concentrations of radioactive cesium to facilitate handling waste samples from NPP Kozloduy. Preliminary series of tests were carried out to determine the exact conditions for sufficient cesium removal from five simulated waste solutions with concentrations of compounds, whose complexing power complicates any subsequent processing. Simulated wastes solutions contain high concentrations of nitrates, borates, H2C2O4, ethylenediaminetetraacetate (EDTA) and Citric acid, according to the composition of the real waste from the NPP. On this basis a laboratory treatment protocol was created. This experiment is a preparation for the analysis of real waste samples. In this sense the results are preliminary. Unwanted removal of non-cesium radioactive species from simulated waste solutions was studied with gamma spectrometry with the aim to find a compromise between on the one hand the AMP effectiveness and on the other hand unwanted affinity to AMP of Uranium and Americium. Success for the treatment protocol is defined by proving minimal uptake of U and Am, while at the same time demonstrating good removal effectiveness through the use of AMP. Uptake of U and Am were determined as influenced by oxidizing agents at nitric acid concentrations, proposed by Savannah River National laboratory. It was found that AMP does not significantly remove U and Am when concentration of oxidizing agents is more than 0.1M for simulated waste solutions and for contact times inherent in laboratory treatment protocol. Uranium and Americium affinity under experimental conditions for cesium removal were evaluated from gamma spectrometric data. Results are given for the model experiment and an approach for the real waste analysis is chosen. Under our experimental conditions simulated wastes solutions showed minimal affinity to AMP when U and Am are most probably in the

  17. Shutdown margin for high conversion BWRs operating in Th-{sup 233}U fuel cycle

    Energy Technology Data Exchange (ETDEWEB)

    Shaposhnik, Y., E-mail: shaposhy@bgu.ac.il [NRCN – Nuclear Research Center Negev, POB 9001, Beer Sheva 84190 (Israel); Department of Nuclear Engineering, Ben-Gurion University of the Negev, POB 653, Beer Sheva 84105 (Israel); Shwageraus, E. [Department of Nuclear Engineering, Ben-Gurion University of the Negev, POB 653, Beer Sheva 84105 (Israel); Elias, E. [Faculty of Mechanical Engineering, Technion – Israel Institute of Technology, Technion City 32000, Haifa (Israel)

    2014-09-15

    Highlights: • BWR core operating in a closed self-sustainable Th-{sup 233}U fuel cycle. • Shutdown Margin in Th-RBWR design. • Fully coupled MC with fuel depletion and thermo-hydraulic feedback modules. • Thermal–hydraulic analysis includes MCPR observation. - Abstract: Several reactivity control system design options are explored in order to satisfy shutdown margin (SDM) requirements in a high conversion BWRs operating in Th-{sup 233}U fuel cycle (Th-RBWR). The studied core has an axially heterogeneous fuel assembly structure with a single fissile zone “sandwiched” between two fertile blanket zones. The utilization of an originally suggested RBWR Y-shape control rod in Th-RBWR is shown to be insufficient for maintaining adequate SDM to balance the high negative reactivity feedbacks, while maintaining fuel breeding potential, core power rating, and minimum Critical Power Ratio (CPR). Implementation of alternative reactivity control materials, reducing axial leakage through non-uniform enrichment distribution, use of burnable poisons, reducing number of pins as well as increasing pin diameter are also shown to be incapable of meeting the SDM requirements. Instead, an alternative assembly design, based on Rod Cluster Control Assembly with absorber rods was investigated. This design matches the reference ABWR core power and has adequate shutdown margin. The new concept was modeled as a single three-dimensional fuel assembly having reflective radial boundaries, using the BGCore system, which consists of the MCNP code coupled with fuel depletion and thermo-hydraulic feedback modules.

  18. 232Th, 233Pa, and 234U capture cross-section measurements in moderated neutron flux

    International Nuclear Information System (INIS)

    The Th-U cycle was studied through the evolution of a 100 μg 232Th sample irradiated in a moderated neutron flux of 8.01014 n/cm2/s, intensity close to that of a thermal molten salt reactor. After 43 days of irradiation and 6 months of cooling, a precise mass spectrometric analysis, using both TIMS and MC-ICP-MS techniques, was performed, according to a rigorous methodology. The measured thorium and uranium isotopic ratios in the final irradiated sample were then compared with integral simulations based on evaluated data; an overall good agreement was seen. Four important thermal neutron-capture cross-sections were also extracted from the measurements, 232Th (7.34±0.21 b), 233Pa (38.34±1.78 b), 234U (106.12±3.34 b), and 235U (98.15±11.24 b). Our 232Th and 235U results confirmed existing values whereas the cross-sections of 233Pa and 234U (both key parameters) have been redefined

  19. A novel GH secretagogue, A233, exhibits enhanced growth activity and innate immune system stimulation in teleosts fish.

    Science.gov (United States)

    Martinez, Rebeca; Ubieta, Kenia; Herrera, Fidel; Forellat, Alina; Morales, Reynold; de la Nuez, Ania; Rodriguez, Rolando; Reyes, Osvaldo; Oliva, Ayme; Estrada, Mario P

    2012-09-01

    In teleosts fish, secretion of GH is regulated by several hypothalamic factors that are influenced by the physiological state of the animal. There is an interaction between immune and endocrine systems through hormones and cytokines. GH in fish is involved in many physiological processes that are not overtly growth related, such as saltwater osmoregulation, antifreeze synthesis, and the regulation of sexual maturation and immune functions. This study was conducted to characterize a decapeptide compound A233 (GKFDLSPEHQ) designed by molecular modeling to evaluate its function as a GH secretagogue (GHS). In pituitary cell culture, the peptide A233 induces GH secretion and it is also able to increase superoxide production in tilapia head-kidney leukocyte cultures. This effect is blocked by preincubation with the GHS receptor antagonist [d-Lys(3)]-GHRP6. Immunoneutralization of GH by addition of anti-tilapia GH monoclonal antibody blocked the stimulatory effect of A233 on superoxide production. These experiments propose a GH-mediated mechanism for the action of A233. The in vivo biological action of the decapeptide was also demonstrated for growth stimulation in goldfish and tilapia larvae (Ptilapia larvae treated with this novel molecule. The decapeptide A233 designed by molecular modeling is able to function as a GHS in teleosts and enhance parameters of the innate immune system in the fish larvae. PMID:22707376

  20. Assessment of the available 233U cross-section evaluations in the calculation of critical benchmark experiments

    International Nuclear Information System (INIS)

    In this report we investigate the adequacy of the available 233U cross-section data for calculation of experimental critical systems. The 233U evaluations provided in two evaluated nuclear data libraries, the U.S. Data Bank [ENDF/B (Evaluated Nuclear Data Files)] and the Japanese Data Bank [JENDL (Japanese Evaluated Nuclear Data Library)] are examined. Calculations were performed for six thermal and ten fast experimental critical systems using the Sn transport XSDRNPM code. To verify the performance of the 233U cross-section data for nuclear criticality safety application in which the neutron energy spectrum is predominantly in the epithermal energy range, calculations of four numerical benchmark systems with energy spectra in the intermediate energy range were done. These calculations serve only as an indication of the difference in calculated results that may be expected when the two 233U cross-section evaluations are used for problems with neutron spectra in the intermediate energy range. Additionally, comparisons of experimental and calculated central fission rate ratios were also made. The study has suggested that an ad hoc 233U evaluation based on the JENDL library provides better overall results for both fast and thermal experimental critical systems

  1. Assessment of the Available (Sup 233)U Cross Sections Evaluations in the Calculation of Critical Benchmark Experiments

    Energy Technology Data Exchange (ETDEWEB)

    Leal, L.C.

    1993-01-01

    In this report we investigate the adequacy of the available {sup 233}U cross-section data for calculation of experimental critical systems. The {sup 233}U evaluations provided in two evaluated nuclear data libraries, the U. S. Data Bank [ENDF/B (Evaluated Nuclear Data Files)] and the Japanese Data Bank [JENDL (Japanese Evaluated Nuclear Data Library)] are examined. Calculations were performed for six thermal and ten fast experimental critical systems using the Sn transport XSDRNPM code. To verify the performance of the {sup 233}U cross-section data for nuclear criticality safety application in which the neutron energy spectrum is predominantly in the epithermal energy range, calculations of four numerical benchmark systems with energy spectra in the intermediate energy range were done. These calculations serve only as an indication of the difference in calculated results that may be expected when the two {sup 233}U cross-section evaluations are used for problems with neutron spectra in the intermediate energy range. Additionally, comparisons of experimental and calculated central fission rate ratios were also made. The study has suggested that an ad hoc {sup 233}U evaluation based on the JENDL library provides better overall results for both fast and thermal experimental critical systems.

  2. Contribution to the study of 233U production with MOX-ThPu fuel in PWR reactor. Transition scenarios towards Th/233U iso-generating concepts in thermal spectrum. Development of the MURE fuel evolution code

    International Nuclear Information System (INIS)

    If nuclear power is to provide a significant fraction of the growing world energy demand, only through the breeding concept can the development of sustainable nuclear energy become a reality. The study of such a transition, from present-day nuclear technologies to future breeding concepts is therefore pertinent. Among these future concepts, those using the thorium cycle Th/U-233 in a thermal neutron spectrum are of particular interest; molten-salt type thermal reactors would allow for breeding while requiring comparatively low initial inventories of U-233. The upstream production of U-233 can be obtained through the use of thorium-plutonium mixed oxide fuel in present-day light water reactors. This work presents, firstly, the development of the MURE evolution code system, a C++ object-oriented code that allows the study, through Monte Carlo (M.C.) simulation, of nuclear reactors and the evolution of their fuel under neutron irradiation. The M.C. methods are well-suited for the study of any reactor, whether it'd be an existing reactor using a new kind of fuel or a future concept altogether, the simulation is only dependent on nuclear data. Exact and complex geometries can be simulated and continuous energy particle transport is performed. MURE is an interface with MCNP, the well-known and validated transport code, that allows, among other functionalities, to simulate constant power and constant reactivity evolutions. Secondly, the study of MOX ThPu fuel in a conventional light water reactor (REP) is presented; it explores different plutonium concentrations and isotopic qualities in order to evaluate their safety characteristics. Simulation of their evolution allows us to quantify the production of U-233 at the end of burnup. Last, different french scenarios validating a possible transition towards a park of thermal Th/U-233 breeders, are presented. In these scenarios, U-233 is produced in ThPu moxed light water reactors. (author)

  3. Characteristics of plutonium and americium contamination at the former U.K. atomic weapons test ranges at Maralinga and Emu

    Energy Technology Data Exchange (ETDEWEB)

    Burns, P.A.; Cooper, M.B.; Lokan, K.H.; Wilks, M.J.; Williams, G.A. [Australian Radiation Lab., Melbourne, VIC (Australia)

    1995-11-01

    Physico-chemical studies on environmental plutonium are described, which provide data integral to an assessment of dose for the inhalation of artificial actinides by Australian Aborigines living a semi-traditional lifestyle at Maralinga and Emu, sites of U.K. atomic weapons tests between 1953 and 1963. The most significant area, from a radiological perspective, is the area contaminated by plutonium in a series of ``one point`` safety trials in which large quantities of plutonium were dispersed explosively at a location known as Taranaki. The activity distribution of plutonium and americium with particle size is quite different from the mass distribution, as a considerably higher proportion of the activity is contained in the finer (inhalable) fraction than of the mass. Except in areas which were disturbed through ploughing during a cleanup in 1967, most the activity remains in the top 1 cm of the surface. Much of the activity is in particulate form, even at distances > 20 km from the firing sites, and discrete particles have been located even at distances beyond 100 km. Data are presented which permit the assessment of annual committed doses through the inhalation pathway, for Aborigines living a semi-traditional lifestyle in the areas affected by the Taranaki firings in particular. (author).

  4. Evaluation of synthetic water-soluble metal-binding polymers with ultrafiltration for selective concentration of americium and plutonium

    International Nuclear Information System (INIS)

    Routine counting methods and ICP-MS are unable to directly measure the new US Department of Energy (DOE) regulatory level for discharge waters containing alpha-emitting radionuclides of 30 pCi/L total alpha or the 0.05 pCi/L regulatory level for Pu or Am activity required for surface waters at the Rocky Flats site by the State of Colorado. This inability indicates the need to develop rapid, reliable, and robust analytical techniques for measuring actinide metal ions, particularly americium and plutonium. Selective separation or preconcentration techniques would aid in this effort. Water-soluble metal-binding polymers in combination with ultrafiltration are shown to be an effective method for selectively removing dilute actinide ions from acidic solutions of high ionic strength. The actinide-binding properties of commercially available water-soluble polymers and several polymers which have been reported in the literature were evaluated. The functional groups incorporated in the polymers were pyrrolidone, amine, oxime, and carboxylic, phosphonic, or sulfonic acid. The polymer containing phosphonic acid groups gave the best results with high distribution coefficients and concentration factors for 241Am(III) and 238Pu(III)/(IV) at pH 4 to 6 and ionic strengths of 0.1 to 4

  5. Characterization of a Sealed Americium-Beryllium (AmBe) Source by Inductively Coupled Plasma Mass Spectrometry

    International Nuclear Information System (INIS)

    Two Americium-Beryllium neutron sources were dismantled, sampled (sub-sampled) and analyzed via inductively coupled plasma mass spectrometry (ICP-MS). Characteristics such as 'age' since purification, actinide content, trace metal content and inter and intra source composition were determined. The 'age' since purification of the two sources was determined to be 25.0 and 25.4 years, respectively. The systematic errors in the 'age' determination were ± 4 % 2s. The amount and isotopic composition of U and Pu varied substantially between the sub-samples of Source 2 (n=8). This may be due to the physical means of sub-sampling or the way the source was manufactured. Source 1 was much more consistent in terms of content and isotopic composition (n=3 sub-samples). The Be-Am ratio varied greatly between the two sources. Source 1 had an Am-Be ratio of 6.3 ± 52 % (1s). Source 2 had an Am-Be ratio of 9.81 ± 3.5 % (1s). In addition, the trace element content between the samples varied greatly. Significant differences were determined between Source 1 and 2 for Sc, Sr, Y, Zr, Mo, Ba and W.

  6. Use of radioanalytical methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in radioactive wastes

    International Nuclear Information System (INIS)

    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI + EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI + EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)

  7. Use of radioactive methods for determination of uranium, neptunium, plutonium, americium and curium isotopes in waste radioactive

    International Nuclear Information System (INIS)

    Activated charcoal is a common type of radioactive waste that contains high concentrations of fission and activation products. The management of this waste includes its characterization aiming the determination and quantification of the specific radionuclides including those known as Difficult-to-Measure Radionuclides (RDM). The analysis of the RDM's generally involves complex radiochemical analysis for purification and separation of the radionuclides, which are expensive and time-consuming. The objective of this work was to define a methodology for sequential analysis of the isotopes of uranium, neptunium, plutonium, americium and curium present in a type of radioactive waste, evaluating chemical yield, analysis of time spent, amount of secondary waste generated and cost. Three methodologies were compared and validated that employ ion exchange (TI+EC), extraction chromatography (EC) and extraction with polymers (ECP). The waste chosen was the activated charcoal from the purification system of primary circuit water cooling the reactor IEA-R1. The charcoal samples were dissolved by acid digestion followed by purification and separation of isotopes with ion exchange resins, extraction and chromatographic extraction polymers. Isotopes were analyzed on an alpha spectrometer, equipped with surface barrier detectors. The chemical yields were satisfactory for the methods TI+EC and EC. ECP method was comparable with those methods only for uranium. Statistical analysis as well the analysis of time spent, amount of secondary waste generated and cost revealed that EC method is the most effective for identifying and quantifying U, Np, Pu, Am and Cm present in charcoal. (author)

  8. Migration of the fission products strontium, technetium, iodine, cesium, and the actinides neptunium, plutonium, americium in granitic rock

    International Nuclear Information System (INIS)

    Rock samples were taken from drilling cores in granitic and granodioritic rock, and small (2x2x2 cm) rock tablets from the drilling cores were exposed to a groundwater solution containing one of the studied elements at race levels. The concentration of the element versus penetration depth in the rock tablet was measured radiometrically. The sorption on the mineral faces and the migration into the rock was studied, by an autoradiographic technique. The cationic fission products strontium and cesium had apparent diffusivities of 10-13-10-14 m2/s. They migrate mainly in fissures or filled fractures containing e.g., calcite, epidote or chlorite or in veins with hgih capacity minerals (e.g. biotite). The anionic fission products iodine and technetium had apparent diffusivities of about 10-14 m2/s. These species migrate along mineral boundaries and in open fractures and to a minor extent in high capacity mineral veins. The migration of the actinides neptunium, plutonium and americium is very slow (in the mm-range after 2-3 years contact time). The apparent diffusivities were about 10-15 m2/s. The actinide migration into the rock was largely confined to fissures. (orig./HP)

  9. Distribution of plutonium, americium, and several rare earth fission product elements between liquid cadmium and LiCl-KCl eutectic

    International Nuclear Information System (INIS)

    Separation factors were measured that describe the partition between molten cadmium and molten LiCl-KCl eutectic of plutonium, americium, praseodymium, neodymium, cerium, lanthanum, gadolinium, dysprosium, and yttrium. The temperature range was 753-788 K, and the range of concentrations was that allowed by the sensitivity of the chemical analysis methods. Mean separation factors were derived for Am-Pu, Nd-Am, Nd-Pu, Nd-Pr, Gd-La, Dy-La, La-Ce, La-Nd, Y-La, and Y-Nd. Where previously published data were available, agreement was good. For convenience, the following series of separation factors relative to plutonium was derived by combining the measured separation factors: Pu, 1.00 (basis); Am, 1.54; Pr, 22.0; Nd, 23.4; Ce, 26; La, 70; Gd, 77; Dy, 270; Y, 3000. These data are used in calculating the distribution of the actinide and rare earth elements in the prochemical reprocessing of spent fuel from the Integral Fast Reactor. (orig.)

  10. Characteristics of plutonium and americium contamination at the former U.K. atomic weapons test ranges at Maralinga and Emu

    International Nuclear Information System (INIS)

    Physico-chemical studies on environmental plutonium are described, which provide data integral to an assessment of dose for the inhalation of artificial actinides by Australian Aborigines living a semi-traditional lifestyle at Maralinga and Emu, sites of U.K. atomic weapons tests between 1953 and 1963. The most significant area, from a radiological perspective, is the area contaminated by plutonium in a series of ''one point'' safety trials in which large quantities of plutonium were dispersed explosively at a location known as Taranaki. The activity distribution of plutonium and americium with particle size is quite different from the mass distribution, as a considerably higher proportion of the activity is contained in the finer (inhalable) fraction than of the mass. Except in areas which were disturbed through ploughing during a cleanup in 1967, most the activity remains in the top 1 cm of the surface. Much of the activity is in particulate form, even at distances > 20 km from the firing sites, and discrete particles have been located even at distances beyond 100 km. Data are presented which permit the assessment of annual committed doses through the inhalation pathway, for Aborigines living a semi-traditional lifestyle in the areas affected by the Taranaki firings in particular. (author)

  11. Measured solubilities and speciations of neptunium, plutonium, and americium in a typical groundwater (J-13) from the Yucca Mountain region

    International Nuclear Information System (INIS)

    Solubility and speciation data are important in understanding aqueous radionuclide transport through the geosphere. They define the source term for transport retardation processes such as sorption and colloid formation. Solubility and speciation data are useful in verifying the validity of geochemical codes that are part of predictive transport models. Results are presented from solubility and speciation experiments of 237NpO2+, 239Pu4+, 241Am3+/Nd3+, and 243Am3+ in J-13 groundwater (from the Yucca Mountain region, Nevada, which is being investigated as a potential high-level nuclear waste disposal site) at three different temperatures (25 degree, 60 degree, and 90 degree C) and pH values (5.9, 7.0, and 8.5). The solubility-controlling steady-state solids were identified and the speciation and/or oxidation states present in the supernatant solutions were determined. The neptunium solubility decreased with increasing temperature and pH. Plutonium concentrations decreased with increasing temperature and showed no trend with pH. The americium solutions showed no clear solubility trend with increasing temperature and increasing pH

  12. Calculation of the neutron induced fission cross-section of 233Pa up to 20 MeV

    International Nuclear Information System (INIS)

    Since very recently, direct measurements of the 233Pa(n,f) cross-section are available in the energy range from 1.0 to 8.5 MeV. This has stimulated a new, self-consistent, neutron cross-section evaluation for the n+233Pa system, in the incident neutron energy range 0.01-20 MeV. Since higher fission chances are involved also the lighter Pa-isotopes had to be re-evaluated in a consistent manner. The results are quite different compared to earlier evaluation attempts. Since 233Pa is a key isotope in the thorium based fuel cycle the quality of its reaction cross-sections is important for the modeling of future advanced fuel and reactor concepts. The present status of the evaluated libraries is that they differ by a factor of two in the absolute fission cross-section and also in the threshold energy value

  13. Analysis of Hydrogen Generation and Accumulation in U-233 Tube Vaults

    International Nuclear Information System (INIS)

    The purpose of the 233U Safe Storage Program is to enhance the safe storage of 233U-bearing materials. This report describes the work done at the Oak Ridge National Laboratory's Radiochemical Development Facility (RDF) to address questions related to possible hydrogen generation and accumulation in 233U tube vaults. The objective of this effort was to verify assumptions in the mathematical model used to estimate the hydrogen content of the gaseous atmosphere that possibly could occur inside the tube vaults in Building 3019 and to evaluate proposed measures for mitigating any hydrogen concerns. A mathematical model was developed using conservative assumptions to evaluate possible hydrogen generation and accumulation in the tube vaults. The model concluded that an equilibrium concentration would be established below the lower flammability limit (LFL) of 4.1% hydrogen. The major assumptions used in the model that were validated are as follows: (1) The shield plug does not form a seal with the tube vault wall, thus allowing the hydrogen gas to diffuse past the shield plug to the upper section of the tube vault. (2) The tube vault end-cap leaks sufficiently to allow air to be drawn into the tube vault by the off-gas system, thereby purging hydrogen from the upper section of the tube vault. (3) Any hydrogen gas generated completely mixes with the other gases present in the lower section of the tube vault and does not stratify beneath the shield plug. (4) The diffusion coefficient determined from the literature for constant diffusion of hydrogen in air is valid. The coefficient is corrected for temperatures from 0 to 25 C. Another assumption used in the model, that hydrogen generated by radiolytic decomposition of hydrogen-bearing materials (e.g., moisture and plastic) leaks from the cans under steady-state condition, as opposed to a sudden release resulting from rupture of the can(s), was beyond the scope of this investigation. Several parameters from the original model

  14. High conversion Th–U233 fuel for current generation of PWRs: Part II – 3D full core analysis

    International Nuclear Information System (INIS)

    Highlights: • Three-dimensional full core analysis of high conversion Th–U233 PWR was performed. • Thermal–hydraulic safety margins were evaluated. • Feasibility of achieving conversion ratio close to unity was demonstrated. • The major tradeoffs are lower power output and shorter fuel cycle. - Abstract: This study explores a possibility of designing a high conversion (HC) Th–U233 core for current generation of pressurized water reactors (PWRs). Increasing the conversion ratio in existing PWRs can potentially improve the utilization of natural resources, through the exploitation of vast thorium reserves and reduction in natural uranium demand. HC can be achieved through the use of heterogeneous seed-blanket (SB) Th–U233 fuel assembly design, where the supercritical seed works as a neutron supplier, while the subcritical blanket acts as U233 breeder. One of the main challenges associated with the heterogeneous SB fuel assembly designs is significant power imbalance between the seed and blanket regions caused by the high concentration of fissile material in the seed region and consequently requiring a substantial reduction in the core average power density. The main objectives of the current work are: (1) to design a high conversion SB Th–U233 fuel assembly which is directly retrofittable into existing PWRs without introducing significant modifications into the core and plant design; (2) to estimate the reasonably achievable core power density level at which reactor safety is not compromised by performing 3D coupled neutronic and thermal–hydraulic (T–H) analysis of a typical PWR core fully loaded with HC Th–U233 SB fuel. Part II of the two-part paper reports on the steady-state whole core analysis of 100% Th–U233 fueled PWR. The results of this study demonstrate the feasibility in principle of achieving conversion ratio close to unity for a Th–U233 PWR core operating at power density of 60 W/cc, in three-batch annual fuel cycle and without

  15. 233U mass yield measurements around and within the symmetry region with the ILL Lohengrin spectrometer

    Science.gov (United States)

    Chebboubi, A.; Kessedjian, G.; Sage, C.; Bernard, D.; Blanc, A.; Faust, H.; Köster, U.; Litaize, O.; Mutti, P.; Serot, O.

    2016-03-01

    The study of fission yields has a major impact on the characterization and understanding of the fission process and is mandatory for reactor applications. The LPSC in collaboration with ILL and CEA has developed a measurement program on fission fragment distributions at the Lohengrin spectrometer of the ILL, with a special focus on the masses constituting the heavy peak. We will present in this paper our measurement of the very low fission yields in the symmetry mass region and the heavy mass wing of the distribution for 233U thermal neutron induced fission. The difficulty due to the strong contamination by other masses with much higher yields will be addressed in the form of a new analysis method featuring the required contaminant correction. The apparition of structures in the kinetic energy distributions and possible interpretations will be discussed, such as a possible evidence of fission modes.

  16. Shutdown Margin for High Conversion BWRs Operating in Th-233U Fuel Cycle

    CERN Document Server

    Shaposhnik, Yaniv; Elias, Ezra

    2013-01-01

    Several reactivity control system design options are explored in order to satisfy shutdown margin (SDM) requirements in a high conversion BWRs operating in Th-233U fuel cycle (Th-RBWR). The studied has an axially heterogeneous fuel assembly structure with a single fissile zone sandwiched between two fertile blanket zones. The utilization of an originally suggested RBWR Y-shape control rod in Th-RBWR is shown to be insufficient for maintaining adequate SDM to balance the high negative reactivity feedbacks, while maintaining fuel breeding potential, core power rating, and minimum Critical Power Ratio (CPR). Instead, an alternative assembly design, also relying on heterogeneous fuel zoning, is proposed for achieving fissile inventory ratio (FIR) above unity, adequate SDM and meeting minimum CPR limit at thermal core output matching the ABWR power. The new concept was modeled as a single 3-dimensional fuel assembly having reflective radial boundaries, using the BGCore system, which consists of the MCNP code coupl...

  17. Amster: a molten-salt reactor concept generating its own 233U and incinerating transuranium elements

    International Nuclear Information System (INIS)

    In the coming century, sustainable development of atomic energy will require the development of new types of reactors able to exceed the limits of the existing reactor types, be it in terms of optimum use of natural fuel resources, reduction in the production of long-lived radioactive waste, or economic competitiveness. Of the various candidates with the potential to meet these needs, molten-salt reactors are particularly attractive, in the light of the benefits they offer, arising from two fundamental features: - A liquid fuel does away with the constraints inherent in solid fuel, leading to a drastic simplification of the fuel cycle, in particular making in possible to carry out on-line pyrochemical reprocessing; - Thorium cycle and thermal spectrum breeding. The MSBR concept proposed by ORNL in the 1970's thus gave a breeding factor of 1.06, with a doubling time of about 25 years. However, given the tight neutron balance of the thorium cycle (the η of 233U is about 2.3), MSBR performance is only possible if there are strict constraints set on the in-line reprocessing unit: all the 233Pa must be removed from the core so that it can decay on the 233U in no more than about ten days (or at least 15 tonnes of salt to be extracted from the core daily), and the absorbing fission products, in particular the rare earths, must be extracted in about fifty days. With the AMSTER MSR concept, which we initially developed for incinerating transuranium elements, we looked to reduce the mass of salt to be reprocessed in order to minimise the size and complexity of the reprocessing unit coupled to the reactor, and the quantity of transuranium elements sent for disposal, as this is directly proportional to the mass of salt reprocessed for extraction of the fission products. Given that breeding was not an absolute necessity, because the reactor can be started by incinerating the transuranium elements from the spent fuel assemblies of current reactors, or if necessary by loading

  18. 233U mass yield measurements around and within the symmetry region with the ILL Lohengrin spectrometer

    Directory of Open Access Journals (Sweden)

    Chebboubi A.

    2016-01-01

    Full Text Available The study of fission yields has a major impact on the characterization and understanding of the fission process and is mandatory for reactor applications. The LPSC in collaboration with ILL and CEA has developed a measurement program on fission fragment distributions at the Lohengrin spectrometer of the ILL, with a special focus on the masses constituting the heavy peak. We will present in this paper our measurement of the very low fission yields in the symmetry mass region and the heavy mass wing of the distribution for 233U thermal neutron induced fission. The difficulty due to the strong contamination by other masses with much higher yields will be addressed in the form of a new analysis method featuring the required contaminant correction. The apparition of structures in the kinetic energy distributions and possible interpretations will be discussed, such as a possible evidence of fission modes.

  19. Health physics experience during recovery of 233U from irradiated thorium rods

    International Nuclear Information System (INIS)

    Recovery of 233U from the irradiated thorium rods (46 numbers) received from Bhabha Atomic Research Centre (BARC) was carried out successfully at Reprocessing Development Laboratory (RDL), Indira Gandhi Centre for Atomic Research (IGCAR). The reprocessing was done in five stages viz., charging of fuel rods into charging flask, decladding, dissolution, solvent extraction and reconversion. The complete operation, being first of its kind, undertaken at the centre needed extensive health physics surveillance and supervision at each stage of the operation. The operational radiation protection methods followed and the experience gained during this initial campaign in area and personnel monitoring, air monitoring and contamination are discussed. The results of routine stack monitoring and analysis of waste generated in the process are given. Special operations like decommissioning of the glove box are highlighted. A brief description of unusual occurrences is also given. (author)

  20. Aerosols generated by 239PU and 233U droplets burning in air

    International Nuclear Information System (INIS)

    The inhalation hazards of radioactive aerosols produced by the explosive disruption and subsequent combustion of metallic plutonium in air are not adequately understood. Results of a study to determine whether uranium can be substituted for plutonium in such a situation in which experiments were performed under identical conditions with laser-ignited, single, freely falling droplets of 239Pu and 233U are reported. The total amounts of aerosol produced were studied quantitatively as a function of time during the combustion. Also, particle size distributions of selected aerosols were studied with aerodynamic particle separation techniques. Results showed that the ultimate quantity of aerosols, their final particle size distributions, and depositions as a function of time are not identical mainly because of the different vapor pressures of the metals, and the unlike degrees of violence of the explosions of the droplets

  1. Measurement and calculation of the 233Pa fission cross-section for advanced fuel cycles

    International Nuclear Information System (INIS)

    The energy dependence of the neutron-induced fission cross-section of 233Pa has been measured directly for the first time from the fission threshold up to 8.5 MeV. This fission cross-section is a key ingredient in feasibility studies on fast reactors and accelerator driven systems based on the Th-U fuel cycle. The results are at strong variance with the existing evaluations. The new experimental data give lower cross-section values and resolve the question about the threshold energy. Additionally a new theoretical calculation of the reaction cross-section has been performed with the statistical model code STATIS, showing a very good agreement with the experimental data. (authors)

  2. 233U fuel production and 30-year utilization without reprocessing and refuelling using heavy water coolant

    International Nuclear Information System (INIS)

    This study examines the physics of a thorium fuel cycle based on generating the initial fissile (233U) fuel inventory in a Deuterium-Tritium fusion device and on operating a 600 MWth fission reactor. For both phases of the fuel cycle, the fuel form is an aqueous slurry consisting of thorium oxide micro-particles dispersed into heavy water. The slurry is the fuel carrier and the coolant. After 180 full power days in the fusion driven device, the fuel enrichment is 1.4%. The enrichments is defined as the ratio between the fissile actinides mass and the total actinides mass. After the removal of fission products, the 1.4% enriched slurry thorium-uranium fuel can be used for longer than 30 full power years in a 600 MWth critical reactor core, without adding any fissile material. The critical reactor has three zones: inner fissile, central fertile, and outer reflector. (author)

  3. Final characterization report for the non-process areas of the 233-S Plutonium Concentration Facility

    International Nuclear Information System (INIS)

    This report addresses the 233-S Plutonium Concentration Facility characterization survey data collected from January 21, 1997 through February 3, 1997. The characterization activities evaluated the radiological status and identified the hazardous materials locations. The scope of this report is limited to the nonprocess areas in the facility, which include the special work permit (SWP) change room, toilet, equipment room, electrical cubicle, control room, and pipe gallery. A portion of the roof (excluding the roof over the process hood and viewing room) was also included. Information in this report will be used to identify waste streams, provide specific chemical and radiological data to aid in planning decontamination and demolition activities, and allow proper disposal of the demolition debris, as required by the Comprehensive Environmental Response, Compensation, and Liability Act of 1980

  4. Batch extraction studies for the recovery of 233U from thoria irradiated in PHWR

    International Nuclear Information System (INIS)

    Batch equilibrium studies were carried out to optimise the extraction parameters for the recovery of 233U from thoria irradiated in PHWR. The thorium concentration and the acidity of the feed was adjusted to ca. 100 g/l and 4 M nitric acid respectively. The concentration of uranium was in the range of 1.4 g/L and it contained long lived fission product like 144Ce-144Pr, 134Cs, 137Cs, 106Ru-106Rh, 105Eu, 154Eu, 90Sr-90Y and 125Sb. 3% TBP in dodecane was used as the solvent. Four stages of batch extraction was followed by a single scrub stage of 4 M nitric acid. The scrubbed organic was stripped with 0.01 M HNO3 thrice. The stripped product was concentrated by evaporation and passed through a cation exchanger to remove the residual thorium. The results of the studies are discussed in detail. (author)

  5. Thermal-Neutron-Induced Fission of U235, U233 and Pu239

    International Nuclear Information System (INIS)

    We have used solid-state detectors to measure the kinetic energies of the coincident fission fragments in the thermal-neutron-induced fission of U235, U233 and Pu239. Special care has been taken to eliminate spurious-events near symmetry to give an accurate measure of such quantities as the average total kinetic energy at symmetry. For each fissioning system over 106 events were recorded. As a result the statistics are good enough to see definite evidence for fine structure over a wide range of masses and energies. The data have been analysed to give mass yield curves, average kinetic energies as a function of mass, and other quantities of interest. For each fissioning system the average total kinetic energy goes through a maximum for a heavy fragment mass of about 132 and for the corresponding light fragment mass. There is a pronounced minimum at symmetry, although not as deep as that found in time-of-flight experiments. The difference between the maximum average kinetic energy and that at symmetry is about 32 MeV for U235, 18 MeV for U233 and 20 MeV for Pu239. The dispersion of kinetic energies at symmetry is also smaller than that found in time-of-flight experiments. Fine structure is apparent in two different representations of the data. The energy spectrum of heavy fragments in coincidence with light fragment energies is greater than the most probable value. This structure becomes more pronounced as the light fragment energy increases. The mass yield curves for a given total kinetic energy show a structure suggesting a preference for fission fragments with masses ∼134, ∼140 and ∼145 (and their light fragment partners). Much of the structure observed can be understood by considering a semi-empirical mass surface and a simple model for the nuclear configuration at the saddle point. (author)

  6. Investigation of the fission yields of the fast neutron-induced fission of 233U

    International Nuclear Information System (INIS)

    As a stars, a survey of the different methods of investigations of the fission product yields and the experimental data status have been studied, showing advantages and shortcomings for the different approaches. An overview of the existing models for the fission product distributions has been as well intended. The main part of this thesis was the measurement of the independent yields of the fast neutron-induced fission of233U, never investigated before this work. The experiment has been carried out using the mass separator OSIRIS (Isotope Separator On-Line). Its integrated ion-source and its specific properties required an analysis of the delay-parameter and ionisation efficiency for each chemical species. On the other hand, this technique allows measurement of independent yields and cumulative yields for elements from Cu to Ba, covering most of the fission yield distribution. Thus, we measured about 180 independent yields from Zn (Z=30) to Sr (Z=38) in the mass range A=74-99 and from Pd (Z=46) to Ba (Z=56) in the mass range A=113-147, including many isomeric states. An additional experiment using direct γ-spectroscopy of aggregates of fission products was used to determine more than 50 cumulative yields of element with half-life from 15 min to a several days. All experimental data have been compared to estimates from a semi-empirical model, to calculated values and to evaluated values from the European library JEF 2.2. Furthermore, a study of both thermal and fast neutron-induced fission of 233U measured at Studsvik, the comparison of the OSIRIS and LOHENGRIN facilities and the trends in new data for the Reactors Physics have been discussed. (author)

  7. The role of natural organic matter in the migration behaviour of americium in the Boom Clay - Part 1: migration experiments

    International Nuclear Information System (INIS)

    Full text of publication follows: In demonstrating the suitability of Boom Clay as reference site for studying the disposal of radioactive waste, the role of the relatively high amount of Natural Organic Matter (NOM) present in the Boom Clay on the mobility of critical radionuclides needs to be investigated thoroughly. It is generally accepted that trivalent actinides and lanthanides form strong complexes with humic substances. Complexation of these trivalent radionuclides with NOM present in the Boom Clay may therefore have two opposite effects. If complexed by the aqueous phase NOM (the mobile NOM), the radionuclide transport will be governed by the mobility of these dissolved radionuclide- NOM species. If complexed by the solid phase NOM (the immobile NOM) the migration will be retarded. One of the aims of the EC projects TRANCOM-Clay and TRANCOM-II was to investigate the role of mobile NOM as radionuclide carrier in order to develop a conceptual model for inclusion in a performance assessment (PA) model. The migration behaviour of Americium (used as an analogue for the critical radionuclide Pu) was investigated by complexing 241Am with radiolabelled (14C-labelled) NOM before passing through undisturbed Boom Clay cores contained in columns. The use of two different radionuclides, allows the migration behaviour of both the NOM and the Am to be followed. The results of the migration experiments showed that the Am-NOM complexes dissociated when they came into contact with Boom Clay and that the bulk of Am became immobilised (either as Am complexed to immobile NOM or sorbed to the mineral phase). Only a small percentage of the complex persisted as 'stabilised' Am-OM complex which exhibited slow dissociation kinetics upon moving through the Boom Clay. When the applied radionuclide source also contains Am in the form of an inorganic solid phase (when Am is applied above the solubility limit), a continuous source of Am exists to form 'temporarily stabilised' Am

  8. Molten salt extraction (MSE) of americium from plutonium metal in CaCl2-KCl-PuCl3 and CaCl2-PuCl3 salt systems

    International Nuclear Information System (INIS)

    Molten salt extraction (MSE) of americium-241 from reactor-grade plutonium has been developed using plutonium trichloride salt in stationary furnaces. Batch runs with oxidized and oxide-free metal have been conducted at temperature ranges between 750 and 945C, and plutonium trichloride concentrations from one to one hundred mole percent. Salt-to-metal ratios of 0.10, 0.15, and 0 30 were examined. The solvent salt was either eutectic 74 mole percent CaCl2 endash 26 mole percent KCl or pure CaCl2. Evidence of trivalent product americium, and effects of temperature, salt-to-metal ratio, and oxide contamination on the americium extraction efficiency are given. 24 refs, 20 figs, 13 tabs

  9. Measurement of average cross section for Pa-233 (n, 2n) Pa-232 reaction to neutrons with fission-type reactor spectrum

    International Nuclear Information System (INIS)

    Among some nuclides concerning thorium fuel cycle, the reaction cross sections of Pa-233 should be thoroughly investigated because of its relatively long life of 27 days half life. In the present works, the average cross section for Pa-233(n,2n)Pa-232 reaction, which has been considered to contribute to the production of troublesome concomitant U-232, was initially measured using the Pa-233 specimen as pure as possible followed by the re-irradiation in a fission-type neutron spectrum. The purest Pa-233 was produced from the first thermal neutron irradiation of Th-oxide, which was selected from the viewpoint of low Th-230 content to avoid the production of bothering Pa-231 having a large cross section for thermal neutron capture reaction. The chemically isolated Pa-233 was immediately re-irradiated with reactor neutrons having fission-type reactor spectrum in KUR, along with some flux monitors for fast neutrons. After completely decaying out Pa-233 to U-233, the chemical purification of uranium was performed and the resultant uranium isotopes were analysed with an alpha-spectrometry. By using the activity ratios of U-232/U-233, the objective cross section was evaluated to be 52.1 mbarn with an estimated overall experimental error of 10 % after correcting the inevitable bypath reaction by small amount of Pa-231 content. (author)

  10. Plutonium, americium and radiocaesium in the marine environment close to the Vandellos I nuclear power plant before decommissioning

    International Nuclear Information System (INIS)

    The Vandellos nuclear power plant (NPP), releasing low-level radioactive liquid waste to the Mediterranean Sea, is the first to be decommissioned in Spain, after an incident which occurred in 1989. The presence, distribution and uptake of various artificial radionuclides (radiocaesium, plutonium and americium) in the environment close to the plant were studied in seawater, bottom sediments and biota, including Posidonia oceanica, fish, crustaceans and molluscs. Seawater, sediments and Posidonia oceanica showed enhanced levels in the close vicinity of the NPP, although the effect was restricted to its near environment. Maximum concentrations in seawater were 11.6±0.5 Bq m-3 and 16.9±1.2 mBq m-3 for 137Cs and 239,240Pu, respectively. When sediment concentrations were normalized to excess 210Pb, they showed both the short-distance transport of artificial radionuclides from the Vandellos plant and the long-distance transport of 137Cs from the Asco NPP. Posidonia oceanica showed the presence of various gamma-emitters attributed to the impact of the Chernobyl accident, on which the effect of the NPP was superimposed. Seawater, sediment and Posidonia oceanica collected near the plant also showed an enhancement of the plutonium isotopic ratio above the fallout value. The uptake of these radionuclides by marine organisms was detectable but limited. Pelagic fish showed relatively higher 137Cs concentrations and only in the case of demersal fish was the plutonium isotopic ratio increased. The reported levels constitute a set of baseline values against which the impact of the decommissioning operations of the Vandellos I NPP can be studied

  11. 29 CFR 2.33 - Responsibilities of DOL, DOL social service providers and State and local governments...

    Science.gov (United States)

    2010-07-01

    ... 29 Labor 1 2010-07-01 2010-07-01 true Responsibilities of DOL, DOL social service providers and... Organizations; Protection of Religious Liberty of Department of Labor Social Service Providers and Beneficiaries § 2.33 Responsibilities of DOL, DOL social service providers and State and local...

  12. 16 CFR 233.3 - Advertising retail prices which have been established or suggested by manufacturers (or other...

    Science.gov (United States)

    2010-01-01

    ... Practices FEDERAL TRADE COMMISSION GUIDES AND TRADE PRACTICE RULES GUIDES AGAINST DECEPTIVE PRICING § 233.3..., therefore, deceptive. Typically, a list price is a price at which articles are sold, if not everywhere, then... insubstantial volume of sales in the area, advertising of the list price would be deceptive. (g) On the...

  13. Health physics surveillance during recovery of 233U from irradiated thorium rods at reprocessing development lab, IGCAR

    International Nuclear Information System (INIS)

    Second campaign for the recovery of 233U from the irradiated rods from CIRUS and DHRUVA reactors at BARC, was carried out successfully at Reprocessing Development Laboratory (RDL) at Indira Gandhi Centre for Atomic Research (IGCAR). Health physics surveillance was provided all through the operation. The operational radiation protection methods followed and the experience gained during the campaign are discussed in this paper. (author)

  14. 45 CFR 233.34 - Computing the assistance payment in the initial one or two months (AFDC).

    Science.gov (United States)

    2010-10-01

    ... 45 Public Welfare 2 2010-10-01 2010-10-01 false Computing the assistance payment in the initial... § 233.34 Computing the assistance payment in the initial one or two months (AFDC). A State shall compute...) If the initial month is computed prospectively as in paragraph (a) of this section, the second...

  15. Heavy coolant fast neutron reactor BRUS-150 for minor actinides burning and U-233 build-up

    International Nuclear Information System (INIS)

    The present paper deals with the calculational research into the performance of fast reactor BRUS-150 cooled with liquid metal coolant eutectic lead-bismuth alloy with reference to minor actinides (Np, Am, Cm) transmutation and isotopic pure U 233 build up. (authors). 10 refs., 2 figs

  16. Determination by gamma-ray spectrometry of the plutonium and americium content of the Pu/Am separation scraps. Application to molten salts; Determination par spectrometrie gamma de la teneur en plutonium et en americium de produits issus de separation Pu/Am. Application aux bains de sels

    Energy Technology Data Exchange (ETDEWEB)

    Godot, A. [CEA Valduc, Dept. de Traitement des Materiaux Nucleaires, 21 - Is-sur-Tille (France); Perot, B. [CEA Cadarache, Dept. de Technologie Nucleaire, Service de Modelisation des Transferts et Mesures Nucleaires, 13 - Saint-Paul-lez-Durance (France)

    2005-07-01

    Within the framework of plutonium recycling operations in CEA Valduc (France), americium is extracted from molten plutonium metal into a molten salt during an electrolysis process. The scraps (spent salt, cathode, and crucible) contain extracted americium and a part of plutonium. Nuclear material management requires a very accurate determination of the plutonium content. Gamma-ray spectroscopy is performed on Molten Salt Extraction (MSE) scraps located inside the glove box, in order to assess the plutonium and americium contents. The measurement accuracy is influenced by the device geometry, nuclear instrumentation, screens located between the sample and the detector, counting statistics and matrix attenuation, self-absorption within the spent salt being very important. The purpose of this study is to validate the 'infinite energy extrapolation' method employed to correct for self-attenuation, and to detect any potential bias. We present a numerical study performed with the MCNP computer code to identify the most influential parameters and some suggestions to improve the measurement accuracy. A final uncertainty of approximately 40% is achieved on the plutonium mass. (authors)

  17. Recovery of plutonium and americium from laboratory acidic waste solutions using tri-n-octylamine and octylphenyl-N-N- diisobutylcarbamoylmethylphosphine oxide.

    Science.gov (United States)

    Michael, K M; Rizvi, G H; Mathur, J N; Kapoor, S C; Ramanujam, A; Iyer, R H

    1997-11-01

    Plutonium from acidic waste solutions has been recovered quantitatively using tri-n-octylamine (TnOA) in xylene and americium using a mixture of octylphenyl-N-N- diisobutylcarbamoylmethylphosphine oxide (CMPO) and TBP in dodecane by extraction and extraction chromatographic methods. The Pu ( IV ) TnOA species extracted into the organic phase from higher nitric acid concentrations has been confirmed as (R(3)NH)(2)Pu(NO(3))(6) (where R(3)N = TnOA by employing slope analysis as well as spectrophotometric studies. PMID:18966958

  18. Theoretical investigation of pressure-induced structural transitions in americium using GGA+U and hybrid density functional theory methods

    DEFF Research Database (Denmark)

    Verma, Ashok K.; Modak, P.; Sharma, Surinder M.;

    2013-01-01

    First-principles calculations have been performed for americium (Am) metal using the generalized gradient approximation + orbital-dependent onsite Coulomb repulsion via Hubbard interaction (GGA+U) and hybrid density functional theory (HYB-DFT) methods to investigate various ground state properties...... phase in order to match the experimental data. Thus, neither the GGA+U nor the HYB-DFT methods are able to describe the energetics of Am metal properly in the entire pressure range from 0 GPa to 50 GPa with a single choice of their respectiveU and α parameters. Low binding-energy peaks in the...

  19. Dissertation on the computer-based exploitation of a coincidence multi parametric recording. Application to the study of the disintegration scheme of Americium 241

    International Nuclear Information System (INIS)

    After having presented the meaning of disintegration scheme (alpha and gamma emissions, internal conversion, mean lifetime), the author highlights the benefits of the use of multi-parametric chain for the recording of correlated parameters, and of the use of a computer for the analysis of bi-parametric information based on contour lines. Using the example of Americium 241, the author shows how these information are obtained (alpha and gamma spectrometry, time measurement), how they are chosen, coded, analysed and stored, and then processed by contour lines

  20. Uptake of curium (244Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    International Nuclear Information System (INIS)

    Curium (244Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium. (author)

  1. Uptake of curium (/sup 244/Cm) by five benthic marine species (Arenicola marina, Cerastoderma edule, Corophium volutator, Nereis diversicolor and Scrobicularia plana): comparison with americium and plutonium

    Energy Technology Data Exchange (ETDEWEB)

    Miramand, P.; Germain, P.; Arzur, J.C.

    1987-01-01

    Curium (/sup 244/Cm) uptake from contaminated sea water was studied in five benthic marine species: two bivalve molluscs (Scrobicularia plana and Cerastoderma edule), two polychaete annelids (Arenicola marina and Nereis diversicolor) and one amphidpod crustacean (Corophium volutator). The concentrations in the whole organisms relative to the concentration in the sea water (concentration factors) were: 700 for the amphipods (after 11 d of accumulation), 140 for the cockles (after 28 d), 80 for the scrobicularia (after 23d) and approx. 30 for the two annelids (after > 20 d). All species except S. plana accumulated americium and curium similarly; S. plana accumulated similar amounts of curium and plutonium.

  2. Application of the SCALE TSUNAMI Tools for the Validation of Criticality Safety Calculations Involving 233U

    Energy Technology Data Exchange (ETDEWEB)

    Mueller, Don [ORNL; Rearden, Bradley T [ORNL; Hollenbach, Daniel F [ORNL

    2009-02-01

    The Radiochemical Development Facility at Oak Ridge National Laboratory has been storing solid materials containing 233U for decades. Preparations are under way to process these materials into a form that is inherently safe from a nuclear criticality safety perspective. This will be accomplished by down-blending the {sup 233}U materials with depleted or natural uranium. At the request of the U.S. Department of Energy, a study has been performed using the SCALE sensitivity and uncertainty analysis tools to demonstrate how these tools could be used to validate nuclear criticality safety calculations of selected process and storage configurations. ISOTEK nuclear criticality safety staff provided four models that are representative of the criticality safety calculations for which validation will be needed. The SCALE TSUNAMI-1D and TSUNAMI-3D sequences were used to generate energy-dependent k{sub eff} sensitivity profiles for each nuclide and reaction present in the four safety analysis models, also referred to as the applications, and in a large set of critical experiments. The SCALE TSUNAMI-IP module was used together with the sensitivity profiles and the cross-section uncertainty data contained in the SCALE covariance data files to propagate the cross-section uncertainties ({Delta}{sigma}/{sigma}) to k{sub eff} uncertainties ({Delta}k/k) for each application model. The SCALE TSUNAMI-IP module was also used to evaluate the similarity of each of the 672 critical experiments with each application. Results of the uncertainty analysis and similarity assessment are presented in this report. A total of 142 experiments were judged to be similar to application 1, and 68 experiments were judged to be similar to application 2. None of the 672 experiments were judged to be adequately similar to applications 3 and 4. Discussion of the uncertainty analysis and similarity assessment is provided for each of the four applications. Example upper subcritical limits (USLs) were

  3. Investigation of solubility of cesium, strontium, barium, rare-earth, uranium and americium fluorides in acid nitrosyl fluoride (NOFx3HF)

    International Nuclear Information System (INIS)

    Solubility of Am and other elements, which are fission products, in acid nitrosylfluoride has been studied. Cesium fluoride has maximum solubility; uranium tetrafluoride is also noticeably soluble; americium trifluoride is practically insoluble; fluorides of rare earth elements are slightly soluble in NOFx3HF. Analysis of the solid phase obtained after treating the mixture of the above fluorides with acid nitrosylfluoride has shown that cesium fluoride reacts with NOFx3HF with the formation of an acid salt (CsFxHF), whereas fluorides of alkaline and rare earth elements remain unchanged. The behaviour of a mixture of cesium, barium, and lanthanum fluorides in the process of three-multiple treating with acid nitrosylfluoride has been studied. It is shown that more than 98% of cesium fluoride and 5% of barium fluoride pass into the mother liquor while lanthanum fluoride remains completely in the solid phase. The data on americium fluoride solubility in acid nitrosylfluoride have indicated that it behaves in the same way as fluorides of rare earth elements; it is practically insoluble in HOFx3HF

  4. Determining the americium transmutation rate and fission rate by post-irradiation examination within the scope of the ECRIX-H experiment

    International Nuclear Information System (INIS)

    The ECRIX-H experiment aims to assess the feasibility of transmuting americium micro-dispersed in an inert magnesia matrix under a locally moderated neutron flux in the Phénix reactor. A first set of examinations demonstrated that pellet behaviour was satisfactory with moderate swelling at the end of the irradiation. Additional post-irradiation examinations needed to be conducted to confirm the high transmutation rate so as to definitively conclude on the success of the ECRIX-H experiment. This article presents and discusses the results of these new examinations. They confirm the satisfactory behaviour of the MgO matrix not only during the basic irradiation but also during post-irradiation thermal transients. These examinations also provide additional information on the behaviour of fission products both in the americium-based particles and in the MgO matrix. These results particularly validate the transmutation rate predicted by the calculation codes using several different analytical techniques. The fission rate is also determined

  5. Measurement of neutron capture and fission cross sections of 233U in the resonance region

    Directory of Open Access Journals (Sweden)

    Tsekhanovich I.

    2012-02-01

    Full Text Available In the framework of studies concerning new fuel cycles and nuclear wastes incineration experimental data of the α ratio between capture and fission cross sections of 233U reactions play an important role in the Th/U cycle. The safety evaluation and the detailed performance assessment for the generation IV nuclear-energy system based on 232Th cycle strongly depend on this ratio. Since the current data are scarce and sometimes contradictory, new experimental studies are required. The measurement will take place at the neutron time-of-flight facility GELINA at Geel, designed to perform neutron cross section measurements with high incident neutron-energy resolution. A dedicated high efficiency fission ionization chamber (IC as fission fragment detector and six C6D6 liquid scintilators sensitive to γ-rays and neutrons will be used. The method, based on the IC energy response study, allowing to distinguish between gammas originating from fission and capture, in the resonance region, will be presented.

  6. Numbers of prompt neutrons per fission for U233, U235, Pu239, and Cf252

    International Nuclear Information System (INIS)

    An absolute measurement of #-v#, the average number of prompt neutrons emitted per fission, is being made for the spontaneous fission of Cf262. The relative values of #-v# are being measured for neutron-induced fission of U233, U235, and Pu239, and are being compared with the spontaneous fission #-v# of Cf252. Neutrons with energies between thermal and 15 MeV are used. Particular emphasis is put on studying the dependence of #-v# on the incident neutron energy. A fission counter containing the appropriate isotope is placed in the centre of a large cadmium-loade d liquid scintillator. Through the fissionable isotope is passed a collimated beam of neutrons. Fission events, identified by pulses from the fission counter, open an electronic gate between the large liquid scintillator and a scaler. Scintillator pulses due to capture in the scintillating solution of thermalized fission neutrons are counted during the gate. The fission neutrons are detected almost independently of energy and with very high efficiency. With this technique values of #-v# to an accuracy of 1 % are expected. (author)

  7. Site-Specific Health and Safety Plan, 233-S Decontamination and Decommissioning

    International Nuclear Information System (INIS)

    The 233-S Facility operated from January 1952 until July 1967, at which time the building entered the U.S. Department of Energy's Surplus Facility Management Program as a retired facility. The facility has since undergone severe degradation due to exposure to extreme weather conditions. A freeze and thaw cycle occurred at the Hanford Site during February 1996, which caused cracking failure of portions of the building roof. This resulted in significant infiltration of water into the facility, which creates a pathway for potential release of radioactive material into the environment (air and/or ground). Additionally, the weather caused existing cracks in concrete structures of the building to lengthen, thereby increasing the potential for failed confinement of the building's radioactive material. Differential settlement has also occurred, causing portions of the facility to separate from the main building structure, increasing the potential for release of radioactive material to the environment. An expedited response is proposed to remove this threat and ensure protection of human health and the environment

  8. Measurements of neutron induced capture and fission reactions on $^{233}$ U (EAR1)

    CERN Multimedia

    The $^{233}$U plays the essential role of ssile nucleus in the Th-U fuel cycle, which has been proposed as a safer and cleaner alternative to the U-Pu fuel cycle. Considered the scarce data available to assess the capture cross section, a measurement was proposed and successfully performed at the n_TOF facility at CERN using the 4$\\pi$ Total Absorp- tion Calorimeter (TAC). The measurement was extremely dicult due to the need to accurately distinguish between capture and fission $\\gamma$-rays without any additional discrim-ination tool and the measured capture cross section showed a signicant disagreement in magnitude when compared with the ENDF/B-VII.1 library despite the agreement in shape. We propose a new measurement that is aimed at providing a higher level of dis-crimination between competing nuclear reactions, to extend the neutron energy range and to obtain more precise and accurate data, thus fullling the demands of the "NEA High Priority Nuclear Data Request List". The setup is envisaged as a combin...

  9. Thermoionic emission characteristics of uranium with application to its determination by MSID technique using 233U tracer

    International Nuclear Information System (INIS)

    Experimental details of the uranium determination in geological samples (50-1500 ppm range) by mass spectrometric isotope dilution technique (MSID) employing 233U tracer are presented. For this purpose the thermoionic emission characteristics of uranium in various filament arrangements like simple plane, filament boat, double, are studied and the most efficient one selected for the isotope dilution analysis. The various experimental procedures involved in the MSID like sample dissolution, chemical separation and mass spectrometric analysis are developed and optimised. The experimental results on the uranium determination by MSID with 233U tracer yielded precision and accuracy of 0,5% and 1% respectively. The importance of the sampling in the precise and accuracy determination of uranium in geological samples, where it is heterogeneously distributed, is discussed. (author)

  10. Qualification and initial characterization of a high-purity 233U spike for use in uranium analyses

    International Nuclear Information System (INIS)

    Several high-purity 233U items potentially useful as isotope dilution mass spectrometry standards for safeguards, non-proliferation, and nuclear forensics measurements are identified and rescued from downblending. By preserving the supply of 233U materials of different pedigree for use as source materials for certified reference materials (CRMs), it is ensured that the safeguards community has high quality uranium isotopic standards required for calibration of the analytical instruments. One of the items identified as a source material for a high-purity CRM is characterized for the uranium isotope-amount ratios using thermal ionization mass spectrometry (TIMS). Additional verification measurements on this material using quadrupole inductively coupled plasma mass spectrometry (ICPMS) are also performed. As a result, the comparison of the ICPMS uranium isotope-amount ratios with the TIMS data, with much smaller uncertainties, validated the ICPMS measurement practices. ICPMS is proposed for the initial screening of the purity of items in the rescue campaign

  11. ALARA Review of the Activation/Repair of Fire Detectors in Zone Three at the 233-S Facility

    International Nuclear Information System (INIS)

    A formal as low as reasonably achievable (ALARA) review is required by BHI-SH-02, Vol. 1, Procedure 1.22, 'Planning Radiological Work', when radiological conditions exceed trigger levels. The level of contamination inside the viewing room meets this criterion. This ALARA review is for task instruction 1997-03-18-005-8.3.3 (mini task instruction to a living work package), 'Instructions for D ampersand D Support of Fire Detector Troubleshooting and Minor Maintenance Work at 233-S,' and DynCorp 2G-98-7207C, '233-S Reconnect Smoke Detectors Zone 3.' The Radiological Work Permit (RWP) request broke these two task instructions into four separate tasks. The four tasks identified in the RWP request were used to estimate airborne concentrations and the total exposure

  12. Determination of the 233Pa(n,f) reaction cross-section for thorium-fuelled reactors

    International Nuclear Information System (INIS)

    A direct measurement of the energy-dependent neutron-induced fission cross-section of 233Pa has been performed for the first time. The 233Pa isotope plays a key role in the thorium fuel cycle, serving as an intermediate isotope in the formation of the uranium fuel material. Since fission is one of the reactions determining the balance of nuclei at a given time, the cross-section is of vital importance for any calculation of a thorium-fuel-based nuclear-power device. In a first measurement series, four energies between 1.0 and 3.0 MeV were measured. The resulting average above-threshold cross-section found is lower than all literature values. (authors)

  13. Cross sections and neutron yields for U233, U235 and Pu239 at 2200 m/sec

    International Nuclear Information System (INIS)

    The experimental information on the 2200 m/sec values for σabs, σf, α, ν and η for 233U , 235U and 23 been collected and discussed. The values will later be used in an evaluation of a 'best' set of data. In appendix the isotopic abundances of the uranium isotopes are discussed and also the alpha activities of the uranium isotopes and Pu-239

  14. Photofission cross sections of U-233 and Pu-239 near threshold induced by gamma-rays from thermal neutron capture

    International Nuclear Information System (INIS)

    The photofission cross sections of U-233 and PU-239 have been studied using monochromatic photons produced by thermal neutron capture in several materials placed in a radial beam hole of the IEA-R1, 2 MW pool type research reactor, in the energy interval from 5.43 MeV to 9.72 MeV. The gamma flux incident on the samples were measured using a (3X3) inch. NaI(Tl) crystal. The photofission fragments were detected in MAKROFOL-KG (solid state nuclear track detector) etched 30 min. in a KOH (35%wt) solution at 600C. The efficiency of the detector was obtained using a Californium-252 calibrated source and its value was (0.4323 ± 3%). The tracks were counted by means of an automatic spark counting. Analyzing the photofission data we have observed similarities between the cross sections obtained for the two samples in comparison with other authors. A structure was also observed in the U-233 cross section near the energy of 7.23 MeW. Acoording to the liquid drop model the height of the simple fission barrier were determined: (5.6 ± 0.2) MeV and (5.7 ± 0.2) MeV for U-233 and Pu-239 respectively. The relative fissionability of the samples to U-238 were also determined in each excitation energy and showed to be energy independent: (2.12 +-0.25) for U-233, and (3.32+-0.41) for Pu-239. (author)

  15. Defense In-Depth Accident Analysis Evaluation of Tritium Facility Bldgs. 232-H, 233-H, and 234-H

    International Nuclear Information System (INIS)

    'The primary purpose of this report is to document a Defense-in-Depth (DID) accident analysis evaluation for Department of Energy (DOE) Savannah River Site (SRS) Tritium Facility Buildings 232-H, 233-H, and 234-H. The purpose of a DID evaluation is to provide a more realistic view of facility radiological risks to the offsite public than the bounding deterministic analysis documented in the Safety Analysis Report, which credits only Safety Class items in the offsite dose evaluation.'

  16. Study of (n,p) and (n,α) cross-sections for 232Th, 231Pa, 233U isotopes

    International Nuclear Information System (INIS)

    The study of neutron induced reaction cross-sections in the charged particle emission in this energy region will help us to understand the energy dependence of activation cross-sections in detail, thereby providing a complete database that will lead to better understanding of mechanisms of the nuclear reactions. The present study describes nuclear model calculations of (n,p) and (n,α) reaction cross-sections for 232Th, 231Pa and 233U isotopes

  17. Molecular Gas and Dust in the Massive Star Forming Region S 233 IR

    Institute of Scientific and Technical Information of China (English)

    Rui-Qing Mao; Qin Zeng

    2004-01-01

    The massive star forming region S 233 IR is observed in the molecular lines CO J = 2-1, 3-2, NH3 (1,1), (2,2) and the 870μm dust continuum. Four submillimeter continuum sources, labelled SMM 1-4, are revealed in the 870μm dust emission. The main core, SMM1, is found to be associated with a deeply embedded near infrared cluster in the northeast; while the weaker source SMM2 coincides with a more evolved cluster in the southwest. The best fit spectral energy distribution of SMM1 gives an emissivity ofβ = 1.6, and temperatures of 32 K and 92 K for the cold- and hot-dust components. An SMM1 core mass of 246 M⊙ and a total mass of 445 M⊙ are estimated from the 870 μm dust continuum emission.SMM1 is found to have a temperature gradient decreasing from inside out, indicative of the presence of interior heating sources. The total outflow gas mass as traced by the CO J - 3-2 emission is estimated to be 35 M⊙. Low velocity outflows are also found in the NH3 (1,1) emission. The non-thermal dominant NH3 line width as well as the substantial core mass suggest that the SMM1 core is a "turbulent,massive dense core", in the process of forming a group or a cluster of stars. The much higher star formation efficiency found in the southwest cluster supports the suggestion that this cluster is more evolved than the northeast one. Large near infrared photometric variations found in the source PCS-IR93, a previously found highly polarized nebulosity, indicate an underlying star showing the FU Orionis type of behavior.

  18. Neutronic optimization in high conversion Th-233U fuel assembly with simulated annealing

    International Nuclear Information System (INIS)

    This paper reports on fuel design optimization of a PWR operating in a self sustainable Th-233U fuel cycle. Monte Carlo simulated annealing method was used in order to identify the fuel assembly configuration with the most attractive breeding performance. In previous studies, it was shown that breeding may be achieved by employing heterogeneous Seed-Blanket fuel geometry. The arrangement of seed and blanket pins within the assemblies may be determined by varying the designed parameters based on basic reactor physics phenomena which affect breeding. However, the amount of free parameters may still prove to be prohibitively large in order to systematically explore the design space for optimal solution. Therefore, the Monte Carlo annealing algorithm for neutronic optimization is applied in order to identify the most favorable design. The objective of simulated annealing optimization is to find a set of design parameters, which maximizes some given performance function (such as relative period of net breeding) under specified constraints (such as fuel cycle length). The first objective of the study was to demonstrate that the simulated annealing optimization algorithm will lead to the same fuel pins arrangement as was obtained in the previous studies which used only basic physics phenomena as guidance for optimization. In the second part of this work, the simulated annealing method was used to optimize fuel pins arrangement in much larger fuel assembly, where the basic physics intuition does not yield clearly optimal configuration. The simulated annealing method was found to be very efficient in selecting the optimal design in both cases. In the future, this method will be used for optimization of fuel assembly design with larger number of free parameters in order to determine the most favorable trade-off between the breeding performance and core average power density. (authors)

  19. Inhaled americium dioxide

    International Nuclear Information System (INIS)

    This project includes experiments to determine the effects of Zn-DTPA therapy on the retention, translocation and biological effects of inhaled 241AmO2. Beagle dogs that received inhalation exposure to 241AmO2 developed leukopenia, clincial chemistry changes associated with hepatocellular damage, and were euthanized due to respiratory insufficiency caused by radiation pneumonitis 120 to 131 days after pulmonary deposition of 22 to 65 μCi 241Am. Another group of dogs that received inhalation exposure to 241AmO2 and were treated daily with Zn-DTPA had initial pulmonary deposition of 19 to 26 μCi 241Am. These dogs did not develop respiratory insufficiency, and hematologic and clinical chemistry changes were less severe than in the non-DTPA-treated dogs

  20. Fc Gamma Receptor 3B (FCGR3Bc.233C>A-rs5030738) Polymorphism Modifies the Protective Effect of Malaria Specific Antibodies in Ghanaian Children

    DEFF Research Database (Denmark)

    Adu, Bright; Jepsen, Micha Phill Grønholm; Gerds, Thomas A;

    2014-01-01

    Immunoglobulin G (IgG) cross-linking with Fc gamma receptor IIIB (FcγRIIIB) triggers neutrophil degranulation, releasing reactive oxygen species with high levels associated with protection against malaria. The FCGR3B-c.233C>A polymorphism thought to influence the interaction between IgG and FcγRI....../AC individuals compared with 233CC children. This genotype related effect modification may significantly influence malaria sero-epidemiological and vaccine trial studies....

  1. Partitioning studies in China and the separation of americium and fission product rare earths with dialkyl phosphinic acid and its thio-substituted derivatives

    International Nuclear Information System (INIS)

    Studies on the TRPO extractions process for recovering actinides from highly active waste (HAW) and its application to the pretreatment of Chinese HAW are described. The removal of Sr by di-cyclohexyl 18 crown 6 and the removal of Cs by spherical titanium ferrous hexa-cyanate from acidic waste are also described. Results of the extraction of trivalent americium and fission product rare earths (FPREs) by dialkyl-phosphinic, dialkyl-mono-thio-phosphinic and dialkyl-di-thio-phosphinic acids are reported. Dialkyl-thio-phosphinic acid (commercial product Cyanex 301, alkyl =2, 4, 4-methyl-pentyl) shows very high selectivity towards Am. Using 1M Cyanex 301 -kerosene as extractant, 99.9 % Am can be separated from 0.5M(Pr+Nd)(NO3)3 solution with 3-4 extraction stages and 3-4 scrubbing stages. (authors)

  2. Theoretical and experimental study of the bio-geochemical behaviour of americium 241 in simplified rhizosphere conditions. Application to a calcareous agricultural soil

    International Nuclear Information System (INIS)

    Americium 241, is one of the most radio-toxic contaminant produced during the nuclear fuel cycle. It can be found in all environmental compartments, in particular the soils. The main goals of this study are to identify, quantify and model the effect of the main factors controlling the mobility of 241Am in the rhizosphere and the agricultural soils. The physico-chemical parameters of the soil and of the soil solution, the potential role of microorganisms on the sorption-desorption processes, and the speciation of americium in solution have been more particularly studied. 241Am remobilization has been studied at the laboratory using leaching experiments performed in controlled conditions on reworked calcareous soils artificially contaminated with 241Am. The soil samples have been washed out in different hydrodynamic conditions by solutions with various compositions. The eluted solution has been analyzed (pH, conductivity, ionic composition, Fetot, organic acids, 241Am) and its bacterial biomass content too. The overall results indicate that 241Am remobilization is contrasted and strongly linked with the condition under study (pH, ionic strength, glucose and/or citrate concentration). Therefore, a solution in equilibrium with the soil or containing small exudate concentrations (10-4 M) re-mobilizes only a very small part of the americium fixed on the solid phase. The desorption of 241Am corresponds to a solid/liquid coefficient of partition (Kd) of about 105 L.kg-1. A significant addition of glucose induces an important dissolution of soil carbonates by the indirect action of microorganisms, but does not significantly favor the 241Am remobilization. On the other hand, the presence of strong citrate concentrations (≥ 10-2 M) allows 300 to 10000 time greater re-mobilizations by the complexing of 241Am released after the dissolution of the carrying phases. Finally, the colloidal transport of 241Am has been systematically observed in a limited but significant extend and

  3. An evaluation of the VM/VF ratio to standard UO2 and MOX fuel with 4,5% enrichment and 1% of americium insertion

    International Nuclear Information System (INIS)

    A growing interest exists in the development of techniques for burning and transmuting minor actinides. Some indicate the possibility of differentiated burnup when studying different VM/VF. The VM/VF ratio, moderator volume/fuel volume, is directly related with the value obtained for the multiplication factor k. There is a VM/VF for which k is maximum, and this is directly related with the fuel composition. This work is a study to find a better value of VM/VF, using the WIMS-D5 code, considering a UO2 fuel and a MOX fuel, with 1% Americium insertion. The following parameters were appraised: spectrum hardening, boron worth, and reactivity temperature coefficients. (author)

  4. Recovery of Americium-241 from lightning rod by the method of chemical treatment; Recuperacion del Americio-241 provenientes de los pararrayos por el metodo de tratamiento quimico

    Energy Technology Data Exchange (ETDEWEB)

    Cruz, W.H., E-mail: wcruz@ipen.gob.pe [Instituto Peruano de Energia Nuclear (GRRA/IPEN), Lima (Peru). Division de Gestion de Residuos Radiactivos

    2013-07-01

    About 95% of the lightning rods installed in the Peruvian territory have set in their structures, pose small amounts of radioactive sources such as Americium-241 ({sup 241}Am), fewer and Radium 226 ({sup 226}Ra) these are alpha emitters and have a half life of 432 years and 1600 years respectively. In this paper describes the recovery of radioactive sources of {sup 241}Am radioactive lightning rods using the conventional chemical treatment method using agents and acids to break down the slides. The {sup 241}Am recovered was as excitation source and alpha particle generator for analysing samples by X Ray Fluorescence, for fixing the stainless steel {sup 241}Am technique was used electrodeposition. (author)

  5. Preliminary application of 241-Americium calcaneus bone mineral density measurement in osteoporosis. Comparison with double X-ray densitometry of the lumber spine

    International Nuclear Information System (INIS)

    Bone mineral density (BMD) of calcaneus in 54 normals, 45 Osteoporosis, 25 suspected osteoporosis and 16 other non-osteoporosis patients, a total of 140 cases were measured by HUAKE (HK-1) 241-Americium BMD absorpmetry, among them 43 were compared with that of lumber spine (L2 - L4) measured by Lunar Corporation's Expert-XL absorpmeter. BMD of normal group of calcaneus was (409.8 +- 79.4) mg/cm2. The BMD were decreased slowly with the increasing age. The BMD of osteoporosis, suspected osteoporosis and non-osteoporosis group were 230.3 +- 62.3, 395.7 +- 57.4 and 363.3 +- 51.9 mg/cm2 respectively. The BMD of osteoporosis group was much lower than that of normal group, and also lower than that of the other two groups, among 26 patients (57.78%) had bone fracture, all was in accordance with the clinical diagnosis of osteoporosis. The BMD of suspected osteoporosis and non-osteoporosis had no significant difference with normal group. The coefficient variation (CV) of BMD in repeated measurement in calcaneus of 4 participants was less than 1.2%. The correlative coefficient (r) between BMD of calcaneus and lumber spine (L2 - L4) group was 0.6824. The correlative coefficient of normal young adult-matched percentage and T value in 2 groups were 0.6863 and 0.6755 respectively, whereas aged-matched percentage, Z value were 0.4614 and 0.5009 respectively. In conclusion 241-Americium calcaneus BMD absorpmetry has the advantage of low price, easy to operate, reliable and valuable in diagnosis osteoporosis. The correlations of calcaneus and lumber spine BMD, normal young adult-matched percentage and T value were rather good

  6. Safe handling of kilogram amounts of fuel-grade plutonium and of gram amounts of plutonium-238, americium-241 and curium-244

    International Nuclear Information System (INIS)

    During the past 10 years about 600 glove-boxes have been installed at the Institute for Transuranium Elements at Karlsruhe. About 80% of these glove-boxes have been designed and equipped for handling 100-g to 1-kg amounts of 239Pu containing 8-12% 240Pu (low-exposure plutonium). A small proportion of the glove-boxes is equipped with additional shielding in the form of lead sheet or lead glass for work with recycled plutonium. In these glove-boxes gram-amounts of 241Am have also been handled for preparation of Al-Am targets using tongs and additional shielding inside the glove-boxes themselves. Water- and lead-shielded glove-boxes equipped with telemanipulators have been installed for routine work with gram-amounts of 241Am, 243Am and 244Cm. A prediction of the expected radiation dose for the personnel is difficult and only valid for a preparation procedure with well-defined preparation steps, owing to the fact that gamma dose-rates depend strongly upon proximity and source seize. Gamma radiation dose measurements during non-routine work for 241Am target preparation showed that handling of gram amounts leads to a rather high irradiation dose for the personnel, despite lead or steel glove-box shielding and shielding within the glove-boxes. A direct glove-hand to americium contact must be avoided. For all glove-handling of materials with gamma radiation an irradiation control of the forearms of the personnel by, for example, thermoluminescence dosimeters is necessary. Routine handling of americium and curium should be executed with master-slave equipment behind neutron and gamma shielding. (author)

  7. Investigation of tritium and 233U breeding in a fission-fusion hybrid reactor fuelling with ThO2

    International Nuclear Information System (INIS)

    In the world, thorium reserves are three times more than natural Uranium reserves. It is planned in the near future that nuclear reactors will use thorium as a fuel. Thorium is not a fissile isotope because it doesn't make fission with thermal neutrons so it could be converted to 233U isotope which has very high quality fission cross-section with thermal neutrons. 233U isotope can be used in present LWRs as an enrichment fuel. In the fusion reactors, tritium is the most important fossil fuel. Because tritium is not natural isotope, it has to be produced in the reactor. The purpose of this work is to investigate the tritium and 233U breeding in a fission-fusion hybrid reactor fuelling with ThO2 for Δt=10 days during a reactor operation period in five years. The neutronic analysis is performed on an experimental hybrid blanket geometry. In the center of the hybrid blanket, there is a line neutron source in a cylindrical cavity, which simulates the fusion plasma chamber where high energy neutrons (14.1 MeV) are produced. The conventional fusion reaction delivers the external neutron source for blankets following, 2D + 3T →? 4He (3.5 MeV) + n (14.1 MeV). (1) The fuel zone made up of natural-ThO2 fuel and it is cooled with different coolants. In this work, five different moderator materials, which are Li2BeF4, LiF-NaF-BeF2, Li20Sn80, natural Lithium and Li17Pb83, are used as coolants. The radial reflector, called tritium breeding zones, is made of different Lithium compounds and graphite in sandwich structure. In the work, eight different Lithium compounds were used as tritium breeders in the tritium breeding zones, which are Li3N, Li2O, Li2O2, Li2TiO3, Li4SiO3, Li2ZrO3, LiBr and LiH. Neutron transport calculations are conducted in spherical geometry with the help of SCALE4.4A SYSTEM by solving the Boltzmann transport equation with code CSAS and XSDRNPM, under consideration of unresolved and resolved resonances, in S8-P3 approximation with Gaussian quadratures using

  8. Neutron-induced fission cross section of 233Pa between 1.0 and 3.0 MeV.

    Science.gov (United States)

    Tovesson, F; Hambsch, F J; Oberstedt, A; Fogelberg, B; Ramström, E; Oberstedt, S

    2002-02-11

    The energy dependent neutron-induced fission cross section of 233Pa has for the first time been measured directly with monoenergetic neutrons. This nuclide is an important intermediary in a thorium based fuel cycle, and its fission cross section is a key parameter in the modeling of future advanced fuel and reactor concepts. A first experiment resulted in four cross section values between 1.0 and 3.0 MeV, establishing a fission threshold in excess of 1 MeV. Significant discrepancies were found with a previous indirect experimental determination and with model estimates. PMID:11863801

  9. Photonuclear reactions of U-233 and Pu-239 near threshold induced by thermal neutron capture gamma rays

    International Nuclear Information System (INIS)

    The photonuclear cross sections of U-293 and Pu-239 have been studied by using monochromatic and discrete photons, in the energy interval from 5.49 to 9.72 MeV, produced by thermal neutron capture. The gamma fluxes incident on the samples were measured using a ( 3 x 3 )'' NaI (TI) crystal. The photofission fragments were detected in Makrofol-Kg (SSNTD). A possible structure was observed in the U-233 cross sections, near 7.23 MeV. The relative fissionability of the nuclides was determined at each excitation energy and shown to be energy independent: ( 2.12 ± 0.25) for U-233 and ( 3.32 ± 0.41 ) for Pu-239. The angular distribution of photofission fragments of Pu-239 were measured at two mean excitation energies of 5.43 and 7.35 MeV. An anisotropic distribution of ( 12.2 ± 3.6 ) % was observed at 5.43 MeV. The total neutron cross sections were measured by using a long counter detector. The photoneutron cross sections were calculated by using energy dependent neutron multiplicities values, γ(E), obtained in the literature. The competition Γn/γf was also determined at each excitation energy, and shown to be energy independent: ( 0.54 ± 0.05 ) for U-233 and ( 0.44 ± 0.05 ) for Pu-239, and were correlated to the parameters Z sup(2)/A, ( Ef'-Bn'), A. According to the FUJIMOTO-YAMAGUCHI and CONSTANT NUCLEAR TEMPERATURE models, the nuclear temperatures were calculated. The total photoabsorption cross sections were also calculated as a sum of the photofission and photoneutron cross sections at each energy excitation. From these results the competition Γf/ΓA, called fission probability Pf, were obtained: ( 0.66 ± 0.02) for U-233 and ( 0.70 ± 0.02 ) for Pu-239. (author)

  10. Fractional independent yields of 141La and 142La from thermal-neutron-induced fission of 233U

    International Nuclear Information System (INIS)

    The fractional independent yields of 141La and 142La from thermal-neutron-induced fission of 233U were found to be 0.026 +- 0.006 and 0.068 +- 0.010, respectively. These yields are consistent with charge distributions for which σ = 0.56 +- 0.02 and 0.52 +- 0.02, respectively. These results are in good agreement with similar yields measured for fission of 235U, but not with those from fission of 249Cf. (author)

  11. Neutron-induced fission cross section of 233Pa between 1.0 and 3.0 MeV

    International Nuclear Information System (INIS)

    The energy dependent neutron-induced fission cross section of P233a has for the first time been measured directly with monoenergetic neutrons. This nuclide is an important intermediary in a thorium based fuel cycle, and its fission cross section is a key parameter in the modeling of future advanced fuel and reactor concepts. A first experiment resulted in four cross section values between 1.0 and 3.0 MeV, establishing a fission threshold in excess of 1 MeV. Significant discrepancies were found with a previous indirect experimental determination and with model estimates

  12. Fission, total and neutron capture cross section measurements at ORELA for {sup 233}U, {sup 27}Al and natural chlorine

    Energy Technology Data Exchange (ETDEWEB)

    Guber, K.H.; Spencer, R.R.; Leal, L.C.; Larson, D.C.; Santos, G. Dos; Harvey, J.A.; Hill, N.W.

    1998-08-01

    The authors have made use of the Oak Ridge Electron Linear Accelerator (ORELA) to measure the fission cross section of {sup 233}U in the neutron energy range of 0.36 eV to {approximately} 700 keV. This paper reports integral data and average cross sections. In addition they measured the total neutron cross section of {sup 27}Al and natural chlorine, as well as the capture cross section of Al over an energy range from 100 eV up to about 400 keV.

  13. Within the framework of the new fuel cycle 232Th/233U, determination of the 233Pa(n.γ) radiative capture cross section for neutron energies ranging between 0 and 1 MeV

    International Nuclear Information System (INIS)

    The Thorium cycle Th232/U233 may face brilliant perspectives through advanced concepts like molten salt reactors or accelerator driven systems but it lacks accurate nuclear data concerning some nuclei. Pa233 is one of these nuclei, its high activity makes the direct measurement of its radiative neutron capture cross-section almost impossible. This difficulty has been evaded by considering the transfer reaction Th232(He3,p)Pa234* in which the Pa234 nucleus is produced in various excited states according to the amount of energy available in the reaction. The first chapter deals with the thorium cycle and its assets to contribute to the quenching of the fast growing world energy demand. The second chapter gives a detailed description of the experimental setting. A scintillation detector based on deuterated benzene (C6D6) has been used to counter gamma ray cascades. The third chapter is dedicated to data analysis. In the last chapter we compare our experimental results with ENDF and JENDL data and with computed values from 2 statistical models in the 0-1 MeV neutron energy range. Our results disagree clearly with evaluated data: our values are always above ENDF and JENDL data but tend to near computed values. We have also perform the measurement of the radiative neutron cross-section of Pa231 for a 110 keV neutron: σ(n,γ) 2.00 ± 0.14 barn. (A.C.)

  14. The structure, phase transition and molecular dynamics of [C(NH2)3]3[Sb2Br9

    International Nuclear Information System (INIS)

    The crystal structures of [C(NH2)3]3[Sb2Br9] (Gu3Sb2Br9) at 300 K and of [C(NH2)3]3[Sb2Cl9] (Gu3Sb2Cl9) at 90 and 300 K are determined. The compounds crystallize in the monoclinic space group: C 2/c. The structure is composed of Sb2X93- (X = Cl, Br) ions, which form two-dimensional layers through the crystal, and guanidinium cations. In Gu3Sb2Br9 the structural phase transformation of the first-order type is detected at 435/450 K (on cooling/heating) by the DSC and dilatometric techniques. The dielectric relaxation process in the frequency range between 75 kHz and 5 MHz over the low temperature phase indicates reorientations of weakly distorted guanidinium cations. The proton 1H NMR second-moment and spin-lattice relaxation time, T1, temperature runs for the polycrystalline Gu3Sb2Br9 sample indicate a complex cation motion. A significant dynamical non-equivalence of two guanidinium cations was found. The possible mechanism of the phase transition in Gu3Sb2Br9 is discussed on the basis of the results presented

  15. The structure, phase transition and molecular dynamics of [C(NH2)3]3[Sb2Br9

    Science.gov (United States)

    Szklarz, P.; Zaleski, J.; Jakubas, R.; Bator, G.; Medycki, W.; Falinska, K.

    2005-04-01

    The crystal structures of [C(NH2)3]3[Sb2Br9] (Gu3Sb2Br9) at 300 K and of [C(NH2)3]3[Sb2Cl9] (Gu3Sb2Cl9) at 90 and 300 K are determined. The compounds crystallize in the monoclinic space group: C 2/c. The structure is composed of Sb2X93- (X = Cl, Br) ions, which form two-dimensional layers through the crystal, and guanidinium cations. In Gu3Sb2Br9 the structural phase transformation of the first-order type is detected at 435/450 K (on cooling/heating) by the DSC and dilatometric techniques. The dielectric relaxation process in the frequency range between 75 kHz and 5 MHz over the low temperature phase indicates reorientations of weakly distorted guanidinium cations. The proton 1H NMR second-moment and spin-lattice relaxation time, T1, temperature runs for the polycrystalline Gu3Sb2Br9 sample indicate a complex cation motion. A significant dynamical non-equivalence of two guanidinium cations was found. The possible mechanism of the phase transition in Gu3Sb2Br9 is discussed on the basis of the results presented.

  16. Measurement of the ionization yield of nuclear recoils in liquid argon at 80 and 233 keV

    CERN Document Server

    Bondar, A; Dolgov, A; Grishnyaev, E; Polosatkin, S; Shekhtman, L; Shemyakina, E; Sokolov, A

    2014-01-01

    The energy calibration of nuclear recoil detectors is of primary importance to rare-event experiments such as those of direct dark matter search and coherent neutrino-nucleus scattering. In particular, such a calibration is performed by measuring the ionization yield of nuclear recoils in liquid Ar and Xe detection media, using neutron elastic scattering off nuclei. In the present work, the ionization yield for nuclear recoils in liquid Ar has for the first time been measured in the higher energy range, at 80 and 233 keV, using a two-phase Cryogenic Avalanche Detector (CRAD) and DD neutron generator. The ionization yield in liquid Ar at an electric field of 2.3 kV/cm amounted to 7.8+/-1.1 and 9.7+/-1.3 e-/keV at 80 and 233 keV respectively. Neither Jaffe model for nuclear recoil-induced ionization nor that of Thomas-Imel can consistently describe the energy dependence of the ionization yield.

  17. Emission probabilities of the KX-rays following the decay of 237 Np in equilibrium with 233 Pa

    International Nuclear Information System (INIS)

    Following participation in the international EUROMET project No. 416 and after our recent paper, concerning the measurement of the emission probability values of the main gamma-rays of 237 Np in equilibrium with 233 Pa, a complementary work has been done in the frame of the collaboration LNHB-VNIIM-KRI-IFIN (with the support of 'Ministere des Affaires Etrangeres' of France). The purpose was to determine the photon emission probabilities for the KX-rays following the decay of these two nuclides. Two different analysis methods have been used. At first, the KX-rays region was analyzed by fitting Voigt functions according to a least squares procedure, included in 'COLEGRAM' deconvolution code. In the second case, the analysis was performed by using full response functions. Thus, the work allowed the determination of the photon emission probabilities with a relative uncertainty of about 2%. This accurate set of data is useful in calculations related to the atomic level scheme of 237 Np/233 Pa and in X-ray spectrometry based applications. (authors)

  18. Actinide Oxidation State and O/M Ratio in Hypostoichiometric Uranium-Plutonium-Americium U0.750Pu0.246Am0.004O2-x Mixed Oxides.

    Science.gov (United States)

    Vauchy, Romain; Belin, Renaud C; Robisson, Anne-Charlotte; Lebreton, Florent; Aufore, Laurence; Scheinost, Andreas C; Martin, Philippe M

    2016-03-01

    Innovative americium-bearing uranium-plutonium mixed oxides U1-yPuyO2-x are envisioned as nuclear fuel for sodium-cooled fast neutron reactors (SFRs). The oxygen-to-metal (O/M) ratio, directly related to the oxidation state of cations, affects many of the fuel properties. Thus, a thorough knowledge of its variation with the sintering conditions is essential. The aim of this work is to follow the oxidation state of uranium, plutonium, and americium, and so the O/M ratio, in U0.750Pu0.246Am0.004O2-x samples sintered for 4 h at 2023 K in various Ar + 5% H2 + z vpm H2O (z = ∼15, ∼90, and ∼200) gas mixtures. The O/M ratios were determined by gravimetry, XAS, and XRD and evidenced a partial oxidation of the samples at room temperature. Finally, by comparing XANES and EXAFS results to that of a previous study, we demonstrate that the presence of uranium does not influence the interactions between americium and plutonium and that the differences in the O/M ratio between the investigated conditions is controlled by the reduction of plutonium. We also discuss the role of the homogeneity of cation distribution, as determined by EPMA, on the mechanisms involved in the reduction process. PMID:26907589

  19. Environmental Assessment for the U-233 Disposition, Medical Isotope Production, and Building 3019 Complex Shutdown at the Oak Ridge National Laboratory

    International Nuclear Information System (INIS)

    The purpose of the proposed action evaluated in this environmental assessment (EA) is the processing of uranium-233 (233U) stored at the Oak Ridge National Laboratory (ORNL) and other small quantities of similar material currently stored at other U. S. Department of Energy (DOE) sites in order to render it suitable for safe, long-term, economical storage. The 233U is stored within Bldg. 3019A, which is part of the Bldg. 3019 Complex. The location of the Bldg. 3019 Complex is shown on Fig. 1.1. Additionally, the proposed action would increase the availability of medical isotopes needed for research and treatment and place the Bldg. 3019 Complex in safe and stable shutdown for transfer to the DOE program for decontamination and decommissioning (D and D). DOE has determined that there is no programmatic use for the 233U currently in storage at ORNL other than as a possible source of medical isotopes. Since 233U is a special nuclear material, continued long-term storage of the ORNL inventory in its current configuration represents a significant financial liability for DOE. Continued long-term storage in Bldg. 3019A would require major capital upgrades and retrofits to critical facility systems that have deteriorated due to aging or that may not meet current standards. Storing the material in its current form requires significant annual operating expenses to meet the material-handling requirements and to provide protection against nuclear criticality accidents or theft of the material. The ORNL inventory of 233U represents most of the readily available source of thorium-229 (229Th) in the Western Hemisphere. Actinum-225 (225Ac) and its daughter product, bismuth-213 (213Bi), are isotopes in the decay chain of 233U/229Th that are showing significant promise for ongoing cancer research, including clinical trials for treatment of acute myelogenous leukemia. These isotopes are also being explored for treatment of other cancers of the lungs, pancreas, and kidneys. Figure 1

  20. Americium, plutonium and uranium contamination and speciation in well waters, streams and atomic lakes in the Sarzhal region of the Semipalatinsk Nuclear Test Site, Kazakhstan

    International Nuclear Information System (INIS)

    New data are reported on the concentrations, isotopic composition and speciation of americium, plutonium and uranium in surface and ground waters in the Sarzhal region of the Semipalatinsk Test Site, and an adjacent area including the settlement of Sarzhal. The data relate to filtered water and suspended particulate from (a) streams originating in the Degelen Mountains, (b) the Tel'kem 1 and Tel'kem 2 atomic craters, and (c) wells on farms located within the study area and at Sarzhal. The measurements show that 241Am, 239,240Pu and 238U concentrations in well waters within the study area are in the range 0.04-87 mBq dm-3, 0.7-99 mBq dm-3, and 74-213 mBq dm-3, respectively, and for 241Am and 239,240Pu are elevated above the levels expected solely on the basis of global fallout. Concentrations in streams sourced in the Degelen Mountains are similar, while concentrations in the two water-filled atomic craters are somewhat higher. Suspended particulate concentrations in well waters vary considerably, though median values are very low, at 0.01 mBq dm-3, 0.08 mBq dm-3 and 0.32 mBq dm-3 for 241Am, 239,240Pu and 238U, respectively. The 235U/238U isotopic ratio in almost all well and stream waters is slightly elevated above the 'best estimate' value for natural uranium worldwide, suggesting that some of the uranium in these waters is of test-site provenance. Redox analysis shows that on average most of the plutonium present in the microfiltered fraction of these waters is in a chemically reduced form (mean 69%; 95% confidence interval 53-85%). In the case of the atomic craters, the proportion is even higher. As expected, all of the americium present appears to be in a reduced form. Calculations suggest that annual committed effective doses to individual adults arising from the daily ingestion of these well waters are in the range 11-42 μSv (mean 21 μSv). Presently, the ground water feeding these wells would not appear to be contaminated with radioactivity from past

  1. Contribution to the study of {sup 233}U production with MOX-ThPu fuel in PWR reactor. Transition scenarios towards Th/{sup 233}U iso-generating concepts in thermal spectrum. Development of the MURE fuel evolution code; Contribution a l'etude de la production d'{sup 233}U en combustible MOX-ThPu en reacteur a eau sous pression. Scenarios de transition vers des concepts isogenerateurs Th/{sup 233}U en spectre thermique. Developpement du code MURE d'evolution du combustible

    Energy Technology Data Exchange (ETDEWEB)

    Michel-Sendis, F

    2006-12-15

    If nuclear power is to provide a significant fraction of the growing world energy demand, only through the breeding concept can the development of sustainable nuclear energy become a reality. The study of such a transition, from present-day nuclear technologies to future breeding concepts is therefore pertinent. Among these future concepts, those using the thorium cycle Th/U-233 in a thermal neutron spectrum are of particular interest; molten-salt type thermal reactors would allow for breeding while requiring comparatively low initial inventories of U-233. The upstream production of U-233 can be obtained through the use of thorium-plutonium mixed oxide fuel in present-day light water reactors. This work presents, firstly, the development of the MURE evolution code system, a C++ object-oriented code that allows the study, through Monte Carlo (M.C.) simulation, of nuclear reactors and the evolution of their fuel under neutron irradiation. The M.C. methods are well-suited for the study of any reactor, whether it'd be an existing reactor using a new kind of fuel or a future concept altogether, the simulation is only dependent on nuclear data. Exact and complex geometries can be simulated and continuous energy particle transport is performed. MURE is an interface with MCNP, the well-known and validated transport code, that allows, among other functionalities, to simulate constant power and constant reactivity evolutions. Secondly, the study of MOX ThPu fuel in a conventional light water reactor (REP) is presented; it explores different plutonium concentrations and isotopic qualities in order to evaluate their safety characteristics. Simulation of their evolution allows us to quantify the production of U-233 at the end of burnup. Last, different french scenarios validating a possible transition towards a park of thermal Th/U-233 breeders, are presented. In these scenarios, U-233 is produced in ThPu moxed light water reactors. (author)

  2. Basic characterization of 233U: Determination of age and 232U content using sector field ICP-MS, gamma spectrometry and alpha spectrometry

    International Nuclear Information System (INIS)

    The possibility to determine the age, i.e. the time since the last chemical separation, of 233U was studied using two fundamentally different measurement techniques: inductively coupled plasma mass spectrometry (ICP-MS) and gamma spectrometry. Moreover, the isotope ratio 232U/233U was measured using both alpha spectrometry and gamma spectrometry. For the two materials analysed, all measurement results were in agreement, i.e. consistent within the combined uncertainties. One of the materials was also measured using gamma spectrometry under field conditions. This measurement was also in agreement with the other results on this material

  3. Cost-based optimizations of power density and target-blanket modularity for {sup 232}Th/{sup 233}U-based ADEP

    Energy Technology Data Exchange (ETDEWEB)

    Krakowski, R.A.

    1995-07-01

    A cost-based parametric systems model is developed for an Accelerator-Driven Energy Production (ADEP) system based on a {sup 232}Th/{sup 233}U fuel cycle and a molten-salt (LiF/BeF{sub 2}/ThF{sub 3}) fluid-fuel primary system. Simplified neutron-balance, accelerator, reactor-core, chemical-processing, and balance-of-plant models are combined parametrically with a simplified costing model. The main focus of this model is to examine trade offs related to fission power density, reactor-core modularity, {sup 233}U breeding rate, and fission product transmutation capacity.

  4. Investigation of the fission yields of the fast neutron-induced fission of {sup 233}U; Mesure de la distribution en masse et en charge des produits de la fission rapide de l'{sup 233}U

    Energy Technology Data Exchange (ETDEWEB)

    Galy, J

    1999-09-01

    As a stars, a survey of the different methods of investigations of the fission product yields and the experimental data status have been studied, showing advantages and shortcomings for the different approaches. An overview of the existing models for the fission product distributions has been as well intended. The main part of this thesis was the measurement of the independent yields of the fast neutron-induced fission of{sup 233}U, never investigated before this work. The experiment has been carried out using the mass separator OSIRIS (Isotope Separator On-Line). Its integrated ion-source and its specific properties required an analysis of the delay-parameter and ionisation efficiency for each chemical species. On the other hand, this technique allows measurement of independent yields and cumulative yields for elements from Cu to Ba, covering most of the fission yield distribution. Thus, we measured about 180 independent yields from Zn (Z=30) to Sr (Z=38) in the mass range A=74-99 and from Pd (Z=46) to Ba (Z=56) in the mass range A=113-147, including many isomeric states. An additional experiment using direct {gamma}-spectroscopy of aggregates of fission products was used to determine more than 50 cumulative yields of element with half-life from 15 min to a several days. All experimental data have been compared to estimates from a semi-empirical model, to calculated values and to evaluated values from the European library JEF 2.2. Furthermore, a study of both thermal and fast neutron-induced fission of {sup 233}U measured at Studsvik, the comparison of the OSIRIS and LOHENGRIN facilities and the trends in new data for the Reactors Physics have been discussed. (author)

  5. Human bones obtained from routine joint replacement surgery as a tool for studies of plutonium, americium and 90Sr body-burden in general public

    International Nuclear Information System (INIS)

    The paper presents a new sampling method for studying in-body radioactive contamination by bone-seeking radionuclides such as 90Sr, 239+240Pu, 238Pu, 241Am and selected gamma-emitters, in human bones. The presented results were obtained for samples retrieved from routine surgeries, namely knee or hip joints replacements with implants, performed on individuals from Southern Poland. This allowed to collect representative sets of general public samples. The applied analytical radiochemical procedure for bone matrix is described in details. Due to low concentrations of 238Pu the ratio of Pu isotopes which might be used for Pu source identification is obtained only as upper limits other then global fallout (for example Chernobyl) origin of Pu. Calculated concentrations of radioisotopes are comparable to the existing data from post-mortem studies on human bones retrieved from autopsy or exhumations. Human bones removed during knee or hip joint surgery provide a simple and ethical way for obtaining samples for plutonium, americium and 90Sr in-body contamination studies in general public. - Highlights: → Surgery for joint replacement as novel sampling method for studying in-body radioactive contamination. → Proposed way of sampling is not causing ethic doubts. → It is a convenient way of collecting human bone samples from global population. → The applied analytical radiochemical procedure for bone matrix is described in details. → The opposite patient age correlations trends were found for 90Sr (negative) and Pu, Am (positive).

  6. The estimation of reactions of hematopoietic systems of organisms to the effect, caused by americium and plutonium, of nuclear industry workers

    Energy Technology Data Exchange (ETDEWEB)

    Gasteva, G. N.; Ivanova, T. A.; Gordeeva, A. A.; Suvorova, L. A.; Molokanov, A. A.; Badine, I.

    2004-07-01

    Object of research are the workers having in an organism radioactive substance (Am-241 and Pu-239). The purpose of work was the estimation of reaction hemopoietic systems of an organism on influence of americium and plutonium at workers of the nuclear industry. At the surveyed contingent of persons the determined effects caused by total influence Am-241 and Pu-239 are ascertained; chronic radiation disease with development, besides diffusive a pneumoscleoris and a chronic toxic-chemical radiating bronchitis, reactions of system of blood, jet hepatopathy which frequency accrued with increase doses loadings and essentially did not depend on age. In peripheral blood on the foreground jet changes act: hyperglobulia, the tendency to neutrophilus leukocytosis, monocytosis, increase ESR, decrease (reduction ?/G of factor reflecting weight and processing of defeat bronchus and pulmonary of system. Stable downstroke in number thrombocytes and reticulocytes in peripheral blood, their direct dependence on a doze of an irradiation, reflect hypoplastic a background hemogenesis, caused by long influence incorporatedin a bone and a bone brain of radioactive substances. At cytologic research punctate a bone brain jet changes which are expressed in increase of functional activity erythro-and myelopoiesiscome to light and provide compensatory reaction of peripheral blood. At histologic research of a bone brain and a bone fabric attributes of development atrophic process which is expressed in reduction of volume parenchyma a bone brain (a fatty atrophy) and dysplasia to a bone fabric are observed.

  7. Human bones obtained from routine joint replacement surgery as a tool for studies of plutonium, americium and {sup 90}Sr body-burden in general public

    Energy Technology Data Exchange (ETDEWEB)

    Mietelski, Jerzy W., E-mail: jerzy.mietelski@ifj.edu.pl [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Edward B. [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Department of Physical Therapy Basics, Faculty of Physical Therapy, Administration College, Bielsko-Biala (Poland); Tomankiewicz, Ewa [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland); Golec, Joanna [Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Nowak, Sebastian [Traumatology and Orthopaedic Clinic, 5th Military Clinical Hospital and Polyclinic, Independent Public Healthcare Facility, Wroclawska 1-3, 30-901 Cracow (Poland); Orthopaedic Rehabilitation Department, Chair of Clinical Rehabilitation, Faculty of Motor of the Bronislaw Czech' s Academy of Physical Education, Cracow (Poland); Szczygiel, Elzbieta [Physical Therapy Department, Institute of Physical Therapy, Faculty of Heath Science, Jagiellonian University, Medical College, Cracow (Poland); Brudecki, Kamil [Henryk Niewodniczanski Institute of Nuclear Physics, Polish Academy of Sciences, Radzikowskiego 152, 31-342 Cracow (Poland)

    2011-06-15

    The paper presents a new sampling method for studying in-body radioactive contamination by bone-seeking radionuclides such as {sup 90}Sr, {sup 239+240}Pu, {sup 238}Pu, {sup 241}Am and selected gamma-emitters, in human bones. The presented results were obtained for samples retrieved from routine surgeries, namely knee or hip joints replacements with implants, performed on individuals from Southern Poland. This allowed to collect representative sets of general public samples. The applied analytical radiochemical procedure for bone matrix is described in details. Due to low concentrations of {sup 238}Pu the ratio of Pu isotopes which might be used for Pu source identification is obtained only as upper limits other then global fallout (for example Chernobyl) origin of Pu. Calculated concentrations of radioisotopes are comparable to the existing data from post-mortem studies on human bones retrieved from autopsy or exhumations. Human bones removed during knee or hip joint surgery provide a simple and ethical way for obtaining samples for plutonium, americium and {sup 90}Sr in-body contamination studies in general public. - Highlights: > Surgery for joint replacement as novel sampling method for studying in-body radioactive contamination. > Proposed way of sampling is not causing ethic doubts. > It is a convenient way of collecting human bone samples from global population. > The applied analytical radiochemical procedure for bone matrix is described in details. > The opposite patient age correlations trends were found for 90Sr (negative) and Pu, Am (positive).

  8. The recycling of the actinides neptunium, americium and curium in a fast power reactor to reduce the long term activity in a final store

    International Nuclear Information System (INIS)

    The starting point for the considerations and calculations given in this dissertation is the inevitable production of radioactive materials in the use of nuclear energy, which creates a considerable potential danger in a final store for a very long period. As one possibility of alleviating this problem, a concept for recycling the waste actinides neptunium, americium and curium was proposed. The waste actinides are separated in the reprocessing of burnt-up fuel elements and reach a further irradiation circuit. There they pass through the stages 'manufacture of irradiation elements', 'use in a fast power reactor' and reprocessing of irradiation elements' several times. In each irradiation and subsequent storage, about 17% of the waste actinides are removed by fission or by conversion into nuclides which can be reused as fuel, so that during the life of 40 years of the fast recycling reacor, the waste actinides can be reduced in mass by one half. In order to determine this mass reduction effect, a model calculation was developed, which includes the representation of the neutron physics and thermal properties of the reactor core and the storage and reprocessing of the irradiation elements. (orig./RB)

  9. Actinide and lanthanum accumulation by immobilized cells of a citrobacter sp. and application to the decontamination of solutions containing americium and plutonium

    International Nuclear Information System (INIS)

    Phosphatase-mediated metal bioaccumulation by a Citrobacter sp. underlies a bioprocess for the removal of heavy metals from solution, as cell-bound metal phosphate. Deposition of uranyl ion indicated a role in the biotechnological removal of americium and plutonium from wastes generated from the nuclear fuel cycle. Preliminary studies suggested a recalcitrance of tetravalent species of U(IV), Th(IV) and Zr(IV) and, by implication, Pu(IV), probably attributable to the stability of metal-ligand complexes in solution. Trials with the trivalent model, La(III), indicated probable bioaccumulation of Pu(III) and Am(III), which was confirmed by the removal of 241Am by cells immobilized in a cartridge incorporated into a flow supplemented with Am. Pu(V) and Pu(IV) wastes may be treatable via prior reduction to Pu(III), with simultaneous removal of the latter with the co-contaminant Am(III). An oxidative route, to Pu(VI), with desolubilization as HPuO2PO4 was also considered, but experiments using the analogous U(VI) (uranyl ion) demonstrated a greater efficiency of M(III) removal. Initial experiments utilized polyacrylamide gel-immobilized cells. 241Am removal also occurred with Citrobacter sp. immobilized as biofilm on reticulated foam supports, more amenable to large-scale processes

  10. Characterization of americium(III) and lanthanide(III) complexes in mixed solvent extraction systems containing a malonamide and a dialkyl-phosphoric acid

    International Nuclear Information System (INIS)

    In order to further reduce toxicity of nuclear waste, the French Commissariat a l'energie atomique et aux energies alternatives (CEA) is developing processes that allow separation of minor actinides from fission products. The DIAMEX (Diamide extraction) - SANEX (Selective actinide extraction) process is based on a mixture of two organic extractants: a malonamide, the N,N'-dimethyl-N,N'-dioctyl-hexyl-ethoxy-malonamide (DMDOHEMA) and a dialkyl-phosphoric acid, the di(2-ethylhexyl)phosphoric acid (HDEHP), dissolved in an alkane. The mechanisms of its extraction process are still not completely understood. Various complementary analytical techniques were used to identify and characterize americium(III) and lanthanide(III) metallic complexes formed in the organic phase after solvent extraction (UV-Visible, Infrared, NMR and Time Resolved Laser-Induced Fluorescence spectroscopy, as well as Electro-spray Ionization Mass Spectrometry). These speciation studies were performed under a variety of experimental conditions (influence of the extractants concentration, acidity of the aqueous phase..) and mixed species including the two extractants were observed. (authors)

  11. Fission cross-section measurements on 233U and minor actinides at the CERN n-TOF facility

    International Nuclear Information System (INIS)

    Neutron-induced fission cross-sections of minor actinides have been measured at the white neutron source n-TOF at CERN, Geneva. The studied isotopes include 233U, interesting for Th/U based nuclear fuel cycles, 241,243Am and 245Cm, relevant for transmutation and waste reduction studies in new generation fast reactors (Gen-IV) or Accelerator Driven Systems. The measurements take advantage of the unique features of the n-TOF facility, namely the wide energy range, the high instantaneous neutron flux and the low background. Results for the involved isotopes are reported from ∼30 meV to around 1 MeV neutron energy. The measurements have been performed with a dedicated Fission Ionization Chamber (FIC), relative to the standard cross-section of the 235U fission reaction, measured simultaneously with the same detector. Results are here reported. (authors)

  12. Multiplicity and energy of neutrons from {sup 233}U(n{sub th},f) fission fragments

    Energy Technology Data Exchange (ETDEWEB)

    Nishio, Katsuhisa; Kimura, Itsuro; Nakagome, Yoshihiro [Kyoto Univ. (Japan)

    1998-03-01

    The correlation between fission fragments and prompt neutrons from the reaction {sup 233}U(n{sub th},f) was measured with improved accuracy. The results determined the neutron multiplicity and emission energy as a function of fragment mass and total kinetic energy. The average energy as a function of fragment mass followed a nearly symmetric distribution centered about the equal mass-split and formed a remarkable contrast with the saw-tooth distribution of the average neutron multiplicity. The neutron multiplicity from the specified fragment decreases linearly with total kinetic energy, and the slope of multiplicity with kinetic energy had the minimum value at about 130 u. The level density parameter versus mass determined from the neutron data showed a saw-tooth structure with the pronounced minimum at about 128 and generally followed the formula by Gilbert and Cameron, suggesting that the neutron emission process was very much affected by the shell-effect of the fission fragment. (author)

  13. Determination of the 233Pa(n, f) reaction cross section from 0.5 to 10 MeV neutron energy using the transfer reaction 232Th(3He, p)234Pa

    International Nuclear Information System (INIS)

    The fission probability distributions of 232,233,234Pa and 231Th have been measured up to an excitation energy of 15 MeV, using the transfer reactions 232Th(3He, t)232Pa, 232Th(3He, d)233Pa, 232Th(3He, p)234Pa and 232Th(3He, 4He)231Th. From these measurements, the neutron induced fission cross sections of 231Pa, 233Pa and 230Th have been determined from the product of the fission probabilities of 232Pa, 233Pa and 231Th respectively with the calculated compound nucleus formation cross sections in the 231Pa+n, 233Pa+n and 230Th+n reactions. The validity of the applied method has been successfully tested with the existing neutron induced fission cross sections of 230Th and 231Pa. Special emphasis is put on the 233Pa(n, f) reaction which is of importance for thorium fueled nuclear reactors. Based on a statistical model analysis of the neutron induced fission cross section as a function of neutron energy, it has been possible to determine the barrier parameters of the 234Pa fissioning nucleus. Cross sections for the compound nucleus inelastic scattering 233Pa(n, n') and radiative capture 233Pa(n, γ) reactions have also been calculated and compared with recent evaluations

  14. Utilization of non-weapons-grade plutonium and highly enriched uranium with breeding of the 233U isotope in the VVER reactors using thorium and heavy water

    International Nuclear Information System (INIS)

    A method for joint utilization of non-weapons-grade plutonium and highly enriched uranium in the thorium–uranium—plutonium oxide fuel of a water-moderated reactor with a varying water composition (D2O, H2O) is proposed. The method is characterized by efficient breeding of the 233U isotope and safe reactor operation and is comparatively simple to implement

  15. Utilization of non-weapons-grade plutonium and highly enriched uranium with breeding of the 233U isotope in the VVER reactors using thorium and heavy water

    Science.gov (United States)

    Marshalkin, V. E.; Povyshev, V. M.

    2015-12-01

    A method for joint utilization of non-weapons-grade plutonium and highly enriched uranium in the thorium-uranium—plutonium oxide fuel of a water-moderated reactor with a varying water composition (D2O, H2O) is proposed. The method is characterized by efficient breeding of the 233U isotope and safe reactor operation and is comparatively simple to implement.

  16. New calculation for the neutron-induced fission cross section of 233Pa between 1.0 and 3.0 MeV

    International Nuclear Information System (INIS)

    The 233Pa(n,f) cross section, a key ingredient for fast reactors and accelerators driven systems, was measured recently with relatively good accuracy [F. Tovesson et al., Phys. Rev. Lett. 88, 062502 (2002)]. The results are at strong variance with accepted evaluations and an existing indirect experiment. This circumstance led us to perform a quite detailed and complete evaluation of the 233Pa(n,f) cross section between 1.0 and 3.0 MeV, where use of our newly developed routines for the parametrization of the nuclear surface and the calculation of deformation parameters and level densities (including low-energy discrete levels) were made. The results show good quantitative and excellent qualitative agreement with the experimental direct data obtained by Tovesson et al. [F. Tovesson et al., Phys. Rev. Lett. 88, 062502 (2002)]. Additionally, our methodology opens new possibilities for the analysis of subthreshold fission and above threshold second-chance fission for both 233Pa and its decay product 233U, as well as other strategically important fissionable nuclides

  17. Measurement of the fission cross section induced by fast neutrons of the {sup 232}Th/{sup 233}U nuclei within the innovating fuel cycles framework; Mesure de la section efficace de fission induite par neutrons rapides des noyaux {sup 232}Th/{sup 233}U dans le cadre des cycles de combustible innovants

    Energy Technology Data Exchange (ETDEWEB)

    Grosjean, C

    2005-03-15

    The thorium-U{sup 233} fuel cycle might provided safer and cleaner nuclear energy than the present Uranium/Pu fuelled reactors. Over the last 10 years, a vast campaign of measurements has been initiated to bring the precision of neutron data for the key nuclei (Th{sup 232}, Pa{sup 233} and U{sup 233}) at the level of those for the U-Pu cycle. This is the framework of these measurements, the energy dependent neutron induced fission cross section of Th{sup 232} and U{sup 233} has been measured from 1 to 7 MeV with a target accuracy lesser than 5 per cent. These measurements imply the accurate determination of the fission rate, the number of the target nuclei as well as the incident neutron flux impinging on the target, the latter has been obtained using the elastic scattering (n,p). The cross section of which is very well known in a large neutron energy domain ({approx} 0,5 % from 1 eV to 50 MeV) compared to the U{sup 235}(n,f) reaction. This technique has been applied for the first time to the Th{sup 232}(n,f) and U{sup 233}(n,f) cases. A Hauser-Feshbach statistical model has been developed. It consists of describing the different decay channels of the compound nucleus U{sup 234} from 0,01 to 10 MeV neutron energy. The parameters of this model were adjusted in order to reproduce the measured fission cross section of U{sup 233}. From these parameters, the cross sections from the following reactions could be extracted: inelastic scattering U{sup 233}(n,n'), radiative capture U{sup 233}(n,{gamma}) and U{sup 233}(n,2n). These cross sections are still difficult to measure by direct neutron reactions. The calculated values have allowed us to fill the lack of experimental data for the major fissile nucleus of the thorium cycle. (author)

  18. Extraction and chromatographic separation and concentration of plutonium and americium from natural matrices. Author-review of dissertation submitted for fulfillment of the scientific degree 'Philosophiae doctor' (PhD.)

    International Nuclear Information System (INIS)

    We followed the optimization of separation progress of americium (241Am) from environmental samples - soil from surroundings nuclear power plant Jaslovske Bohunice, in our work. Selection and optimization of separation progresses had to verify the condition for preparation of samples on spectral measurement with coprecipitation of americium or plutonium with NdF3 (undesirable presence of calcium, magnesium, lanthanides) and condition of spectral purity (spectral overlapping 228Th, 238Pu, 241Am and 222Rn of energy). Very important step was the realization of existing goal and learn suitable isolation techniques of plutonium. We are choosing technique separation of plutonium base upon amine liquid extraction, for a digest consider qualitative quantitative factor of separation. Extraction reagent has been Aliquat-336, which extracts nitric complex of plutonium [Pu(NO3)62-] from 7-8 M solution HNO3. Use method separate off quantitative the plutonium, thorium and uranium from americium. Background sample formed the sample of soil from surroundings Velke Kostolany. Real samples were sampling from surroundings of pollute river Dudvah. Average value mass activities of 239,240Pu in the background sample had value 0.28 ± 0.10 Bq · kg-1. Value mass activities of 239,240Pu in sample from surroundings river Dudvah were in the range (0,6 - 39.4) Bq · kg-1. Methodical side separation of americium we step by step by using ion exchange methods, liquid extraction with extraction reagent TOPO, or combination of them and extraction chromatography with TOPO. We find out: (a) on exchange procedure are suitable on obtainable basis extract tracer of radionuclide, also is very up to time. Optimal method was indicate techniques using the formation of rhodanide complex of americium, with following adsorption on stark acidity anionic exchanger (lanthanides were non-absorbing); (b) t liquid extraction formed emulsion, the third phase on the interface of phases. If we treat the molar of

  19. The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium

    Energy Technology Data Exchange (ETDEWEB)

    Ketelaer, Jens

    2010-06-14

    The construction of TRIGA-TRAP and direct high-precision Penning trap mass measurements on rare-earth elements and americium: Nuclear masses are an important quantity to study nuclear structure since they reflect the sum of all nucleonic interactions. Many experimental possibilities exist to precisely measure masses, out of which the Penning trap is the tool to reach the highest precision. Moreover, absolute mass measurements can be performed using carbon, the atomic-mass standard, as a reference. The new double-Penning trap mass spectrometer TRIGA-TRAP has been installed and commissioned within this thesis work, which is the very first experimental setup of this kind located at a nuclear reactor. New technical developments have been carried out such as a reliable non-resonant laser ablation ion source for the production of carbon cluster ions and are still continued, like a non-destructive ion detection technique for single-ion measurements. Neutron-rich fission products will be available by the reactor that are important for nuclear astrophysics, especially the r-process. Prior to the on-line coupling to the reactor, TRIGA-TRAP already performed off-line mass measurements on stable and long-lived isotopes and will continue this program. The main focus within this thesis was on certain rare-earth nuclides in the well-established region of deformation around N {proportional_to} 90. Another field of interest are mass measurements on actinoids to test mass models and to provide direct links to the mass standard. Within this thesis, the mass of {sup 241}Am could be measured directly for the first time. (orig.)

  20. 6,6 '-bis (5,5,8,8-tetramethyl-5,6,7,8-tetra-hydro-benzo 1,2,4 triazine-3-yl) 2,2 ' bipyridine, an effective extracting agent for the separation of americium(III) and curium(III) from the lanthanides

    International Nuclear Information System (INIS)

    The extraction of americium(III), curium(III), and the lanthanides(III) from nitric acid by 6,6'- bis (5,5,8,8-tetramethyl-5,6,7,8-tetra-hydro-benzo[1,2,4]triazine-3-yl)-[2,2'] bipyridine (CyMe4-BTBP) has been studied. Since the extraction kinetics were slow, N,N'-dimethyl-N,N'-di-octyl-2-(2-hexyl-oxy-ethyl)malonamide (DMDOHEMA) was added as a phase transfer reagent. With a mixture of 0.01 M CyMe4-BTBP + 0.25 M DMDOHEMA in n -octanol, extraction equilibrium was reached within 5 min of mixing. At a nitric acid concentration of 1 M, an americium(III) distribution ratio of approx. 10 was achieved. Americium(III)/lanthanide(III) separation factors between 50 (dysprosium) and 1500 (lanthanum) were obtained. Whereas americium(III) and curium(III) were extracted as di-solvates, the stoichiometries of the lanthanide(III) complexes were not identified unambiguously, owing to the presence of DMDOHEMA. In the absence of DMDOHEMA, both americium(III) and europium(III) were extracted as di-solvates. Back-extraction with 0.1 M nitric acid was thermodynamically possible but rather slow. Using a buffered glycolate solution of pH=4, an americium(III) distribution ratio of 0.01 was obtained within 5 min of mixing. There was no evidence of degradation of the extractant, for example, the extraction performance of CyMe4-BTBP during hydrolysis with 1 M nitric acid did not change over a two month contact. (authors)