WorldWideScience

Sample records for american cockroach periplaneta

  1. Transplantation immunity in the American cockroach, Periplaneta americana: the rejection of integumentary grafts from Blatta orientalis.

    Science.gov (United States)

    Karp, R D; Meade, C C

    1993-01-01

    The results from several previous studies have indicated that the American cockroach is able to respond to integumentary xenografts, but doubt remained as to whether cockroaches could effectively discriminate between self and allogeneic differences. This was emphasized by the fact that while one study reported that Periplaneta americana responded to grafts donated by the closely related genus Blatta orientalis, the data reported elsewhere, using a different assay system, found no such reactivity. Since we have subsequently reported, using a direct histological assay, that Periplaneta can in fact recognize and destroy integumentary allografts, we initiated a study to hopefully sort out the enigma presented by previous data using Blatta as a transplant donor. Integument from Blatta orientalis was transplanted orthotopically onto Periplaneta americana, and at various time points post-transplant, scored histologically for the survival of the subcuticular epidermal layer. The results clearly demonstrated that Periplaneta reacted to the Blatta tissue, because approximately 82% of the grafts had the epidermal layer destroyed by day 7 posttransplant. The kinetics of the response to Blatta was more in line with our allograft data, which would be in agreement with other work indicating that the closer the donor and recipient are on the phylogenetic tree, the less intense the reactivity to the foreign transplant.

  2. Symbiotic essential amino acids provisioning in the American cockroach, Periplaneta americana (Linnaeus) under various dietary conditions.

    Science.gov (United States)

    Ayayee, Paul A; Larsen, Thomas; Sabree, Zakee

    2016-01-01

    Insect gut microbes have been shown to provide nutrients such as essential amino acids (EAAs) to their hosts. How this symbiotic nutrient provisioning tracks with the host's demand is not well understood. In this study, we investigated microbial essential amino acid (EAA) provisioning in omnivorous American cockroaches (Periplaneta americana), fed low-quality (LQD) and comparatively higher-quality dog food (DF) diets using carbon stable isotope ratios of EAAs (δ (13)CEAA). We assessed non-dietary EAA input, quantified as isotopic offsets (Δ(13)C) between cockroach (δ (13)CCockroach EAA) and dietary (δ (13)CDietary EAA) EAAs, and subsequently determined biosynthetic origins of non-dietary EAAs in cockroaches using (13)C-fingerprinting with dietary and representative bacterial and fungal δ (13)CEAA. Investigation of biosynthetic origins of de novo non-dietary EAAs indicated bacterial origins of EAA in cockroach appendage samples, and a mixture of fungal and bacterial EAA origins in gut filtrate samples for both LQD and DF-fed groups. We attribute the bacteria-derived EAAs in cockroach appendages to provisioning by the fat body residing obligate endosymbiont, Blattabacterium and gut-residing bacteria. The mixed signatures of gut filtrate samples are attributed to the presence of unassimilated dietary, as well as gut microbial (bacterial and fungal) EAAs. This study highlights the potential impacts of dietary quality on symbiotic EAA provisioning and the need for further studies investigating the interplay between host EAA demands, host dietary quality and symbiotic EAA provisioning in response to dietary sufficiency or deficiency.

  3. Molecular characterization and localization of the first tyramine receptor of the American cockroach (Periplaneta americana).

    Science.gov (United States)

    Rotte, C; Krach, C; Balfanz, S; Baumann, A; Walz, B; Blenau, W

    2009-09-15

    The phenolamines octopamine and tyramine control, regulate, and modulate many physiological and behavioral processes in invertebrates. Vertebrates possess only small amounts of both substances, and thus, octopamine and tyramine, together with other biogenic amines, are referred to as "trace amines." Biogenic amines evoke cellular responses by activating G-protein-coupled receptors. We have isolated a complementary DNA (cDNA) that encodes a biogenic amine receptor from the American cockroach Periplaneta americana, viz., Peatyr1, which shares high sequence similarity to members of the invertebrate tyramine-receptor family. The PeaTYR1 receptor was stably expressed in human embryonic kidney (HEK) 293 cells, and its ligand response has been examined. Receptor activation with tyramine reduces adenylyl cyclase activity in a dose-dependent manner (EC(50) approximately 350 nM). The inhibitory effect of tyramine is abolished by co-incubation with either yohimbine or chlorpromazine. Receptor expression has been investigated by reverse transcription polymerase chain reaction and immunocytochemistry. The mRNA is present in various tissues including brain, salivary glands, midgut, Malpighian tubules, and leg muscles. The effect of tyramine on salivary gland acinar cells has been investigated by intracellular recordings, which have revealed excitatory presynaptic actions of tyramine. This study marks the first comprehensive molecular, pharmacological, and functional characterization of a tyramine receptor in the cockroach.

  4. Aerobic Bacterial Community of American Cockroach Periplaneta americana,a Step toward Finding Suitable Paratransgenesis Candidates.

    Science.gov (United States)

    Akbari, Sanaz; Oshaghi, Mohammad Ali; Hashemi-Aghdam, Saedeh Sadat; Hajikhani, Sara; Oshaghi, Ghazaleh; Shirazi, Mohammad Hasan

    2015-06-01

    Cockroaches mechanically spread pathogenic agents, however, little is known about their gut microbiota. Identification of midgut microbial community helps targeting novel biological control strategies such as paratransgenesis. Here the bacterial microbiota of Periplaneta americana midgut, were identified and evaluated for finding proper paratransgenesis candidate. Midgut of specimens were dissected and cultivated in different media. The bacterial isolates were then identified using the phenotypic and 16S-rRNA sequencing methods. The analytical profile index (API) kit showed presence of 11 bacterial species including: Escherichia coli, Shigella flexineri, Citrobacter freundii, E. vulneris, Enterobacter cloacae, Yersinia pseudotuberculosis, Y. intermedia, Leclericia adecarboxylata, Klebsiella oxytoca, K. planticola, and Rahnella aquatilis in the cockroach midguts. The first three species are potentially symbiotic whereas others are transient. The conventional plating method revealed presence of only four isolates of Salmonella, E. coli, and Proteus which in three cases mismatched with API and 16S-rRNA genotyping. The API correctly identified the four isolates as Shigella flexneri, Citrobacter freundii, and E. coli (n= 2). 16S-rRNA sequence analysis confirmed the API results; however the C. freundii sequence was identical with C. murliniae indicating lack of genetic variation in the gene between these two closely related species. A low number of potentially symbiotic bacteria were found in the American cockroach midguts. Among them Enterobacter cloacae is a potential candidate for paratransgenesis approach whereas other bacteria are pathogens and are not useful for the approach. Data analysis showed that identification levels increase from the conventional to API and to genotyping respectively.

  5. Aerobic Bacterial Community of American Cockroach Periplaneta americana,a Step toward Finding Suitable Paratransgenesis Candidates

    Directory of Open Access Journals (Sweden)

    Sanaz Akbari

    2015-10-01

    Full Text Available Background: Cockroaches mechanically spread pathogenic agents, however, little is known about their gut microbiota. Identification of midgut microbial community helps targeting novel biological control strategies such as paratransgenesis. Here the bacterial microbiota of Periplaneta americana midgut, were identified and evaluated for finding proper paratransgenesis candidate.Methods: Midgut of specimens were dissected and cultivated in different media. The bacterial isolates were then identified using the phenotypic and 16S-rRNA sequencing methods.Results: The analytical profile index (API kit showed presence of 11 bacterial species including: Escherichia coli, Shigella flexineri, Citrobacter freundii, E. vulneris, Enterobacter cloacae, Yersinia pseudotuberculosis, Y.intermedia, Leclericia adecarboxylata, Klebsiella oxytoca, K. planticola, and Rahnella aquatilis in the cockroach midguts. The first three species are potentially symbiotic whereas others are transient. The conventional platingmethod revealed presence of only four isolates of Salmonella, E. coli, and Proteus which in three cases mismatched with API and 16S-rRNA genotyping. The API correctly identified the four isolates as Shigella flexneri, Citrobacter freundii, and E. coli (n= 2. 16S-rRNA sequence analysis confirmed the API results; however the C. freundii sequencewas identical with C. murliniae indicating lack of genetic variation in the gene between these two closely related species.Conclusion: A low number of potentially symbiotic bacteria were found in the American cockroach midguts. Among them Enterobacter cloacae is a potential candidate for paratransgenesis approach whereas other bacteria are pathogens and are not useful for the approach. Data analysis showed that identification levels increase from the conventional to API and to genotyping respectively.

  6. Isolation and Purification of an Antibacterial Protein from Immune Induced Haemolymph of American Cockroach, Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Hamid Reza Basseri

    2016-10-01

    Full Text Available Background: Antimicrobial peptides play a role as effectors substances in the immunity of vertebrate and inverte­brate hosts. In the current study, antimicrobial peptide was isolated from the haemolymph of the American cock­roach, Periplaneta americana.Methods: Micrococcus luteus as Gram-positive bacteria and Escherichia coli as Gram-negative bacteria were candi­date for injection. Induction was done by injecting both bacteria into the abdominal cavity of two groups of cock­roaches separately. The haemolymphs were collected 24 hours after post injection and initially tested against both bacteria. Subsequently, the immune induced haemolymph was purified by high performance liquid chromatography (HPLC to separate the proteins responsible for the antibacterial activity.Results: The non-induced haemolymph did not show any activity against both bacteria whereas induced haemo­lymph exhibited high activity against M. luteus but did less against E. coli. Two fractions showed antibacterial activ­ity against M. luteus. Finally the molecular weight of the isolated antibacterial proteins were determined as 72 kDa and 62 kDa using SDS-PAGE.Conclusion: Induced haemolymph of American cockroaches has the ability to produce peptides to combat against Gram-positive bacteria when an immune challenge is mounted. Further work has to be done to sequence of the pro­tein, which it would be advantageous.

  7. Fast and Powerful: Biomechanics and Bite Forces of the Mandibles in the American Cockroach Periplaneta americana.

    Directory of Open Access Journals (Sweden)

    Tom Weihmann

    Full Text Available Knowing the functionality and capabilities of masticatory apparatuses is essential for the ecological classification of jawed organisms. Nevertheless insects, especially with their outstanding high species number providing an overwhelming morphological diversity, are notoriously underexplored with respect to maximum bite forces and their dependency on the mandible opening angles. Aiming for a general understanding of insect biting, we examined the generalist feeding cockroach Periplaneta americana, characterized by its primitive chewing mouth parts. We measured active isometric bite forces and passive forces caused by joint resistance over the entire mandibular range with a custom-built 2D force transducer. The opening angle of the mandibles was quantified by using a video system. With respect to the effective mechanical advantage of the mandibles and the cross-section areas, we calculated the forces exerted by the mandible closer muscles and the corresponding muscle stress values. Comparisons with the scarce data available revealed close similarities of the cockroaches' mandible closer stress values (58 N/cm2 to that of smaller specialist carnivorous ground beetles, but strikingly higher values than in larger stag beetles. In contrast to available datasets our results imply the activity of faster and slower muscle fibres, with the latter becoming active only when the animals chew on tough material which requires repetitive, hard biting. Under such circumstances the coactivity of fast and slow fibres provides a force boost which is not available during short-term activities, since long latencies prevent a specific effective employment of the slow fibres in this case.

  8. The Core Gut Microbiome of the American Cockroach, Periplaneta americana, Is Stable and Resilient to Dietary Shifts.

    Science.gov (United States)

    Tinker, Kara A; Ottesen, Elizabeth A

    2016-11-15

    The omnivorous cockroach Periplaneta americana hosts a diverse hindgut microbiota encompassing hundreds of microbial species. In this study, we used 16S rRNA gene sequencing to examine the effect of diet on the composition of the P. americana hindgut microbial community. Results show that the hindgut microbiota of P. americana exhibit a highly stable core microbial community with low variance in compositions between individuals and minimal community change in response to dietary shifts. This core hindgut microbiome is shared between laboratory-hosted and wild-caught individuals, although wild-caught specimens exhibited a higher diversity of low-abundance microbes that were lost following extended cultivation under laboratory conditions. This taxonomic stability strongly contrasts with observations of the gut microbiota of mammals, which have been shown to be highly responsive to dietary change. A comparison of P. americana hindgut samples with human fecal samples indicated that the cockroach hindgut community exhibited higher alpha diversity but a substantially lower beta diversity than the human gut microbiome. This suggests that cockroaches have evolved unique mechanisms for establishing and maintaining a diverse and stable core microbiome. The gut microbiome plays an important role in the overall health of its host. A healthy gut microbiota typically assists with defense against pathogens and the digestion and absorption of nutrients from food, while dysbiosis of the gut microbiota has been associated with reduced health. In this study, we examined the composition and stability of the gut microbiota from the omnivorous cockroach Periplaneta americana. We found that P. americana hosts a diverse core gut microbiome that remains stable after drastic long-term changes in diet. While other insects, notably ant and bee species, have evolved mechanisms for maintaining a stable association with specific gut microbiota, these insects typically host low-diversity gut

  9. PeaTAR1B: Characterization of a Second Type 1 Tyramine Receptor of the American Cockroach, Periplaneta americana.

    Science.gov (United States)

    Blenau, Wolfgang; Balfanz, Sabine; Baumann, Arnd

    2017-10-30

    The catecholamines norepinephrine and epinephrine regulate important physiological functions in vertebrates. In insects; these neuroactive substances are functionally replaced by the phenolamines octopamine and tyramine. Phenolamines activate specific guanine nucleotide-binding (G) protein-coupled receptors (GPCRs). Type 1 tyramine receptors are better activated by tyramine than by octopamine. In contrast; type 2 tyramine receptors are almost exclusively activated by tyramine. Functionally; activation of type 1 tyramine receptors leads to a decrease in the intracellular concentration of cAMP ([cAMP] i ) whereas type 2 tyramine receptors can mediate Ca 2+ signals or both Ca 2+ signals and effects on [cAMP] i . Here; we report that the American cockroach ( Periplaneta americana ) expresses a second type 1 tyramine receptor (PeaTAR1B) in addition to PeaTAR1A (previously called PeaTYR1). When heterologously expressed in flpTM cells; activation of PeaTAR1B by tyramine leads to a concentration-dependent decrease in [cAMP] i . Its activity can be blocked by a series of established antagonists. The functional characterization of two type 1 tyramine receptors from P. americana ; PeaTAR1A and PeaTAR1B; which respond to tyramine by changing cAMP levels; is a major step towards understanding the actions of tyramine in cockroach physiology and behavior; particularly in comparison to the effects of octopamine.

  10. PeaTAR1B: Characterization of a Second Type 1 Tyramine Receptor of the American Cockroach, Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Wolfgang Blenau

    2017-10-01

    Full Text Available The catecholamines norepinephrine and epinephrine regulate important physiological functions in vertebrates. In insects; these neuroactive substances are functionally replaced by the phenolamines octopamine and tyramine. Phenolamines activate specific guanine nucleotide-binding (G protein-coupled receptors (GPCRs. Type 1 tyramine receptors are better activated by tyramine than by octopamine. In contrast; type 2 tyramine receptors are almost exclusively activated by tyramine. Functionally; activation of type 1 tyramine receptors leads to a decrease in the intracellular concentration of cAMP ([cAMP]i whereas type 2 tyramine receptors can mediate Ca2+ signals or both Ca2+ signals and effects on [cAMP]i. Here; we report that the American cockroach (Periplaneta americana expresses a second type 1 tyramine receptor (PeaTAR1B in addition to PeaTAR1A (previously called PeaTYR1. When heterologously expressed in flpTM cells; activation of PeaTAR1B by tyramine leads to a concentration-dependent decrease in [cAMP]i. Its activity can be blocked by a series of established antagonists. The functional characterization of two type 1 tyramine receptors from P. americana; PeaTAR1A and PeaTAR1B; which respond to tyramine by changing cAMP levels; is a major step towards understanding the actions of tyramine in cockroach physiology and behavior; particularly in comparison to the effects of octopamine.

  11. amylase from cockroach, Periplaneta americana

    African Journals Online (AJOL)

    STORAGESEVER

    2008-08-04

    Aug 4, 2008 ... The enzyme was stable up to 55°C and its pH stability was in range of 5.6 - 6.6. .... acrylamide gel and by gel filtration chromatography. Gel filtration .... Activity at 55 °C. Figure 8. Thermic inactivation at 37°C and 55°C of Periplaneta americana α-amylase. Thermal stability of the enzyme was followed for 1 h.

  12. Specific B-cell Epitope of Per a 1: A Major Allergen of American Cockroach (Periplaneta americana) and Anatomical Localization.

    Science.gov (United States)

    Sookrung, Nitat; Khetsuphan, Thanyathon; Chaisri, Urai; Indrawattana, Nitaya; Reamtong, Onrapak; Chaicumpa, Wanpen; Tungtrongchitr, Anchalee

    2014-07-01

    Cockroach (CR) is a common source of indoor allergens, and Per a 1 is a major American CR (Periplaneta americana) allergen; however, several attributes of this protein remain unknown. This study identifies a novel specific B cell epitope and anatomical locations of Per a 1.0105. Recombinant Per a 1.0105 (rPer a 1.0105) was used as BALB/c mouse immunogen for the production of monoclonal antibodies (MAb). The MAb specific B cell epitope was identified by determining phage mimotopic peptides and pair-wise alignment of the peptides with the rPer a 1.0105 amino acid sequence. Locations of the Per a 1.0105 in P. americana were investigated by immunohistochemical staining. The rPer a 1.0105 (~13 kDa) had 100%, 98% and ≥90% identity to Per a 1.0105, Per a 1.0101, and Cr-PII, respectively. The B-cell epitope of the Per a 1.0105 specific-MAb was located at residues(99) QDLLLQLRDKGV(110) contained in all 5 Per a 1.01 isoforms and Per a 1.02. The epitope was analogous to the Bla g 1.02 epitope; however, this B-cell epitope was not an IgE inducer. Per a 1.0105 was found in the midgut and intestinal content of American CR but not in the other organs. The amount of the Per a 1 was ~544 ℃g per gram of feces. The novel Per a 1 B-cell epitope described in this study is a useful target for allergen quantification in samples; however, the specific MAb can be used as an allergen detection reagent. The MAb based-affinity resin can be made for allergen purification, and the so-purified protein can serve as a standard and diagnostic allergen as well as a therapeutic vaccine component. The finding that the Per a 1 is contained in the midgut and feces is useful to increase yield and purity when preparing this allergen.

  13. Characterization of an Invertebrate-Type Dopamine Receptor of the American Cockroach, Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Britta Troppmann

    2014-01-01

    Full Text Available We have isolated a cDNA coding for a putative invertebrate-type dopamine receptor (Peadop2 from P. americana brain by using a PCR-based strategy. The mRNA is present in samples from brain and salivary glands. We analyzed the distribution of the PeaDOP2 receptor protein with specific affinity-purified polyclonal antibodies. On Western blots, PeaDOP2 was detected in protein samples from brain, subesophageal ganglion, thoracic ganglia, and salivary glands. In immunocytochemical experiments, we detected PeaDOP2 in neurons with their somata being located at the anterior edge of the medulla bilaterally innervating the optic lobes and projecting to the ventro-lateral protocerebrum. In order to determine the functional and pharmacological properties of the cloned receptor, we generated a cell line constitutively expressing PeaDOP2. Activation of PeaDOP2-expressing cells with dopamine induced an increase in intracellular cAMP. In contrast, a C-terminally truncated splice variant of this receptor did not exhibit any functional property by itself. The molecular and pharmacological characterization of the first dopamine receptor from P. americana provides the basis for forthcoming studies focusing on the significance of the dopaminergic system in cockroach behavior and physiology.

  14. Characterization of an invertebrate-type dopamine receptor of the American cockroach, Periplaneta americana.

    Science.gov (United States)

    Troppmann, Britta; Balfanz, Sabine; Krach, Christian; Baumann, Arnd; Blenau, Wolfgang

    2014-01-06

    We have isolated a cDNA coding for a putative invertebrate-type dopamine receptor (Peadop2) from P. americana brain by using a PCR-based strategy. The mRNA is present in samples from brain and salivary glands. We analyzed the distribution of the PeaDOP2 receptor protein with specific affinity-purified polyclonal antibodies. On Western blots, PeaDOP2 was detected in protein samples from brain, subesophageal ganglion, thoracic ganglia, and salivary glands. In immunocytochemical experiments, we detected PeaDOP2 in neurons with their somata being located at the anterior edge of the medulla bilaterally innervating the optic lobes and projecting to the ventro-lateral protocerebrum. In order to determine the functional and pharmacological properties of the cloned receptor, we generated a cell line constitutively expressing PeaDOP2. Activation of PeaDOP2-expressing cells with dopamine induced an increase in intracellular cAMP. In contrast, a C-terminally truncated splice variant of this receptor did not exhibit any functional property by itself. The molecular and pharmacological characterization of the first dopamine receptor from P. americana provides the basis for forthcoming studies focusing on the significance of the dopaminergic system in cockroach behavior and physiology.

  15. Synanthropic Cockroaches (Blattidae: Periplaneta spp.) Harbor Pathogenic Leptospira in Colombia.

    Science.gov (United States)

    Gonzalez-Astudillo, Viviana; Bustamante-Rengifo, Javier A; Bonilla, Álvaro; Lehmicke, Anna Joy J; Castillo, Andrés; Astudillo-Hernández, Miryam

    2016-01-01

    Leptospirosis cases in Colombia are typically linked to peridomestic rodents; however, empirical data suggest that Leptospira-infected patients with no apparent exposure to these reservoirs are common. Cockroaches (Periplaneta spp.) have equal or greater interaction with humans than rodents, yet their potential role as carriers of Leptospira has not been assessed. We determined if pathogenic Leptospira is harbored by Periplaneta spp. in Cali (Colombia) and the variables influencing this relationship. Fifty-nine cockroaches were captured from seven sites and DNA was extracted from the body surface and digestive tract for a multiplex polymerase chain reaction, targeting genes secY and flaB. Logistic regression models and proportion tests showed a higher likelihood for Leptospira to be isolated from body surfaces (P > 0.001) and from individuals inside houses (six times more likely). These findings are the first to demonstrate an association between Periplaneta spp. and Leptospira, suggesting the need to investigate the potential for cockroaches to serve as reservoirs or transport hosts for Leptospira. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  16. Cloning and characterization of the adipokinetic hormone receptor from the cockroach Periplaneta americana

    DEFF Research Database (Denmark)

    Hansen, Karina K; Hauser, Frank; Cazzamali, Giuseppe

    2006-01-01

    Cockroaches have long been used as insect models to investigate the actions of biologically active neuropeptides. Here, we describe the cloning and functional expression in Chinese hamster ovary cells of an adipokinetic hormone (AKH) G protein-coupled receptor from the cockroach Periplaneta...... americana. This receptor is only activated by various insect AKHs (we tested eight) and not by a library of 29 other insect or invertebrate neuropeptides and nine biogenic amines. Periplaneta has two intrinsic AKHs, Pea-AKH-1, and Pea-AKH-2. The Periplaneta AKH receptor is activated by low concentrations...... of both Pea-AKH-1 (EC50, 5 x 10(-9)M), and Pea-AKH-2 (EC50, 2 x 10(-9)M). Insects can be subdivided into two evolutionary lineages, holometabola (insects with a complete metamorphosis during development) and hemimetabola (incomplete metamorphosis). This paper describes the first AKH receptor from...

  17. [Asymmetry of antennal grooming in the cockroach (Periplaneta americana)].

    Science.gov (United States)

    2014-07-01

    The present study was conducted to determine the key features of antennal grooming of male American cockroaches in neutral circumstances. It was shown for the first time that the right antenna was cleaned significantly more often than the left one, which indicates the presence of functional asymmetry of antennal grooming in this insect species. At the same time, no statistically significant asymmetry was found for grooming of antennal bases and legs. Morphological asymmetries of antennae and legs and/or brain lateralization are the plausible sources of observed behavioral asymmetry in antennal grooming.

  18. Modelling active antennal movements of the American cockroach

    DEFF Research Database (Denmark)

    Pequeno-Zurro, Alejandro; Nitschke, Jahn; Szyszka, Paul

    2017-01-01

    lacking. Here we report on an integrated experimental and computational approach to investigate how sensory information affects antennal movements. We present a modelling approach to characterise the relationship between antennal searching movement of the American cockroach Periplaneta americana......Cockroach antennae are multimodal sensory appendages engaging in active olfactory and tactile sensing. They are involved in unisensory behaviours such as chemotaxis, thigmotaxis, obstacle negotiation and tactile orientation. Studies of multisensory capabilities mediated by the antennae are however...

  19. Grooming behavior in American cockroach is affected by novelty and odor.

    Science.gov (United States)

    Zhukovskaya, Marianna I

    2014-01-01

    The main features of grooming behavior are amazingly similar among arthropods and land vertebrates and serve the same needs. A particular pattern of cleaning movements in cockroaches shows cephalo-caudal progression. Grooming sequences become longer after adaptation to the new setting. Novelty related changes in grooming are recognized as a form of displacement behavior. Statistical analysis of behavior revealed that antennal grooming in American cockroach, Periplaneta americana L., was significantly enhanced in the presence of odor.

  20. Potential of ultraviolet radiation for control of American cockroach populations

    International Nuclear Information System (INIS)

    Gingrich, J.B.; Pratt, J.J. Jr.; Mandels, G.R.

    1977-01-01

    Populations of Periplaneta americana (L.) were exposed for 8-20 week periods in specially designed rooms to 254 nm UV radiation at low intensity (50-115 ergs s -1 cm -2 ), high intensity (160-220 ergs s -1 cm -2 ), or to white light. The rooms contained tables and chairs to simulate occupied space, with food and water placed in positions exposed to UV radiation. 'General' irradiation (where the whole room was exposed to UV) at 115 ergs s -1 cm -2 and above was effective in producing high mortality in all stages except 8-10th instar nymphs and adults. 'Hot-spots' irradiation (where UV lamps were placed behind table and chair harborages) produced high mortality only in 1st-3rd instar nymphs which would result in slower elimination of a population. Crude aggregation pheromone was not successful in holding cockroaches close to radiation sources or substantially increasing mortality under the conditions of the experiments

  1. Population ecology and movement of the American cockroach (Dictyoptera: Blattidae) in sewers.

    Science.gov (United States)

    Tee, Hui-Siang; Saad, Ahmad Ramli; Lee, Chow-Yang

    2011-07-01

    The population size, age-class structure, and movement of the American cockroach, Periplaneta americana (L.) (Dictyoptera: Blattidae), were studied in three sewers in Penang, Malaysia, from September 2008 to October 2009. Eighteen to 20 glass-jar traps (two per manhole) were deployed for a 24-h period during each sampling occasion at each sewer. Adults and nymphs were active throughout the study period, with an average monthly trap catch of 57-97 adults and 79-99 nymphs. The mean proportions of adults and nymphs at the three sewers ranged from 0.47 to 0.57. Of the 2177 male and 2717 female cockroaches marked and released over the three sewers, recapture rates were 29.4-45.8 and 30.8-47.0%, respectively. The proportion of marked males and females did not differ significantly from the proportion of recaptured marked males and females. However, the mean number of times a marked female was recaptured was significantly greater than that of males. Of the 783 males and 1,030 females that were marked and recaptured, 19.4 and 24.7%, respectively, had moved between manholes, and significantly more females than males moved between manholes. Of the 406 recaptured marked adults that moved between manholes, 90.4% moved a distance of 2-20 m from their initial release site; one male moved 192 m, the longest distance recorded. Trap catch on each sampling occasion was positively correlated with daily mean temperature. The number of cockroach movements between manholes also was correlated with the mean daily minimum temperature.

  2. Evaluation of Piper aduncum Linn. Essential Oil (Fam:Piperaceae against Periplaneta americana(L.

    Directory of Open Access Journals (Sweden)

    I Ling A

    2009-12-01

    Full Text Available Background: The efficacy of Piper aduncum essential oil was evaluated against Periplaneta americana adults and nymphs in the laboratory."nMethods: The plant essential oil at varying concentrations ranging between 10,000 to 80,000 ppm were placed inside glass beakers, rolled horizontally to ensure the essential oil covers all sides of the beakers and exposed to adults and nymphs of P. americana. Resigen (R 1ppm was used as positive control and distilled water as negative control. The LT50 and LT90 was obtained using Log Probit programme."nResults: Exposure of essential oil to females P. americana at concentrations between 10,000 to 80,000 ppm indicated the LT50 and LT90 values between 5.31 h-189.19 h and 14.90 h-2105.31 h, respectively. Treatment with the same con­centrations against males P. americana ,the LT50 and LT90 were 2.08 h-181.73 h and 5.4 h-8460.51 h, respectively. Treatment against the nymphal stage with the same range of concentrations indicated the LT50 and LT 90 of 4.68 h-381.02 h and 28.71 h-5313.36 h, respectively.The nymphs and males were more susceptible than the females cock­roaches. Treatment with Resigen (R at 1ppm indicated much lower LT 50 and LT 90 values of 2.54 h-9.47 h for the fe­males, 1.47 h-4.22 h for the males and 4.69 h-8.92 h for the nymphs.The negative control indicated no mortality for all stages of the cockroach."nConclusion: Piper aduncum essential oil can be used as an alternative natural product for controlling the cockroach Peri­patetic americana. "nKeywords: Piper aduncum essential oil, Periplaneta americana, Adults, Nymphs

  3. Evaluation of Piper aduncum Linn. Essential Oil (Fam:Piperaceae against Periplaneta americana(L.

    Directory of Open Access Journals (Sweden)

    I Ling A

    2009-12-01

    Full Text Available Background: The efficacy of Piper aduncum essential oil was evaluated against Periplaneta americana adults and nymphs in the laboratory.Methods: The plant essential oil at varying concentrations ranging between 10,000 to 80,000 ppm were placed inside glass beakers, rolled horizontally to ensure the essential oil covers all sides of the beakers and exposed to adults and nymphs of P. americana. Resigen (R 1ppm was used as positive control and distilled water as negative control. The LT50 and LT90 was obtained using Log Probit programme.Results: Exposure of essential oil to females P. americana at concentrations between 10,000 to 80,000 ppm indicated the LT50 and LT90 values between 5.31 h-189.19 h and 14.90 h-2105.31 h, respectively. Treatment with the same con­centrations against males P. americana ,the LT50 and LT90 were 2.08 h-181.73 h and 5.4 h-8460.51 h, respectively. Treatment against the nymphal stage with the same range of concentrations indicated the LT50 and LT 90 of 4.68 h-381.02 h and 28.71 h-5313.36 h, respectively.The nymphs and males were more susceptible than the females cock­roaches. Treatment with Resigen (R at 1ppm indicated much lower LT 50 and LT 90 values of 2.54 h-9.47 h for the fe­males, 1.47 h-4.22 h for the males and 4.69 h-8.92 h for the nymphs.The negative control indicated no mortality for all stages of the cockroach.Conclusion: Piper aduncum essential oil can be used as an alternative natural product for controlling the cockroach Peri­patetic americana.

  4. The Distribution and Movement of American Cockroaches in Urban Niches of New Orleans.

    Science.gov (United States)

    Carlson, John C; Rabito, Felicia A; Werthmann, Derek; Fox, Mark

    2017-10-01

    American cockroaches are an important source of household allergens in tropical and semitropical climates. To determine which outdoor niches produce American cockroaches, traps were placed at 40 homes in New Orleans to collect nymphs. Nymphs were collected from the sewers, yards, and within the homes themselves. To compare sewers and yards as sources of cockroaches entering homes, adult cockroaches were collected, marked, and released into yards and sewers. No sewer-released cockroaches were collected in homes. Cockroaches released into yards were collected in the homes, suggesting that yards, rather than sewers, are a more important source niche. A field trial applying boric acid granules to the yard was performed in an effort to reduce entry of cockroaches. There was a significant reduction in the cockroach antigen collected in intervention homes compared with controls.

  5. Distribution of serotonergic and dopaminergic nerve fibers in the salivary gland complex of the cockroach Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Kühnel Dana

    2002-06-01

    Full Text Available Abstract Background The cockroach salivary gland consists of secretory acini with peripheral ion-transporting cells and central protein-producing cells, an extensive duct system, and a pair of reservoirs. Salivation is controled by serotonergic and dopaminergic innervation. Serotonin stimulates the secretion of a protein-rich saliva, dopamine causes the production of a saliva without proteins. These findings suggest a model in which serotonin acts on the central cells and possibly other cell types, and dopamine acts selectively on the ion-transporting cells. To examine this model, we have analyzed the spatial relationship of dopaminergic and serotonergic nerve fibers to the various cell types. Results The acinar tissue is entangled in a meshwork of serotonergic and dopaminergic varicose fibers. Dopaminergic fibers reside only at the surface of the acini next to the peripheral cells. Serotonergic fibers invade the acini and form a dense network between central cells. Salivary duct segments close to the acini are locally associated with dopaminergic and serotonergic fibers, whereas duct segments further downstream have only dopaminergic fibers on their surface and within the epithelium. In addition, the reservoirs have both a dopaminergic and a serotonergic innervation. Conclusion Our results suggest that dopamine is released on the acinar surface, close to peripheral cells, and along the entire duct system. Serotonin is probably released close to peripheral and central cells, and at initial segments of the duct system. Moreover, the presence of serotonergic and dopaminergic fiber terminals on the reservoir indicates that the functions of this structure are also regulated by dopamine and serotonin.

  6. Laboratory Evaluation of Toxicity of Insecticide Formulations from Different Classes against American Cockroach (Dictyoptera: Blattidae.

    Directory of Open Access Journals (Sweden)

    Ruhma Syed

    2014-06-01

    Full Text Available The present study was designed to investigate the insecticidal efficacy of four different classes of insecticides: pyrethroids, organophosphates, phenyl-pyrazoles and neo-nicotenoids. One representative chemical from each class was selected to compare the toxicity: deltamethrin from pyrethroids, Dichlorovinyl Dimethyl Phosphate (DDVP from organophosphates, fipronil from phenyl-pyrazoles and imidacloprid from neo-nicotenoids. The objective of this study was to determine which of these insecticides were most effective against American cockroach.These insecticides were tested for their LC50 values against Periplaneta americana under topical bioassay method, using different concentrations for each chemical.Fipronil 2.5% EC was highly effective at all concentrations applied, while DDVP 50% EC was least toxic amongst all. One way analysis of variance confirmed significant differences between mortality of P. americana and different concentrations applied (P< 0.05.Locality differentiation is an important factor in determining the range of resistance between various localities, as all three localities behaved differently in terms of their levels of resistance.

  7. Variation in the mechanical properties of tracheal tubes in the American cockroach

    International Nuclear Information System (INIS)

    Becker, Winston R; Webster, Matthew R; De Vita, Raffaella; Socha, John J

    2014-01-01

    The insect cuticle serves the protective role of skin and the supportive role of the skeleton while being lightweight and flexible to facilitate flight. The smart design of the cuticle confers camouflage, thermo-regulation, communication, self-cleaning, and anti-wetting properties to insects. The mechanical behavior of the internal cuticle of the insect in tracheae remains largely unexplored due to their small size. In order to characterize the material properties of insect tracheae and understand their role during insect respiration, we conducted tensile tests on ring sections of tracheal tubes of American cockroaches (Periplaneta americana). A total of 33 ring specimens collected from 14 tracheae from the upper thorax of the insects were successfully tested. The ultimate tensile strength (22.6 ± 13.3 MPa), ultimate strain (1.57 ± 0.68%), elastic modulus (1740 ± 840 MPa), and toughness (0.175 ± 0.156 MJ m −3 ) were measured. We examined the high variance in mechanical properties statistically and demonstrated that ring sections excised from the same trachea exhibit comparable mechanical properties. Our results will form the basis for future studies aimed at determining the structure–function relationship of insect tracheal tubes, ultimately inspiring the design of multi-functional materials and structures. (technical note)

  8. Investigation on American cockroaches medically important bacteria in Khorramshahr hospital, Iran

    Directory of Open Access Journals (Sweden)

    Hamid Kassiri

    2014-06-01

    Full Text Available Objective: To investigate American cockroaches' infection to various bacteria in Khorramshahr Vali-e-Asr hospital, which was done in 2008. Methods: In this descriptive cross-sectional study, 20 American cockroaches were caught via direct collection. Medically important bacteria were extracted from their outer surface of bodies by standard procedures. Results: Culturing outer surface wash of cockroaches resulted in the separation of Klebsiella, Pseudomonas, Escherichia coli, Staphylococcus, Proteus and Streptococcus. The main common bacteria were Klebsiella (35% and Pseudomonas (30%. Also, results of culture media showed that about 90% of cockroaches infected to at least one bacterium. Conclusions: American cockroaches can transmit pathogenic and potential pathogenic bacteria, therefore their presence in hospitals may be a sanitation challenge. It is recommended to assess plans in purpose to combat these pests in the hospitals.

  9. Distinct localization of FMRFamide- and bovine pancreatic polypeptide-like material in the brain, retrocerebral complex and suboesophageal ganglion of the cockroach Periplaneta americana L

    DEFF Research Database (Denmark)

    Verhaert, P; Grimmelikhuijzen, C J; De Loof, A

    1985-01-01

    One bovine pancreatic polypeptide (BPP) antiserum and two FMRFamide antisera were applied in the peroxidase-antiperoxidase (PAP) immunohistochemical technique on a complete series of sections of brains, suboesophageal ganglia (SOG), corpora cardiaca (CC) and corpora allata of Periplaneta americana...... L. Double immunohistochemical staining demonstrated that the same perikarya and processes were stained by both the BPP and FMRFamide antisera. This was caused by cross-reaction of the BPP and FMRFamide antisera with common antigenic determinants as was shown by a number of solid-phase absorptions....... Application of a third FMRFamide antiserum, which was especially selected for its inability to react with bovine and avian pancreatic polypeptide, showed that more than half of the structures that were stained with the 'unspecific' BPP and FMRFamide antisera, contained material which was genuinely FMRFamide...

  10. Cockroach Allergy

    Science.gov (United States)

    ... the Allergist Search Health Professionals Partners Media Donate Allergies Cockroach Allergy Cockroaches are insects that live in many locations ... other children with asthma. What Is a Cockroach Allergy? Cockroaches contain a protein that is an allergen ...

  11. Mixing compatibilities of Aspergillus and American cockroach allergens with other high-protease fungal and insect extracts.

    Science.gov (United States)

    Grier, Thomas J; Hall, Dawn M; Duncan, Elizabeth A; Coyne, Terrance C

    2015-03-01

    Recent studies have shown that Alternaria and German cockroach allergens can be degraded by endogenous proteases from other insect and fungal extracts when combined for immunotherapy, but data supporting the compatibilities of other high-protease products in comparable mixtures have not been reported. To assess the stabilities and compatibilities of Aspergillus fumigatus and American cockroach allergens after mixing with protease-rich extracts from other insects or fungi at concentrations similar to those recommended for subcutaneous immunotherapy. Mixtures containing A fumigatus, American cockroach, and other fungal or insect extracts were evaluated by quantitative (enzyme-linked immunosorbent assays) and qualitative (immunoblotting) methods. Test mixtures and control samples at 10% to 50% glycerin concentrations were analyzed after storage for up to 12 months at 2°C to 8°C. Moderate to high recoveries of Aspergillus extract activities were retained in control samples and extract mixtures under all conditions examined. American cockroach extract controls were partly degraded at 10% to 25% glycerin, and cockroach allergen compatibilities were decreased significantly in mixtures with several fungal extracts at 25% glycerin. Mixing with other insects did not compromise the stability of American cockroach allergens at 25% to 50% glycerin. Aspergillus extracts exhibited favorable stabilities after mixing with other high-protease products. American cockroach extract potencies were unstable in less than 50% glycerin, even in the absence of other protease-containing allergens, and were destabilized in mixtures with several fungal extracts. Addition of fungal and insect extracts to separate treatment vials or preparation of fungal-insect mixtures at elevated glycerin concentrations might be necessary to produce compatible patient formulations for allergen immunotherapy injections. Copyright © 2015 American College of Allergy, Asthma & Immunology. Published by Elsevier

  12. Comparative study of specific IgE for cockroach between asthma and allergic rhinitis patients

    International Nuclear Information System (INIS)

    Guo Yinshi; Xu Yiping; Zhu Lijun; Wang Limin; Cao Lingxian; Yao Suhang

    2005-01-01

    To compare the degrees of allergic reaction and the cross-reactive allergens for three strains of cockroach (Periplanceta fuliginosa , Periplaneta americana and Blattella germanica) between patients with asthma and allergic rhinitis, the specific IgE(sIgE) in asthma and allergic rhinitis for these three strains of cockroach were determined with ELISA. The results showed that the sIgE positive rates for Periplaneta americana, Periplaneta fuliginosa and Blattella germanica in patients with asthma were 23.5%, 16.0% and 14.8%, respectively. The reactive coincidence rate between Periplaneta americana and Periplaneta fuliginoas was 74.0%, between Periplaneta americana and Blattella germanica was 73.5%, and between Periplaneta fuliginosa and Blattella germanica was 85.0% in asthma patients. The IgE positive rates for Periplaneta americana, Periplaneta fuliginosa and Blattella gerraanica in allergic rhinitis patients were 24.8%, 17.6% and 15.8%, respectively. The reactive coincidence rate between Periplaneta americana and Periplaneta fuliginosa was 73.9%, between Periplaneta americana and Blattella germanica was 75.2%, and between Periplaneta fuliginosa and Blattella germanica was 86.1% in allergic rhinitis patients. There was no significant difference between asthma and allergic rhinitis patients although the sIgE positive rates of allergic rhinitis patients were higher than those of asthma patients for these three strains of cock- roach. All these results indicated that the degrees of allergic reaction are similar between asthma and allergic rhinitis patients and there are some cross-reactive allergic components among these three strains of cockroach. (authors)

  13. Effect of thiamethoxam on cockroach locomotor activity is associated with its metabolite clothianidin.

    Science.gov (United States)

    Benzidane, Yassine; Touinsi, Sarra; Motte, Emilie; Jadas-Hécart, Alain; Communal, Pierre-Yves; Leduc, Lionel; Thany, Steeve H

    2010-12-01

    In the present study, the effect of thiamethoxam and clothianidin on the locomotor activity of American cockroach, Periplaneta americana (L.), was evaluated. Because it has been proposed that thiamethoxam is metabolised to clothianidin, high-performance liquid chromatography coupled with mass spectrometry was used to evaluate the amount of clothianidin on thiamethoxam-treated cockroaches. One hour after neonicotinoid treatment, the time spent in the open-field-like apparatus significantly increased, suggesting a decrease in locomotor activity. The percentage of cockroaches displaying locomotor activity was significantly reduced 1 h after haemolymph application of 1 nmol g(-1) neonicotinoid, while no significant effect was found after topical and oral administration. However, at 24 and 48 h, all neonicotinoids were able to reduce locomotor activity, depending on their concentrations and the way they were applied. Interestingly, it was found that thiamethoxam was converted to clothianidin 1 h after application, but the amount of clothianidin did not rise proportionately to thiamethoxam, especially after oral administration. The data suggest that the effect of thiamethoxam on cockroach locomotor activity is due in part to clothianidin action because (1) thiamethoxam levels remained persistent 48 h after application and (2) the amount of clothianidin in cockroach tissues was consistent with the toxicity of thiamethoxam. Copyright © 2010 Society of Chemical Industry.

  14. Antibiotics susceptibility patterns of bacteria isolated from American and German cockroaches as potential vectors of microbial pathogens in hospitals

    Directory of Open Access Journals (Sweden)

    Mohammad Reza Fakoorziba

    2014-09-01

    Full Text Available Objective: To identify the cockroach species, their bacterial flora and antibiotics susceptibility patterns of these bacteria in Shiraz. Methods: In the present descriptive study, only two species of cockroaches were recognized. The washing solutions from the digestion systems and surfaces of 156 American and German cockroaches were cultured. The latter was found to be the commonest (89.7% in all places. Results: Overall, 18 species of bacteria were isolated and identified by standard culture methods. The most frequent bacterium isolated from both species of cockroaches in all places was Pseudomonas (41.7%. The second and third commonest bacteria were Enterobacter (39.7% and Klebsiella (32.7%, respectively. Conclusions: The antibiogram profiles showed full (100% resistance of Klebsiella, Citrobacter, Acinetobacter and Proteus to amoxicillin and ampicillin at both hospitals, while Pseudomonas showed resistance (95.7% to cephalothin. Thus it is concluded that German and American cockroaches carry multidrug resistant bacteria in two hospitals which raises alarm for stricter control measures.

  15. Preparation and Identification of Per a 5 as a Novel American Cockroach Allergen

    Directory of Open Access Journals (Sweden)

    Ji-Fu Wei

    2014-01-01

    Full Text Available Glutathione S-transferase (GST from various arthropods can elicit allergic reactions. In the present study, Per a 5, a GST, was cloned from American cockroach (CR and expressed in both baculovirus-infected insect cell (iPer a 5 and E. coli expression (bPer a 5 systems. The secondary structures were predicted to be 45.93 and 8.69% of α-helix β-sheets in iPer a 5 and 42.54 and 8.49% of α-helix and β-sheets in bPer a 5, respectively. It is found that 4 out of 16 (25% sera from American CR allergy patients reacted to both bPer a 9 and iPer a 9 as assessed by ELISA and Western blotting analysis, confirming that Per a 5 is not a major allergen of American CR. Induction of upregulated expression of CD63 and CCR3 on passively sensitized human basophils (sera from American CR allergy patients by approximately up to 4.5- and 3.2-fold indicates that iPer a 5 and bPer a 5 are functionally active. Recombinant Per a 5 (rPer a 5 should be a useful tool for studying and understanding the role of Per a 5 in CR allergy.

  16. IgE-Binding Epitope Mapping and Tissue Localization of the Major American Cockroach Allergen Per a 2.

    Science.gov (United States)

    Lee, Mey Fann; Chang, Chia Wei; Song, Pei Pong; Hwang, Guang Yuh; Lin, Shyh Jye; Chen, Yi Hsing

    2015-07-01

    Cockroaches are the second leading allergen in Taiwan. Sensitization to Per a 2, the major American cockroach allergen, correlates with clinical severity among patients with airway allergy, but there is limited information on IgE epitopes and tissue localization of Per a 2. This study aimed to identify Per a 2 linear IgE-binding epitopes and its distribution in the body of a cockroach. The cDNA of Per a 2 was used as a template and combined with oligonucleotide primers specific to the target areas with appropriate restriction enzyme sites. Eleven overlapping fragments of Per a 2 covering the whole allergen molecule, except 20 residues of signal peptide, were generated by PCR. Mature Per a 2 and overlapping deletion mutants were affinity-purified and assayed for IgE reactivity by immunoblotting. Three synthetic peptides comprising the B cell epitopes were evaluated by direct binding ELISA. Rabbit anti-Per a 2 antibody was used for immunohistochemistry. Human linear IgE-binding epitopes of Per a 2 were located at the amino acid sequences 57-86, 200-211, and 299-309. There was positive IgE binding to 10 tested Per a 2-allergic sera in 3 synthetic peptides, but none in the controls. Immunostaining revealed that Per a 2 was localized partly in the mouth and midgut of the cockroach, with the most intense staining observed in the hindgut, suggesting that the Per a 2 allergen might be excreted through the feces. Information on the IgE-binding epitope of Per a 2 may be used for designing more specific diagnostic and therapeutic approaches to cockroach allergy.

  17. In silico epitope prediction, expression and functional analysis of Per a 10 allergen from the American cockroach

    Science.gov (United States)

    Tong, Xunliang; Guo, Miao; Jin, Min; Chen, Hao; Li, Yanming; Wei, Ji-Fu

    2016-01-01

    Cockroach (CR) allergies caused by the American cockroach hyave been recognized to be repsonsible for IgE-mediated type I hypersensitivity worldwide. Per a 10 is one of the recognized main allergens of the American CR. In a previous study, we examined another American CR allergen, Per a 9 in patients with CR allergies and examined epitope sequences in this allergen. In the present study, we aimed to examine epitope sequences in the Per a 10 allergen. for this purpose, the Per a 10 gene was cloned and expressed in Escherichia coli (E. coli) systems. Our results revealed that 9 out of 16 (56.3%) sera from patients with American CR allergies reacted to Per a10, as assessed by ELISA, confirming that Per a 10 is a major allergen of the American CR. Our results also revealed that the expression of CD63 and CCR3 on passively sensitized basophils (obtained sera of patients with American CR allergies) was increased by approximately 2.3-fold, indicating that recombinant Per a 10 is functionally active. In addition, 3 immunoinformatics tools, namely the DNAStar Protean system, the Bioinformatics Predicted Antigenic Peptides (BPAP) system and the BepiPred 1.0 server were used to predict the peptides and the results revealed 8 peptides (2–12, 55–67, 98–120, 125–133, 149–160, 170–182, 201–208 and 223–227) as potential B cell epitopes of the Per a 10 allergen. Moreover, Per a 10 was predicted to have 3 T cell epitope sequences, namely 83–92, 139–147 and 162–170. The findings of our study on the CR allergen may prove to be useful in the development of peptide-based vaccine for the prevention and/or treatment of CR allergies. PMID:27840898

  18. Static electric fields modify the locomotory behaviour of cockroaches.

    Science.gov (United States)

    Jackson, Christopher W; Hunt, Edmund; Sharkh, Suleiman; Newland, Philip L

    2011-06-15

    Static electric fields are found throughout the environment and there is growing interest in how electric fields influence insect behaviour. Here we have analysed the locomotory behaviour of cockroaches (Periplaneta americana) in response to static electric fields at levels equal to and above those found in the natural environment. Walking behaviour (including velocity, distance moved, turn angle and time spent walking) were analysed as cockroaches approached an electric field boundary in an open arena, and also when continuously exposed to an electric field. On approaching an electric field boundary, the greater the electric field strength the more likely a cockroach would be to turn away from, or be repulsed by, the electric field. Cockroaches completely exposed to electric fields showed significant changes in locomotion by covering less distance, walking slowly and turning more often. This study highlights the importance of electric fields on the normal locomotory behaviour of insects.

  19. Insect-specific irreversible inhibitors of acetylcholinesterase in pests including the bed bug, the eastern yellowjacket, German and American cockroaches, and the confused flour beetle.

    Science.gov (United States)

    Polsinelli, Gregory A; Singh, Sanjay K; Mishra, Rajesh K; Suranyi, Robert; Ragsdale, David W; Pang, Yuan-Ping; Brimijoin, Stephen

    2010-09-06

    Insecticides directed against acetylcholinesterase (AChE) are facing increased resistance among target species as well as increasing concerns for human toxicity. The result has been a resurgence of disease vectors, insects destructive to agriculture, and residential pests. We previously reported a free cysteine (Cys) residue at the entrance to the AChE active site in some insects but not higher vertebrates. We also reported Cys-targeting methanethiosulfonate molecules (AMTSn), which, under conditions that spared human AChE, caused total irreversible inhibition of aphid AChE, 95% inhibition of AChE from the malaria vector mosquito (Anopheles gambia), and >80% inhibition of activity from the yellow fever mosquito (Aedes aegypti) and northern house mosquito (Culex pipiens). We now find the same compounds inhibit AChE from cockroaches (Blattella germanica and Periplaneta americana), the flour beetle (Tribolium confusum), the multi-colored Asian ladybird beetle (Harmonia axyridis), the bed bug (Cimex lectularius), and a wasp (Vespula maculifrons), with IC(50) values of approximately 1-11muM. Our results support further study of Cys-targeting inhibitors as conceptually novel insecticides that may be free of resistance in a range of insect pests and disease vectors and, compared with current compounds, should demonstrate much lower toxicity to mammals, birds, and fish. Copyright (c) 2010 Elsevier Ireland Ltd. All rights reserved.

  20. Cockroaches ’ bacterial infections in wards of hospitals, Hamedan city, west of Iran

    Directory of Open Access Journals (Sweden)

    Nejati Jalil

    2012-10-01

    Full Text Available Objective: To identify the relationship between different species of cockroaches with their bacterial infection in different wards of Hamedan county hospitals, western Iran. Methods: Using sticky trap, hand collection and glass trap, 250 cockroaches were collected from 14 wards of 5 hospitals. After having their identification determined by detection key, all of them were used to isolate bacteria from cuticle and alimentary tract. Results: From four identified species, Blatella germanica were the most common in all of the wards (88.8% and next was the Periplaneta Americana (8%. 20 bacteria species isolated from cockroaches' surface and 21 from digestive organ. Escherichia coli were the most predominant bacteria isolated from external surface (26.5 % as well as alimentary tract (30.8%. The frequency of investigated bacteria on cockroaches' body surface was not significantly different between Periplaneta Americana and Blattella germanica except for Kllebsiella oxytoca (P<0.001 and Providensia Spp (P=0.035. Also, frequency of detected bacteria in cockroaches' digestive organ was not significantly different between these two species. Furthermore, the frequency of bacteria isolated from the cockroaches' external surface was not significantly different from that of digestive organ except for shigella disantery (P<0.001, Pseudomonas aeroginosa (P<0.001 and Klebsiella oxytoca (P=0.01 3. Conclusions: Since cockroaches can carry pathogenic bacteria, so their existence in the hospitals could be a serious public health problem. It is suggested to compile programs in order to control cockroaches especially in the hospitals.

  1. Cockroach GABAB receptor subtypes: molecular characterization, pharmacological properties and tissue distribution.

    Science.gov (United States)

    Blankenburg, S; Balfanz, S; Hayashi, Y; Shigenobu, S; Miura, T; Baumann, O; Baumann, A; Blenau, W

    2015-01-01

    γ-aminobutyric acid (GABA) is the predominant inhibitory neurotransmitter in the central nervous system (CNS). Its effects are mediated by either ionotropic GABAA receptors or metabotropic GABAB receptors. GABAB receptors regulate, via Gi/o G-proteins, ion channels, and adenylyl cyclases. In humans, GABAB receptor subtypes are involved in the etiology of neurologic and psychiatric disorders. In arthropods, however, these members of the G-protein-coupled receptor family are only inadequately characterized. Interestingly, physiological data have revealed important functions of GABAB receptors in the American cockroach, Periplaneta americana. We have cloned cDNAs coding for putative GABAB receptor subtypes 1 and 2 of P. americana (PeaGB1 and PeaGB2). When both receptor proteins are co-expressed in mammalian cells, activation of the receptor heteromer with GABA leads to a dose-dependent decrease in cAMP production. The pharmacological profile differs from that of mammalian and Drosophila GABAB receptors. Western blot analyses with polyclonal antibodies have revealed the expression of PeaGB1 and PeaGB2 in the CNS of the American cockroach. In addition to the widespread distribution in the brain, PeaGB1 is expressed in salivary glands and male accessory glands. Notably, PeaGB1-like immunoreactivity has been detected in the GABAergic salivary neuron 2, suggesting that GABAB receptors act as autoreceptors in this neuron. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Quality of housing and allergy to cockroaches in the Dominican Republic.

    Science.gov (United States)

    Barnes, K C; Brenner, R J

    1996-01-01

    Fifty-one atopic asthmatic and/or allergic rhinitic children and 23 nonatopic control from Santo Domingo, the Dominican Republic, were skin tested with an extract mix of three cockroach species (Blattella germanica, Blatta orientalis, and Periplaneta americana). Sixteen percent of the atopics and none of the nonatopics demonstrated positive immediate skin reactions to the cockroach mix (chi 2 = 4.05, p = 0.04). Hypersensitivity was correlated with the quality of the homes; 22% (8/36) of the atopics who lived in a concrete home were skin test positive to the cockroach mix, while none (0/15) of the atopics who lived in a wood home were skin test positive (chi 2 = 4.86, p = 0.03). Although the incidence of cockroach allergy in this study is lower than that found elsewhere, these data support the notion that, in this tropical environment, sensitization to cockroaches is associated with housing quality.

  3. Cockroaches as carriers of human intestinal parasites in two localities in Ethiopia.

    Science.gov (United States)

    Kinfu, Addisu; Erko, Berhanu

    2008-11-01

    A study was undertaken to assess the role of cockroaches as potential carriers of human intestinal parasites in Addis Ababa and Ziway, Ethiopia. A total of 6480 cockroaches were trapped from the two localities from October 2006 to March 2007. All the cockroaches trapped in Addis Ababa (n=2240) and almost 50% (2100/4240) of those trapped in Ziway were identified as Blattella germanica. The rest of the cockroaches trapped in Ziway were identified as Periplaneta brunnea (24.52%), Pycnoscelus surinamensis (16.03%) and Supella longipalpa (9.90%). Microscopic examination of the external body washes of pooled cockroaches and individual gut contents revealed that cockroaches are carriers of Entamoeba coli and Entamoeba histolytica/dispar cysts as well as Enterobius vermicularis, Trichuris trichiura, Taenia spp. and Ascaris lumbricoides ova. Besides their role as a nuisance, the present study further confirms that cockroaches serve as carriers of human intestinal parasites. The possible association of cockroaches with allergic conditions such as asthma is also discussed. Hence, appropriate control measures should be taken particularly to make hotels and residential areas free of cockroaches as they represent a health risk.

  4. Pathogenicity of Aspergillus westerdijkiae to females and oothecae of Periplaneta Americana

    Directory of Open Access Journals (Sweden)

    Mariah Valente Baggio

    2016-01-01

    Full Text Available ABSTRACT: Cockroach control is performed by the application of chemical insecticides which exert high selective pressure on populations and introduces synthetic substances in the environment, motivating the search for other methods of control such as entomopathogenic fungi. The objectives of this study were to investigate the pathogenicity of the JAB 42 Aspergillus westerdijkiae to females and oothecae of Periplaneta americana and to demonstrate its mechanism of action on oothecae. Suspensions containing 106 to 108 conidia/ml were used to infect females and oothecae. Mortality and other variables such as scanning electron microscopy were used to demonstrate the mechanism of action of the fungus. The isolated JAB 42 A. westerdijkiae is pathogenic to oothecae of P. americana, with low capacity to kill females. Adhesion, germination, penetration and extrusion of the fungus on the cockroach oothecae were observed.

  5. Genetic diversity of Entamoeba: Novel ribosomal lineages from cockroaches.

    Directory of Open Access Journals (Sweden)

    Tetsuro Kawano

    Full Text Available Our current taxonomic perspective on Entamoeba is largely based on small-subunit ribosomal RNA genes (SSU rDNA from Entamoeba species identified in vertebrate hosts with minor exceptions such as E. moshkovskii from sewage water and E. marina from marine sediment. Other Entamoeba species have also been morphologically identified and described from non-vertebrate species such as insects; however, their genetic diversity remains unknown. In order to further disclose the diversity of the genus, we investigated Entamoeba spp. in the intestines of three cockroach species: Periplaneta americana, Blaptica dubia, and Gromphadorhina oblongonota. We obtained 134 Entamoeba SSU rDNA sequences from 186 cockroaches by direct nested PCR using the DNA extracts of intestines from cockroaches, followed by scrutinized BLASTn screening and phylogenetic analyses. All the sequences identified in this study were distinct from those reported from known Entamoeba species, and considered as novel Entamoeba ribosomal lineages. Furthermore, they were positioned at the base of the clade of known Entamoeba species and displayed remarkable degree of genetic diversity comprising nine major groups in the three cockroach species. This is the first report of the diversity of SSU rDNA sequences from Entamoeba in non-vertebrate host species, and should help to understand the genetic diversity of the genus Entamoeba.

  6. There are more asthmatics in homes with high cockroach infestation

    Directory of Open Access Journals (Sweden)

    Sarinho E.

    2004-01-01

    Full Text Available Although asthma has been commonly associated with sensitivity to cockroaches, a clear causal relationship between asthma, allergy to cockroaches and exposure levels has not been extensively investigated. The objective of the present study was to determine whether asthma occurs more frequently in children living in homes with high cockroach infestation. The intensity of household infestation was assessed by the number of dead insects after professional pesticide application. Children living in these houses in the metropolitan area of Recife, PE, were diagnosed as having asthma by means of a questionnaire based on the ISAAC study. All children had physician-diagnosed asthma and at least one acute exacerbation in the past year. Children of both sexes aged 4 to 12 years who had been living in the households for more than 2 years participated in this transverse study and had a good socioeconomic status. In the 172 houses studied, 79 children were considered to have been exposed to cockroaches and 93 not to have been exposed. Children living in residences with more than 5 dead cockroaches after pesticide application were considered to be at high infestation exposure. Asthma was diagnosed by the questionnaire in 31.6% (25/79 of the exposed group and in 11.8% (11/93 of the non-exposed group (P = 0.001, with a prevalence ratio of 3.45 (95%CI, 1.48-8.20. The present results indicate that exposure to cockroaches was significantly associated with asthma among the children studied and can be considered a risk factor for the disease. Blattella germanica and Periplaneta americana were the species found in 96% of the infested houses.

  7. The prevalence of protozoa in the gut of German cockroaches (Blattella germanica) with special reference to Lophomonas blattarum.

    Science.gov (United States)

    Martínez-Girón, Rafael; Martínez-Torre, Cristina; van Woerden, Hugo Cornelis

    2017-11-01

    The German cockroach (Blattella germanica) is a common domestic pest, which produces allergens that have been associated with broncho-pulmonary disease. Various protozoan species have been identified in the intestine of this cockroach and it has been hypothesised that these protozoa, or their proteases, may contribute to the burden of cockroach-associated allergens and adjuvants present in domestic dust. The aim of this study was therefore to determine the prevalence of protozoan species in the intestine of Blattella germanica. German cockroaches were anesthetised and dissected and gut contents are used to produce wet slides for microscopy. Both, Giemsa and Papanicolaou stains were used to confirm correct identification of Lophomonas blattarum. Representatives of four genera of protozoa were identified in 110 cockroaches: Nyctoterus sp. was observed in 91.8% of cases, Gregarina sp. in 64.5%, Amoeba sp. in 25.4% and Lophomonas blattarum in 13.6%. Nyctoterus and Gregarina were statistically significantly more likely to be found in diseased cockroaches compared to Amoeba or Lophomonas. The prevalence of Lophomonas blattarum was similar to that in published studies of a different species of cockroach, Periplaneta americana. Further work is needed to assess the interplay between protozoa, cockroaches and broncho-pulmonary diseases.

  8. Molecular cloning, expression, IgE binding activities and in silico epitope prediction of Per a 9 allergens of the American cockroach

    Science.gov (United States)

    Yang, Haiwei; Chen, Hao; Jin, Min; Xie, Hua; He, Shaoheng; Wei, Ji-Fu

    2016-01-01

    Per a 9 is a major allergen of the American cockroach (CR), which has been recognized as an important cause of imunoglobulin E-mediated type I hypersensitivity worldwide. However, it is not neasy to obtain a substantial quantity of this allergen for use in functional studies. In the present study, the Per a 9 gene was cloned and expressed in Escherichia coli (E. coli) systems. It was found that 13/16 (81.3%) of the sera from patients with allergies caused by the American CR reacted to Per a 9, as assessed by enzyme-linked immunosorbent assay, confirming that Per a 9 is a major allergen of CR. The induction of the expression of CD63 and CCR3 in passively sensitized basophils (from sera of patients with allergies caused by the American CR) by approximately 4.2-fold indicated that recombinant Per a 9 was functionally active. Three immunoinformatics tools, including the DNASTAR Protean system, Bioinformatics Predicted Antigenic Peptides (BPAP) system and the BepiPred 1.0 server were used to predict the potential B cell epitopes, while Net-MHCIIpan-2.0 and NetMHCII-2.2 were used to predict the T cell epitopes of Per a 9. As a result, we predicted 11 peptides (23–28, 39–46, 58–64, 91–118, 131–136, 145–154, 159–165, 176–183, 290–299, 309–320 and 338–344) as potential B cell linear epitopes. In T cell prediction, the Per a 9 allergen was predicted to have 5 potential T cell epitope sequences, 119–127, 194–202, 210–218, 239–250 and 279–290. The findings of our study may prove to be useful in the development of peptide-based vaccines to combat CR-induced allergies. PMID:27840974

  9. Contamination of cockroaches (Insecta: Blattaria) to medically fungi: A systematic review and meta-analysis.

    Science.gov (United States)

    Nasirian, H

    2017-12-01

    Fungal infections have emerged worldwide. Cockroaches have been proved vectors of medically fungi. A systematic meta-analysis review about cockroach fungal contamination was investigated. Relevant topics were collected between January 2016 and January 2017. After a preliminary review among 392 collected papers, 156 were selected to become part of the detailed systematic meta-analysis review. Cockroaches contaminated to 38 fungi species belonging to 19 families and 12 orders. About 38, 25 and 13 fungal species were recovered from the American, German and brown-banded cockroaches, respectively with a variety of medical importance. Except the fungi isolated from German and brown-banded cockroaches, 15 species have been isolated only from the American cockroaches. The global world mean and trend of cockroach fungal contamination were 84.1 and 50.6-100%, respectively in the human dwelling environments. There is a significant difference between cockroach fungal contamination in the urban and rural environments (P0.05). The external and internal cockroach fungal contamination is more dangerous than entire surfaces, while the internal is more dangerous than the external surface. The German and brown-banded cockroach fungal contamination are more dangerous than the American cockroaches in the hospital environments. The study indicates that globally cockroach fungal contamination has been increased recognizing as agents of human infections and associating with high morbidity and mortality in immune-compromised patients. These facts, along with insecticide resistance emergence and increasing globally cockroach infestation, reveal importance of cockroaches and need for their control more than ever. Copyright © 2017 Elsevier Masson SAS. All rights reserved.

  10. Synthèses enzymatiques de néoglucoconjugués catalysées par l'alpha-glucosidase purifiée de la blatte Periplaneta americana (Linnaeus

    Directory of Open Access Journals (Sweden)

    Kamenan A.

    2005-01-01

    Full Text Available Enzymatic synthesis of neoglucoconjugates by purified α-glucosidase from cockroach Periplaneta americana (Linnaeus. Cockroach Periplaneta americana (Linnaeus contains in his digestive tract an acid (pH 5,0 and mesophile (50°C α-glucosidase. This enzyme, purified to homogeneity, hydrolyses highly maltose, sucrose and p-nitrophenyl-α-Dglucopyranoside. The ability of α-glucosidase from cockroach purified to homogeneity to catalyse transglucosylation reactions was tested using maltose and saccharose as glucosyl donors and 2-phenylethanol and phenol as acceptors. The experimental conditions were optimized in relation to the time course of the reaction, pH and concentrations of glucosyl donors and acceptors. The yields in transglucosylation reactions at 37 °C were very high and could attain 67% and 48% with 2-phenylethanol and phenol respectively as glucosyl acceptors. This α-glucosidase hydrolyzed the products formed. It seems that the products formed were the phenylethyl-α-D-glucoside and phenyl-α-D-glucoside. These results suggest that α- glucosidase from cockroach is an exoglucosidase which catalyse the splitting of the α-glucosyl residue from the non reducing terminal of the substrate to liberate α-glucose. This comportment indicates that this enzyme operated by a mechanism involving the retention of the anomeric configuration. On the basis of this work, α-glucosidase from P. americana appears to be a valuable tool for the preparation of α-neoglucoconjugates.

  11. Evaluation of Piper aduncum Linn. Essential Oil (Fam:Piperaceae) against Periplaneta americana (L.).

    Science.gov (United States)

    Ling A, I; Sulaiman, S; Othman, H

    2009-01-01

    The efficacy of Piper aduncum essential oil was evaluated against Periplaneta americana adults and nymphs in the laboratory. The plant essential oil at varying concentrations ranging between 10,000 to 80,000 ppm were placed inside glass beakers, rolled horizontally to ensure the essential oil covers all sides of the beakers and exposed to adults and nymphs of P. americana. Resigen (R) 1ppm was used as positive control and distilled water as negative control. The LT50 and LT90 was obtained using Log Probit programme. Exposure of essential oil to females P. americana at concentrations between 10,000 to 80,000 ppm indicated the LT50 and LT90 values between 5.31 h-189.19 h and 14.90 h-2105.31 h, respectively. Treatment with the same concentrations against males P. americana ,the LT50 and LT90 were 2.08 h-181.73 h and 5.4 h-8460.51 h, respectively. Treatment against the nymphal stage with the same range of concentrations indicated the LT50 and LT 90 of 4.68 h-381.02 h and 28.71 h-5313.36 h, respectively.The nymphs and males were more susceptible than the females cockroaches. Treatment with Resigen (R) at 1ppm indicated much lower LT 50 and LT 90 values of 2.54 h-9.47 h for the females, 1.47 h-4.22 h for the males and 4.69 h-8.92 h for the nymphs.The negative control indicated no mortality for all stages of the cockroach. Piper aduncum essential oil can be used as an alternative natural product for controlling the cockroach Peripatetic americana.

  12. Prevalence and Antibiotic Resistance of Gram-Negative Pathogenic Bacteria Species Isolated from Periplaneta americana and Blattella germanica in Varanasi, India.

    Directory of Open Access Journals (Sweden)

    D Leshan Wannigama

    2014-06-01

    Full Text Available Cockroaches are among the medically important pests found within the human habitations that cause serious public health problems. They may harbor a number of pathogenic bacteria on the external surface with antibiotic resistance. Hence, they are regarded as major microbial vectors. This study investigates the prevalence and antibiotic resistance of Gram-negative pathogenic bacteria species isolated from Periplaneta americana and Blattella germanica in Varanasi, India.Totally, 203 adult cockroaches were collected form 44 households and 52 food-handling establishments by trapping. Bacteriological examination of external surfaces of Pe. americana and Bl. germanica were carried out using standard method and antibiotics susceptibility profiles of the isolates were determined using Kirby-Bauer disc diffusion methods.Among the places, we found that 54% had cockroache infestation in households and 77% in food- handling establishments. There was no significant different between the overall bacteria load of the external surface in Pe. americana (64.04% and Bl. germanica (35.96%. However the predominant bacteria on cockroaches were Klebsiella pneumonia, Escherichia coli, Enterobacter aerogenes, and Pseudomonas aeruginosa. However, Kl. pneumoniae and Ps. aeruginosa were the most prevalent, drug-resistant strains were isolated from the cockroaches with 100% resistance to sulfamethoxazole/trimethoprim and ampicillin. For individual strains of bacteria, Escherichia coli was found to have multi-resistance to four antibiotic tested, Citrobacter freundii four, Enterobacter aerogenes and Proteus mirabilis to three.Cockroaches are uniformly distributed in domestic environment, which can be a possible vector for transmission of drug-resistant bacteria and food-borne diseases.

  13. Adipokinetic hormones control amylase activity in the cockroach (Periplaneta americana) gut

    Czech Academy of Sciences Publication Activity Database

    Bodláková, K.; Jedlička, Pavel; Kodrík, Dalibor

    2017-01-01

    Roč. 24, č. 2 (2017), s. 259-269 ISSN 1672-9609 R&D Projects: GA ČR GA14-07172S Institutional support: RVO:61388963 ; RVO:60077344 Keywords : AKH * AKH receptor * amylase * enzyme * gene expression * midgut Subject RIV: ED - Physiology OBOR OECD: Entomology; Biochemistry and molecular biology (BC-A) Impact factor: 2.026, year: 2016

  14. The role of gut microbiota in the regulation of standard metabolic rate in female Periplaneta americana

    Directory of Open Access Journals (Sweden)

    Paul A. Ayayee

    2018-05-01

    Full Text Available Insect gut microbiota contribute significantly to host nutritional ecology. Disrupting insect gut microbial assemblages impacts nutrient provisioning functions, and can potentially affect host standard metabolic rate (SMR, a measure of host energy balance. In this study, we evaluated the effect of disrupting gut microbial assemblages on the SMR of female Periplaneta americana cockroaches fed dog food (DF, high protein/carbohydrate (p/c ratio, and cellulose-amended dog food (CADF, 30% dog food, 70% cellulose, low p/c ratio diets, supplemented with none, low, or high antibiotic doses. Bacterial loads decreased significantly between diet types (P = 0.04 and across antibiotic doses (P = 0.04. There was a significant diet type x antibiotic dose interaction on SMR of females on both diets (P = 0.05 by the end of the seven-day experimental period. In CADF-fed females, SMR decreased linearly with decreasing bacterial load. However, SMR of DF-fed females on the low dose was significantly higher than those in the control and high dose groups. This is interpreted as a diet-dependent response by low dose DF-fed females to the loss of nutritional services provided by gut bacteria. Severe reductions in bacterial load at high doses reduced SMR of females on both diet types. This study provides insights into the potential role of gut bacteria as modulators of host energy expenditure under varying dietary conditions.

  15. Memory Consolidation and Gene Expression in "Periplaneta Americana"

    Science.gov (United States)

    Strausfeld, Nicholas J.; Pinter, Marianna; Lent, David D.

    2005-01-01

    A unique behavioral paradigm has been developed for "Periplaneta americana" that assesses the timing and success of memory consolidation leading to long-term memory of visual-olfactory associations. The brains of trained and control animals, removed at the critical consolidation period, were screened by two-directional suppression subtractive…

  16. Pathogenic Fungal Species Associated with Digestive System of Periplaneta americana (Blattaria: Blattidae Trapped from Residential Dwellings in Ahvaz City, Southwestern Iran

    Directory of Open Access Journals (Sweden)

    Hamid Kassiri

    2018-03-01

    Full Text Available Background: Cockroaches are the most prevalent domestic pests of a worldwide distribution. They were recognized as possible vectors of pathogenic bacteria, viruses, fungi and parasites in residential dwellings and hospital environ­ments. The present study isolated and identified yeasts and filamentous fungi from digestive tract of American cock­roaches, collected from three different residential regions of Iran.Methods: Seventy cockroaches were sampled using direct collection (hand catch, vacuum cleaner and sticky traps in Ahvaz, Iran in 2009–2010. Their medically important fungal microorganisms were isolated from digestive tract using standard mycological methods. Filamentous fungi were identified by macroscopic and microscopic examina­tion. Yeasts were identified by API ID32C-32100 kit.Results: A high percentage of cockroaches (88.6% were detected to carry fungi of medical importance. Overall, 23 fungi species/genera were isolated from the American cockroaches' alimentary tract. The fungi isolated from cock­roaches, from the residential regions were species of Aspergillus, Rhizopus, Penicillium, Mucorales, Alternaria, Cladosporium, Mycelia, Chrysosporium, Candida, Rhodotorula, Zygosaccharomyces, and Debaryomyces. Candida spp. (41.4%, Aspergillus spp. (37.1% and Rhodotorula spp (27.1% were the most common fungi recovered on cockroaches. Candida albicans and Candida glabrata were the commonest species of the genus Candida. In addi­tion, Aspergillus niger and A. flavus were the most frequent species of the genus Aspergillus.Conclusion: American cockroaches may carry pathogenic fungi in the urban areas of Ahvaz.

  17. Interplay between a Wnt-dependent organiser and the Notch segmentation clock regulates posterior development in Periplaneta americana

    Directory of Open Access Journals (Sweden)

    John E. Chesebro

    2012-12-01

    Sequential addition of segments in the posteriorly growing end of the embryo is a developmental mechanism common to many bilaterians. However, posterior growth and patterning in most animals also entails the establishment of a ‘posterior organiser’ that expresses the Caudal and Wnt proteins and has been proposed to be an ancestral feature of animal development. We have studied the functional relationships between the Wnt-driven organiser and the segmentation mechanisms in a basal insect, the cockroach Periplaneta americana. Here, posteriorly-expressed Wnt1 promotes caudal and Delta expression early in development to generate a growth zone from which segments will later bud off. caudal maintains the undifferentiated growth zone by dampening Delta expression, and hence Notch-mediated segmentation occurs just outside the caudal domain. In turn, Delta expression maintains Wnt1, maintaining this posterior gene network until all segments have formed. This feedback between caudal, Wnt and Notch-signalling in regulating growth and segmentation seems conserved in other arthropods, with some aspects found even in vertebrates. Thus our findings not only support an ancestral Wnt posterior organiser, but also impinge on the proposals for a common origin of segmentation in arthropods, annelids and vertebrates.

  18. Cellular elements for seeing in the dark: voltage-dependent conductances in cockroach photoreceptors

    Directory of Open Access Journals (Sweden)

    Salmela Iikka

    2012-08-01

    Full Text Available Abstract Background The importance of voltage-dependent conductances in sensory information processing is well-established in insect photoreceptors. Here we present the characterization of electrical properties in photoreceptors of the cockroach (Periplaneta americana, a nocturnal insect with a visual system adapted for dim light. Results Whole-cell patch-clamped photoreceptors had high capacitances and input resistances, indicating large photosensitive rhabdomeres suitable for efficient photon capture and amplification of small photocurrents at low light levels. Two voltage-dependent potassium conductances were found in the photoreceptors: a delayed rectifier type (KDR and a fast transient inactivating type (KA. Activation of KDR occurred during physiological voltage responses induced by light stimulation, whereas KA was nearly fully inactivated already at the dark resting potential. In addition, hyperpolarization of photoreceptors activated a small-amplitude inward-rectifying (IR current mediated at least partially by chloride. Computer simulations showed that KDR shapes light responses by opposing the light-induced depolarization and speeding up the membrane time constant, whereas KA and IR have a negligible role in the majority of cells. However, larger KA conductances were found in smaller and rapidly adapting photoreceptors, where KA could have a functional role. Conclusions The relative expression of KA and KDR in cockroach photoreceptors was opposite to the previously hypothesized framework for dark-active insects, necessitating further comparative work on the conductances. In general, the varying deployment of stereotypical K+ conductances in insect photoreceptors highlights their functional flexibility in neural coding.

  19. Transcriptome analysis and RNA interference of cockroach phototransduction indicate three opsins and suggest a major role for TRPL channels

    Directory of Open Access Journals (Sweden)

    Andrew S French

    2015-07-01

    Full Text Available Our current understanding of insect phototransduction is based on a small number of species, but insects occupy many different visual environments. We created the retinal transcriptome of a nocturnal insect, the cockroach, Periplaneta americana to identify proteins involved in the earliest stages of compound eye phototransduction, and test the hypothesis that different visual environments are reflected in different molecular contributions to function. We assembled five novel mRNAs: two green opsins, one UV opsin, and one each TRP and TRPL ion channel homologs. One green opsin mRNA (pGO1 was 100-1000 times more abundant than the other opsins (pGO2 and pUVO, while pTRPL mRNA was 10 times more abundant than pTRP, estimated by transcriptome analysis or quantitative PCR (qPCR. Electroretinograms were used to record photoreceptor responses. Gene-specific in vivo RNA interference (RNAi was achieved by injecting long (596-708 bp double-stranded RNA into head hemolymph, and verified by qPCR. RNAi of the most abundant green opsin reduced both green opsins by more than 97% without affecting UV opsin, and gave a maximal reduction of 75% in ERG amplitude seven days after injection that persisted for at least 19 days. RNAi of pTRP and pTRPL genes each specifically reduced the corresponding mRNA by 90%. Electroretinogram reduction by pTRPL RNAi was slower than for opsin, reaching 75% attenuation by 21 days, without recovery at 29 days. pTRP RNAi attenuated ERG much less; only 30% after 21 days. Combined pTRP plus pTRPL RNAi gave only weak evidence of any cooperative interactions. We conclude that silencing retinal genes by in vivo RNAi using long dsRNA is effective, that visible light transduction in Periplaneta is dominated by pGO1, and that pTRPL plays a major role in cockroach phototransduction.

  20. Prussakas on kõva hammustaja

    Index Scriptorium Estoniae

    2015-01-01

    Artikkel "Fast and Powerful: Biomechanics and Bite Forces of the Mandibles in the American Cockroach Periplaneta americana" on ilmunud ajakirjas PLOS ONE November 11, 2015 DOI: 10.1371/journal.pone.0141226

  1. Vectorial Potential of Cockroaches in Transmitting Parasites of ...

    African Journals Online (AJOL)

    infectious pathogens, control measures instituted in toilets, kitchens; and targeting especially the females and both stages of ... Cockroaches are among the most notorious pests of premises, they ..... Bacterial of cockroaches in relation to urban.

  2. Cockroaches probably cleaned up after dinosaurs.

    Directory of Open Access Journals (Sweden)

    Peter Vršanský

    Full Text Available Dinosaurs undoubtedly produced huge quantities of excrements. But who cleaned up after them? Dung beetles and flies with rapid development were rare during most of the Mesozoic. Candidates for these duties are extinct cockroaches (Blattulidae, whose temporal range is associated with herbivorous dinosaurs. An opportunity to test this hypothesis arises from coprolites to some extent extruded from an immature cockroach preserved in the amber of Lebanon, studied using synchrotron X-ray microtomography. 1.06% of their volume is filled by particles of wood with smooth edges, in which size distribution directly supports their external pre-digestion. Because fungal pre-processing can be excluded based on the presence of large particles (combined with small total amount of wood and absence of damages on wood, the likely source of wood are herbivore feces. Smaller particles were broken down biochemically in the cockroach hind gut, which indicates that the recent lignin-decomposing termite and cockroach endosymbionts might have been transferred to the cockroach gut upon feeding on dinosaur feces.

  3. Cockroaches probably cleaned up after dinosaurs.

    Science.gov (United States)

    Vršanský, Peter; van de Kamp, Thomas; Azar, Dany; Prokin, Alexander; Vidlička, L'ubomír; Vagovič, Patrik

    2013-01-01

    Dinosaurs undoubtedly produced huge quantities of excrements. But who cleaned up after them? Dung beetles and flies with rapid development were rare during most of the Mesozoic. Candidates for these duties are extinct cockroaches (Blattulidae), whose temporal range is associated with herbivorous dinosaurs. An opportunity to test this hypothesis arises from coprolites to some extent extruded from an immature cockroach preserved in the amber of Lebanon, studied using synchrotron X-ray microtomography. 1.06% of their volume is filled by particles of wood with smooth edges, in which size distribution directly supports their external pre-digestion. Because fungal pre-processing can be excluded based on the presence of large particles (combined with small total amount of wood) and absence of damages on wood, the likely source of wood are herbivore feces. Smaller particles were broken down biochemically in the cockroach hind gut, which indicates that the recent lignin-decomposing termite and cockroach endosymbionts might have been transferred to the cockroach gut upon feeding on dinosaur feces.

  4. Synergistic effect of some essential oils on toxicity and knockdown effects, against mosquitos, cockroaches and housefly

    Directory of Open Access Journals (Sweden)

    Idin Zibaee

    2015-12-01

    Full Text Available The toxicity and knockdown effect of Eucalyptus globulus, Rosmarinus officinalis essential oils and their mixed formulation on Periplaneta Americana (L., Blattella germanica (L., Supella longipalpa, Culex pipiens, Anopheles stephensi and Musca domestica were evaluated in a series of laboratory experiments. In all bioassay five different doses (0.625, 1.25, 2.5, 5 and 10% were used by filter paper (cm2 and aerosol (cm3 bioassay methods, all essential oils was toxic to cockroaches, mosquitos and housefly species the lowest and the highest LC50 belong to mixed formulation on B. germanica (LC50 6.1 and E. globulus on P. americana (LC50 27.7 respectively. In continuous exposure experiments, Mortality (LT50 values for cockroaches ranged from 1403.3 min with 0.625% E. globulus (for P. americana to 2.2 min with 10% mixed formulation for A. stephensi. The KT50 values ranged from 0.1 to 1090.8 min for 10% and 0.625 for mixed formulation and R. officinalis respectively. The mortality after 24 h for mixed formulation was 100% but for single essential oils ranged from 81.5 to 98.3 for P. americana treated with R. officinalis and A. stephensi treated with E. globulus respectively. Studies on persistence of essential oils on impregnated paper revealed that it has more adulticidal activity for longer period at low storage temperature. Gas chromatographic-mass spectrometric analysis of essential oil showed 14 and 16 peaks for E. globules and R. officinalis respectively. α-Pinene (39.8%, 1, 8-Cineole (13.2%, Camphene (9.1% and Borneol (3.7% were present in major amounts for R. officinalis and 1,8-Cineole (31.4%, α-Pinene (15.3%, d-Limonene (9.7% and α-Terpinolen (5.3% were present in major amounts for E. globulus respectively. Our results showed that two surveyed essential oils has compatible with synergistic effect on various insect species, furthermore it is useful for applying as integrated pest management tool for studied insects management, especially in

  5. Intersegmental coordination of cockroach locomotion: adaptive control of centrally coupled pattern generator circuits

    Directory of Open Access Journals (Sweden)

    Einat eFuchs

    2011-01-01

    Full Text Available Animals’ ability to demonstrate both stereotyped and adaptive locomotor behavior is largely dependent on the interplay between centrally-generated motor patterns and the sensory inputs that shape them. We utilized a combined experimental and theoretical approach to investigate the relative importance of CPG interconnections vs. intersegmental afferents in the cockroach: an animal that is renowned for rapid and stable locomotion. We simultaneously recorded coxal levator and depressor motor neurons (MN in the thoracic ganglia of Periplaneta americana, while sensory feedback was completely blocked or allowed only from one intact stepping leg. In the absence of sensory feedback, we observed a coordination pattern with consistent phase relationship that shares similarities with a double tripod gait, suggesting central, feedforward control. This intersegmental coordination pattern was then reinforced in the presence of sensory feedback from a single stepping leg. Specifically, we report on transient stabilization of phase differences between activity recorded in the middle and hind thoracic MN following individual front-leg steps, suggesting a role for afferent phasic information in the coordination of motor circuits at the different hemiganglia. Data were further analyzed using stochastic models of coupled oscillators and maximum likelihood techniques to estimate underlying physiological parameters, such as uncoupled endogenous frequencies of hemisegmental oscillators and coupling strengths and directions. We found that descending ipsilateral coupling is stronger than ascending coupling, while left-right coupling in both the meso- and meta-thoracic ganglia appear to be symmetrical. We discuss our results in comparison with recent findings in stick insects that share similar neural and body architectures, and argue that the two species may exemplify opposite extremes of a fast-slow locomotion continuum, mediated through different intersegmental

  6. Arthromitus (Bacillus cereus) symbionts in the cockroach Blaberus giganteus: dietary influences on bacterial development and population density

    Science.gov (United States)

    Feinberg, L.; Jorgensen, J.; Haselton, A.; Pitt, A.; Rudner, R.; Margulis, L.

    1999-01-01

    The filamentous spore-forming bacterium Arthromitus, discovered in termites, millipedes, sow bugs and other soil-dwelling arthropods by Leidy (1850), is the intestinal stage of Bacillus cereus. We extend the range of Arthromitus habitats to include the hindgut of Blaberus giganteus, the large tropical American cockroach. The occurrence and morphology of the intestinal form of the bacillus were compared in individual cockroaches (n=24) placed on four different diet regimes: diurnally maintained insects fed (1) dog food, (2) soy protein only, (3)purified cellulose only, and (4) a dog food-fed group maintained in continuous darkness. Food quality exerted strong influence on population densities and developmental stages of the filamentous bacterium and on fecal pellet composition. The most dramatic rise in Arthromitus populations, defined as the spore-forming filament intestinal stage, occurred in adult cockroaches kept in the dark on a dog food diet. Limited intake of cellulose or protein alone reduced both the frequency of Arthromitus filaments and the rate of weight gain of the insects. Spores isolated from termites, sow bugs, cockroaches and moths, grown on various hard surfaces display a branching mobility and resistance to antibiotics characteristic to group I Bacilli whose members include B. cereus, B. circulans, B. alvei and B. macerans. DNA isolated from pure cultures of these bacilli taken from the guts of Blaberus giganteus (cockroach), Junonia coenia (moth), Porcellio scaber (sow bug) and Cryptotermes brevis (termite) and subjected to Southern hybridization with a 23S-5S B. subtilis ribosomal sequence probe verified that they are indistinguishable from laboratory strains of Bacillus cereus.

  7. Cockroaches (Blattaria) of Ecuador-checklist and history of research.

    Science.gov (United States)

    Vidlička, Lubomír

    2013-01-09

    Cockroaches are an understudied group and the total number of described taxa increases every year. The last checklist of Ecuador species was published in 1926. The main aim of this study was to complete a new checklist of cockroach species recorded in Ecuador supplemented with a research history of cockroaches (Blattaria) on the territory of continental Ecuador. In addition, the checklist contains comments on Ecuadorian faunistic records, including the Galápagos Islands. A total of 114 species (105 in continental Ecuador and 18 in Galápagos Islands) belonging to 6 families and 44 genera are listed. Forty species (38.1 %) occur solely in continental Ecuador and five (27.8 %) are endemic on Galápagos Islands. The results indicate that further research on the cockroach fauna of Ecuador as well as determination of museum collections from this territory is needed.

  8. Biogeography and Phylogeny of Wood-feeding Cockroaches in the Genus Cryptocercus

    Directory of Open Access Journals (Sweden)

    Kiyoto Maekawa

    2011-07-01

    Full Text Available Subsocial, xylophagous cockroaches of the genus Cryptocercus exhibit a disjunct distribution, with representatives in mature montane forests of North America, China, Korea and the Russian Far East. All described species are wingless and dependent on rotting wood for food and shelter at all stages of their life cycle; consequently, their distribution is tied to that of forests and strongly influenced by palaeogeographical events. Asian and American lineages form distinct monophyletic groups, comprised of populations with complex geographic substructuring. We review the phylogeny and distribution of Cryptocercus, and discuss splitting events inferred from molecular data.

  9. Mechanical properties of the cuticles of three cockroach species that differ in their wind-evoked escape behavior

    Directory of Open Access Journals (Sweden)

    Andrew J. Clark

    2014-07-01

    Full Text Available The structural and material properties of insect cuticle remain largely unexplored, even though they comprise the majority (approximately 80% of animals. Insect cuticle serves many functions, including protection against predatory attacks, which is especially beneficial to species failing to employ effective running escape responses. Despite recent advances in our understanding of insect escape behaviors and the biomechanics of insect cuticle, there are limited studies on the protective qualities of cuticle to extreme mechanical stresses and strains imposed by predatory attacks, and how these qualities vary between species employing different escape responses. Blattarians (cockroaches provide an appropriate model system for such studies. Wind-evoked running escape responses are strong in Periplaneta americana, weak in Blaberus craniifer and absent in Gromphodorhina portentosa, putting the latter two species at greater risk of being struck by a predator. We hypothesized that the exoskeletons in these two larger species could provide more protection from predatory strikes relative to the exoskeleton of P. americana. We quantified the protective qualities of the exoskeletons by measuring the puncture resistance, tensile strength, strain energy storage, and peak strain in fresh samples of thoracic and abdominal cuticles from these three species. We found a continuum in puncture resistance, tensile strength, and strain energy storage between the three species, which were greatest in G. portentosa, moderate in B. craniifer, and smallest in P. americana. Histological measurements of total cuticle thickness followed this same pattern. However, peak strain followed a different trend between species. The comparisons in the material properties drawn between the cuticles of G. portentosa, B. craniifer, and P. americana demonstrate parallels between cuticular biomechanics and predator running escape responses.

  10. Life style of people and surveillance of management related to cockroaches in Southern Punjab, Pakistan

    OpenAIRE

    NAEEM, Afifa; JALEEL, Waqar; SAEED, Qamar; ZAKA, Syed Muhammad; SAEED, Shafqat; NAQQASH, Muhammad Nadir; BAKHTAWAR, Marryam; AYUB, Waleed Bin

    2014-01-01

    Cockroaches are the major household pests which prefer humid areas for habitation i.e. bathrooms, kitchens, sewerage systems etc., where warmth, moisture and food are satisfactory. Cockroaches are responsible for transmitting microorganisms like pathogenic bacteria, virus and fungi. Some examples of common bacterial diseases of human beings transmitted by cockroaches are Pasteurellapestisand bubonic plague; Shigellaalkalescensand dysentery; Staphylococcus aureusand boils and abscesses; Shigel...

  11. Food-borne human parasitic pathogens associated with household cockroaches and houseflies in Nigeria

    Directory of Open Access Journals (Sweden)

    Oyetunde T. Oyeyemi

    2016-03-01

    Full Text Available Cockroaches and houseflies pose significant public health threat owning to their ability to mechanically transmit human intestinal parasites and other disease-causing microorganisms. This study aims at assessing the vectoral capacity of cockroaches and houseflies in the transmission of human intestinal parasites. Intestinal parasite external surface contamination of 130 cockroaches and 150 houseflies caught within dwelling places in Ilishan-Remo town, Ogun State, Nigeria was determined. Cockroaches (six parasite species were more contaminated than houseflies (four parasite species. The most prevalent parasites were Trichuris trichiura (74.0% and hookworm (63.0% in houseflies and cockroaches respectively. There were significant differences in the prevalence of hookworm, T. trichiura and Taenia spp. isolated from cockroaches and houseflies (P < 0.05. There is high contamination of human intestinal parasites in cockroaches and houseflies in human dwelling places in the study area, thus they have the ability to transmit these parasites to unkempt food materials.

  12. Life history and habitat associations of the broad wood cockroach, Parcoblatta lata (Blattaria: Blattellidae) and other native cockroaches in the Coastal Plain of South Carolina.

    Energy Technology Data Exchange (ETDEWEB)

    Horn, Scott; Hanula, James, L.

    2002-06-18

    Wood cockroaches are an important prey of the red-cockaded woodpecker, Picoides borealis, an endangered species inhabiting pine forests in the southern United States. These woodpeckers forage on the boles of live pine trees, but their prey consists of a high proportion of wood cockroaches, Parcoblatta spp., that are more commonly associated with dead plant material. Cockroach population density samples were conducted on live pine trees, dead snags and coarse woody debris on the ground. The studies showed that snags and logs are also important habitats of wood cockroaches in pine forests.

  13. Selected food-borne parasites associated with cockroaches and ...

    African Journals Online (AJOL)

    Of these, 20 (62.5%) were protozoa and 12 (37.5%) were helminthes from the houseflies while 19 (54.3%) were protozoa and 16 (45.7%) were helminthes from the cockroaches. The protozoa that were identified include; cysts of Balantidium coli, cysts of Entamoeba coli, Entamoeba Histolytica and Endolimax nana. Also ...

  14. Binary Cockroach Swarm Optimization for Combinatorial Optimization Problem

    Directory of Open Access Journals (Sweden)

    Ibidun Christiana Obagbuwa

    2016-09-01

    Full Text Available The Cockroach Swarm Optimization (CSO algorithm is inspired by cockroach social behavior. It is a simple and efficient meta-heuristic algorithm and has been applied to solve global optimization problems successfully. The original CSO algorithm and its variants operate mainly in continuous search space and cannot solve binary-coded optimization problems directly. Many optimization problems have their decision variables in binary. Binary Cockroach Swarm Optimization (BCSO is proposed in this paper to tackle such problems and was evaluated on the popular Traveling Salesman Problem (TSP, which is considered to be an NP-hard Combinatorial Optimization Problem (COP. A transfer function was employed to map a continuous search space CSO to binary search space. The performance of the proposed algorithm was tested firstly on benchmark functions through simulation studies and compared with the performance of existing binary particle swarm optimization and continuous space versions of CSO. The proposed BCSO was adapted to TSP and applied to a set of benchmark instances of symmetric TSP from the TSP library. The results of the proposed Binary Cockroach Swarm Optimization (BCSO algorithm on TSP were compared to other meta-heuristic algorithms.

  15. Nest sanitation through defecation: antifungal properties of wood cockroach feces

    Science.gov (United States)

    Rosengaus, Rebeca B.; Mead, Kerry; Du Comb, William S.; Benson, Ryan W.; Godoy, Veronica G.

    2013-11-01

    The wood cockroach Cryptocercus punctulatus nests as family units inside decayed wood, a substrate known for its high microbial load. We tested the hypothesis that defecation within their nests, a common occurrence in this species, reduces the probability of fungal development. Conidia of the entomopathogenic fungus, Metarhizium anisopliae, were incubated with crushed feces and subsequently plated on potato dextrose agar. Relative to controls, the viability of fungal conidia was significantly reduced following incubation with feces and was negatively correlated with incubation time. Although the cockroach's hindgut contained abundant β-1,3-glucanase activity, its feces had no detectable enzymatic function. Hence, these enzymes are unlikely the source of the fungistasis. Instead, the antifungal compound(s) of the feces involved heat-sensitive factor(s) of potential microbial origin. When feces were boiled or when they were subjected to ultraviolet radiation and subsequently incubated with conidia, viability was "rescued" and germination rates were similar to those of controls. Filtration experiments indicate that the fungistatic activity of feces results from chemical interference. Because Cryptocercidae cockroaches have been considered appropriate models to make inferences about the factors fostering the evolution of termite sociality, we suggest that nesting in microbe-rich environments likely selected for the coupling of intranest defecation and feces fungistasis in the common ancestor of wood cockroaches and termites. This might in turn have served as a preadaptation that prevented mycosis as these phylogenetically related taxa diverged and evolved respectively into subsocial and eusocial organizations.

  16. Wirkungen biogener Amine auf die Erregungs-Sekretions-Kopplung in der Speicheldrüse von Periplaneta americana (L.)

    Science.gov (United States)

    Rietdorf, Katja

    2003-07-01

    AMP und / oder cGMP erhöht und anschließend den Proteingehalt im Endspeichel gemessen. Ein Anstieg der intrazellulären Ca2+-Konzentration aktiviert nur eine geringe Rate der Proteinsekretion. Dagegen kann die Steigerung der intrazellulären cAMP-Konzentration eine stärkere Proteinsekretion aktivieren, die sich nicht signifikant von der nach 5-HT-Stimulierung unterscheidet. Die cAMP-stimulierte Proteinsekretion kann durch gleichzeitige Erhöhung der intrazellulären Ca2+-Konzentration weiter gesteigert werden. Dagegen aktivierte eine Erhöhung der intrazellulären cGMP-Konzentration die Proteinsekretion nicht. Aufgrund dieser Ergebnisse postuliere ich die Existenz eines die Adenylatcyclase aktivierenden 5-HT-Rezeptors in der Basolateralmembran der C-Zellen. The aim of this PhD-work was to investigate major mechanisms of excitation-secretion coupling in the salivary gland of the cockroach Periplaneta americana (L.). This salivary gland is innervated by dopaminergic and serotonergic fibres (Baumann et al., 2002). The two transmitters stimulate different processes in the gland: Dopamine (DA) stimulates the p-cells of the acini and the salivary duct cells, whereas 5-HT (serotonin) activates the p- and the c-cells of the acini, but not the salivary duct cells. Final saliva is completely protein-free after dopamine stimulation. It contains proteins, which are secreted by the c-cells of the acini, after a 5-HT-stimulation (Just & Walz, 1996). In the first part of my work I measured the electrolytic composition of the final saliva by capillary electrophoretic analysis and measured the rates of fluid secretion, in order to answer the following questions: 1.) Which transporters affect the production of primary saliva and its modification? 2.) What is the function of the transport-active salivary duct cells for the modification of the primary saliva? Electrolytic composition of the DA- and 5-HT-stimulated final saliva is not significantly different from each other, and is

  17. Allergenic characterization of a novel allergen, homologous to chymotrypsin, from german cockroach.

    Science.gov (United States)

    Jeong, Kyoung Yong; Son, Mina; Lee, Jae Hyun; Hong, Chein Soo; Park, Jung Won

    2015-05-01

    Cockroach feces are known to be rich in IgE-reactive components. Various protease allergens were identified by proteomic analysis of German cockroach fecal extract in a previous study. In this study, we characterized a novel allergen, a chymotrypsin-like serine protease. A cDNA sequence homologous to chymotrypsin was obtained by analysis of German cockroach expressed sequence tag (EST) clones. The recombinant chymotrypsins from the German cockroach and house dust mite (Der f 6) were expressed in Escherichia coli using the pEXP5NT/TOPO vector system, and their allergenicity was investigated by ELISA. The deduced amino acid sequence of German cockroach chymotrypsin showed 32.7 to 43.1% identity with mite group 3 (trypsin) and group 6 (chymotrypsin) allergens. Sera from 8 of 28 German cockroach allergy subjects (28.6%) showed IgE binding to the recombinant protein. IgE binding to the recombinant cockroach chymotrypsin was inhibited by house dust mite chymotrypsin Der f 6, while it minimally inhibited the German cockroach whole body extract. A novel allergen homologous to chymotrypsin was identified from the German cockroach and was cross-reactive with Der f 6.

  18. Reversible brain inactivation induces discontinuous gas exchange in cockroaches.

    Science.gov (United States)

    Matthews, Philip G D; White, Craig R

    2013-06-01

    Many insects at rest breathe discontinuously, alternating between brief bouts of gas exchange and extended periods of breath-holding. The association between discontinuous gas exchange cycles (DGCs) and inactivity has long been recognised, leading to speculation that DGCs lie at one end of a continuum of gas exchange patterns, from continuous to discontinuous, linked to metabolic rate (MR). However, the neural hypothesis posits that it is the downregulation of brain activity and a change in the neural control of gas exchange, rather than low MR per se, which is responsible for the emergence of DGCs during inactivity. To test this, Nauphoeta cinerea cockroaches had their brains inactivated by applying a Peltier-chilled cold probe to the head. Once brain temperature fell to 8°C, cockroaches switched from a continuous to a discontinuous breathing pattern. Re-warming the brain abolished the DGC and re-established a continuous breathing pattern. Chilling the brain did not significantly reduce the cockroaches' MR and there was no association between the gas exchange pattern displayed by the insect and its MR. This demonstrates that DGCs can arise due to a decrease in brain activity and a change in the underlying regulation of gas exchange, and are not necessarily a simple consequence of low respiratory demand.

  19. Isolation of Intestinal Parasites of Public Health Importance from Cockroaches (Blattella germanica) in Jimma Town, Southwestern Ethiopia

    OpenAIRE

    Hamu, Haji; Debalke, Serkadis; Zemene, Endalew; Birlie, Belay; Mekonnen, Zeleke; Yewhalaw, Delenasaw

    2014-01-01

    Cockroaches are claimed to be mechanical transmitters of disease causing microorganisms such as intestinal parasites, bacteria, fungi, and viruses. This study assessed the potential of the German cockroach Blattella germanica in the mechanical transmission of intestinal parasites of public health importance. A total of 2010 cockroaches were collected from 404 households in Jimma Town, southwestern Ethiopia. All the collected cockroaches were identified to species as B. germanica. The contents...

  20. Students' Knowledge about the Internal Structure of Mice and Cockroaches in Their Environment

    Science.gov (United States)

    Kilic, Selda

    2013-01-01

    The aim of this study is to determine 9th class students knowledge about the internal structures of mice and cockroaches using drawings. Drawings of 122 students from the 9th class of a high school in the center of Konya about the internal structures of mice and cockroaches have been analyzed. Drawings were analyzed independently by two…

  1. Chow Down! Using Madagascar Hissing Cockroaches to Explore Basic Nutrition Concepts

    Science.gov (United States)

    Wagler, Ron

    2009-01-01

    The Madagascar hissing cockroach ("Gromphadorhina portentosa") is one of the most exciting and enjoyable animals to incorporate into your science curriculum. Madagascar hissing cockroaches (MHCs) do not bite, are easy to handle, produce little odor compared to many terrarium animals, have a fascinating social structure, are easy to breed, teach…

  2. Microbial Carriage of Cockroaches at a Tertiary Care Hospital in Ghana

    Directory of Open Access Journals (Sweden)

    Patience B. Tetteh-Quarcoo

    2013-01-01

    Full Text Available Cockroaches are common in the environment of many hospitals in Ghana; however, little is known about their public health risks. To evaluate potential risks, we investigated the external and internal microbial flora of 61 cockroaches from a tertiary hospital in Ghana and evaluated the antibiotic resistance profiles of the common bacterial species. Standard methods were used in all the microbiological investigations and antibiotic susceptibility testing. A rotavirus carriage rate of 19.7% was observed among the cockroaches. Four types of intestinal parasites were carried externally by the cockroaches, and the most prevalent was Hookworm (4.9%. Eight nosocomial bacteria were isolated from the cockroaches, and the most prevalent was Klebsiella pneumoniae , which occurred internally in 29.5% of the cockroaches and 26.2% externally. Multiple drug resistance among common bacteria isolated from the cockroaches ranged from 13.8% ( Escherichia coli to 41.1% ( Klebsiella pneumoniae . Cockroaches constitute an important reservoir for pathogenic microorganisms, and may be important vectors of multiple resistant nosocomial pathogens in the studied hospital.

  3. The Use of Genetic Mechanisms and Behavioral Characteristics to Control Natural Populations of the German Cockroach.

    Science.gov (United States)

    1981-03-01

    release of sterile males into natural populations of the German cockroach. Submitted to Entomologia exp. & Appl. Feb., 1981. A first draft was...populations of the German cockroach. Subm. Entomologia Exp. & Appl. Feb., 1981. aEight other publications of earlier research on this Contract have

  4. Immunochemical detection of the crustacean cardioactive peptide in the cephalic ganglia cockroaches (Blattodea: Blattidae)

    Czech Academy of Sciences Publication Activity Database

    Gladysz, M.; Guzik, J.; Sehadová, Hana; Baran, B.; Bembenek, J.; Dolezych, B.

    2015-01-01

    Roč. 112, č. 2 (2015), s. 235-244 ISSN 1210-5759 Institutional support: RVO:60077344 Keywords : Blattodea * Periplaneta americana * Gromphadorhina portentosa Subject RIV: ED - Physiology Impact factor: 0.975, year: 2014 http://www.eje.cz/corproof.php?tartkey=eje-000000-0111#.VRVB0PmG8mM

  5. Enterobactérias isoladas de baratas (Periplaneta americana capturadas em um hospital brasileiro

    Directory of Open Access Journals (Sweden)

    Marinésia A. Prado

    2002-02-01

    Full Text Available Objetivo. Isolar e identificar microrganismos em baratas capturadas em um hospital público e determinar o seu perfil de suscetibilidade antimicrobiana. Métodos. As baratas foram capturadas nos períodos matutino e noturno, colocadas em frascos desinfetados com álcool a 70%, transferidas para um frasco estéril e levadas ao laboratório. Consideraram-se as baratas íntegras e vivas, as quais foram colocadas em solução salina estéril (0,8% e homogeneizadas. Essa solução foi semeada nos meios de cultura ágar MacConkey, caldo nutriente, infusão de cérebro e coração (ágar BHI, ágar Sabouraud e ágar manitol. As culturas foram examinadas em um estereomicroscópio para a contagem das unidades formadoras de colônias. Para a determinação do perfil de suscetibilidade antimicrobiana utilizou-se o teste de difusão de disco. Resultados. Detectou-se prevalência de 56% de enterobactérias e de 18% de estafilococos coagulase negativos. Identificaram-se 15 espécies de enterobactérias. As mais freqüentes foram Klebsiella pneumoniae (17%; Enterobacter aerogenes (14%; Serratia marcescens (13%; Hafnia alvei (12%; Enterobacter gergoviae e Enterobacter cloacae (9%; e Serratia spp. (6%. Tanto as enterobactérias quanto os estafilococos coagulase negativos apresentaram uma resistência significativa aos antimicrobianos, inclusive à oxacilina. Conclusões. A prevalência de bactérias enteropatogênicas e de estafilococos coagulase negativos isolados de baratas Periplaneta americana no hospital estudado demonstra a fragilidade das condutas adotadas tanto para o controle de vetores quanto para o uso dos antimicrobianos. Os resultados demonstram a necessidade da implementação de um programa efetivo de saneamento ambiental e do uso racional dos antimicrobianos dentro das instituições de saúde.

  6. Enterobactérias isoladas de baratas (Periplaneta americana capturadas em um hospital brasileiro

    Directory of Open Access Journals (Sweden)

    Prado Marinésia A.

    2002-01-01

    Full Text Available Objetivo. Isolar e identificar microrganismos em baratas capturadas em um hospital público e determinar o seu perfil de suscetibilidade antimicrobiana. Métodos. As baratas foram capturadas nos períodos matutino e noturno, colocadas em frascos desinfetados com álcool a 70%, transferidas para um frasco estéril e levadas ao laboratório. Consideraram-se as baratas íntegras e vivas, as quais foram colocadas em solução salina estéril (0,8% e homogeneizadas. Essa solução foi semeada nos meios de cultura ágar MacConkey, caldo nutriente, infusão de cérebro e coração (ágar BHI, ágar Sabouraud e ágar manitol. As culturas foram examinadas em um estereomicroscópio para a contagem das unidades formadoras de colônias. Para a determinação do perfil de suscetibilidade antimicrobiana utilizou-se o teste de difusão de disco. Resultados. Detectou-se prevalência de 56% de enterobactérias e de 18% de estafilococos coagulase negativos. Identificaram-se 15 espécies de enterobactérias. As mais freqüentes foram Klebsiella pneumoniae (17%; Enterobacter aerogenes (14%; Serratia marcescens (13%; Hafnia alvei (12%; Enterobacter gergoviae e Enterobacter cloacae (9%; e Serratia spp. (6%. Tanto as enterobactérias quanto os estafilococos coagulase negativos apresentaram uma resistência significativa aos antimicrobianos, inclusive à oxacilina. Conclusões. A prevalência de bactérias enteropatogênicas e de estafilococos coagulase negativos isolados de baratas Periplaneta americana no hospital estudado demonstra a fragilidade das condutas adotadas tanto para o controle de vetores quanto para o uso dos antimicrobianos. Os resultados demonstram a necessidade da implementação de um programa efetivo de saneamento ambiental e do uso racional dos antimicrobianos dentro das instituições de saúde.

  7. Medically Important Parasites Carried by Cockroaches in Melong Subdivision, Littoral, Cameroon

    Directory of Open Access Journals (Sweden)

    R. J. Atiokeng Tatang

    2017-01-01

    Full Text Available Cockroaches have been recognized as mechanical vectors of pathogens that can infest humans or animals. A total of 844 adult cockroaches (436 males and 408 females were caught. In the laboratory, cockroaches were first washed in saturated salt solution to remove ectoparasites and then rinsed with 70% alcohol, dried, and dissected for endoparasites. An overall transport rate of 47.39% was recorded. Six genera of parasites were identified. These were Ascaris (33.76%, Trichuris (11.97%, Capillaria (6.16%, Toxocara (4.86%, Hook Worm (4.86%, and Eimeria (2.73%. The parasites were more recorded on the external surface (54.27% of cockroaches than in the internal surface (GIT, 38.51%. The same tendency was obtained between sexes with female cockroaches having a higher transport rate (36.69%. Cockroaches caught in toilets carried more parasites (31.99% as compared to those from kitchens (22.63% and houses (11.14%. Almost all encountered parasites were recognized as responsible of zoonosis and they can be consequently released in nature by hosts and easily disseminated by cockroaches as mechanical vectors. Sanitary education, reenforcement of worms’ eradication programs, and the fight against these insects remain a necessity in the Mélong Subdivision.

  8. Rapid Elimination of German Cockroach, Blatella germanica, by Fipronil and Imidacloprid Gel Baits

    Directory of Open Access Journals (Sweden)

    H Nasirian

    2008-06-01

    Full Text Available Background: Baits have become popular and effective formulations against urban insect pests. Compared with re­sidual sprays toxic gel baits are used more and more frequently to control urban cockroach populations. The aim of this study was to investigate the usage of two commercially available fipronil and imidacloprid gel bait formulations against Blattella germanica field infested in Iran.Methods:  The study was carried out in an urban area at Tehran from March 2004 to September 2005. The 0.05% fipronil and 2.15% imidacloprid gel baits were placed continuously in 3 residential German cockroach infested units. Pre- and post-treatment cockroach density was assessed by visual count method.Results: Pre- and post-treatment visual count of cockroaches in treatment and control areas, and percentage reduc­tion in cockroach density in treatment areas in comparison to control areas was showed that density reduction was increased with the 0.05% fipronil and 2.15% imidacloprid gel baits in treated areas from 1st to 9th week in compari­son to control area. After 60 days, German cockroaches eliminated completely from these areas.Conclusion: These results show that fipronil and imidacloprid gel baits are highly effective in field German cock­roach infested after insecticide spraying control failure German cockroach infested fields where spraying  of pyrethroid insecticides failed to control the situation and confirm previous  reports stating that avermectin and hydramethylnon are more effective than conventional insecticides in baits against cockroaches. Therefore, fipronil and imidacloprid gel baits are appropriate candidates for controlling German cockroach infested dwellings in Iran where control with other insectices failed because of resistance.

  9. Rapid Elimination of German Cockroach, Blatella germanica, by Fipronil and Imidacloprid Gel Baits

    Directory of Open Access Journals (Sweden)

    H Nasirian

    2008-08-01

    Full Text Available Background: Baits have become popular and effective formulations against urban insect pests. Compared with re­sidual sprays toxic gel baits are used more and more frequently to control urban cockroach populations. The aim of this study was to investigate the usage of two commercially available fipronil and imidacloprid gel bait formulations against Blattella germanica field infested in Iran. Methods:  The study was carried out in an urban area at Tehran from March 2004 to September 2005. The 0.05% fipronil and 2.15% imidacloprid gel baits were placed continuously in 3 residential German cockroach infested units. Pre- and post-treatment cockroach density was assessed by visual count method. Results: Pre- and post-treatment visual count of cockroaches in treatment and control areas, and percentage reduc­tion in cockroach density in treatment areas in comparison to control areas was showed that density reduction was increased with the 0.05% fipronil and 2.15% imidacloprid gel baits in treated areas from 1st to 9th week in compari­son to control area. After 60 days, German cockroaches eliminated completely from these areas. Conclusion: These results show that fipronil and imidacloprid gel baits are highly effective in field German cock­roach infested after insecticide spraying control failure German cockroach infested fields where spraying  of pyrethroid insecticides failed to control the situation and confirm previous  reports stating that avermectin and hydramethylnon are more effective than conventional insecticides in baits against cockroaches. Therefore, fipronil and imidacloprid gel baits are appropriate candidates for controlling German cockroach infested dwellings in Iran where control with other insectices failed because of resistance.

  10. Survival and weight change among adult individuals of Periplaneta americana (Linnaeus, 1758 (Blattaria, Blattidae subject to various stress conditions

    Directory of Open Access Journals (Sweden)

    Jucelio Peter Duarte

    2015-05-01

    Full Text Available Periplaneta americana is a species of great importance to public health, since it can act as a vector of many pathogens and it reaches large populations in urban environments. This is probably due to its ability to resist starvation and desiccation. This study aimed to evaluate the effects of absence of water and food on survival and weight change among adult P. americana individuals and check whether the initial weight of individuals influences on their survival. Four groups having twenty P. americana couples were formed and subject to: I no water or food; II no food; III no water; and IV control group. Insects were isolated according to the groups, which were weighed at the beginning and end of the stress conditions. They remained under these conditions until all individuals in each test group were dead. Stress conditions caused reduction in survival time when compared to the control group. Adults with higher body mass survived longer when deprived only of food, while among those lacking water, weight had no influence on survival. Total weight loss was greater among individuals deprived of water than those deprived only of food.

  11. Survival and weight change among adult individuals of Periplaneta americana (Linnaeus, 1758 (Blattaria, Blattidae subject to various stress conditions

    Directory of Open Access Journals (Sweden)

    Jucelio Peter Duarte

    2015-03-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2015v28n2p103 Periplaneta americana is a species of great importance to public health, since it can act as a vector of many pathogens and it reaches large populations in urban environments. This is probably due to its ability to resist starvation and desiccation. This study aimed to evaluate the effects of absence of water and food on survival and weight change among adult P. americana individuals and check whether the initial weight of individuals influences on their survival. Four groups having twenty P. americana couples were formed and subject to: I no water or food; II no food; III no water; and IV control group. Insects were isolated according to the groups, which were weighed at the beginning and end of the stress conditions. They remained under these conditions until all individuals in each test group were dead. Stress conditions caused reduction in survival time when compared to the control group. Adults with higher body mass survived longer when deprived only of food, while among those lacking water, weight had no influence on survival. Total weight loss was greater among individuals deprived of water than those deprived only of food.

  12. Transoceanic Dispersal and Plate Tectonics Shaped Global Cockroach Distributions: Evidence from Mitochondrial Phylogenomics.

    Science.gov (United States)

    Bourguignon, Thomas; Tang, Qian; Ho, Simon Y W; Juna, Frantisek; Wang, Zongqing; Arab, Daej A; Cameron, Stephen L; Walker, James; Rentz, David; Evans, Theodore A; Lo, Nathan

    2017-04-01

    Following the acceptance of plate tectonics theory in the latter half of the 20th century, vicariance became the dominant explanation for the distributions of many plant and animal groups. In recent years, however, molecular-clock analyses have challenged a number of well-accepted hypotheses of vicariance. As a widespread group of insects with a fossil record dating back 300 My, cockroaches provide an ideal model for testing hypotheses of vicariance through plate tectonics versus transoceanic dispersal. However, their evolutionary history remains poorly understood, in part due to unresolved relationships among the nine recognized families. Here, we present a phylogenetic estimate of all extant cockroach families, as well as a timescale for their evolution, based on the complete mitochondrial genomes of 119 cockroach species. Divergence dating analyses indicated that the last common ancestor of all extant cockroaches appeared ∼235 Ma, ∼95 My prior to the appearance of fossils that can be assigned to extant families, and before the breakup of Pangaea began. We reconstructed the geographic ranges of ancestral cockroaches and found tentative support for vicariance through plate tectonics within and between several major lineages. We also found evidence of transoceanic dispersal in lineages found across the Australian, Indo-Malayan, African, and Madagascan regions. Our analyses provide evidence that both vicariance and dispersal have played important roles in shaping the distribution and diversity of these insects.

  13. Repellent Activity of Apiaceae Plant Essential Oils and their Constituents Against Adult German Cockroaches.

    Science.gov (United States)

    Lee, Hyo-Rim; Kim, Gil-Hah; Choi, Won-Sil; Park, Il-Kwon

    2017-04-01

    We evaluated the repellent activity of 12 Apiaceae plant essential oils and their components against male and female adult German cockroaches, Blattella germanica L., to find new natural repellents. Of all the plant essential oils tested, ajowan (Trachyspermum ammi Sprague) and dill (Anethum graveolens L.) essential oils showed the most potent repellent activity against male and female adult German cockroaches. Repellent activities of chemicals already identified in active oils were also investigated. Of the compounds identified, carvacrol, thymol, and R-(-)-carvone showed >80% repellent activity against male and female adult German cockroaches at 2.5 µg/cm2. S-(+)-Carvone, (+)-dihydrocarvone, and terpinen-4-ol showed >70% repellent activity against male and female adult German cockroaches at 10 µg/cm2. Our results indicated that Apiaceae plant essential oils and their constituents have good potential as natural repellents against adult German cockroaches. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. Horizontal transfer of bait in the German cockroach: indoxacarb causes secondary and tertiary mortality.

    Science.gov (United States)

    Buczkowski, Grzegorz; Scherer, Clay W; Bennett, Gary W

    2008-06-01

    Horizontal transfer of indoxacarb in the German cockroach, Blattella germanica (L.), was examined under laboratory conditions. Results show that a single bait-fed adult cockroach (i.e., the donor) transferred indoxacarb to numerous primary recipients (secondary mortality),which then became secondary donors. These recipients subsequently became donors to other cockroaches and caused significant mortality in other members of the aggregation, resulting in tertiary kill. Indoxacarb was effectively transferred among adult cockroaches and resulted in significant secondary mortality. When adult males served as donors and vectored the insecticide to adult males, the donor:recipient ratio affected the mortality of the recipients and the rate of secondary mortality increased with increasing the ratio of donors to recipients. Furthermore, secondary mortality in the untreated cockroaches was significantly affected by the freshness of excretions from the donors, the presence of alternative food, and the duration of contact between the donors and the recipients. Ingested indoxacarb was most effectively translocated when the recipients interacted with freshly symptomatic donors in the absence of alternative food. The transfer of indoxacarb continued beyond secondary mortality and resulted in significant tertiary mortality. Excretions from a single bait-fed adult killed 38/50 (76%) nymphs within 72 h. The dead nymphs then vectored indoxacarb to 20 adult males and killed 16/20 (81%) recipients within 72 h. Behavioral mechanisms involved in the horizontal transfer of indoxacarb may include: contact with excretions, necrophagy, emetophagy, and ingestion of other excretions that originate from the donors.

  15. Design and Implementation of Markerless Augmented Reality Application for Cockroach Phobia Therapy Using Adaptive Threshold

    Directory of Open Access Journals (Sweden)

    Fiandra Fatharany

    2017-01-01

    Full Text Available Augmented reality (AR technology is useful for treating several psychological problems, including phobias such as fear of flying, agoraphobia, claustrophobia, and phobia to insects and small animals. However, the currently existing applications for therapy of cockroach phobia that uses AR technology are still very dependent towards the presence of markers, which might lessen the feeling of being in an actual scenario from everyday lives. In this paper, we created a system that is able to use everyday things as a replacement for markers for phobia therapy for cockroach. There are five main processes: getting the live streaming feed from camera, preprocessing, extracting the center point of the objects, tracking the marker-substitute objects, and lastly, instantiating cockroaches randomly after user lifts the objects according to the number and mode of the cockroaches, whether it is moving or not, that are predetermined by the user. The evaluation in this paper includes eight participants that are carefully selected based on their Fear of Spiders Questionnaire (FSQ score that is translated into Indonesian and modified to accommodate cockroaches instead of spiders. The results is that the system can induce anxiety level on participants with the highest score of 10, which is the highest score in Standard Unit of Discomfort scale (SUDs. While the presence and reality judgment of this paper has the highest score of 7 which is also the highest score in Slater-Usoh-Steed Questionnaire (SUS.

  16. Evaluation of Five Local Formulated Insecticides against German Cockroach (Blattella germanica L. in Southern Iran

    Directory of Open Access Journals (Sweden)

    M Shahi

    2008-06-01

    Full Text Available Background: The German cockroach, Blattella germanica L., is a serious household and public health pest worldwide. Con­trol of this species has been very difficult to achieve. Toxicity of cypermethrin EC10%, deltamethrin EC5%, diazi­non EC0.5%, lambda-cyhalothrin EC5% and Negon® (permethrin+propoxur oil liquid1% commercial for­mula­tions were investigated against adult males of German cockroaches collected from four hospitals of Bandar Abbas City, southern Iran, during 2006. These insecticides have been used for cockroach con­trol in this city.Methods: The tests were carried out only on males by the glass jar contact method recommended by the WHO.Results: Maximum mortality rates of 20, 35, 90, and 100% were obtained after one hour contact to label-recom­mended doses of cypermethrin, deltamethrin, lambad-cyhalothrin, diazinon and permethrin+propoxur insecti­cides, respectively. KT50 results were different from 5.68 min for permethrin+propoxur mixture to 240.37 min for cyper­methrin. German cockroach showed < 80 per cent mortality using three pyrethroid insecticides.Conclusion: It seems that the label-recommended concentrations of these insecticides were wrong and lower than WHO advised for cockroach control. For monitoring of resistance it is recommended to do more tests using the pure ac­tive ingredient of these insecticides.

  17. The embodiment of cockroach aggregation behavior in a group of micro-robots.

    Science.gov (United States)

    Garnier, Simon; Jost, Christian; Gautrais, Jacques; Asadpour, Masoud; Caprari, Gilles; Jeanson, Raphaël; Grimal, Anne; Theraulaz, Guy

    2008-01-01

    We report the faithful reproduction of the self-organized aggregation behavior of the German cockroach Blattella germanica with a group of robots. We describe the implementation of the biological model provided by Jeanson et al. in Alice robots, and we compare the behaviors of the cockroaches and the robots using the same experimental and analytical methodology. We show that the aggregation behavior of the German cockroach was successfully transferred to the Alice robot despite strong differences between robots and animals at the perceptual, actuatorial, and computational levels. This article highlights some of the major constraints one may encounter during such a work and proposes general principles to ensure that the behavioral model is accurately transferred to the artificial agents.

  18. Toxicity of Cypermethrin and Chlorpyrifos Against German Cockroach [ Blattella germanica (Blattaria: Blattellidae)] Strains from Hamadan, Iran.

    Science.gov (United States)

    Nazari, Mansour; Motlagh, Behrouz Alipourian; Nasirian, Hassan

    German cockroach has relatively short life cycle and reproduce rapidly. It is the most common medically and public health pest. As a result, it is essential to combat this pest. Cypermethrin and chlorpyrifos are used by private companies in Hamadan to control Blattella germanica. It seems necessary to determine its susceptibility levels to these insecticides. The aim of this study was to determine the susceptibility levels of B. germanica strains to cypermethrin and chlorpyrifos in Hamadan. In this study, the German cockroach strains were collected from two hospitals (Fatemiyeh and Atiyeh) in Hamadan and transfered to the insectarium. The cockroach strains were reared under the same laboratory condition. Then their sensitivity levels were considered to 1, 2, 4, 8 and 16 mg m -2 for cypermethrin and 0.82, 1.65, 3.31, 6.63, 9.945 and 13.26 mg m -2 for chlorpyrifos using surface contact method. Results based on insecticide treated doses, B. germanica strains showed different percent mortality to the insecticides ranged from 13.3-100. The LD 50 and LD 90 and regression lines of the treated insecticides against German cockroach strains indicate that Fatemiyeh Hospital strain is more susceptible to the treated insecticides than Atiyeh Hospital strain. The LD 50 and LD 90 of chlorpyrifos are also lower than cypermethrin, indicated that chlorpyrifos is more effective than cypermethrin against German cockroach. As the slopes of the regression lines are observed mild in this study indicate that the population of the cockroach strains is very heterogeneous. It can be a symbol of insecticides resistance to cypermethrin and chlorpyrifos. As chlorpyrifos and cypermethrin insecticides are also used for residual spraying by private companies and the doses which provide more than 90% mortality are below the WHO recommended insecticide doses. Therefore, chlorpyrifos and cypermethrin insecticides can be used for B. germanica control in Hamadan within regular monitoring and preventive

  19. Energetic Cost of Subacute Chlorpyrifos Intoxication in the German Cockroach (Dictyoptera: Blattellidae)

    DEFF Research Database (Denmark)

    Nielsen, Søren Achim; Jensen, Karl-Martin Vagn; Kristensen, Michael

    2006-01-01

    The energetic cost of a sublethal treatment with chlorpyrifos was estimated by use of direct microcalorimetry to measure metabolic heat in susceptible and resistant strains of the German cockroach Blattella germanica L. Moreover, one of the detoxifcation enzyme systems known to be involved...... in detoxifcation of chlorpyrifos, glutathione-S-transferase, was measured. Individual cockroaches were exposed for 20 min on a glass-surfaces treated with 1.14 ...  g/cm2 of chlorpyrifos. There was no difference in glutathione-S-transferase activity of susceptible or resistant strains after the treatment. The heat...

  20. Biocontrol of the Brown-banded Cockroach, Supella longipalpa F. (Blattaria: Blattellidae, with Entomopathogenic Fungus, Metharhizium anisopliae

    Directory of Open Access Journals (Sweden)

    Mona Sharififard

    2016-01-01

    Full Text Available Background: Considering to the high distribution of cockroaches as urban pests, the efficacy of different formula­tions of Metarhizium anisopliae strain Iran 437C were assessed against the brown-banded cockroach, Supella longi­palpa F. under laboratory and field conditions.Methods: Metarhizium anisopliae isolates were screened with immersing adults of the brown-banded cockroachs in aqueous suspension of 108 conidia ml-1 followed by surface or bait treated with different doses of the most virulent isolate against the nymphs. Then formulations of conidia oil-in-water were examined versus cockroach nymphs us­ing different plant oils and paraffin. Then they were evaluated and compared with aqueous suspension and control group. On a large-scale, the sunflower oil-in-water formulation of conidia was sprayed at houses using a hand sprayer.Results: Metarhizium anisopliae IRAN 437C was the most virulent isolate against the brown-banded cockroach, causing 100% mortality in adults at seven days post-exposure. Inoculated bait with this isolate was not enough path­ogenic against the cockroach even at two weeks after treatment. Treated surface with conidia as aqueous suspension or oil-in- water formulation was more effective than the bait formulation against the cockroach caused 39.4–97.2% mortality compared with 2.5% mortality in control group after two days. Spraying the conidia formulated with sun­flower oil was an effective formulation causing 76.1% reduction in the cockroach density on the third day post treatment in the houses.Conclusion: The oil-in-water formulation of M. anisopliae IRAN 437C could be recommended as a promising al­ternative for cockroach control.  

  1. Diet shapes the gut microbiota of the omnivorous cockroach Blattella germanica.

    Science.gov (United States)

    Pérez-Cobas, Ana Elena; Maiques, Elisa; Angelova, Alexandra; Carrasco, Purificación; Moya, Andrés; Latorre, Amparo

    2015-04-01

    The gut microbiota of insects contributes positively to the physiology of its host mainly by participating in food digestion, protecting against pathogens, or provisioning vitamins or amino acids, but the dynamics of this complex ecosystem is not well understood so far. In this study, we have characterized the gut microbiota of the omnivorous cockroach Blattella germanica by pyrosequencing the hypervariable regions V1-V3 of the 16S rRNA gene of the whole bacterial community. Three diets differing in the protein content (0, 24 and 50%) were tested at two time points in lab-reared individuals. In addition, the gut microbiota of wild adult cockroaches was also analyzed. In contrast to the high microbial richness described on the studied samples, only few species are shared by wild and lab-reared cockroaches, constituting the bacterial core in the gut of B. germanica. Overall, we found that the gut microbiota of B. germanica is highly dynamic as the bacterial composition was reassembled in a diet-specific manner over a short time span, with no-protein diet promoting high diversity, although the highest diversity was found in the wild cockroaches analyzed. We discuss how the flexibility of the gut microbiota is probably due to its omnivorous life style and varied diets. © FEMS 2015. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  2. Some Guides to Discovery About Elm Trees, Owls, Cockroaches, Earthworms, Cement and Concrete.

    Science.gov (United States)

    Busch, Phyllis S.

    The introduction emphasizes the need for environmental and conservation education, and advocates an inquiry approach. Outdoor resources available to every school are listed. Detailed suggestions are made for investigating cement and concrete, cockroaches, earthworms, elm trees, and owls. In each case general background information and a list of…

  3. Home Sweet Home: How to Build a Madagascar Hissing Cockroach Habitat out of Recycled Materials

    Science.gov (United States)

    Wagler, Ron

    2010-01-01

    Madagascar hissing cockroaches (MHC) are amazing insects that can be an integral part of an effective science learning and teaching environment. MHCs have a fascinating social structure. They make excellent pets, teach students how to properly care for animals, and their large size adds to their "wow" factor. These characteristics make them unique…

  4. COCKROACHES, PESTICIDE USE, AND CHILDREN'S PULMONARY FUNCTION IN AN ARID COMMUNITY

    Science.gov (United States)

    Cockroaches, pesticide use, and children's pulmonary function in an arid communityErik Svendsen1, Mary Ross1, Melissa Gonzales2, Debra Walsh1, Scott Rhoney1, Gina Terrill1, Lucas Neas11US EPA, Chapel Hill, NC; 2University of New MexicoThe El Paso Children's He...

  5. Insecticidal Properties of Essential Oils and Some of Their Constituents on the Turkestan Cockroach (Blattodea: Blattidae).

    Science.gov (United States)

    Gaire, Sudip; O'Connell, Mary; Holguin, Francisco O; Amatya, Anup; Bundy, Scott; Romero, Alvaro

    2017-04-01

    The Turkestan cockroach, Blatta lateralis (Walker), has become the most important peridomestic species in urban areas of the Southwestern United States. The aim of this study was to evaluate the use of botanical compounds to control this urban pest. We tested the acute toxicity and repellency of six botanical constituents and three essential oils on Turkestan cockroach nymphs. Chemical composition of the essential oils was also determined. Topical and fumigant assays with nymphs showed that thymol was the most toxic essential oil constituent, with a LD50 of 0.34 mg/nymph and a LC50 of 27.6 mg/liter air, respectively. Contact toxicity was also observed in assays with trans-Cinnamaldehyde, eugenol, geraniol, methyl eugenol, and p-Cymene. Methyl eugenol and geraniol had limited fumigant toxicity. The essential oils from red thyme, clove bud, and Java citronella exhibited toxicity against nymphs. Cockroaches avoided fresh dry residues of thymol and essential oils. Chemical analysis of the essential oils confirmed high contents of effective essential oil constituents. Our results demonstrated that essential oils and some of their constituents have potential as eco-friendly insecticides for the management of Turkestan cockroaches. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  6. Cockroaches traverse crevices, crawl rapidly in confined spaces, and inspire a soft, legged robot

    Science.gov (United States)

    Jayaram, Kaushik; Full, Robert J.

    2016-01-01

    Jointed exoskeletons permit rapid appendage-driven locomotion but retain the soft-bodied, shape-changing ability to explore confined environments. We challenged cockroaches with horizontal crevices smaller than a quarter of their standing body height. Cockroaches rapidly traversed crevices in 300–800 ms by compressing their body 40–60%. High-speed videography revealed crevice negotiation to be a complex, discontinuous maneuver. After traversing horizontal crevices to enter a vertically confined space, cockroaches crawled at velocities approaching 60 cm⋅s−1, despite body compression and postural changes. Running velocity, stride length, and stride period only decreased at the smallest crevice height (4 mm), whereas slipping and the probability of zigzag paths increased. To explain confined-space running performance limits, we altered ceiling and ground friction. Increased ceiling friction decreased velocity by decreasing stride length and increasing slipping. Increased ground friction resulted in velocity and stride length attaining a maximum at intermediate friction levels. These data support a model of an unexplored mode of locomotion—“body-friction legged crawling” with body drag, friction-dominated leg thrust, but no media flow as in air, water, or sand. To define the limits of body compression in confined spaces, we conducted dynamic compressive cycle tests on living animals. Exoskeletal strength allowed cockroaches to withstand forces 300 times body weight when traversing the smallest crevices and up to nearly 900 times body weight without injury. Cockroach exoskeletons provided biological inspiration for the manufacture of an origami-style, soft, legged robot that can locomote rapidly in both open and confined spaces. PMID:26858443

  7. Pyrethroid resistance and cross-resistance in the German cockroach, Blattella germanica (L).

    Science.gov (United States)

    Wei, Y; Appel, A G; Moar, W J; Liu, N

    2001-11-01

    A German cockroach (Blatella germanica (L)) strain, Apyr-R, was collected from Opelika, Alabama after control failures with pyrethroid insecticides. Levels of resistance to permethrin and deltamethrin in Apyr-R (97- and 480-fold, respectively, compared with a susceptible strain, ACY) were partially or mostly suppressed by piperonyl butoxide (PBO) and S,S,S,-tributylphosphorotrithioate (DEF), suggesting that P450 monooxygenases and hydrolases are involved in resistance to these two pyrethroids in Apyr-R. However, incomplete suppression of pyrethroid resistance with PBO and DEF implies that one or more additional mechanisms are involved in resistance. Injection, compared with topical application, resulted in 43- and 48-fold increases in toxicity of permethrin in ACY and Apyr-R, respectively. Similarly, injection increased the toxicity of deltamethrin 27-fold in ACY and 28-fold in Apyr-R. These data indicate that cuticular penetration is one of the obstacles for the effectiveness of pyrethroids against German cockroaches. However, injection did not change the levels of resistance to either permethrin or deltamethrin, suggesting that a decrease in the rate of cuticular penetration may not play an important role in pyrethroid resistance in Apyr-R. Apyr-R showed cross-resistance to imidacloprid, with a resistance ratio of 10. PBO treatment resulted in no significant change in the toxicity of imidacloprid, implying that P450 monooxygenase-mediated detoxication is not the mechanism responsible for cross-resistance. Apyr-R showed no cross-resistance to spinosad, although spinosad had relatively low toxicity to German cockroaches compared with other insecticides tested in this study. This result further confirmed that the mode of action of spinosad to insects is unique. Fipronil, a relatively new insecticide, was highly toxic to German cockroaches, and the multi-resistance mechanisms in Apyr-R did not confer significant cross-resistance to this compound. Thus, we propose

  8. Origin and extent of resistance to fipronil in the German cockroach, Blattella germanica (L.) (Dictyoptera: Blattellidae).

    Science.gov (United States)

    Holbrook, Glenn L; Roebuck, Jamie; Moore, Clyde B; Waldvogel, Michael G; Schal, Coby

    2003-10-01

    Fipronil, a phenylpyrazole insecticide, was made available in 1999 in bait formulations for use against the German cockroach, Blattella germanica (L.). We have investigated resistance to fipronil in the descendants of cockroaches collected just before, or contemporaneously with, the introduction of fipronil baits. Cockroaches were obtained in two types of settings: homes that either had or had not been serviced by a pest management professional while occupied by their current residents. Thorough inspections by us turned up no evidence that fipronil had been used in any of the homes, and in addition, no residents claimed to have used baits containing fipronil. Resistance to fipronil was detected by topically dosing adult males with the LC99 of fipronil, the value of which was determined in a dose-response assay with males of an insecticide-susceptible strain. Fewer than 99 of 100 males of all field-collected strains died within 72 h of being treated. Moreover, substantial numbers of males survived doses three and 10-fold greater than the LC99. Regression analysis showed that 67% of the variation in the percentage of males that died after being treated with fipronil was explained by a linear relationship with the percentage that died after being treated with dieldrin. Therefore, it appears that resistance to fipronil in German cockroaches--whose ancestors had never been exposed to it--is attributable to enduring resistance to the cyclodienes, which were formerly used for cockroach control and have a similar mode of action as fipronil. Lastly, we found that insects resistant to topically administered fipronil were likewise resistant, and to a similar degree, to ingested fipronil.

  9. Isolation of Intestinal Parasites of Public Health Importance from Cockroaches (Blattella germanica) in Jimma Town, Southwestern Ethiopia.

    Science.gov (United States)

    Hamu, Haji; Debalke, Serkadis; Zemene, Endalew; Birlie, Belay; Mekonnen, Zeleke; Yewhalaw, Delenasaw

    2014-01-01

    Cockroaches are claimed to be mechanical transmitters of disease causing microorganisms such as intestinal parasites, bacteria, fungi, and viruses. This study assessed the potential of the German cockroach Blattella germanica in the mechanical transmission of intestinal parasites of public health importance. A total of 2010 cockroaches were collected from 404 households in Jimma Town, southwestern Ethiopia. All the collected cockroaches were identified to species as B. germanica. The contents of their gut and external body parts were examined for the presence of intestinal parasites. Overall, 152 (75.6%) of the 210 batches were found to harbor at least one species of human intestinal parasite. Ascaris lumbricoides, Trichuris trichiura, Taenia spp, Strongyloides-like parasite, Entamoeba histolytica/dispar/moshkovski, Giardia duodenalis and Balantidium coli were detected from gut contents. Moreover, parasites were also isolated from the external surface in 22 (10.95%) of the batches. There was significant difference in parasite carriage rate of the cockroaches among the study sites (P = 0.013). In conclusion, B. germanica was found to harbor intestinal parasites of public health importance. Hence, awareness on the potential role of cockroaches in the mechanical transmission of human intestinal parasites needs to be created. Moreover, further identification of the Strongyloides-like worm is required using molecular diagnostics.

  10. Isolation of Intestinal Parasites of Public Health Importance from Cockroaches (Blattella germanica in Jimma Town, Southwestern Ethiopia

    Directory of Open Access Journals (Sweden)

    Haji Hamu

    2014-01-01

    Full Text Available Cockroaches are claimed to be mechanical transmitters of disease causing microorganisms such as intestinal parasites, bacteria, fungi, and viruses. This study assessed the potential of the German cockroach Blattella germanica in the mechanical transmission of intestinal parasites of public health importance. A total of 2010 cockroaches were collected from 404 households in Jimma Town, southwestern Ethiopia. All the collected cockroaches were identified to species as B. germanica. The contents of their gut and external body parts were examined for the presence of intestinal parasites. Overall, 152 (75.6% of the 210 batches were found to harbor at least one species of human intestinal parasite. Ascaris lumbricoides, Trichuris trichiura, Taenia spp, Strongyloides-like parasite, Entamoeba histolytica/dispar/moshkovski, Giardia duodenalis and Balantidium coli were detected from gut contents. Moreover, parasites were also isolated from the external surface in 22 (10.95% of the batches. There was significant difference in parasite carriage rate of the cockroaches among the study sites (P=0.013. In conclusion, B. germanica was found to harbor intestinal parasites of public health importance. Hence, awareness on the potential role of cockroaches in the mechanical transmission of human intestinal parasites needs to be created. Moreover, further identification of the Strongyloides-like worm is required using molecular diagnostics.

  11. New predatory cockroaches (Insecta: Blattaria: Manipulatoridae fam.n.) from the Upper Cretaceous Myanmar amber

    Science.gov (United States)

    Vršanský, Peter; Bechly, Günter

    2015-04-01

    We describe a new extinct lineage Manipulatoridae (new family) of cockroaches from the Upper Cretaceous (Cenomanian) amber of Myanmar. Manipulator modificaputis gen. et sp. n. is a morphologically unique extinct cockroach that represents the first (of a total of 29 known worldwide) cockroach family reported exclusively from the Myanmar amber. This family represents an early side branch of the stem group of Mantodea (most probably a sister group of Eadiidae within Blattaria/Corydioidea) because it has some synapomorphies with the Mantodea (including the stem group and Eadiidae). This family also retains symplesiomorphies that exclude a position in the crown group, and furthermore has unique autapomorphies that exclude a position as a direct ancestor of Mantodea. The unique adaptations such as strongly elongated extremities and freely movable head on a long neck suggest that these animals were pursuit predators. Five additional specimens (including two immatures) reported from the Myanmar amber suggest that this group was relatively rare but belonged to the indigenous and autochthonous inhabitants of the ancient amber forest of the Myanmar region.

  12. Effects of neck and circumoesophageal connective lesions on posture and locomotion in the cockroach.

    Science.gov (United States)

    Ridgel, Angela L; Ritzmann, Roy E

    2005-06-01

    Few studies in arthropods have documented to what extent local control centers in the thorax can support locomotion in absence of inputs from head ganglia. Posture, walking, and leg motor activity was examined in cockroaches with lesions of neck or circumoesophageal connectives. Early in recovery, cockroaches with neck lesions had hyper-extended postures and did not walk. After recovery, posture was less hyper-extended and animals initiated slow leg movements for multiple cycles. Neck lesioned individuals showed an increase in walking after injection of either octopamine or pilocarpine. The phase of leg movement between segments was reduced in neck lesioned cockroaches from that seen in intact animals, while phases in the same segment remained constant. Neither octopamine nor pilocarpine initiated changes in coordination between segments in neck lesioned individuals. Animals with lesions of the circumoesophageal connectives had postures similar to intact individuals but walked in a tripod gait for extended periods of time. Changes in activity of slow tibial extensor and coxal depressor motor neurons and concomitant changes in leg joint angles were present after the lesions. This suggests that thoracic circuits are sufficient to produce leg movements but coordinated walking with normal motor patterns requires descending input from head ganglia.

  13. The orange spotted cockroach (Blaptica dubia, Serville 1839) is a permissive experimental host for Francisella tularensis

    Science.gov (United States)

    Eklund, Bridget E.; Mahdi, Osama; Huntley, Jason F.; Collins, Elliot; Martin, Caleb; Horzempa, Joseph; Fisher, Nathan A.

    2018-01-01

    Francisella tularensis is a zoonotic bacterial pathogen that causes severe disease in a wide range of host animals, including humans. Well-developed murine models of F. tularensis pathogenesis are available, but they do not meet the needs of all investigators. However, researchers are increasingly turning to insect host systems as a cost-effective alternative that allows greater increased experimental throughput without the regulatory requirements associated with the use of mammals in biomedical research. Unfortunately, the utility of previously-described insect hosts is limited because of temperature restriction, short lifespans, and concerns about the immunological status of insects mass-produced for other purposes. Here, we present a novel host species, the orange spotted (OS) cockroach (Blaptica dubia), that overcomes these limitations and is readily infected by F. tularensis. Intrahemocoel inoculation was accomplished using standard laboratory equipment and lethality was directly proportional to the number of bacteria injected. Progression of infection differed in insects housed at low and high temperatures and F. tularensis mutants lacking key virulence components were attenuated in OS cockroaches. Finally, antibiotics were delivered to infected OS cockroaches by systemic injection and controlled feeding; in the latter case, protection correlated with oral bioavailability in mammals. Collectively, these results demonstrate that this new host system provides investigators with a new tool capable of interrogating F. tularensis virulence and immune evasion in situations where mammalian models are not available or appropriate, such as undirected screens of large mutant libraries. PMID:29578544

  14. Analysis of Cockroach Fauna and Frequency in Human Residential Habitats of North of Isfahan, Iran

    Directory of Open Access Journals (Sweden)

    Dehghani R.1 PhD,

    2016-08-01

    Full Text Available Aims Considering the medical significance of cockroaches as insect vectors of food toxicities, and triggering allergy in respiratory system and skin, this survey was conducted to study the frequency of infestation and their effective factors in Shahin Shahr, Iran. Materials & Methods This cross-sectional descriptive study was carried out in 2010 in Shahin Shahr, Isfahan, Iran. Data gathering instrument was a researcher-made questionnaire regarding to the research aims. Data were analyzed by SPSS 11.5 software using Chi square and Fisher exact tests. Findings 675 of 1000 studied houses (67.5% were infested by all life stages of the cockroaches and 32.5% had no infestation. 46% of infested houses had few, 30% had medium and 24% had high infestation. the bathrooms and toilets were recognized as the most infested places (41%. There were significant relationships between infestation of houses and the age of building (p<0.001, the type of building (p=0.009 and the education level of the family (p<0.001. Significant difference was found between houses equipped their doors and windows by tulles and without tulles (p=0.03. Most infection was found in houses sheltering 5 and more people (72.3%. Significant correlation was found between the infection and the number of family members (p=0.0012. Conclusion Infestation rate of cockroaches in Shahin Shahr houses is high and is mostly of P. americana species.

  15. Pycnoscelus surinamensis cockroach gut microbiota respond consistently to a fungal diet without mirroring those of fungus-farming termites.

    Directory of Open Access Journals (Sweden)

    Callum Richards

    Full Text Available The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within this "bioreactor", and as a key factor for the divergence of the termite gut microbiota from the omnivorous cockroach ancestor. The gut microbiota in most termites supports primarily the breakdown of lignocellulose, but the fungus-farming sub-family of higher termites has become similar in gut microbiota to the ancestral omnivorous cockroaches. To assess the importance of a fungus diet as a driver of community structure, we compare community compositions in the guts of experimentally manipulated Pycnoscelus surinamensis cockroaches fed on fungus cultivated by fungus-farming termites. MiSeq amplicon analysis of gut microbiotas from 49 gut samples showed a step-wise gradient pattern in community similarity that correlated with an increase in the proportion of fungal material provided to the cockroaches. Comparison of the taxonomic composition of manipulated communities to that of gut communities of a fungus-feeding termite species showed that although some bacteria OTUs shared by P. surinamensis and the farming termites increased in the guts of cockroaches on a fungal diet, cockroach communities remained distinct from those of termites. These results demonstrate that a fungal diet can play a role in structuring gut community composition, but at the same time exemplifies how original community compositions constrain the magnitude of such change.

  16. Brain-Computer Interface Controlled Cyborg: Establishing a Functional Information Transfer Pathway from Human Brain to Cockroach Brain.

    Science.gov (United States)

    Li, Guangye; Zhang, Dingguo

    2016-01-01

    An all-chain-wireless brain-to-brain system (BTBS), which enabled motion control of a cyborg cockroach via human brain, was developed in this work. Steady-state visual evoked potential (SSVEP) based brain-computer interface (BCI) was used in this system for recognizing human motion intention and an optimization algorithm was proposed in SSVEP to improve online performance of the BCI. The cyborg cockroach was developed by surgically integrating a portable microstimulator that could generate invasive electrical nerve stimulation. Through Bluetooth communication, specific electrical pulse trains could be triggered from the microstimulator by BCI commands and were sent through the antenna nerve to stimulate the brain of cockroach. Serial experiments were designed and conducted to test overall performance of the BTBS with six human subjects and three cockroaches. The experimental results showed that the online classification accuracy of three-mode BCI increased from 72.86% to 78.56% by 5.70% using the optimization algorithm and the mean response accuracy of the cyborgs using this system reached 89.5%. Moreover, the results also showed that the cyborg could be navigated by the human brain to complete walking along an S-shape track with the success rate of about 20%, suggesting the proposed BTBS established a feasible functional information transfer pathway from the human brain to the cockroach brain.

  17. Effectiveness of an Integrated Pest Management Intervention in Controlling Cockroaches, Mice, and Allergens in New York City Public Housing

    Science.gov (United States)

    Kass, Daniel; McKelvey, Wendy; Carlton, Elizabeth; Hernandez, Marta; Chew, Ginger; Nagle, Sean; Garfinkel, Robin; Clarke, Brian; Tiven, Julius; Espino, Christian; Evans, David

    2009-01-01

    Background Cockroaches and mice, which are common in urban homes, are sources of allergens capable of triggering asthma symptoms. Traditional pest control involves the use of scheduled applications of pesticides by professionals as well as pesticide use by residents. In contrast, integrated pest management (IPM) involves sanitation, building maintenance, and limited use of least toxic pesticides. Objectives We implemented and evaluated IPM compared with traditional practice for its impact on pests, allergens, pesticide use, and resident satisfaction in a large urban public housing authority. Methods We assigned IPM or control status to 13 buildings in five housing developments, and evaluated conditions at baseline, 3 months, and 6 months in 280 apartments in Brooklyn and Manhattan, in New York City (New York). We measured cockroach and mouse populations, collected cockroach and mouse urinary protein allergens in dust, and interviewed residents. All statistical models controlled for baseline levels of pests or allergens. Results Compared with controls, apartments receiving IPM had significantly lower counts of cockroaches at 3 months and greater success in reducing or sustaining low counts of cockroaches at both 3 and 6 months. IPM was associated with lower cockroach allergen levels in kitchens at 3 months and in beds and kitchens at 6 months. Pesticide use was reduced in IPM relative to control apartments. Residents of IPM apartments also rated building services more positively. Conclusions In contrast to previous IPM studies, which involved extensive cleaning, repeat visits, and often extensive resident education, we found that an easily replicable single IPM visit was more effective than the regular application of pesticides alone in managing pests and their consequences. PMID:19672400

  18. Effectiveness of an integrated pest management intervention in controlling cockroaches, mice, and allergens in New York City public housing.

    Science.gov (United States)

    Kass, Daniel; McKelvey, Wendy; Carlton, Elizabeth; Hernandez, Marta; Chew, Ginger; Nagle, Sean; Garfinkel, Robin; Clarke, Brian; Tiven, Julius; Espino, Christian; Evans, David

    2009-08-01

    Cockroaches and mice, which are common in urban homes, are sources of allergens capable of triggering asthma symptoms. Traditional pest control involves the use of scheduled applications of pesticides by professionals as well as pesticide use by residents. In contrast, integrated pest management (IPM) involves sanitation, building maintenance, and limited use of least toxic pesticides. We implemented and evaluated IPM compared with traditional practice for its impact on pests, allergens, pesticide use, and resident satisfaction in a large urban public housing authority. We assigned IPM or control status to 13 buildings in five housing developments, and evaluated conditions at baseline, 3 months, and 6 months in 280 apartments in Brooklyn and Manhattan, in New York City (New York). We measured cockroach and mouse populations, collected cockroach and mouse urinary protein allergens in dust, and interviewed residents. All statistical models controlled for baseline levels of pests or allergens. Compared with controls, apartments receiving IPM had significantly lower counts of cockroaches at 3 months and greater success in reducing or sustaining low counts of cockroaches at both 3 and 6 months. IPM was associated with lower cockroach allergen levels in kitchens at 3 months and in beds and kitchens at 6 months. Pesticide use was reduced in IPM relative to control apartments. Residents of IPM apartments also rated building services more positively. In contrast to previous IPM studies, which involved extensive cleaning, repeat visits, and often extensive resident education, we found that an easily replicable single IPM visit was more effective than the regular application of pesticides alone in managing pests and their consequences.

  19. Major changes in microbial diversity and community composition across gut sections of a juvenile Panchlora cockroach.

    Directory of Open Access Journals (Sweden)

    Erin A Gontang

    Full Text Available Investigations of gut microbiomes have shed light on the diversity and genetic content of these communities, and helped shape our understanding of how host-associated microorganisms influence host physiology, behavior, and health. Despite the importance of gut microbes to metazoans, our understanding of the changes in diversity and composition across the alimentary tract, and the source of the resident community are limited. Here, using community metagenomics and 16S rRNA gene sequencing, we assess microbial community diversity and coding potential in the foregut, midgut, and hindgut of a juvenile Panchlora cockroach, which resides in the refuse piles of the leaf-cutter ant species Atta colombica. We found a significant shift in the microbial community structure and coding potential throughout the three gut sections of Panchlora sp., and through comparison with previously generated metagenomes of the cockroach's food source and niche, we reveal that this shift in microbial community composition is influenced by the ecosystems in which Panchlora sp. occurs. While the foregut is composed of microbes that likely originate from the symbiotic fungus gardens of the ants, the midgut and hindgut are composed of a microbial community that is likely cockroach-specific. Analogous to mammalian systems, the midgut and hindgut appear to be dominated by Firmicutes and Bacteroidetes with the capacity for polysaccharide degradation, suggesting they may assist in the degradation of dietary plant material. Our work underscores the prominence of community changes throughout gut microbiomes and highlights ecological factors that underpin the structure and function of the symbiotic microbial communities of metazoans.

  20. Major changes in microbial diversity and community composition across gut sections of a juvenile Panchlora cockroach.

    Science.gov (United States)

    Gontang, Erin A; Aylward, Frank O; Carlos, Camila; Glavina Del Rio, Tijana; Chovatia, Mansi; Fern, Alison; Lo, Chien-Chi; Malfatti, Stephanie A; Tringe, Susannah G; Currie, Cameron R; Kolter, Roberto

    2017-01-01

    Investigations of gut microbiomes have shed light on the diversity and genetic content of these communities, and helped shape our understanding of how host-associated microorganisms influence host physiology, behavior, and health. Despite the importance of gut microbes to metazoans, our understanding of the changes in diversity and composition across the alimentary tract, and the source of the resident community are limited. Here, using community metagenomics and 16S rRNA gene sequencing, we assess microbial community diversity and coding potential in the foregut, midgut, and hindgut of a juvenile Panchlora cockroach, which resides in the refuse piles of the leaf-cutter ant species Atta colombica. We found a significant shift in the microbial community structure and coding potential throughout the three gut sections of Panchlora sp., and through comparison with previously generated metagenomes of the cockroach's food source and niche, we reveal that this shift in microbial community composition is influenced by the ecosystems in which Panchlora sp. occurs. While the foregut is composed of microbes that likely originate from the symbiotic fungus gardens of the ants, the midgut and hindgut are composed of a microbial community that is likely cockroach-specific. Analogous to mammalian systems, the midgut and hindgut appear to be dominated by Firmicutes and Bacteroidetes with the capacity for polysaccharide degradation, suggesting they may assist in the degradation of dietary plant material. Our work underscores the prominence of community changes throughout gut microbiomes and highlights ecological factors that underpin the structure and function of the symbiotic microbial communities of metazoans.

  1. Evolutionary convergence and nitrogen metabolism in Blattabacterium strain Bge, primary endosymbiont of the cockroach Blattella germanica.

    Directory of Open Access Journals (Sweden)

    Maria J López-Sánchez

    2009-11-01

    Full Text Available Bacterial endosymbionts of insects play a central role in upgrading the diet of their hosts. In certain cases, such as aphids and tsetse flies, endosymbionts complement the metabolic capacity of hosts living on nutrient-deficient diets, while the bacteria harbored by omnivorous carpenter ants are involved in nitrogen recycling. In this study, we describe the genome sequence and inferred metabolism of Blattabacterium strain Bge, the primary Flavobacteria endosymbiont of the omnivorous German cockroach Blattella germanica. Through comparative genomics with other insect endosymbionts and free-living Flavobacteria we reveal that Blattabacterium strain Bge shares the same distribution of functional gene categories only with Blochmannia strains, the primary Gamma-Proteobacteria endosymbiont of carpenter ants. This is a remarkable example of evolutionary convergence during the symbiotic process, involving very distant phylogenetic bacterial taxa within hosts feeding on similar diets. Despite this similarity, different nitrogen economy strategies have emerged in each case. Both bacterial endosymbionts code for urease but display different metabolic functions: Blochmannia strains produce ammonia from dietary urea and then use it as a source of nitrogen, whereas Blattabacterium strain Bge codes for the complete urea cycle that, in combination with urease, produces ammonia as an end product. Not only does the cockroach endosymbiont play an essential role in nutrient supply to the host, but also in the catabolic use of amino acids and nitrogen excretion, as strongly suggested by the stoichiometric analysis of the inferred metabolic network. Here, we explain the metabolic reasons underlying the enigmatic return of cockroaches to the ancestral ammonotelic state.

  2. Evolutionary Convergence and Nitrogen Metabolism in Blattabacterium strain Bge, Primary Endosymbiont of the Cockroach Blattella germanica

    Science.gov (United States)

    López-Sánchez, Maria J.; Neef, Alexander; Peretó, Juli; Patiño-Navarrete, Rafael; Pignatelli, Miguel; Latorre, Amparo; Moya, Andrés

    2009-01-01

    Bacterial endosymbionts of insects play a central role in upgrading the diet of their hosts. In certain cases, such as aphids and tsetse flies, endosymbionts complement the metabolic capacity of hosts living on nutrient-deficient diets, while the bacteria harbored by omnivorous carpenter ants are involved in nitrogen recycling. In this study, we describe the genome sequence and inferred metabolism of Blattabacterium strain Bge, the primary Flavobacteria endosymbiont of the omnivorous German cockroach Blattella germanica. Through comparative genomics with other insect endosymbionts and free-living Flavobacteria we reveal that Blattabacterium strain Bge shares the same distribution of functional gene categories only with Blochmannia strains, the primary Gamma-Proteobacteria endosymbiont of carpenter ants. This is a remarkable example of evolutionary convergence during the symbiotic process, involving very distant phylogenetic bacterial taxa within hosts feeding on similar diets. Despite this similarity, different nitrogen economy strategies have emerged in each case. Both bacterial endosymbionts code for urease but display different metabolic functions: Blochmannia strains produce ammonia from dietary urea and then use it as a source of nitrogen, whereas Blattabacterium strain Bge codes for the complete urea cycle that, in combination with urease, produces ammonia as an end product. Not only does the cockroach endosymbiont play an essential role in nutrient supply to the host, but also in the catabolic use of amino acids and nitrogen excretion, as strongly suggested by the stoichiometric analysis of the inferred metabolic network. Here, we explain the metabolic reasons underlying the enigmatic return of cockroaches to the ancestral ammonotelic state. PMID:19911043

  3. Paleocene origin of the cockroach families Blaberidae and Corydiidae: Evidence from Amur River region of Russia.

    Science.gov (United States)

    Vršanský, Peter; Vidlička, L'Ubomír; Barna, Peter; Bugdaeva, Eugenia; Markevich, Valentina

    2013-01-01

    Morphna paleo sp. n., the earliest winged representative of any living cockroach genus and the earliest representative of the family Blaberidae, is described from the Danian Arkhara-Boguchan coal mine in the Amur River region (Russian Far East). The branched Sc and A suggest Ectobiidae (=Blattellidae) probably is not the ancestral family because Blaberidae were derived directly from the extinct family Mesoblattindae. The associated Danian locality Belaya Gora yielded Ergaula stonebut sp. n., the earliest record of the family Corydiidae. Both species belong to genera codominant in the Messel locality, thus validating their dominance in early Cenozoic assemblages.

  4. Once in Contact, Always in Contact: Contagious Essence and Conceptions of Purification in American and Hindu Indian Children

    Science.gov (United States)

    Hejmadi, Ahalya; Rozin, Paul; Siegal, Michael

    2004-01-01

    Cultural and age differences in responses to contamination and conceptions of purification were examined in Hindu Indian (N = 125) and American (N = 106) 4- to 5-year-olds and 8-year-olds, who were provided with stories of juice contaminated by contact with a cockroach, a human hair, and a stranger (via sipping). Children who rejected the juice as…

  5. Enterobacteriáceas en partes externas del estadío adulto de Periplaneta americana “cucaracha” capturadas en el mercado Modelo, Iquitos, Perú

    Directory of Open Access Journals (Sweden)

    Xandrix Augusto Ruiz Cabezas

    2015-06-01

    Full Text Available Este estudio, determinó la presencia de Enterobacteriáceas en partes externas del estadío adulto de Periplaneta americana “cucaracha” capturadas en el mercado Modelo de la ciudad de Iquitos. Fueron colectados un total de 68 “cucarachas”, y luego cada una fue depositada en un frasco estéril y trasladadas vivas para el análisis respectivo al laboratorio de Investigación de la Facultad de Ciencias Biológicas; después del aislamiento, las colonias observadas fueron sometidas a pruebas de identificación bioquímica tales como: Prueba de oxidasa, utilización de glucosa, lactosa y sacarosa (agar TSI, pruebas VP-RM, indol, hidrólisis de la úrea. La prevalencia de Enterobacteriáceas se determinó utilizando el método estadístico de distribución de frecuencias y la prueba no paramétrica de Chi cuadrado para prueba de hipótesis. De las 68 cucarachas analizadas se aislaron 118 colonias caracterizadas como lactosa positiva y lactosa negativa, representando el 71 % y 29 % respectivamente de las muestras analizadas.  Finalmente, se aisló e identificó 5 cepas bacterianas, categorizadas en 5 géneros: Providencia (25%, Edwardsiella (9%, Citrobacter (14%, Enterobacter (31% y Klebsiella (21%.

  6. Tomaculocystis corpulenta n. gen., n. sp. (Apicomplexa: Eugregarinorida) parasitizing the little yellow cockroach, Cariblatta lutea (Blattodea: Ectobiidae), in Alabama and Florida with recognition of Tomaculocystis cylindrosa n. comb. and Tomaculocystis mukundai n. comb. parasitizing ectobiid cockroaches in India.

    Science.gov (United States)

    Clopton, Richard E

    2015-02-01

    Tomaculocystis corpulenta n. gen., n. sp. (Apicomplexa: Eugregarinorida: Septatorina: Gregarinidae) is described from populations of the little yellow cockroach, Cariblatta lutea (Blattodea: Ectobiidae), established in laboratory culture from samples collected in Alabama and Florida. Tomaculocystis n. gen. are differentiated from other members of Gregarina by a markedly elliptoid gametocyst inside a persistent, lomentiform hyaline epicyst; developmental organization and growth of the spore tubes from gametocyst surface tumidi; and dehiscence by extrusion of non-chain forming oocysts through spore tubes that barely extend beyond the epicyst wall. Gregarina cylindrosa, Gregarina discocephala, and Gregarina mukundai are recognized as members of Tomaculocystis, and G. cylindrosa is recognized as the senior synonym of G. discocephala. Thus, Tomaculocystis cylindrosa n. comb. and Tomaculocystis mukundai n. comb. are formed. Species of Tomaculocystis are distinguished based on gamont deutomerite and oocyst shape and size. The oocysts of T. corpulenta are broadly dolioform, lack 4 polar knobs, and possess distinct, unique polar plates. Oocysts of all other known species in the genus are more oblong in shape, possess 4 polar knobs, and lack the distinct polar plates observed in the oocysts of T. corpulenta. Host utilization and geographic distribution among gregarine genera parasitizing the cockroach family Ectobiidae reveal a pattern of host-parasite specificity linking gregarine genera with ectobiidid subfamilies. Overall patterns suggest a hypothesis of European endemicy for Gamocystis, but hypotheses for the origin and radiation of Tomaculocystis or species of Gregarina infecting cockroaches are confounded by the cosmopolitan spread of pest cockroach species among humans.

  7. Rediscovered and new perisphaerine cockroaches from SW China with a review of subfamilial diagnosis (Blattodea: Blaberidae).

    Science.gov (United States)

    Li, Xin-Ran; Wang, Li-Li; Wang, Zong-Qing

    2018-04-17

    The taxonomic records of Chinese perisphaerine cockroaches were scattered in literature, and therefore a dedicated study is desired to update our knowledge. This paper reviews the subfamilial diagnosis and Chinese species, mostly from southwestern China. We provide high-definition habitus photos and drawings, the latter emphasizes the genitalia of both sexes, which are generalized with diagrams, abstracted from specimens examined. A total of 18 species are recorded in four genera, including Perisphaerus, or pill cockroach, the type genus of the subfamily. Two new genera and three new species are proposed: Achatiblatta achates gen. sp. nov., Frumentiforma frumentiformis gen. sp. nov., and Pseudoglomeris montana sp. nov.. Pseudoglomeris has five new junior synonyms: Corydidarum, Trichoblatta, Kurokia, Glomerexis, and Glomeriblatta; the following combinations are thus revived or new: Ps. aerea comb. nov., Ps. angustifolia comb. nov., Ps. beybienkoi comb. nov., Ps. fallax comb. nov., Ps. magnifica comb. rev., Ps. montshadskii comb. nov., Ps. nigra comb. nov., Ps. sculpta comb. nov., Ps. semisulcata comb. rev., Ps. tibetana comb. nov., and Ps. valida moderata comb. nov.. The following species are revalidated and combinations revived: Pe. pygmaeus comb. rev., Ps. dubia comb. sp. rev., and Ps. planiuscla comb. sp. rev.

  8. Endogenous rhythm and pattern-generating circuit interactions in cockroach motor centres

    Directory of Open Access Journals (Sweden)

    Izhak David

    2016-09-01

    Full Text Available Cockroaches are rapid and stable runners whose gaits emerge from the intricate, and not fully resolved, interplay between endogenous oscillatory pattern-generating networks and sensory feedback that shapes their rhythmic output. Here we studied the endogenous motor output of a brainless, deafferented preparation. We monitored the pilocarpine-induced rhythmic activity of levator and depressor motor neurons in the mesothoracic and metathoracic segments in order to reveal the oscillatory networks’ architecture and interactions. Data analyses included phase relations, latencies between and overlaps of rhythmic bursts, spike frequencies, and the dependence of these parameters on cycle frequency. We found that, overall, ipsilateral connections are stronger than contralateral ones. Our findings revealed asymmetries in connectivity among the different ganglia, in which meta-to-mesothoracic ascending coupling is stronger than meso-to-metathoracic descending coupling. Within-ganglion coupling between the metathoracic hemiganglia is stronger than that in the mesothoracic ganglion. We also report differences in the role and mode of operation of homologue network units (manifested by levator and depressor nerve activity. Many observed characteristics are similar to those exhibited by intact animals, suggesting a dominant role for feedforward control in cockroach locomotion. Based on these data we posit a connectivity scheme among components of the locomotion pattern generating system.

  9. Effective Stimulus Parameters for Directed Locomotion in Madagascar Hissing Cockroach Biobot.

    Directory of Open Access Journals (Sweden)

    Jonathan C Erickson

    Full Text Available Swarms of insects instrumented with wireless electronic backpacks have previously been proposed for potential use in search and rescue operations. Before deploying such biobot swarms, an effective long-term neural-electric stimulus interface must be established, and the locomotion response to various stimuli quantified. To this end, we studied a variety of pulse types (mono- vs. bipolar; voltage- vs. current-controlled and shapes (amplitude, frequency, duration to parameters that are most effective for evoking locomotion along a desired path in the Madagascar hissing cockroach (G. portentosa in response to antennal and cercal stimulation. We identified bipolar, 2 V, 50 Hz, 0.5 s voltage controlled pulses as being optimal for evoking forward motion and turns in the expected contraversive direction without habituation in ≈50% of test subjects, a substantial increase over ≈10% success rates previously reported. Larger amplitudes for voltage (1-4 V and current (50-150 μA pulses generally evoked larger forward walking (15.6-25.6 cm; 3.9-5.6 cm/s but smaller concomitant turning responses (149 to 80.0 deg; 62.8 to 41.2 deg/s. Thus, the radius of curvature of the initial turn-then-run locomotor response (≈10-25 cm could be controlled in a graded manner by varying the stimulus amplitude. These findings could be used to help optimize stimulus protocols for swarms of cockroach biobots navigating unknown terrain.

  10. Modeling population dynamics of two cockroach species: Effects of the circadian clock, interspecific competition and pest control

    Czech Academy of Sciences Publication Activity Database

    Wu, H. H.; Lee, H. J.; Horng, S. B.; Berec, Luděk

    2007-01-01

    Roč. 249, - (2007), s. 473-486 ISSN 0022-5193 Institutional research plan: CEZ:AV0Z50070508 Keywords : German cockroach * Blattella germanica * Blatella bisignata Subject RIV: EH - Ecology, Behaviour Impact factor: 2.323, year: 2007

  11. Aromatic hexamerin subunit from adult female cockroaches (Blaberus discoidalis) : Molecular cloning, suppression by juvenile hormone, and evolutionary perspectives

    NARCIS (Netherlands)

    Jamroz, RC; Beintema, JJ; Stam, WT; Bradfield, JY

    In an effort to identify several polypeptides that are strongly suppressed by juvenile hormone (JH) in fat body of adult female Blaberus discoidalis cockroaches, we have cloned a cDNA representing a polypeptide member of the hexamerin family of arthropod serum proteins. The deduced primary

  12. CIRCADIAN CONTROL OF VISUAL INFORMATION-PROCESSING IN THE OPTIC LOBE OF THE GIANT COCKROACH BLABERUS-GIGANTEUS

    NARCIS (Netherlands)

    BULT, R; MASTEBROEK, HAK

    1993-01-01

    Extracellular spike activity from three different types of visual interneurons found in the optic lobe of the giant cockroach Blaberus giganteus was recorded. The spike rate of all three types of neurons fluctuated in a circadian manner in constant darkness (DD). Two types, so-called ''on'' neurons

  13. Pycnoscelus surinamensis cockroach gut microbiota respond consistently to a fungal diet without mirroring those of fungus-farming termites

    DEFF Research Database (Denmark)

    Richards, Callum; Otani, Saria; Mikaelyan, Aram

    2017-01-01

    The gut microbiotas of cockroaches and termites play important roles in the symbiotic digestion of dietary components, such as lignocellulose. Diet has been proposed as a primary determinant of community structure within the gut, acting as a selection force to shape the diversity observed within......-feeding termite species showed that although some bacteria OTUs shared by P. surinamensis and the farming termites increased in the guts of cockroaches on a fungal diet, cockroach communities remained distinct from those of termites. These results demonstrate that a fungal diet can play a role in structuring gut...

  14. Distribution of Thelastomatoid Nematodes (Nematoda: Oxyurida) in Endemic and Introduced Cockroaches on the Galápagos Island Archipelago, Ecuador.

    Science.gov (United States)

    Sinnott, Devinn; Carreno, Ramon A; Herrera, Henri

    2015-08-01

    The thelastomatoid pinworm fauna (Nematoda: Oxyurida: Thelastomatoidea) was surveyed in 3 endemic species and 6 introduced species of cockroach hosts (Insecta: Blattaria) in the Galápagos Islands, Ecuador. A total of 658 host specimens were examined from preserved collections that had been collected between 1966 and 2003 from 7 islands in the archipelago. Eight species of pinworms were identified from these cockroach hosts, including the dominant species Cephalobellus ovumglutinosus and a Severianoia sp. as well as Leidynema appendiculata, Hammerschmidtiella diesingi, an unidentified Cephalobellus species resembling Cephalobellus magalhaesi, an unidentified Protrellus species closely resembling Protrellus shamimi, and an undescribed Blattophila sp. Five new host records are identified for C. ovumglutinosus including the endemic Galápagos cockroaches Chorisoneura carpenteri, Ischnoptera snodgrassii, and Ischnoptera santacruzensis. These endemics were also infected with an undescribed Blatticola sp. Other species recorded resemble known pinworms from other hosts around the world. Prevalence between islands and between host species was variable, but total prevalence for individual pinworm species was consistently low (<10%). A single host specimen examined was infected with more than 1 pinworm species; otherwise only a single species was observed in each infected host. At least 1 introduced pinworm species carried to the islands via invasive cockroach hosts was present in endemic host species, but several globally widespread introduced pinworm species were absent from endemic cockroaches. Santa Cruz was inhabited by the greatest number of pinworm species, likely due to a higher rate of invasive host introduction. This survey, the first from this region, showed that the distribution and transmission of pinworms in the Galápagos Islands is complex and may provide future models of invertebrate dispersal and speciation in an ecosystem already rich with examples of

  15. The First Report of Drug Resistant Bacteria Isolated from the Brown-Banded Cockroach, Supella longipalpa, in Ahvaz, South-western Iran.

    Directory of Open Access Journals (Sweden)

    Babak Vazirianzadeh

    2014-06-01

    Full Text Available The brown-banded cockroach, Supella longipalpa is known as a carrier of pathogenic bacteria in urban environments, but its role is not well documented regarding the carriage of antibiotic-resistant pathogenic bacteria in Iran. The aim of this study was to determine the resistance bacteria isolated from the brown-banded cockroach in Ahvaz, south west of Iran.Totally 39 cockroaches were collected from kitchen area of houses and identified. All specimens were cultured to isolate the bacterial agents on blood agar and MacConky agar media. The microorganisms were identified using necessary differential and biochemical tests. Antimicrobial susceptibility tests were performed for isolated organisms by Kirby-Bauer's disk diffusion according to NCLI guideline, using 18 antibiotics.From the 39 collected S. langipalpa, 179 bacterial agents were isolated, 92 of alimentary ducts and 87 of external body surfaces. Isolated bacteria from cockroaches were identified as Enterobacter spp., Klebsiella spp., Citrobacter spp., Escherichia coli, Salmonella spp., Proteus spp., coagulase negative staphylococci, Serratia marcescens, Staphylococcus aureus, and Bacillus species. The pattern resistance rates were determined for gram negative bacilli and gram positive cocci regarding 18 antibiotics.The brown-banded cockroach can be involved in the spread of drug resistant bacteria and increases the possibility of contacting human environment to drug resistant bacteria. Therefore, the potential of removing this insect should be improved. This is the first original report of drug resistant bacteria isolated from the brown-banded cockroach of Iran.

  16. Site of water vapor absorption in the desert cockroach, Arenivaga investigata.

    Science.gov (United States)

    O'Donnell, M J

    1977-01-01

    The desert cockroach, Arenivaga investigata, can gain weight by absorption of water-vapor from unsaturated atmospheres above 82.5% relative humidity. Blocking the anus or the dorsal surface with wax does not prevent water vapor uptake, but interference with movements of the mouthparts or blocking the mouth with wax-prevents such uptake. Weight gains are associated with the protrusion from the mouth of two bladder-like extensions of the hypopharynx. During absorption these structures are warmer than the surrounding mouthparts, their surface temperature increasing with relative humidity. This suggests that the surfaces of the bladder-like structures function at least as sites for condensation of water vapor, but the precise location of its transfer into the hemolymph has not yet been identified. Images PMID:266217

  17. [Cockroaches and co. The role of health pests as allergen source].

    Science.gov (United States)

    Raulf, M; Sander, I; Gonnissen, D; Zahradnik, E; Brüning, T

    2014-05-01

    In most of the cases health pests are carriers of pathogens or parasites which have a negative impact on human health or affect the health of other mammals. What is lesser known is that they can also act as allergens. Most of the health pests in this sense belong to the arthropods, such as cockroaches (Blattaria), mosquitos (Culiciformia), lice (Pediculus humanus corporis), fleas (Siphonaptera) and ticks (Argasidae). In the group of vertebrates rats (Rattus norvegicus and Rattus rattus), house mice (Mus musculus) and pigeons (Columba livia domestica) are also classified as health pests. Also storage pests which are not carriers of pathogens can induce secondary infestation with hygiene pests or molds and have an underestimated impact on human health. In this article selected examples of health pests and also storage pests as an allergen source are described, taking into account the sensitization prevalence and identified single allergens.

  18. Establishing health standards for indoor foreign proteins related to asthma: Dust mite, cat and cockroach

    Energy Technology Data Exchange (ETDEWEB)

    Platts-Mills, T.A.E.; Chapman, M.D.; Pollart, S.M.; Heymann, P.W.; Luczynska, C.M. (Univ. of Virginia, Charlottesville (United States))

    1990-01-01

    There is no doubt that a large number of individuals become allergic to foreign proteins that are predominantly or exclusively present indoors. In each case this immune response can be demonstrated either by immediate skin test responses or by measuring serum IgE antibodies. It has also been obvious for some time that patients presenting with asthma, perennial rhinitis and atopic dermatitis have an increased prevalence of IgE antibodies to these indoor allergens. More recently several epidemiological surveys have suggested that both mite exposure and IgE antibodies are important risk factors for asthma. The present situation is that assays have been developed capable of measuring the presence of mite, cockroach and cat allergens in house dust. Further clinical studies will be necessary to test the proposed standards for mite allergens and to define risk levels for other allergens.

  19. The Optic Lobes Regulate Circadian Rhythms of Olfactory Learning and Memory in the Cockroach.

    Science.gov (United States)

    Lubinski, Alexander J; Page, Terry L

    2016-04-01

    The cockroach, Leucophaea maderae, can be trained in an associative olfactory memory task by either classical or operant conditioning. When trained by classical conditioning, memory formation is regulated by a circadian clock, but once the memory is formed, it can be recalled at any circadian time. In contrast, when trained via operant conditioning, animals can learn the task at any circadian phase, but the ability to recall the long-term memory is tied to the phase of training. The optic lobes of the cockroach contain a circadian clock that drives circadian rhythms of locomotor activity, mating behavior, sensitivity of the compound eye to light, and the sensitivity of olfactory receptors in the antennae. To evaluate the role of the optic lobes in regulating learning and memory processes, the authors examined the effects of surgical ablation of the optic lobes on memory formation in classical conditioning and memory recall following operant conditioning. The effect of optic lobe ablation was to "rescue" the deficit in memory acquisition at a time the animals normally cannot learn and "rescue" the animal's ability to recall a memory formed by operant conditioning at a phase where memory was not normally expressed. The results suggested that the optic lobe pacemaker regulates these processes through inhibition at "inappropriate" times of day. As a pharmacological test of this hypothesis, the authors showed that injections of fipronil, an antagonist of GABA and glutamate-activated chloride channels, had the same effects as optic lobe ablation on memory formation and recall. The data suggest that the optic lobes contain the circadian clock(s) that regulate learning and memory processes via inhibition of neural processes in the brain. © 2015 The Author(s).

  20. Hierarchical Genetic Analysis of German Cockroach (Blattella germanica) Populations from within Buildings to across Continents

    Science.gov (United States)

    Vargo, Edward L.; Crissman, Jonathan R.; Booth, Warren; Santangelo, Richard G.; Mukha, Dmitry V.; Schal, Coby

    2014-01-01

    Understanding the population structure of species that disperse primarily by human transport is essential to predicting and controlling human-mediated spread of invasive species. The German cockroach (Blattella germanica) is a widespread urban invader that can actively disperse within buildings but is spread solely by human-mediated dispersal over longer distances; however, its population structure is poorly understood. Using microsatellite markers we investigated population structure at several spatial scales, from populations within single apartment buildings to populations from several cities across the U.S. and Eurasia. Both traditional measures of genetic differentiation and Bayesian clustering methods revealed increasing levels of genetic differentiation at greater geographic scales. Our results are consistent with active dispersal of cockroaches largely limited to movement within a building. Their low levels of genetic differentiation, yet limited active spread between buildings, suggests a greater likelihood of human-mediated dispersal at more local scales (within a city) than at larger spatial scales (within and between continents). About half the populations from across the U.S. clustered together with other U.S. populations, and isolation by distance was evident across the U.S. Levels of genetic differentiation among Eurasian cities were greater than those in the U.S. and greater than those between the U.S. and Eurasia, but no clear pattern of structure at the continent level was detected. MtDNA sequence variation was low and failed to reveal any geographical structure. The weak genetic structure detected here is likely due to a combination of historical admixture among populations and periodic population bottlenecks and founder events, but more extensive studies are needed to determine whether signatures of global movement may be present in this species. PMID:25020136

  1. Suboptimal nutrient balancing despite dietary choice in glucose-averse German cockroaches, Blattella germanica.

    Science.gov (United States)

    Jensen, Kim; Schal, Coby; Silverman, Jules

    2015-10-01

    Insects have evolved fine-tuned gustatory and post-ingestive physiological mechanisms that enable them to self-select an optimal composition of macronutrients. Their ability to forage optimally among multiple food sources and maximize fitness parameters depends on their ability not only to taste and perceive the nutritional value of potential foods but also to avoid deleterious components; the strength of such avoidance should reflect the severity of the perceived hazard. In German cockroaches (Blattella germanica), glucose aversion has evolved in some populations in response to anthropogenic selection with glucose-containing insecticidal baits. In four feeding treatments, we gave newly eclosed glucose-averse female cockroaches free choice to feed from two artificial, nutritionally complementary foods varying in protein and carbohydrate composition, with glucose or fructose as the sole carbohydrate source in either food. After 6days of feeding, we measured diet consumption and the length of basal oocytes as an estimate of sexual maturation. The females did not compromise on their aversion to glucose in order to balance their protein and carbohydrate intake, and experienced lower sexual maturation rates as a consequence. Nutrient specific hunger via feedback mechanisms, and adjustments to gustatory sensitivity thus do not override the deterrence of glucose, likely due to strong selection against ingesting even small amounts of toxin associated with glucose in baits. In the absence of baits, glucose aversion would be expected to incur a fitness cost compared to wild-type individuals due to lower overall food availability but also to larger difficulty in attaining a nutritionally balanced diet. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Gas exchange patterns and water loss rates in the Table Mountain cockroach, Aptera fusca (Blattodea: Blaberidae).

    Science.gov (United States)

    Groenewald, Berlizé; Bazelet, Corinna S; Potter, C Paige; Terblanche, John S

    2013-10-15

    The importance of metabolic rate and/or spiracle modulation for saving respiratory water is contentious. One major explanation for gas exchange pattern variation in terrestrial insects is to effect a respiratory water loss (RWL) saving. To test this, we measured the rates of CO2 and H2O release ( and , respectively) in a previously unstudied, mesic cockroach, Aptera fusca, and compared gas exchange and water loss parameters among the major gas exchange patterns (continuous, cyclic, discontinuous gas exchange) at a range of temperatures. Mean , and per unit did not differ among the gas exchange patterns at all temperatures (P>0.09). There was no significant association between temperature and gas exchange pattern type (P=0.63). Percentage of RWL (relative to total water loss) was typically low (9.79±1.84%) and did not differ significantly among gas exchange patterns at 15°C (P=0.26). The method of estimation had a large impact on the percentage of RWL, and of the three techniques investigated (traditional, regression and hyperoxic switch), the traditional method generally performed best. In many respects, A. fusca has typical gas exchange for what might be expected from other insects studied to date (e.g. , , RWL and cuticular water loss). However, we found for A. fusca that expressed as a function of metabolic rate was significantly higher than the expected consensus relationship for insects, suggesting it is under considerable pressure to save water. Despite this, we found no consistent evidence supporting the conclusion that transitions in pattern type yield reductions in RWL in this mesic cockroach.

  3. Geographical Assessment of Sacred Groves in Bolpur Sub-division ...

    African Journals Online (AJOL)

    Dr Osondu

    area). Methodology. A total 41 different Sacred Groves in Bolpur sub- division area were randomly ... as breeding sites for some animals and recreational facilities. Groves of Bolpur ..... Cockroach(Periplaneta anericane),Black bee. Reptiles.

  4. ORF Alignment: NT_033779 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available n-like protein CL3 [Periplaneta americana] ... Length = 128 ... Query: 1 ... MVLDNQEDKLLTTTFLKSMGLSFTQSWHH... NT_033779 gi|21357645 >1qddA 26 143 127 254 1e-07 ... dbj|BAA82266.1| Cockroach lecti

  5. Pest Prevalence and Evaluation of Community-Wide Integrated Pest Management for Reducing Cockroach Infestations and Indoor Insecticide Residues.

    Science.gov (United States)

    Zha, Chen; Wang, Changlu; Buckley, Brian; Yang, Ill; Wang, Desen; Eiden, Amanda L; Cooper, Richard

    2018-04-02

    Pest infestations in residential buildings are common, but community-wide pest survey data are lacking. Frequent insecticide applications for controlling indoor pests leave insecticide residues and pose potential health risks to residents. In this study, a community-wide pest survey was carried out in a housing complex consisting of 258 units in 40 buildings in New Brunswick, New Jersey. It was immediately followed by implementation of an integrated pest management (IPM) program in all the cockroach-infested apartments and two bed bug apartments with the goal of eliminating pest infestations, reducing pyrethroid residues, and increasing resident satisfaction with pest control services. The IPM-treated apartments were revisited and treated biweekly or monthly for 7 mo. Initial inspection found the top three pests and their infestation rates to be as follows: German cockroaches (Blattella germanica L. [Blattodea: Blattellidae]), 28%; rodents, 11%; and bed bugs (Cimex lectularius L. [Hemiptera: Cimicidae]), 8%. Floor wipe samples were collected in the kitchens and bedrooms of 20 apartments for pyrethroid residue analysis before the IPM implementation; 17 of the 20 apartments were resampled again at 7 mo. The IPM program reduced cockroach counts per apartment by 88% at 7 wk after initial treatment. At 7 mo, 85% of the cockroach infestations found in the initial survey were eliminated. The average number of pyrethroids detected decreased significantly from 6 ± 1 (mean ± SEM) and 5 ± 1 to 2 ± 1 and 3 ± 1 in the kitchens and bedrooms, respectively. The average concentrations of targeted pyrethroids residue also decreased significantly in the kitchens and bedrooms.

  6. Cuticle Fatty Acid Composition and Differential Susceptibility of Three Species of Cockroaches to the Entomopathogenic Fungi Metarhizium anisopliae (Ascomycota, Hypocreales).

    Science.gov (United States)

    Gutierrez, Alejandra C; Gołębiowski, Marek; Pennisi, Mariana; Peterson, Graciela; García, Juan J; Manfrino, Romina G; López Lastra, Claudia C

    2015-04-01

    Differences in free fatty acids (FFAs) chemical composition of insects may be responsible for susceptibility or resistance to fungal infection. Determination of FFAs found in cuticular lipids can effectively contribute to the knowledge concerning insect defense mechanisms. In this study, we have evaluated the susceptibility of three species of cockroaches to the entomopathogenic fungi Metarhizium anisopliae (Metschnikoff) Sorokin by topical application. Mortality due to M. anisopliae was highly significant on adults and nymphs of Blattella germanica L. (Blattodea: Blattellidae). However, mortality was faster in adults than in nymphs. Adults of Blatta orientalis L. (Blattodea: Blattidae) were not susceptible to the fungus, and nymphs of Blaptica dubia Serville (Blattodea: Blaberidae) were more susceptible to the fungus than adults. The composition of cuticular FFAs in the three species of cockroaches was also studied. The analysis indicated that all of the fatty acids were mostly straight-chain, long-chain, saturated or unsaturated. Cuticular lipids of three species of cockroaches contained 19 FFAs, ranging from C14:0 to C24:0. The predominant fatty acids found in the three studied species of cockroaches were oleic, linoleic, palmitic, and stearic acid. Only in adults of Bl. orientalis, myristoleic acid, γ-linolenic acid, arachidic acid, dihomolinoleic acid, and behenic acid were identified. Lignoceric acid was detected only in nymphs of Bl. orientalis. Heneicosylic acid and docosahexaenoic acid were identified in adults of Ba. dubia. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  7. Caffeine-supplemented diet modulates oxidative stress markers and improves locomotor behavior in the lobster cockroach Nauphoeta cinerea.

    Science.gov (United States)

    da Silva, Cícera Simoni; de Cássia Gonçalves de Lima, Rita; Elekofehinti, Olusola Olalekan; Ogunbolude, Yetunde; Duarte, Antonia Eliene; Rocha, João Batista Teixeira; Alencar de Menezes, Irwin Rose; Barros, Luiz Marivando; Tsopmo, Appolinaire; Lukong, Kiven Erique; Kamdem, Jean Paul

    2018-02-25

    The effects of caffeine supplementation is well documented in conventional animal models, however, in the lobster cockroaches Nauphoeta cinerea, they have not been reported. Thus, the aim of this study was to investigate the locomotor behavior and biochemical endpoints in the head of the nymphs of N. cinerea following 60 days exposure to food supplemented with 0, 0.5, 1.0, 2.5, 5.0 and 10.0 mg of caffeine/g of diet. The analysis of the locomotor behavior using the video-tracking software, Any-maze, for 12 min revealed that caffeine supplementation caused significant behavioral improvement. There was increase in distance travelled, velocity, frequency of rotation and turn angle (stereotypical behavior such as circling movements), and this was supported by the representative track plots of the path travelled by cockroaches in the open-field arena. In addition, caffeine supplementation markedly increased total thiol and non-protein thiol glutathione (GSH) levels in the heads of cockroaches, and this was in parallel with significant reduction of lipid peroxidation and free Fe(II) content. Taking together, our results indicate that long-term caffeine supplementation may exert preventive effects against oxidative stress and support the use of N. cinerea as an efficient alternative model to assess the efficacy of food molecules. Copyright © 2018 Elsevier B.V. All rights reserved.

  8. Leg Regrowth in Blaberus discoidalis (Discoid Cockroach) following Limb Autotomy versus Limb Severance and Relevance to Neurophysiology Experiments

    Science.gov (United States)

    Marzullo, Timothy C.

    2016-01-01

    Background Many insects can regenerate limbs, but less is known about the regrowth process with regard to limb injury type. As part of our neurophysiology education experiments involving the removal of a cockroach leg, 1) the ability of Blaberus discoidalis cockroaches to regenerate a metathoracic leg was examined following autotomy at the femur/trochanter joint versus severance via a transverse coxa-cut, and 2) the neurophysiology of the detached legs with regard to leg removal type was studied by measuring spike firing rate and microstimulation movement thresholds. Leg Regrowth Results First appearance of leg regrowth was after 5 weeks in the autotomy group and 12 weeks in the coxa-cut group. Moreover, regenerated legs in the autotomy group were 72% of full size on first appearance, significantly larger (pbarbs, and a 10% higher electrical microstimulation threshold for movement. Summary It is recommended that neurophysiology experiments on cockroach legs remove the limb at autotomy joints instead of coxa cuts, as the leg regenerates significantly faster when autotomized and does not detract from the neurophysiology educational content. PMID:26824931

  9. Toxicity of entomopathogenic fungi, Beauveria bassiana and Lecanicillium muscarium against a field-collected strain of the German cockroach Blattella germanica (L.) (Dictyoptera: Blattellidae).

    Science.gov (United States)

    Davari, B; Limoee, M; Khodavaisy, S; Zamini, G; Izadi, S

    2015-09-01

    The German cockroach, Blattella germanica (L.) has been recognized as a serious health problem throughout the world. Control failures due to insecticide resistance and chemical contamination of environment have led some researchers focus on the other alternative strategy controls. Microbial insecticides such as those containing entomo pathogenic fungi could be of high significance. Lecanicillium muscarium and Beauveria bassiana grow naturally in soils throughout the world and act as a parasite on various arthropod species, causing white muscardine disease. Thus, these two species could be considered as entomopathogenic fungi. The current study conducted to evaluate the toxicity of Beauveria bassiana and Lecanicillium muscarium against German cockroach, Blattella germanica. Conidial formulations of L. muscarium (PTCC 5184) and B. bassiana (PTCC5197) were prepared in aqueous suspensions with Tween 20. Bioassays were performed using two methods including submersion of cockroaches in conidial suspension and baiting. Data were analyzed by Probit program and LC50 and LC90 were estimated. The obtained results indicated that both fungi species were toxic against German cockroach however; Beauveria bassiana was significantly 4.8 fold more toxic than L. muscarium against German cockroach using submersion method.

  10. Insecticidal and acetylcholine esterase inhibition activity of Asteraceae plant essential oils and their constituents against adults of the German cockroach (Blattella germanica).

    Science.gov (United States)

    Yeom, Hwa-Jeong; Jung, Chan-Sik; Kang, Jaesoon; Kim, Junheon; Lee, Jae-Hyeon; Kim, Dong-Soo; Kim, Hyun-Seok; Park, Pil-Sun; Kang, Kyu-Suk; Park, Il-Kwon

    2015-03-04

    The fumigant and contact toxicities of 16 Asteraceae plant essential oils and their constituents against adult male and female Blattella germanica were examined. In a fumigant toxicity test, tarragon oil exhibited 100% and 90% fumigant toxicity against adult male German cockroaches at 5 and 2.5 mg/filter paper, respectively. Fumigant toxicities of Artemisia arborescens and santolina oils against adult male German cockroaches were 100% at 20 mg/filter paper, but were reduced to 60% and 22.5% at 10 mg/filter paper, respectively. In contact toxicity tests, tarragon and santolina oils showed potent insecticidal activity against adult male German cockroaches. Components of active oils were analyzed using gas chromatography, gas chromatography-mass spectrometry, or nuclear magnetic resonance spectrometer. Among the identified compounds from active essential oils, estragole demonstrated potent fumigant and contact toxicity against adult German cockroaches. β-Phellandrene exhibited inhibition of male and female German cockroach acetylcholinesterase activity with IC50 values of 0.30 and 0.28 mg/mL, respectively.

  11. Role of tropomyosin as a cross-reacting allergen in sensitization to cockroach in patients from Martinique (French Caribbean island) with a respiratory allergy to mite and a food allergy to crab and shrimp

    NARCIS (Netherlands)

    Purohit, A.; Shao, J.; Degreef, J. M.; van Leeuwen, A.; van Ree, R.; Pauli, G.; de Blay, F.

    2007-01-01

    BACKGROUND: Tropomyosin has been described as cross-reacting allergen between mite, cockroach and shrimp. METHODS: In 13 patients with asthma and/or rhinitis sensitized to mite and/or German cockroach and presenting urticaria, oral allergy syndrome or angio-edema upon eating shrimp and/or crab, we

  12. An augmented reality system validation for the treatment of cockroach phobia.

    Science.gov (United States)

    Bretón-López, Juani; Quero, Soledad; Botella, Cristina; García-Palacios, Azucena; Baños, Rosa Maria; Alcañiz, Mariano

    2010-12-01

    Augmented reality (AR) is a new technology in which various virtual elements are incorporated into the user's perception of the real world. The most significant aspect of AR is that the virtual elements add relevant and helpful information to the real scene. AR shares some important characteristics with virtual reality as applied in clinical psychology. However, AR offers additional features that might be crucial for treating certain problems. An AR system designed to treat insect phobia has been used for treating phobia of small animals, and positive preliminary data about the global efficacy of the system have been obtained. However, it is necessary to determine the capacity of similar AR systems and their elements that are designed to evoke anxiety in participants; this is achieved by testing the correspondence between the inclusion of feared stimuli and the induction of anxiety. The objective of the present work is to validate whether the stimuli included in the AR-Insect Phobia system are capable of inducing anxiety in six participants diagnosed with cockroach phobia. Results support the adequacy of each element of the system in inducing anxiety in all participants.

  13. Physiological Costs of Repetitive Courtship Displays in Cockroaches Handicap Locomotor Performance

    Science.gov (United States)

    Mowles, Sophie L.; Jepson, Natalie M.

    2015-01-01

    Courtship displays are typically thought to have evolved via female choice, whereby females select mates based on the characteristics of a display that is expected to honestly reflect some aspect of the male’s quality. Honesty is typically enforced by mechanistic costs and constraints that limit the level at which a display can be performed. It is becoming increasingly apparent that these costs may be energetic costs involved in the production of dynamic, often repetitive displays. A female attending to such a display may thus be assessing the physical fitness of a male as an index of his quality. Such assessment would provide information on his current physical quality as well as his ability to carry out other demanding activities, qualities with which a choosy female should want to provision her offspring. In the current study we use courtship interactions in the Cuban burrowing cockroach, Byrsotria fumigata to directly test whether courtship is associated with a signaler’s performance capacity. Males that had produced courtship displays achieved significantly lower speeds and distances in locomotor trials than non-courting control males. We also found that females mated more readily with males that produced a more vigorous display. Thus, males of this species have developed a strategy where they produce a demanding courtship display, while females choose males based on their ability to produce this display. Courtship displays in many taxa often involve dynamic repetitive actions and as such, signals of stamina in courtship may be more widespread than previously thought. PMID:26606147

  14. Leg Regrowth in Blaberus discoidalis (Discoid Cockroach following Limb Autotomy versus Limb Severance and Relevance to Neurophysiology Experiments.

    Directory of Open Access Journals (Sweden)

    Timothy C Marzullo

    Full Text Available Many insects can regenerate limbs, but less is known about the regrowth process with regard to limb injury type. As part of our neurophysiology education experiments involving the removal of a cockroach leg, 1 the ability of Blaberus discoidalis cockroaches to regenerate a metathoracic leg was examined following autotomy at the femur/trochanter joint versus severance via a transverse coxa-cut, and 2 the neurophysiology of the detached legs with regard to leg removal type was studied by measuring spike firing rate and microstimulation movement thresholds.First appearance of leg regrowth was after 5 weeks in the autotomy group and 12 weeks in the coxa-cut group. Moreover, regenerated legs in the autotomy group were 72% of full size on first appearance, significantly larger (p<0.05 than coxa-cut legs (29% of full size at first appearance. Regenerated legs in both groups grew in size with each subsequent molt; the autotomy-removed legs grew to full size within 18 weeks, whereas coxa-cut legs took longer than 28 weeks to regrow. Removal of the metathoracic leg in both conditions did not have an effect on mortality compared to matched controls with unmolested legs.Autotomy-removed legs had lower spontaneous firing rates, similar marked increased firing rates upon tactile manipulation of tibial barbs, and a 10% higher electrical microstimulation threshold for movement.It is recommended that neurophysiology experiments on cockroach legs remove the limb at autotomy joints instead of coxa cuts, as the leg regenerates significantly faster when autotomized and does not detract from the neurophysiology educational content.

  15. Aryl Hydrocarbon Receptor (AhR Modulates Cockroach Allergen-Induced Immune Responses through Active TGFβ1 Release

    Directory of Open Access Journals (Sweden)

    Yufeng Zhou

    2014-01-01

    Full Text Available Background. Aryl hydrocarbon receptor (AhR, a multifunctional regulator that senses and responds to environmental stimuli, plays a role in normal cell development and immune regulation. Recent evidence supports a significant link between environmental exposure and AhR in the development of allergic diseases. We sought to investigate whether AhR plays a role in mediating cockroach allergen-induced allergic immune responses. Methods. AhR expression in human lung fibroblasts from asthmatic and healthy individuals and in cockroach extract (CRE treated human lung fibroblasts (WI-38 was examined. The role of AhR in modulating CRE induced TGFβ1 production was investigated by using AhR agonist, TCDD, antagonist CH122319, and knockdown of AhR. The role of latent TGFβ1 binding protein-1 (LTBP1 in mediating TCDD induced active TGFβ1 release was also examined. Results. AhR expression was higher in airway fibroblasts from asthmatic subjects as compared to healthy controls. AhR in fibroblasts was activated by TCDD with an increased expression of cyp1a1 and cyp1b1. Increased AhR expression was observed in CRE-treated fibroblasts. Importantly, CRE induced TGFβ1 production in fibroblasts was significantly enhanced by TCDD but inhibited by CH122319. Reduced TGFβ1 production was further confirmed in fibroblasts with AhR knockdown. Moreover, AhR knockdown inhibited CRE induced fibroblast differentiation. Furthermore, TCDD induced active TGFβ1 release was significantly inhibited by LTBP1 knockdown. Conclusion. These results provide evidence for the role of AhR in modulating cockroach allergen-induced immune responses through controlling the active TGFβ1 release, suggesting a possible synergistic effect between exposure to allergens and environmental chemicals on the development of allergic diseases.

  16. Pharmacological characterization of the dopamine-sensitive adenylate cyclase in cockroach brain: evidence for a distinct dopamine receptor

    International Nuclear Information System (INIS)

    Orr, G.L.; Gole, J.W.D.; Notman, H.J.; Downer, R.G.H.

    1987-01-01

    Dopamine increases cyclic AMP production in crude membrane preparations of cockroach brain with plateaus in cyclic AMP production occurring between 1-10 μM and 10 mM. Maximal production of cyclic AMP is 2.25 fold greater than that of control values. Octopamine also increases cyclic AMP production with a Ka of 1.4 μM and maximal production 3.5 fold greater than that of control. 5-Hydroxytryptamine does not increase cyclic AMP production. The effects of octopamine and dopamine are fully additive. The vertebrate dopamine agonists ADTN and epinine stimulate the dopamine-sensitive adenylate cyclase (AC) with Ka values of 4.5 and 0.6 μM respectively and with maximal effectiveness 1.7 fold greater than that of control. The selective D 2 -dopamine agonist LY-171555 stimulates cyclic AMP production to a similar extent with a Ka of 50 μM. Other dopamine agonists have no stimulatory effects. With the exception of mianserin, 3 H-piflutixol is displaced from brain membranes by dopamine antagonists with an order of potency similar to that observed for the inhibition of dopamine-sensitive AC. The results indicate that the octopamine- and dopamine-sensitive AC in cockroach brain can be distinguished pharmacologically and the dopamine receptors coupled to AC have pharmacological characteristics distinct from vertebrate D 1 - and D 2 -dopamine receptors. 33 references, 3 figures, 2 tables

  17. The evolutionary transition from subsocial to eusocial behaviour in Dictyoptera: phylogenetic evidence for modification of the "shift-in-dependent-care" hypothesis with a new subsocial cockroach.

    Science.gov (United States)

    Pellens, Roseli; D'Haese, Cyrille A; Bellés, Xavier; Piulachs, Maria-Dolors; Legendre, Frédéric; Wheeler, Ward C; Grandcolas, Philippe

    2007-05-01

    Cockroaches have always been used to understand the first steps of social evolution in termites because they are close relatives with less complex and integrated social behaviour. Termites are all eusocial and ingroup comparative analysis would be useless to infer the origin of their social behaviour. The cockroach genus Cryptocercus was used as a so-called "prototermite" model because it shows key-attributes similar to the termites (except Termitidae): wood-feeding, intestinal flagellates and subsocial behaviour. In spite of these comparisons between this subsocial cockroach and eusocial termites, the early and remote origin of eusocial behaviour in termites is not well understood yet and the study of other relevant "prototermite" models is however needed. A molecular phylogenetic analysis was carried out to validate a new "prototermite" model, Parasphaeria boleiriana which shows a peculiar combination of these key-attributes. It shows that these attributes of Parasphaeria boleiriana have an independent origin from those of other wood-eating cockroaches and termites. The case of P. boleiriana suggests that a short brood care was selected for with life on an ephemeral wood resource, even with the need for transmission of flagellates. These new phylogenetic insights modify evolutionary hypotheses, contradicting the assumption made with Cryptocercus model that a long brood care is necessary for cooperation between broods in the "shift-in-dependent-care" hypothesis. An ephemeral wood resource is suggested to prompt generation overlap and the evolution of cooperation, even if brood care is shortened.

  18. Look at That!: Using Madagascar Hissing Cockroaches to Develop and Enhance the Scientific Inquiry Skill of Observation in Middle School Students

    Science.gov (United States)

    Wagler, Ron

    2011-01-01

    Middle school students can develop and enhance their observation skills by participating in teacher-guided scientific inquiry (NRC 1996) activities where they observe animals that tend to act in known, predictable ways. Madagascar hissing cockroaches ("Gromphadorhina portentosa") are one such animal. This article presents beginning, intermediate,…

  19. Isolation and partial characterization of a second myotropic peptide from the hindgut of the cockroach, Leucophaea maderae.

    Science.gov (United States)

    Holman, G M; Cook, B J

    1983-01-01

    Proctolin and a second myotropic peptide were extracted from the hindgut of the cockroach Leucophaea maderae with methanol-water-acetic acid (90:9:1). The two peptides were easily separated by HPLC on a mu-Bondapak-phenyl column. Like proctolin, the second peptide was heat stable and was inactivated by the exopeptidases aminopeptidase M and carboxypeptidase Y. The response of the isolated hindgut to the new peptide was distinguishable from the response to proctolin by the following features: (a) a longer interval following application (1-4 min) to reach a maximum contraction, and (b) a much larger amplitude for single phasic contractions. Like proctolin, the new peptide could cause a protracted stimulation of the hindgut for more than 2 hr.

  20. Evaluation of gamma irradiated essential oils to control stored-grain weevil, Sitophilus zeamais and cockroach, Blattella germanica

    International Nuclear Information System (INIS)

    Potenza, Marcos Roberto; Gomes, Davinni Habral Passini; Silvestre, Denise de Fatima; Da Silva, Rita de Cassia; Arthur, Valter

    2004-01-01

    Most of the essential oils have insecticidal activity and are alternatives to plant protection and urban pest control. The gamma radiation has been used to control microorganisms and insects in dehydrate herbs, spices, medicinal plants and other materials. This work aimed to evaluate the effect of irradiated essential oils as contact poison on Stored grain, weevil, Sitophilus zeamais and as stomach poison in cockroach, Blattella germanica. The bioassay with B. germanica demonstrated efficiency between 22.0 and 30.0% and between 30.0 and 42.0% respectively, to irradiated essential oils of E. citriodora and E. globulus and they demonstrated too repellency to the nymphs. The gamma radiation promoted changes in essential oils Eucalyptus citriodora and E. globulus and showed increased effectiveness on B. germanica nymphs besides a significative reduction of repellency. Gamma radiation thus interfered on behavior of some essential oils by increasing or reducing activating or inactivating their efficiency to pest control. (author)

  1. Alveolar Macrophages Play a Key Role in Cockroach-Induced Allergic Inflammation via TNF-α Pathway

    Science.gov (United States)

    Kim, Joo Young; Sohn, Jung Ho; Choi, Je-Min; Lee, Jae-Hyun; Hong, Chein-Soo; Lee, Joo-Shil; Park, Jung-Won

    2012-01-01

    The activity of the serine protease in the German cockroach allergen is important to the development of allergic disease. The protease-activated receptor (PAR)-2, which is expressed in numerous cell types in lung tissue, is known to mediate the cellular events caused by inhaled serine protease. Alveolar macrophages express PAR-2 and produce considerable amounts of tumor necrosis factor (TNF)-α. We determined whether the serine protease in German cockroach extract (GCE) enhances TNF-α production by alveolar macrophages through the PAR-2 pathway and whether the TNF-α production affects GCE-induced pulmonary inflammation. Effects of GCE on alveolar macrophages and TNF-α production were evaluated using in vitro MH-S and RAW264.6 cells and in vivo GCE-induced asthma models of BALB/c mice. GCE contained a large amount of serine protease. In the MH-S and RAW264.7 cells, GCE activated PAR-2 and thereby produced TNF-α. In the GCE-induced asthma model, intranasal administration of GCE increased airway hyperresponsiveness (AHR), inflammatory cell infiltration, productions of serum immunoglobulin E, interleukin (IL)-5, IL-13 and TNF-α production in alveolar macrophages. Blockade of serine proteases prevented the development of GCE induced allergic pathologies. TNF-α blockade also prevented the development of such asthma-like lesions. Depletion of alveolar macrophages reduced AHR and intracellular TNF-α level in pulmonary cell populations in the GCE-induced asthma model. These results suggest that serine protease from GCE affects asthma through an alveolar macrophage and TNF-α dependent manner, reflecting the close relation of innate and adaptive immune response in allergic asthma model. PMID:23094102

  2. Life History of the Emerald Jewel Wasp Ampulex compressa

    Directory of Open Access Journals (Sweden)

    Ryan Arvidson

    2018-04-01

    Full Text Available The Emerald Jewel Wasp Ampulex compressa (Fabricius is an endoparasitoid of the American cockroach Periplaneta americana (Linnaeus. Its host subjugation strategy is unusual in that envenomation is directed into the host central nervous system, eliciting a long-term behavior modification termed hypokinesia, turning stung cockroaches into a lethargic and compliant, but not paralyzed, living food supply for wasp offspring. A. compressa manipulates hypokinesic cockroaches into a burrow, where it oviposits a single egg onto a mesothoracic leg, hatching three days later. Herein we describe the life history and developmental timing of A. compressa. Using head capsule measurements and observations of mandibular morphology, we found that the larvae develop through three instars, the first two ectoparasitoid, and the third exclusively endoparasitoid. The first two instars have mandibles sufficient for piercing and cutting the cuticle respectively, while the third instar has a larger and blunter mandibular structure. During ecdysis to the third instar, the larva enters the body cavity of the cockroach, consuming internal tissues selectively, including fat body and skeletal muscle, but sparing the gut and Malpighian tubules. The developmental timing to pupation is similar between males and females, but cocoon volume and mass, and pupation duration are sexually dimorphic. Further, we show that the difference in cocoon mass and volume can be used to predict sex before eclosion, which is valuable for studies in venom pharmacology, as only females produce venom.

  3. [Effect of population density on enzymatic activity of antioxidative and phenol oxidase systems of imagoes and nymphs of the marble cockroach Nauphoeta cinerea].

    Science.gov (United States)

    Murzagulov, G S; Saltykova, E S; Gaĭfullina, L R; Nikolenko, A G

    2013-01-01

    The work deals with effect of density of population on functional activity of components pf protective system of adult individuals and nymphs of the marble cockroach. The resistance of individuals has been noted to decrease both at individual maintenance and under conditions of overpopulation. Changes in activities of enzymes of antioxidative and phenoloxidase systems are studied ion the insect hemolymph and intestine. Possible consequences of isolation and overpopulation are discussed both for stability and for individual development.

  4. Standard metabolic rate is associated with gestation duration, but not clutch size, in speckled cockroaches Nauphoeta cinerea

    Directory of Open Access Journals (Sweden)

    Natalie G. Schimpf

    2012-09-01

    Metabolic rate varies significantly between individuals, and these differences persist even when the wide range of biotic and abiotic factors that influence metabolism are accounted for. It is important to understand the life history implications of variation in metabolic rate, but they remain poorly characterised despite a growing body of work examining relationships between metabolism and a range of traits. In the present study we used laboratory-bred families (one sire to three dams of Nauphoeta cinerea (Olivier (speckled cockroaches to examine the relationship between standard metabolic rate (SMR and reproductive performance (number of offspring and gestation duration. We show that SMR is negatively associated with female gestation duration. Age at mating is negatively associated with gestation duration for females, and mass is negatively associated with the average gestation duration of the females a male was mated with. In addition to the results in the current literature, the results from the present study suggest that the association between metabolism and life history is more complex than simple relationships between metabolism and various fitness traits. Future work should consider longitudinal, ontogenetic as well as selective and quantitative genetic breeding approaches to fully examine the associations between metabolism and fitness.

  5. Dietary choice for a balanced nutrient intake increases the mean and reduces the variance in the reproductive performance of male and female cockroaches.

    Science.gov (United States)

    Bunning, Harriet; Bassett, Lee; Clowser, Christina; Rapkin, James; Jensen, Kim; House, Clarissa M; Archer, Catharine R; Hunt, John

    2016-07-01

    Sexual selection may cause dietary requirements for reproduction to diverge across the sexes and promote the evolution of different foraging strategies in males and females. However, our understanding of how the sexes regulate their nutrition and the effects that this has on sex-specific fitness is limited. We quantified how protein (P) and carbohydrate (C) intakes affect reproductive traits in male (pheromone expression) and female (clutch size and gestation time) cockroaches (Nauphoeta cinerea). We then determined how the sexes regulate their intake of nutrients when restricted to a single diet and when given dietary choice and how this affected expression of these important reproductive traits. Pheromone levels that improve male attractiveness, female clutch size and gestation time all peaked at a high daily intake of P:C in a 1:8 ratio. This is surprising because female insects typically require more P than males to maximize reproduction. The relatively low P requirement of females may reflect the action of cockroach endosymbionts that help recycle stored nitrogen for protein synthesis. When constrained to a single diet, both sexes prioritized regulating their daily intake of P over C, although this prioritization was stronger in females than males. When given the choice between diets, both sexes actively regulated their intake of nutrients at a 1:4.8 P:C ratio. The P:C ratio did not overlap exactly with the intake of nutrients that optimized reproductive trait expression. Despite this, cockroaches of both sexes that were given dietary choice generally improved the mean and reduced the variance in all reproductive traits we measured relative to animals fed a single diet from the diet choice pair. This pattern was not as strong when compared to the single best diet in our geometric array, suggesting that the relationship between nutrient balancing and reproduction is complex in this species.

  6. A taxonomic study of the beetle cockroaches (Diploptera Saussure) from China, with notes on the genus and species worldwide (Blattodea: Blaberidae: Diplopterinae).

    Science.gov (United States)

    Li, Xinran; Wang, Zongqing

    2015-09-14

    Four taxa of beetle cockroaches (Diploptera Saussure, 1864) from South China are described and illustrated, viz., two new species D. elliptica sp. n. and D. naevus sp. n., one new subspecies D. nigrescens guani subsp. n. and one widespread known species D. punctata (Eschscholtz, 1822). The genus and known species from around the world are discussed based on types and other specimens. D. pulchra Anisyutkin, 2007 is now regarded as a junior synonym of D. bicolor Hanitsch, 1925. Whether the populations of D. punctata represent or not different species needs to be studied in the future. A key, a distribution map, and photos of species are provided.

  7. Personality in the cockroach Diploptera punctata: Evidence for stability across developmental stages despite age effects on boldness

    Science.gov (United States)

    Mettke-Hofmann, Claudia; Preziosi, Richard F.

    2017-01-01

    Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research. Here we test for both differential consistency and age effects upon behavioural traits in the gregarious cockroach Diploptera punctata by testing the same behavioural traits in both juveniles and adults. In our sample, we find consistency in boldness, exploration and sociality within adults whilst only boldness was consistent in juveniles. Both boldness and exploration measures, representative of risk-taking behaviour, show significant consistency across discrete juvenile and adult stages. Age effects are, however, apparent in our data; juveniles are significantly bolder than adults, most likely due to differences in the ecological requirements of these life stages. Size also affects risk-taking behaviour since smaller adults are both bolder and more highly explorative. Whilst a behavioural syndrome linking boldness and exploration is evident in nymphs, this disappears by the adult stage, where links between other behavioural traits become apparent. Our results therefore indicate that differential consistency in personality can be maintained across life stages despite age effects on its magnitude, with links between some personality traits changing over ontogeny, demonstrating plasticity in behavioural syndromes. PMID:28489864

  8. Agonist actions of clothianidin on synaptic and extrasynaptic nicotinic acetylcholine receptors expressed on cockroach sixth abdominal ganglion.

    Science.gov (United States)

    Thany, Steeve H

    2009-11-01

    Clothianidin is new neonicotinoid insecticide acting selectively on insect nicotinic acetylcholine receptors (nAChRs). Its effects on nAChRs expressed on cercal afferent/giant interneuron synapses and DUM neurons have been studied using mannitol-gap and whole-cell patch-clamp techniques, respectively. Bath-application of clothianidin-induced dose-dependent depolarizations of cockroach cercal afferent/giant interneuron synapses which were not reversed after wash-out suggesting a strong desensitization of postsynaptic interneurons at the 6th abdominal ganglion (A6). Clothinidin activity on the nerve preparation was characterized by an increased firing rate of action potentials which then ceased when the depolarization reached a peak. Clothianidin responses were insensitive to all muscarinic antagonists tested but were blocked by co-application of specific nicotinic antagonists methyllicaconitine, alpha-bungarotoxin and d-tubocurarine. In a second round of experiment, clothianidin actions were tested on DUM neurons isolated from the A6. There was a strong desensitization of nAChRs which was not affected by muscarinic antagonists, pirenzepine and atropine, but was reduced with nicotinic antagonist alpha-bungarotoxin. In addition, clothianidin-induced currents were completely blocked by methyllicaconitine suggesting that (1) clothianidin acted as a specific agonist of nAChR subtypes and (2) a small proportion of receptors blocked by MLA was insensitive to alpha-bungarotoxin. Moreover, because clothianidin currents were blocked by d-tubocurarine and mecamylamine, we provided that clothianidin was an agonist of both nAChRs: imidacloprid-sensitive nAChR1 and -insensitive nAChR2 subtypes.

  9. The physiological role of fat body and muscle tissues in response to cold stress in the tropical cockroach Gromphadorhina coquereliana.

    Directory of Open Access Journals (Sweden)

    Szymon Chowański

    Full Text Available Protective mechanisms against cold stress are well studied in terrestrial and polar insects; however, little is known about these mechanisms in tropical insects. In our study, we tested if a tropical cockroach Gromphadorhina coquereliana, possesses any protective mechanisms against cold stress. Based on the results of earlier studies, we examined how short-term (3 h cold (4°C influences biochemical parameters, mitochondrial respiration activity, and the level of HSPs and aquaporins expression in the fat body and leg muscles of G. coquereliana. Following cold exposure, we found that the level of carbohydrates, lipids and proteins did not change significantly. Nevertheless, we observed significant changes in mitochondrial respiration activity. The oxygen consumption of resting (state 4 and phosphorylating (state 3 mitochondria was altered following cold exposure. The increase in respiratory rate in state 4 respiration was observed in both tissues. In state 3, oxygen consumption by mitochondria in fat body was significantly lower compared to control insects, whereas there were no changes observed for mitochondria in muscle tissue. Moreover, there were cold-induced changes in UCP protein activity, but the changes in activity differed in fat body and in muscles. Additionally, we detected changes in the level of HSP70 and aquaporins expression. Insects treated with cold had significantly higher levels of HSP70 in fat body and muscles. On the other hand, there were lower levels of aquaporins in both tissues following exposure to cold. These results suggest that fat body play an important role in protecting tropical insects from cold stress.

  10. Personality in the cockroach Diploptera punctata: Evidence for stability across developmental stages despite age effects on boldness.

    Science.gov (United States)

    Stanley, Christina R; Mettke-Hofmann, Claudia; Preziosi, Richard F

    2017-01-01

    Despite a recent surge in the popularity of animal personality studies and their wide-ranging associations with various aspects of behavioural ecology, our understanding of the development of personality over ontogeny remains poorly understood. Stability over time is a central tenet of personality; ecological pressures experienced by an individual at different life stages may, however, vary considerably, which may have a significant effect on behavioural traits. Invertebrates often go through numerous discrete developmental stages and therefore provide a useful model for such research. Here we test for both differential consistency and age effects upon behavioural traits in the gregarious cockroach Diploptera punctata by testing the same behavioural traits in both juveniles and adults. In our sample, we find consistency in boldness, exploration and sociality within adults whilst only boldness was consistent in juveniles. Both boldness and exploration measures, representative of risk-taking behaviour, show significant consistency across discrete juvenile and adult stages. Age effects are, however, apparent in our data; juveniles are significantly bolder than adults, most likely due to differences in the ecological requirements of these life stages. Size also affects risk-taking behaviour since smaller adults are both bolder and more highly explorative. Whilst a behavioural syndrome linking boldness and exploration is evident in nymphs, this disappears by the adult stage, where links between other behavioural traits become apparent. Our results therefore indicate that differential consistency in personality can be maintained across life stages despite age effects on its magnitude, with links between some personality traits changing over ontogeny, demonstrating plasticity in behavioural syndromes.

  11. Are eavesdroppers multimodal? Sensory exploitation of flo-ral signals by a non-native cockroach Blatta orientalis

    Directory of Open Access Journals (Sweden)

    Rodrigo C. VERGARA, Alejandra TORRES-ARANEDA, Diego A. VILLAGRA, Robert A. RAGUSO, Mary T. K. ARROYO, Cristian A. VILLAGRA

    2011-04-01

    Full Text Available The study of multi-modal communication has only recently been extended to innate and learned interactions between flowers and their animal visitors, and usually only to pollinators. Here we studied the relevance of floral scent and visual display of a night blooming, putatively hawkmoth-pollinated plant Oenothera acaulis (Onagraceae in the attraction of non-native cockroaches Blatta orientalis (Blattodea: Blattidae, which function as facultative floral larcenists in coastal habitats of central Chile. We experimentally decoupled visual (corolla and olfactory (fragrance stimuli by presenting paper corollas and green mesh bags, with or without a freshly-picked natural flower inside. We then contrasted the behavioral responses of roaches in these treatments with those to the natural combination of traits in actual flowers and their respective control treatments, measuring the roaches’ frequency of first visits, mean and total residence time spent in each treatment. The roaches primarily used olfactory cues when approaching O. acaulis flowers at two biologically relevant spatial scales. In addition, the presence of conspecific roaches had a strong influence on recruitment to the experimental arena, increasing the statistical differences among treatments. Our results suggest a primacy of floral fragrance over visual stimuli in the foraging responses of B. orientalis. Olfactory cues were necessary and sufficient to attract the roaches, and the visual cues presented in our manipulations only marginally increased their attraction within a 20 cm diameter of the stimulus. The full spectrum of floral visitation behavior was not elicited by the artificial flowers, suggesting the need for additional tactile or contact chemosensory stimuli not provided by paper. Although the nitrogenous scent compounds that we found in O. acaulis flowers are almost exclusively found in hawkmoth-pollinated flowers, the attractiveness of these compounds to a non

  12. Accurate quantification of 5 German cockroach (GCr) allergens in complex extracts using multiple reaction monitoring mass spectrometry (MRM MS).

    Science.gov (United States)

    Mindaye, S T; Spiric, J; David, N A; Rabin, R L; Slater, J E

    2017-12-01

    German cockroach (GCr) allergen extracts are complex and heterogeneous products, and methods to better assess their potency and composition are needed for adequate studies of their safety and efficacy. The objective of this study was to develop an assay based on liquid chromatography and multiple reaction monitoring mass spectrometry (LC-MRM MS) for rapid, accurate, and reproducible quantification of 5 allergens (Bla g 1, Bla g 2, Bla g 3, Bla g 4, and Bla g 5) in crude GCr allergen extracts. We first established a comprehensive peptide library of allergens from various commercial extracts as well as recombinant allergens. Peptide mapping was performed using high-resolution MS, and the peptide library was then used to identify prototypic and quantotypic peptides to proceed with MRM method development. Assay development included a systematic optimization of digestion conditions (buffer, digestion time, and trypsin concentration), chromatographic separation, and MS parameters. Robustness and suitability were assessed following ICH (Q2 [R1]) guidelines. The method is precise (RSD  0.99, 0.01-1384 fmol/μL), and sensitive (LLOD and LLOQ MS, we quantified allergens from various commercial GCr extracts and showed considerable variability that may impact clinical efficacy. Our data demonstrate that the LC-MRM MS method is valuable for absolute quantification of allergens in GCr extracts and likely has broader applicability to other complex allergen extracts. Definitive quantification provides a new standard for labelling of allergen extracts, which will inform patient care, enable personalized therapy, and enhance the efficacy of immunotherapy for environmental and food allergies. © 2017 The Authors. Clinical & Experimental Allergy published by John Wiley & Sons Ltd. This article has been contributed to by US Government employees and their work is in the public domain in the USA.

  13. Isolation and Identification of Two Novel Attractant Compounds from Chinese Cockroach (Eupolyphaga sinensis Walker by Combination of HSCCC, NMR and CD Techniques

    Directory of Open Access Journals (Sweden)

    Bin Wu

    2013-09-01

    Full Text Available High-speed counter-current chromatography (HSCCC with a two-phase solvent system composed of n-hextane-ethyl acetate-methanol-water (1.5:1:1.5:1, v/v/v/v was applied to the isolation and purification of attractants from Chinese cockroach, Eupolyphaga sinensis Walker. Two new attractants with attractant activity towards the male insects were obtained from the extract sample in a one-step separation. Their purities were determined by HPLC. Subsequent MS, NMR and CD analyses have led to the characterization of (R-3-ethyl-6,8-dihydroxy-7-methyl-3,4-dihydroisochromen-1-one (1 and (R-6,8-dihydroxy-3,7-dimethyl-3,4-dihydroisochromen-1-one (2, two novel isocumarin type attractants. Based on these results, it is concluded that HSCCC is a viable separation method option for purifying insect attractants, while effectively maintaining the attracting activity of the isolates. This is the first attempt to apply counter-current chromatography technique to separate attractants from Chinese cockroach.

  14. dNP2-ctCTLA-4 inhibits German cockroach extract-induced allergic airway inflammation and hyper-responsiveness via inhibition of Th2 responses.

    Science.gov (United States)

    Lim, Sangho; Ho Sohn, Jung; Koo, Ja-Hyun; Park, Jung-Won; Choi, Je-Min

    2017-08-04

    German cockroaches are major household allergens that can trigger allergic airway inflammatory diseases with sensitive T-cell responses. Although the use of immune modulatory biologics, such as antibodies, to mediate allergic responses has recently been examined, only systemic administration is available because of the size limitations on intranasal administration. Here we utilized a cell-permeable peptide, dNP2, to deliver the cytoplasmic domain of cytotoxic T-lymphocyte antigen-4 (ctCTLA-4) through the airway epithelium to modulate Th2 responses in a German cockroach extract (GCE)-induced allergic airway inflammation model. The intranasal delivery efficiency of the dNP2-dTomato protein to the lungs was higher in GCE-induced asthmatic lung parenchymal cells compared to the sham cells. Intranasal administration of the dNP2-ctCTLA-4 protein inhibited airway hyper-responsiveness and reduced airway inflammation and remodeling, including goblet cell metaplasia and collagen deposition around the bronchi. The number of infiltrated cells, including eosinophils, and the levels of IL-4, IL-5, IL-13 and IFN-γ in the lungs were significantly reduced, presumably owing to inhibition of Th2 differentiation. However, intranasal administration of CTLA4-Ig did not inhibit airway inflammation. These results collectively suggest that dNP2-ctCTLA-4 is an efficient intranasally applicable candidate biologic for treating allergic asthma.

  15. MICROBIAL LOAD AND MULTIPLE DRUG RESISTANCE OF PATHOGENIC BACTERIA ISOLATED FROM FEACES AND BODY SURFACES OF COCKROACHES IN AN URBAN AREA OF SOUTHWESTERN NIGERIA

    Directory of Open Access Journals (Sweden)

    Monsuru Adebayo Adeleke

    2012-06-01

    Full Text Available This study investigates the microbial load and antibiotic susceptibility pattern of pathogenic bacteria isolated from the faeces and body surfaces of cockroaches in Osogbo, Southwestern Nigeria. The cockroaches collected from residential areas and hospital vicinities were screened for microbial load and antibiotic susceptibility pattern using standard protocols. A total of twenty- three microorganisms namely Klebsiella aerogenes, Bacillius cereus, Proteus spp, Staphyloccocus aureus, S. saprophyticus, Enteroccocus faecalis, Staphylococus epididermis, E. coli, Listeria monoctogene, Proteus mirabilis, Citrobacter species, Pseudomonas aeruginosa, Psuedomonas species, Seretia mensence, Candida albicans, Candida spp., Aspergilius spp., A. flavus, A. fumigates, Mucor species and Penicilium species were isolated. The microbial load of the microorganisms was significantly higher in the isolates from hospital as compared with the residential area (p<0.05 with the exception of Canidida species, Mucor and Penicillium which had higher or equal microbial load at the residential areas. All the pathogenic bacteria isolated had multiple resistance to antibiotics most importantly, Ampicillin, Augumentin, Amoxicillin and Septrin (30μg. Efforts geared towards controlling the insects will be indispensable in curbing the wide spread of multi-drug resistant pathogens in the study area.

  16. Dust and airborne exposure to allergens derived from cockroach (Blattella germanica) in low-cost public housing in Strasbourg (France).

    Science.gov (United States)

    de Blay, F; Sanchez, J; Hedelin, G; Perez-Infante, A; Vérot, A; Chapman, M; Pauli, G

    1997-01-01

    Although a strong association between allergy to cockroach (CR) and asthma has been observed in the United States and Asia, there are little data about the extent of exposure to CR allergen in Europe. To determine the levels of CR allergens in dust samples from apartments in Strasbourg and to determine the concentration and size of CR allergens in the air. Nine apartments in a public housing complex were chosen on the basis of visual evidence of CR infestation. Levels of CR allergens (Bla g 1 and Bla g 2) in kitchen and mattress dust samples were measured by immunoassay with the use of monoclonal antibodies. Air was sampled for 3 to 8 hours in the kitchen under undisturbed conditions, during artificial disturbance, and during normal domestic activity by using an impinger and a parallel glass fiber filter and at flow rates of 2 to 20 L/min. Airborne CR and mite allergens were measured concurrently in the bedroom of one apartment before, during, and after artificial disturbance. High levels of Bla g 1 and Bla g 2 were found in kitchen dust from the nine apartments (geometric means of 3919 U/gm [range 530 to 14306 U/gm] and 497 U/gm [range 73 to 1946 U/gm], respectively). Under undisturbed conditions, airborne CR allergens were not detectable in any of the apartments. During vigorous artificial disturbance, Bla g 1 and Bla g 2 were detectable in air samples from seven apartments (geometric means of 4.5 U/m3 [range 0.7 to 17.2 U/m3] and 1.0 U/m3 [range 0.4 to 3.4 U/m3], respectively). Both allergens were predominantly collected on the first stage of the impinger, and 76% to 80% of the airborne allergen was associated with particles greater than 10 microns in diameter. The levels were significantly higher than those collected on the second or third stages of the impinger (p low-cost public housing in Strasbourg can be as high as or higher than the levels measured in towns in the United States. CR allergens become airborne during disturbance and are primarily associated

  17. A novel neurotoxin from venom of the spider, Brachypelma albopilosum.

    Directory of Open Access Journals (Sweden)

    Yunhua Zhong

    Full Text Available Spiders have evolved highly selective toxins for insects. There are many insecticidal neurotoxins in spider venoms. Although a large amount of work has been done to focus on neurotoxicity of spider components, little information, which is related with effects of spider toxins on tumor cell proliferation and cytotoxicity, is available for Brachypelma albopilosum venom. In this work, a novel spider neurotoxin (brachyin was identified and characterized from venoms of the spider, Brachypelma albopilosum. Brachyin is composed of 41 amino acid residues with the sequence of CLGENVPCDKDRPNCCSRYECLEPTGYGWWYASYYCYKKRS. There are six cysteines in this sequence, which form three disulfided bridges. The serine residue at the C-terminus is amidated. Brachyin showed strong lethal effects on American cockroaches (Periplaneta americana and Tenebrio molitor (common mealbeetle. This neurotoxin also showed significant analgesic effects in mice models including abdominal writhing induced by acetic acid and formalin-induced paw licking tests. It was interesting that brachyin exerted marked inhibition on tumor cell proliferation.

  18. American Women and American Studies.

    Science.gov (United States)

    Chmaj, Betty E.

    The American Studies Association (ASA) is an interprofessional group, representing a cross-section of persons from American literature, American history, the social sciences, philosophy, archeology, Black Studies, Urban Studies, American Studies, and others. This document by the ASA Commission on the Status of Women includes: (1) a report of the…

  19. The cuticular hydrocarbons of the giant soil-burrowing cockroach Macropanesthia rhinoceros saussure (Blattodea: Blaberidae: Geoscapheinae): analysis with respect to age, sex and location.

    Science.gov (United States)

    Brown, W V; Rose, H A; Lacey, M J; Wright, K

    2000-11-01

    The cuticular hydrocarbons of a widespread species of soil-burrowing cockroach, Macropanesthia rhinoceros, have been sampled from most of its known geographical locations. Analysis of extracts from individual insects has enabled a study of differences within a population as well as among geographical locations. In the case of M. rhinoceros, except for newly hatched first-instar nymphs, variations in hydrocarbon composition among individuals of different cohorts of M. rhinoceros, based on age and sex, are no greater than those among individuals of a single cohort. Geographical populations of this species are variable in hydrocarbon composition unless they occur within a few kilometres of each other. A few populations showed very different hydrocarbon patterns but, in the absence of any correlating biological differences, it is uncertain whether this signifies the presence of otherwise unrecognizable sibling species or just extreme examples of the geographical variation characteristic of this group of insects.

  20. Deltamethrin-resistant German Cockroaches Are Less Sensitive to the Insect Repellents DEET and IR3535 than Non-resistant Individuals.

    Science.gov (United States)

    Mengoni, Sofía L; Alzogaray, Raúl A

    2018-04-02

    The German cockroach, Blattella germanica (L.) (Blattodea: Blattellidae), is a serious worldwide pest with a considerable economical and sanitary impact. It is mainly controlled by the application of synthetic insecticides, but repeated use of these substances has promoted the appearance of resistance in cockroach populations throughout the world. The aim of this study was to compare the behavior of deltamethrin-susceptible (CIPEIN colony) and deltamethrin-resistant (JUBA and VGBA colonies) first instar nymphs exposed to the repellents N,N-diethyl-3-methylbenzamide (DEET) and ethyl 3-[acetyl(butyl)amino]propanoate (IR3535). Firstly, the behavior of the nymphs was assessed in an experimental arena in the absence of repellents. The parameters Distance Traveled, Velocity, Mobility Time, and Time Spent (in each half of the arena) were quantified using an image analyser, and showed that the behavior elicited by the three colonies was similar. After this, the behavior of the nymphs was quantified in an arena, half of which had been treated with repellent. The repellency of DEET increased as a linear function of log concentration for the three colonies. DEET elicited repellency as from a concentration of 97.49 µg/cm2 for the CIPEIN and JUBA colonies and 194.98 µg/cm2 for the VGBA colony. The repellency of IR3535 was weaker and started at a concentration of 389.96 µg/cm2 for the CIPEIN colony, 779.92 μg/cm2 for JUBA, and 1559.84 μg/cm2 for VGBA . Finally, nymphs were exposed to 3:1, 1:1, and 1:3 DEET:IR3535 mixtures, and a synergistic effect was observed only in the CIPEIN colony.

  1. A cockroach for victory

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    From 1 – 5 July, CERN had the pleasure of welcoming Céline, Fanny and Ophélia, the three winners of the special EIROforum prize donated by CERN in the EU Competition for Young Scientists 2012 (EUCYS). Between visits to the installations and meetings, the young French women had a memorable week.   Fanny Risbourg, Ophélia Bolmin and Céline Lay (from left to right), alongside their CERN guide, Marc Goulette. The rules of EUCYS, organised by the EU since 1989, require all candidates to have first won a scientific prize in their own country. That’s easily said… and done for these young scientists, who have won two! After coming first in France’s Engineering Science Olympiad in 2011, they then took home the top prize in the C. Génial competition the following year. “It all started three years ago, with our travaux personnels encadrés (supervised project),” Fanny explained...

  2. Haitian Americans.

    Science.gov (United States)

    Catanese, Anthony V.

    1998-01-01

    Uses 1990 U.S. Census data to show the changing demographic profile of Haitian Americans. Haitian Americans are likely to live along the Atlantic seaboard and to have relatively low, although not the lowest, incomes. However, the demographic mosaic of Haitian Americans is diverse, showing the effects of Haitian national and ethnic history. (SLD)

  3. (Rhabdomys pumilio)

    African Journals Online (AJOL)

    Figures indicate the percentage of each food eaten per day. Preference categories are as described in the text. Otomys irroratus. Rhabdomys pumilio. One. Two. Food species day days. Insects. Grasshoppers (Acrididae). 90. Termites (Hodotermes mossambicus). 50. Cockroaches (Periplaneta americana). 30. Mealworms ...

  4. Nigerian Journal of Parasitology - Vol 32, No 2 (2011)

    African Journals Online (AJOL)

    The Role of Cockroaches (Blatta Orientalis and Periplaneta Americana) in Mechanical Transmission of Parasites in Households in Owerri, South East Nigeria · EMAIL FULL TEXT EMAIL FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CMU Ajero, CN Ukaga, C Ebirim ...

  5. Inhibition of PaCaMKII-E isoform in the dorsal unpaired median neurosecretory cells of cockroach reduces nicotine- and clothianidin-induced currents.

    Science.gov (United States)

    List, Olivier; Calas-List, Delphine; Taillebois, Emiliane; Juchaux, Marjorie; Heuland, Emilie; Thany, Steeve H

    2014-08-01

    Cellular responses to Ca(2+) require intermediary proteins such as calcium/calmodulin-dependent protein kinase II (CaMKII), which transduces the signal into downstream effects. We recently demonstrated that the cockroach genome encodes five different CaMKII isoforms, and only PaCaMKII-E isoform is specifically expressed in the dorsal unpaired median neurosecretory cells. In the present study, using antisense oligonucleotides, we demonstrated that PaCaMKII-E isoform inhibition reduced nicotine-induced currents through α-bungarotoxin-sensitive and -insensitive nicotinic acetylcholine receptor subtypes. Specifically, PaCaMKII-E isoform is sufficient to repress nicotinic current amplitudes as a result of its depression by antisense oligonucleotides. Similar results were found using the neonicotinoid insecticide clothianidin, which acted as a full agonist of dorsal unpaired median neuron nicotinic acetylcholine receptors. Clothianidin current amplitudes are strongly reduced under bath application of PaCaMKII-E antisense oligonucleotides but no significant results are found with α-bungarotoxin co-applied, demonstrating that CaMKII-E isoform affects nicotine currents through α-bungarotoxin-sensitive and -insensitive receptor subtypes whereas clothianidin currents are reduced via α-bungarotoxin-insensitive receptors. In addition, we found that intracellular calcium increase induced by nicotine and clothianidin were reduced by PaCaMKII-E antisense oligonucleotides, demonstrating that intracellular calcium increase induced by nicotine and clothianidin are affected by PaCaMKII-E inhibition. Cellular responses to Ca(2+) require intermediary proteins such as calcium/calmodulin-dependent protein kinase II (CaMKII). We recently demonstrated that the cockroach genome encodes five different CaMKII isoforms and only PaCaMKII-E isoform was specifically expressed in the dorsal unpaired median neurosecretory cells. Here we show that specific inhibition of PaCaMKII-E isoform is

  6. Adhesion and friction of the smooth attachment system of the cockroach Gromphadorhina portentosa and the influence of the application of fluid adhesives

    Directory of Open Access Journals (Sweden)

    Oliver Betz

    2017-05-01

    Full Text Available Two different measurement techniques were applied to study the attachment of the smooth foot pads of the Madagascar hissing cockroach Gromphadorhina portentosa. The attachment of the non-manipulated adhesive organs was compared with that of manipulated ones (depletion or substitution by artificial secretions. From measurements of the friction on a centrifuge, it can be concluded that on nanorough surfaces, the insect appears to benefit from employing emulsions instead of pure oils to avoid excessive friction. Measurements performed with a nanotribometer on single attachment organs showed that, in the non-manipulated euplantulae, friction was clearly increased in the push direction, whereas the arolium of the fore tarsus showed higher friction in the pull direction. The surface of the euplantulae shows an imbricate appearance, whereupon the ledges face distally, which might contribute to the observed frictional anisotropy in the push direction. Upon depletion of the tarsal adhesion-mediating secretion or its replacement by oily fluids, in several cases, the anisotropic effect of the euplantula disappeared due to the decrease of friction forces in push-direction. In the euplantulae, adhesion was one to two orders of magnitude lower than friction. Whereas the tenacity was slightly decreased with depleted secretion, it was considerably increased after artificial application of oily liquids. In terms of adhesion, it is concluded that the semi-solid consistence of the natural adhesion-mediating secretion facilitates the detachment of the tarsus during locomotion. In terms of friction, on smooth to nanorough surfaces, the insects appear to benefit from employing emulsions instead of pure oils to avoid excessive friction forces, whereas on rougher surfaces the tarsal fluid rather functions in improving surface contact by keeping the cuticle compliable and compensating surface asperities of the substratum.

  7. American Illuminations

    DEFF Research Database (Denmark)

    Nye, David

    Illuminated fêtes and civic celebrations began in Renaissance Italy and spread through the courts of Europe. Their fireworks, torches, lamps, and special effects glorified the monarch, marked the birth of a prince, or celebrated military victory. Nineteenth-century Americans rejected such monarch...

  8. American Studies

    Directory of Open Access Journals (Sweden)

    V. O. Pechatnov

    2014-01-01

    Full Text Available The "Founding fathers" of American Studies at MGIMO are considered to be A.V. Efimov and L.I. Clove. Alexey Efimov - Corresponding Member of the USSR Academy of Sciences since 1938, Head of the Department of Modern and Contemporary History and Dean of the Historical School at the Moscow State University - one of the first professors of the Faculty of International Relations MGIMO. Efimov distinguished himself by a broad vision and scope of scientific interests. Back in 1934 he published a monograph "On the history of capitalism in the United States," which initiated a series of research culminating in the fundamental work "The United States. The path of capitalist development (pre-imperialist era". Alexey was not only a great scientist but also a great teacher, whose lectures was popular throughout Moscow. His lecture courses, given at the end of the 1940s at MGIMO, became the basis for the first post-war history textbooks USA - "Essays on the history of the United States." At least as colorful a figure was Professor Leo Izrailevich Zubok - a man of unusual destiny. As a teenager he emigrated to the United States with his parents, where he soon joined the American revolutionary movement in the 1920s and was forced to leave the country. He came to MGIMO being already an experienced scientists. His research interests were very wide: from the study of American foreign policy expansion to the history of the labor movement in the United States. Zubok's fundamental works still have not lost its scientific significance. He has successfully combined scientific work with teaching. Tutorials that are based on his lectures were very popular not only among students of MGIMO.

  9. Profile: Asian Americans

    Science.gov (United States)

    ... and Data > Minority Population Profiles > Asian American Profile: Asian Americans Asian American Profile (Map of the US with the top 10 states displaying the largest Asian American population according to the Census Bureau) CA - ...

  10. Immunizations and African Americans

    Science.gov (United States)

    ... Data > Minority Population Profiles > Black/African American > Immunizations Immunizations and African Americans African American adults are less ... 19 to 35 months had comparable rates of immunization. African American women are as likely to have ...

  11. AMERICAN EXCEPTIONALISM

    Directory of Open Access Journals (Sweden)

    Oana-Andreea Pirnuta

    2017-11-01

    Full Text Available In an interconnected world where foreign relations matter not only for resources or military alliances but also for cultural relationships, it is highly important to have a better understanding of the power relations among nations. The information carries certain meanings that have important outcomes thus defining the power of a given nation. Foreign policy is the channel through which global politics is exercised. International politics is a hierarchy of power being determined by important cultural, economic as well as geographical aspects. The reasons and strategies that are used in order to reach the outcomes in global politics represent the focus of the present paper. The United States has been the leader in international politics since the early 20th century due to its vast resources and wealth as well as its cultural output. America’s interest in preserving a democratic and free world has its foundation in the beliefs and values it stands for the aim of this paper is to question whether or not there is a concrete premise for the idea of American exceptionalism.

  12. Use of random amplified polymorphic DNA (RAPD) for generating specific DNA probes for oxyuroid species (Nematoda).

    Science.gov (United States)

    Jobet, E; Bougnoux, M E; Morand, S; Rivault, C; Cloarec, A; Hugot, J P

    1998-03-01

    Random amplified DNA markers (RAPD; Williams et al., 1990) were used to obtained specific RAPD fragments characterising different species of oxyuroids. We tested six species of worms parasitizing vertebrates or invertebrates: Passalurus ambiguus Rudolphi, 1819, parasite of Leporids; Syphacia obvelata (Rudolphi, 1802) Seurat, 1916, a parasite of rodents; Blatticola blattae (Graeffe, 1860) Chitwood, 1932 parasite of the cockroach Blattella germanica; Hammerschmidtiella diesingi (Hammerschmidt, 1838) Chitwood, 1932 and Thelastoma bulhoesi (Magalhaes, 1990) Travassos, 1929, parasites of the cockroach Periplaneta americana, and an undescribed parasite species of a passalid insect from New Caledonia. Among 15 oligonucleotides tested, nine produced several specific bands allowing the interspecific discrimination.

  13. Obesity and African Americans

    Science.gov (United States)

    ... Data > Minority Population Profiles > Black/African American > Obesity Obesity and African Americans African American women have the ... youthonline . [Accessed 08/18/2017] HEALTH IMPACT OF OBESITY People who are overweight are more likely to ...

  14. Native Americans with Diabetes

    Science.gov (United States)

    ... Read the MMWR Science Clips Native Americans with Diabetes Better diabetes care can decrease kidney failure Language: ... between 1996 and 2013. Problem Kidney failure from diabetes was highest among Native Americans. Native Americans are ...

  15. Obesity and Hispanic Americans

    Science.gov (United States)

    ... and Data > Minority Population Profiles > Hispanic/Latino > Obesity Obesity and Hispanic Americans Among Mexican American women, 77 percent are overweight ... inhqrdr/data/query At a Glace – Risk Factors: Obesity is a risk ... Americans Heart Disease – See Heart Disease and Hispanic Americans ...

  16. Obesity and Asian Americans

    Science.gov (United States)

    ... and Data > Minority Population Profiles > Asian American > Obesity Obesity and Asian Americans Non-Hispanic whites are 60% ... youthonline . [Accessed 08/18/2017] HEALTH IMPACT OF OBESITY People who are overweight are more likely to ...

  17. American Society of Echocardiography

    Science.gov (United States)

    American Society of Echocardiography Join Ase Renew Member Portal Log In Membership Member Portal Log In Join ASE Renew Benefits Rates FASE – Fellow of the American Society of Echocardiography Member Referral Program FAQs Initiatives Advocacy Awards, Grants, ...

  18. Asthma and Hispanic Americans

    Science.gov (United States)

    ... and Data > Minority Population Profiles > Hispanic/Latino > Asthma Asthma and Hispanic Americans In 2015, 2.2 million Hispanics reported that they currently have asthma. Puerto Rican Americans have almost twice the asthma ...

  19. Unlearning American Patriotism

    Science.gov (United States)

    Miller, Richard W.

    2007-01-01

    Immoral excesses of American foreign policy are so severe and so deep-rooted that American patriotism is now a moral burden. This love, which pulls toward amnesia, wishful thinking and inattention to urgent foreign interests, should be replaced by commitment to a global social movement that seeks to hem in the American empire. Teachers can advance…

  20. Allergens involved in the cross-reactivity of Aedes aegypti with other arthropods.

    Science.gov (United States)

    Cantillo, Jose Fernando; Puerta, Leonardo; Lafosse-Marin, Sylvie; Subiza, Jose Luis; Caraballo, Luis; Fernandez-Caldas, Enrique

    2017-06-01

    Cross-reactivity between Aedes aegypti and mites, cockroaches, and shrimp has been previously suggested, but the involved molecular components have not been fully described. To evaluate the cross-reactivity between A aegypti and other arthropods. Thirty-four serum samples from patients with asthma and/or allergic rhinitis were selected, and specific IgE to A aegypti, Dermatophagoides pteronyssinus, Dermatophagoides farinae, Blomia tropicalis, Periplaneta americana. and Litopenaeus vannamei was measured by enzyme-linked immunosorbent assay. Cross-reactivity was investigated using pooled serum samples from allergic patients, allergenic extracts, and the recombinant tropomyosins (Aed a 10.0201, Der p 10, Blo t 10, Lit v 1, and Per a 7). Four IgE reactive bands were further characterized by matrix-assisted laser desorption/ionization tandem time of flight. Frequency of positive IgE reactivity was 82.35% to at least one mite species, 64.7% to A aegypti, 29.4% to P americana, and 23.5% to L vannamei. The highest IgE cross-reactivity was seen between A aegypti and D pteronyssinus (96.6%) followed by L vannamei (95.4%), B tropicalis (84.4%), and P americana (75.4%). Recombinant tropomyosins from mites, cockroach, or shrimp inhibited the IgE reactivity to the mosquito at a lower extent than the extracts from these arthropods. Several bands of A aegypti cross-reacted with arthropod extracts, and 4 of them were identified as odorant binding protein, mitochondrial cytochrome C, peptidyl-prolyl cis-trans isomerase, and protein with hypothetical magnesium ion binding function. We identified 4 novel cross-reactive allergens in A aegypti allergenic extract. These molecules could influence the manifestation of allergy to environmental allergens in the tropics. Copyright © 2017 American College of Allergy, Asthma & Immunology. Published by Elsevier Inc. All rights reserved.

  1. Heart Disease and African Americans

    Science.gov (United States)

    ... Minority Population Profiles > Black/African American > Heart Disease Heart Disease and African Americans Although African American adults are ... were 30 percent more likely to die from heart disease than non-Hispanic whites. African American women are ...

  2. Label-Free Differential Proteomics and Quantification of Exoenzymes from Isolates of the Entomopathogenic Fungus Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Giuseppe Dionisio

    2016-10-01

    Full Text Available Beauveria bassiana is an entomopathogenic fungus that grows both in vivo and in vitro. In vivo it can colonize live insect hosts, and tissue digestion occurs by secreted hydrolytic exoenzymes. It can also colonize dead insect tissue provided this is free from competing microorganisms. Depending on whether the host is alive or dead the expression (quality/quantity of the exoenzymes may vary. We have grown several isolates of B. bassiana in shaking flasks for 120 h at 25 °C in order to evaluate the maximal exoenzyme production using two diet regimes. As sole carbon, nitrogen, and phosphate sources we used 1% shrimp chitin and either 0.5% w/v of dead intact American cockroach (Periplaneta americana or their isolated cuticles. This is the first report of a differential proteomics of B. bassiana exoenzymes performed by label-free nano-LC MS/MS. Total proteolytic enzyme activity was mainly due to Pr1A or Pr1B depending on the isolate and the diet regime. The most differentially secreted enzymes were: the cuticle-degrading subtilisin Pr1A, GH13 alpha-glycosidase, glucan endo-1,3-beta-glucosidase, subtilisin-like proteinase Spm1, lipase 1, beta-1,3 exoglucanase, and endo-1,3-beta-glucosidase. Among the B. bassiana isolates analyzed, Bb 678 and Bb BG were the most active in Pr1A secretion.

  3. Label-Free Differential Proteomics and Quantification of Exoenzymes from Isolates of the Entomopathogenic Fungus Beauveria bassiana.

    Science.gov (United States)

    Dionisio, Giuseppe; Kryger, Per; Steenberg, Tove

    2016-10-14

    Beauveria bassiana is an entomopathogenic fungus that grows both in vivo and in vitro. In vivo it can colonize live insect hosts, and tissue digestion occurs by secreted hydrolytic exoenzymes. It can also colonize dead insect tissue provided this is free from competing microorganisms. Depending on whether the host is alive or dead the expression (quality/quantity) of the exoenzymes may vary. We have grown several isolates of B. bassiana in shaking flasks for 120 h at 25 °C in order to evaluate the maximal exoenzyme production using two diet regimes. As sole carbon, nitrogen, and phosphate sources we used 1% shrimp chitin and either 0.5% w / v of dead intact American cockroach ( Periplaneta americana ) or their isolated cuticles. This is the first report of a differential proteomics of B. bassiana exoenzymes performed by label-free nano-LC MS/MS. Total proteolytic enzyme activity was mainly due to Pr1A or Pr1B depending on the isolate and the diet regime. The most differentially secreted enzymes were: the cuticle-degrading subtilisin Pr1A, GH13 alpha-glycosidase, glucan endo-1,3-beta-glucosidase, subtilisin-like proteinase Spm1, lipase 1, beta-1,3 exoglucanase, and endo-1,3-beta-glucosidase. Among the B. bassiana isolates analyzed, Bb 678 and Bb BG were the most active in Pr1A secretion.

  4. The American Dream

    OpenAIRE

    Önnerth, Lars; Neubert, Mikkel; Omerbasic, Dejan; Heyman, Minch; Kimberly, Marie; Nielsen, Lyngbo; Mynte, Anne; Hørlyck Kaastrup, Markus

    2015-01-01

    This study examines the phenomenon that is the American Dream and its effect on the working and upper class citizens in American society. To give context to the American dream and its origin, we have made use of professor Jim Cullen’s book “The American Dream: A Short Story of an Idea that Shaped a Nation” from 2003. We have identified what we decided to call the “the traditional dream” and “the modern dream”, both representing different outlooks on lives and ethical standards. We have done t...

  5. Help-Seeking Experiences and Attitudes among African American, Asian American, and European American College Students

    Science.gov (United States)

    Masuda, Akihiko; Anderson, Page L.; Twohig, Michael P.; Feinstein, Amanda B.; Chou, Ying-Yi; Wendell, Johanna W.; Stormo, Analia R.

    2009-01-01

    The study examined African American, Asian American, and European American college students' previous direct and indirect experiences of seeking professional psychological services and related attitudes. Survey data were collected from 254 European American, 182 African American and 82 Asian American college students. Results revealed that fewer…

  6. Close relationships between asian american and european american college students

    OpenAIRE

    Chen, C; Edwards, K; Young, B; Greenberger, E

    2001-01-01

    The authors examined attitudes and behaviors regarding close relationships between European and Asian Americans, with a particular emphasis on 5 major subgroups of Asian Americans (Chinese, Japanese, Korean, Vietnamese, and Filipino Americans). Participants were 218 Asian American college students and 171 European American college students attending a culturally diverse university. The European Americans did not differentiate among the various subgroups of Asian Americans. Their attitudes reg...

  7. American Thyroid Association

    Science.gov (United States)

    ... More October 20, 2017 0 American Thyroid Association: Charles H. Emerson, MD, Will Lead New Board of Directors By ATA | 2017 ... Featured , News Releases | No Comments American Thyroid Association: Charles H. Emerson, MD, Will Lead New Board of Directors October 19,… Read ...

  8. The Quiet American Revisited.

    Science.gov (United States)

    Legters, Lyman H.

    1984-01-01

    What is wrong in the American parochialism about foreign languages is the assumption that language acquisition is a cosmetic gain, without any immediate or forseeable practical use. Languages will only be learned effectively when Americans learn that they can be used in getting tasks accomplished. (MSE)

  9. American Studies in Transition

    DEFF Research Database (Denmark)

    Nye, David

    Papers first given at a conference the previous year in Fåborg, Denmark, with a dual focus on 20th century America and new methods in American Studies.......Papers first given at a conference the previous year in Fåborg, Denmark, with a dual focus on 20th century America and new methods in American Studies....

  10. Asian American Cultural Resistance.

    Science.gov (United States)

    Libretti, Tim

    1997-01-01

    Explores the encounter of Marxism and Asian American literary theory and imagines an Asian American Marxism. To do so requires theorizing race, class, and gender not as substantive categories of antagonisms but as complementary and coordinated elements of a totality of social relations structuring racial patriarchal capitalism. (SLD)

  11. The Mexican American.

    Science.gov (United States)

    Rowan, Helen

    The purpose of this paper, prepared for the U. S. Commission on Civil Rights, is to indicate the types and ranges of problems facing the Mexican American community and to suggest ways in which these problems are peculiar to Mexican Americans. Specific examples are cited to illustrate major problems and personal experiences. Topics covered in the…

  12. African American Suicide

    Science.gov (United States)

    African American Suicide Fact Sheet Based on 2012 Data (2014) Overview • In 2012, 2,357 African Americans completed suicide in the U.S. Of these, 1,908 (80. ... rate of 9.23 per 100,000). The suicide rate for females was 1.99 per 100, ...

  13. Teaching American Indian Architecture.

    Science.gov (United States)

    Winchell, Dick

    1991-01-01

    Reviews "Native American Architecture," by Nabokov and Easton, an encyclopedic work that examines technology, climate, social structure, economics, religion, and history in relation to house design and the "meaning" of space among tribes of nine regions. Describes this book's use in a college course on Native American architecture. (SV)

  14. Close relationships between Asian American and European American college students.

    Science.gov (United States)

    Chen, C; Edwards, K; Young, B; Greenberger, E

    2001-02-01

    The authors examined attitudes and behaviors regarding close relationships between European and Asian Americans, with a particular emphasis on 5 major subgroups of Asian Americans (Chinese, Japanese, Korean, Vietnamese, and Filipino Americans). Participants were 218 Asian American college students and 171 European American college students attending a culturally diverse university. The European Americans did not differentiate among the various subgroups of Asian Americans. Their attitudes regarding close relationships were less positive toward Asian Americans than toward Mexican and African Americans, a finding contrary to the prediction of social exchange theory (H. Tajfel, 1975). In contrast to the European Americans' view of homogeneity among Asian Americans, the 5 major subgroups of Asian Americans expressed a distinctive hierarchy of social preference among themselves. Results are discussed in terms of their implications for future research on interethnic relations involving Asian Americans.

  15. Adapting American Policymaking to Overcome American Exceptionalism

    Science.gov (United States)

    2015-04-13

    discomfort at President Bush’s rallying good against evil speeches and the words of the NSS. The President’s us versus them foreign policies...of global leadership, and of concern for the well being of the global community. Classically, American exceptionalism refers to the uniquely free ...longer that force for good, but a force for its own good. Exceptionalism once meant a nation free from tyrannical rule and offering of bountiful

  16. Lolita - the American nightmare

    OpenAIRE

    GRISELDA (ABAZAJ) DANGLLI

    2012-01-01

    This article deals with the analysis of Lolita seen through the lenses of the American society and norms of today. We will see that many observations of the American way of behaving and social norms still hold true even nowadays years after this novel was written. Nabokov, on the other hand, never accepted the fact that this novel probed into the very depths of American life and that his intentions were purely aesthetic. Nevertheless, the phenomenon of pedophilia, obvious in the book, is a po...

  17. American Studies in Romania

    Directory of Open Access Journals (Sweden)

    Ioana Luca

    2006-01-01

    Full Text Available American Studies at the University of BucharestThe idea of teaching American Studies and founding a program in American Studies was first voiced in the long meetings of faculty and students held at the University of Bucharest soon after the collapse of the communist regime. The proposal was one of many that reflected the spirit of reform and hope for radical changes at the outset of Romania’s transition to democracy. The absence of institutional structures other than English departments and t...

  18. Osteoporosis and Asian American Women

    Science.gov (United States)

    ... and Asian American Women Osteoporosis and Asian American Women Asian American women are at high risk for ... medications. Are There Any Special Issues for Asian Women Regarding Bone Health? Recent studies indicate a number ...

  19. Mental Health and Asian Americans

    Science.gov (United States)

    ... Data > Minority Population Profiles > Asian American > Mental Health Mental Health and Asian Americans Suicide was the 9th leading ... Americans is half that of the White population. MENTAL HEALTH STATUS Serious psychological distress among adults 18 years ...

  20. African-Americans and Alzheimer's

    Science.gov (United States)

    ... Share Plus on Google Plus African-Americans and Alzheimer's alz.org | IHaveAlz Introduction 10 Warning Signs Brain ... African-Americans are at a higher risk for Alzheimer's disease. Many Americans dismiss the warning signs of ...

  1. On American Individualism

    Institute of Scientific and Technical Information of China (English)

    李谷雨

    2016-01-01

    Among those American symbols like multiculturalism, hi-tech and its powerful status in the world, an important representative one is its individualism. This paper will briefly discuss it based on daily matters.

  2. American Pediatric Surgical Association

    Science.gov (United States)

    American Pediatric Surgical Association Search for: Login Resources + For Members For Professionals For Training Program Directors For Media For ... Surgical Outcomes Surveys & Results Publications Continuing Education + ExPERT Pediatric Surgery NaT Annual Meeting CME MOC Requirements Residents / ...

  3. American Epilepsy Society

    Science.gov (United States)

    ... for the AES Annual Meeting. More info here . Epilepsy Currents American Epilepsy Society Journal Impact Factor More ... P450 enzyme overexpression during spontaneous recurrent seizures More Epilepsy Professional News AES Status Epilepticus guideline for treatment ...

  4. American Academy of Optometry

    Science.gov (United States)

    ... Award Recipients Nov 07, 2017 View all news Optometry and Vision Science Journal Optometry and Vision Science is the official journal of the American Academy of Optometry. AAO members receive a complimentary online subscription. Learn ...

  5. The American dream

    OpenAIRE

    Camanho, Gilberto Luis

    2015-01-01

    The American dream : literar. Spiegelungen. - In: Weltmacht USA / hrsg. von Josef Becker ... - München : Vögel, 1976. - S. 31-48. - (Schriften der Philosophischen Fachbereiche der Universität Augsburg ; 10)

  6. Latin American Newspapers.

    Science.gov (United States)

    Gardner, Mary A.

    1980-01-01

    Reviews the historical development of the press in Latin America from the sixteenth century to the present. Discusses the various pressures that Latin American newspapers are subject to, including political censorship, economic restrictions, and cultural conflicts. (AEA)

  7. African Americans and Glaucoma

    Science.gov (United States)

    ... Us Donate In This Section African Americans and Glaucoma email Send this article to a friend by ... and eventually, in developing more effective treatments. Does glaucoma treatment differ? Although treatment varies for all individuals, ...

  8. American Geriatrics Society

    Science.gov (United States)

    ... Learn More Social Media Facebook Twitter LinkedIn Instagram Social Media Bar Right Menu Annual Meeting Donate to our Foundation Contact Us American Geriatrics Society 40 Fulton St., 18th Floor New York, NY ...

  9. American Samoa Longline Logbook

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — This data system contains the logbook data of vessels unloading in American Samoa. In 1992, the logbooks of three longline trips conducting an experiment to test the...

  10. American Lyme Disease Foundation

    Science.gov (United States)

    ... Infectious Diseases, 35: 451-464, 2002) What is Lyme Disease? Lyme disease (LD) is an infection caused by ... mission with your own tax-deductible contribution. American Lyme Disease Foundation, Inc. PO Box 466 Lyme, CT 06371 ...

  11. American Nephrology Nurses' Association

    Science.gov (United States)

    ... Join/Renew Jobs Contact Corporate Shop American Nephrology Nurses Association About ANNA Association About ANNA Strategic Plan ... CExpress Events National Events Chapter / Local Events Nephrology Nurses Week ANNA Education Modules CKD Modules Education Services ...

  12. American Vitiligo Research Foundation

    Science.gov (United States)

    ... Place Vitiligo Voices Contact Welcome to The American Vitiligo Foundation Home Page Top Isabella T., California An ... 20.00 USD 20 for - 35.00 USD Vitiligo Doesn't Scare Me by Kim Kirkland Kim ...

  13. American Samoa Cannery Offloading

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — From 1995 through 2010, the two canneries in American Samoa provided Cannery Offloading Reports to the Department of Marine and Wildlife Resources (DMWR) office. In...

  14. American Academy of Audiology

    Science.gov (United States)

    ... Certification Meetings & Events Employee Resources Research Academia Practice Management Reimbursement Coding Compliance Resources and Tools Publications & News News Audiology Today Journal of the American Academy of Audiology Books Brochures Multimedia Guidelines and Standards ...

  15. American Music Therapy Association

    Science.gov (United States)

    American Music Therapy Association Home Contact News Help/FAQ Members Only Login Quick Links Facts About Music Therapy Qualifications ... with AMTA Sponsor AMTA Events Social Networking Support Music Therapy When you shop at AmazonSmile, Amazon will ...

  16. The Roots of Disillusioned American Dream in Typical American

    Institute of Scientific and Technical Information of China (English)

    古冬华

    2016-01-01

    Typical American is one of Gish Jen’s notable novels catching attention of the American literary circle. The motif of disillusioned American dream can be seen clearly through the experiences of three main characters. From perspectives of the consumer culture and cultural conflicts, this paper analyzes the roots of the disillusioned American dream in the novel.

  17. Native American medicine.

    Science.gov (United States)

    Cohen, K

    1998-11-01

    This article summarizes common principles, practices, and ethics of Native American healing, the traditional medicine of North America. Native American healing, spirituality, culture, and, in modern times, political, social, and economic concerns are closely intertwined. Intuition and spiritual awareness are a healer's most essential diagnostic tools. Therapeutic methods include prayer, music, ritual purification, herbalism, massage, ceremony, and personal innovations of individual healers. A community of friends, family, and helpers often participate in the healing intervention and help to alleviate the alienation caused by disease. A healthy patient has a healthy relationship with his or her community and, ultimately, with the greater community of nature known as "All Relations." The goal of Native American healing is to find wholeness, balance, harmony, beauty, and meaning. "Healing," making whole, is as important as curing disease; at times they are identical.

  18. Native American nurse leadership.

    Science.gov (United States)

    Nichols, Lee A

    2004-07-01

    To identify which characteristics, wisdom, and skills are essential in becoming an effective Native American nurse leader. This will lead to the development of a curriculum suitable for Native American nurses. A qualitative, descriptive design was used for this study. Focus groups were conducted in Polson, Montana. A total of 67 Native and non-Native nurses participated. Sixty-seven percent of them were members of Indian tribes. Data were content analyzed using Spradley's ethnographic methodology. Three domains of analysis emerged: point of reference for the leader (individual, family, community), what a leader is (self-actualized, wise, experienced, political, bicultural, recognized, quiet presence, humble, spiritual, and visionary), and what a leader does (mentors, role models, communicates, listens, demonstrates values, mobilizes, and inspires). Native nurse leaders lead differently. Thus, a leadership curriculum suitable for Native nurses may lead to increased work productivity and therefore improved patient care for Native Americans.

  19. Multifaceted defense against antagonistic microbes in developing offspring of the parasitoid wasp Ampulex compressa (Hymenoptera, Ampulicidae.

    Directory of Open Access Journals (Sweden)

    Katharina Weiss

    Full Text Available Effective antimicrobial strategies are essential adaptations of insects to protect themselves, their offspring, and their foods from microbial pathogens and decomposers. Larvae of the emerald cockroach wasp, Ampulex compressa, sanitize their cockroach hosts, Periplaneta americana, with a cocktail of nine antimicrobials comprising mainly (R-(--mellein and micromolide. The blend of these antimicrobials has broad-spectrum antimicrobial activity. Here we explore the spatio-temporal pattern of deployment of antimicrobials during the development from egg to adult as well as their physico-chemical properties to assess how these aspects may contribute to the success of the antimicrobial strategy. Using gas chromatography/mass spectrometry (GC/MS we show that larvae start sanitizing their food as soon as they have entered their host to feed on its tissue. Subsequently, they impregnate the cockroach carcass with antimicrobials to create a hygienic substrate for cocoon spinning inside the host. Finally, the antimicrobials are incorporated into the cocoon. The antimicrobial profiles on cockroach and wasp cocoon differed markedly. While micromolide persisted on the cockroaches until emergence of the wasps, solid-phase microextraction sampling and GC/MS analysis revealed that (R-(--mellein vaporized from the cockroaches and accumulated in the enclosed nest. In microbial challenge assays (R-(--mellein in the headspace of parasitized cockroaches inhibited growth of entomopathogenic and opportunistic microbes (Serratia marcescens, Aspergillus sydowii, Metarhizium brunneum. We conclude that, in addition to food sanitation, A. compressa larvae enclose themselves in two defensive walls by impregnating the cocoon and the cockroach cuticle with antimicrobials. On top of that, they use vaporous (R-(--mellein to sanitize the nest by fumigation. This multifaceted antimicrobial defense strategy involving the spatially and temporally coordinated deployment of several

  20. North American refining

    International Nuclear Information System (INIS)

    Osten, James; Haltmaier, Susan

    2000-01-01

    This article examines the current status of the North American refining industry, and considers the North American economy and the growth in demand in the petroleum industry, petroleum product demand and quality, crude oil upgrading to meet product standards, and changes in crude oil feedstocks such as the use of heavier crudes and bitumens. Refining expansion, the declining profits in refining, and changes due to environmental standards are discussed. The Gross Domestic Product and oil demand for the USA, Canada, Mexico, and Venezuela for the years 1995-2020 are tabulated

  1. American Sign Language

    Science.gov (United States)

    ... combined with facial expressions and postures of the body. It is the primary language of many North Americans who are deaf and ... their eyebrows, widening their eyes, and tilting their bodies forward. Just as with other languages, specific ways of expressing ideas in ASL vary ...

  2. American Housing Survey (AHS)

    Science.gov (United States)

    Employment and Payroll Survey of Business Owners Work from Home Our statistics highlight trends in household statistics from multiple surveys. Data Tools & Apps Main American FactFinder Census Business Builder My Classification Codes (i.e., NAICS) Economic Census Economic Indicators Economic Studies Industry Statistics

  3. Chagas Disease (American trypanosomiasis)

    Science.gov (United States)

    ... sheets/detail/chagas-disease-(american-trypanosomiasis)","@context":"http://schema.org","@type":"Article"}; العربية 中文 français русский español ... capacities, focusing on: strengthening world epidemiological surveillance and information systems; preventing transmission by blood transfusion and organ ...

  4. The American Oyster.

    Science.gov (United States)

    Thompson, Nancy E.

    The Maryland Marine Science Education Project has produced a series of mini-units in marine science education for the junior high/middle school classroom. This unit focuses on the American oyster. Although the unit specifically treats the Chesapeake Bay, it may be adapted for use with similar estuarine systems. In addition, the unit may be…

  5. American Indian Community Colleges.

    Science.gov (United States)

    One Feather, Gerald

    With the emergence of reservation based community colleges (th Navajo Community College and the Dakota Community Colleges), the American Indian people, as decision makers in these institutions, are providing Indians with the technical skills and cultural knowledge necessary for self-determination. Confronted with limited numbers of accredited…

  6. Gifted European American Woman.

    Science.gov (United States)

    Kitano, Margie K.; Perkins, Carol O.

    2000-01-01

    This article describes factors affecting the achievement of 15 highly accomplished European American women in the fields of business, higher education, and law and government. Findings indicate participants tended to attribute their success to external factors while simultaneously employing proactive strategies to overcome potential barriers.…

  7. Depression and African Americans

    Science.gov (United States)

    ... have insurance or can’t afford treatment, your community may have publicly-funded mental health centers or programs that charge you according to ... how he found healing in an African American community. Other Resources ... Institute of Mental Health Phone Number: 301-443-4513 Toll Free Number: ...

  8. American Dream / Anu Raat

    Index Scriptorium Estoniae

    Raat, Anu

    2010-01-01

    Uuritakse sõnapaari "American dream" tähendust, kuidas ja millal see unelmalugu tekkis, miks see on ameerikalik nähtus, samuti 1950-ndate moeloomingut, eriti Christian Diori oma Euroopas ja Ameerikas, selle põhjusi ja mõjusid seoses massilise tarbimisega

  9. American Holidays and Festivals

    Institute of Scientific and Technical Information of China (English)

    冯凌

    2002-01-01

    One of the interesting things to learn about a country is to know different kinds of holidays and festivals its people celebrate(庆祝) and to tell why they celebrate them. Although there are some similarities(相似) between American and Chinese holidays and festivals, there are quite a few differences.

  10. Americans with Disabilities Act.

    Science.gov (United States)

    Kaesberg, Mary Ann; Murray, Kenneth T.

    1994-01-01

    Presents a 35-item checklist of practical activities for school district compliance with the Americans with Disabilities Act (ADA). The checklist is based on ADA statutes, other civil rights legislation and litigation, as well as pertinent regulations and the legislative history of the act contained in the Congressional Record. (MLF)

  11. The Native American Holocaust.

    Science.gov (United States)

    Thornton, Russell

    1989-01-01

    Describes the American Indian "Holocaust," decimation of Indian populations following European discovery of the Americas. European and African diseases, warfare with Europeans, and genocide reduced native populations from 75 million to only a few million. Discusses population statistics and demographic effects of epidemics, continuing infection,…

  12. Grant Wood: "American Gothic."

    Science.gov (United States)

    Fitzgerald, Diane M.

    1988-01-01

    Presents a lesson plan which exposes students in grades 10-12 to the visual symbols and historical references contained in Grant Wood's "American Gothic." Includes background information on the artist and the painting, instructional strategies, a studio activity, and evaluation criteria. (GEA)

  13. Hispanic American Volunteering.

    Science.gov (United States)

    Lopez, Josue; Safrit, R. Dale

    2001-01-01

    Hispanic Americans in Cleveland, Ohio were interviewed about volunteerism. Six themes were identified: (1) influence of family and friends; (2) importance of volunteering to benefit youth; (3) importance of church and religious beliefs; (4) volunteering as a requirement; (5) connections between volunteerism and the community; and (6) personal…

  14. Civic Innovation & American Democracy.

    Science.gov (United States)

    Sirianni, Carmen; Friedland, Lewis

    1997-01-01

    Argues that American democracy is at a critical stage of development, with declining trust in government, citizens feeling displaced by a professional political class, derailed public interest, and policy that limits citizen deliberation and responsibility. Some instances of civic innovation, community organization, civic journalism, and efforts…

  15. American Porphyria Foundation

    Science.gov (United States)

    ... Nicole Castelano Gregary Edwards Megan Parrish ~ How the dog I didn't want became the dog I'd always dreamed of Darnisha Davenport Liz ... or through the site for commercial or public purposes. The American Porphyria Foundation (APF) Tax Forms 990 ...

  16. Asian Americans and Education

    Science.gov (United States)

    Chang, Benjamin

    2017-01-01

    The communities that constitute the racialized category of Asian Americans consist of approximately 20 million people in the United States, or about 5% of the total population. About 20% or 4 million are of primary or secondary school age, and over 1.1 million are in higher education. Both in popular and academic discourse, "Asian…

  17. American Lung Association

    Science.gov (United States)

    ... see if you should get screened. Learn more EDUCATION ADVOCACY RESEARCH Our vision is a world free of lung disease The American Lung Association is ... by lung disease. Help us continue to deliver education, advocacy and research to those who need it. $250 $100 $50 Your best gift Donate now Learn More ... nonprofit software

  18. Native American Architecture.

    Science.gov (United States)

    Nabokov, Peter; Easton, Robert

    This book presents building traditions of the major Indian tribes in nine regions of the North American continent, from the huge, plankhouse villages of the Northwest Coast, to the moundbuilder towns and temples of the Southeast, to the Navajo hogans and adobe pueblos of the Southwest. Indian buildings are a central element of Indian culture, the…

  19. The American University of Beirut

    DEFF Research Database (Denmark)

    Bertelsen, Rasmus Gjedssø

    2016-01-01

    with American society through its board of trustees. American civil society has been a major financial partner since the missionary days to modern day foundation philanthropy. American business has supported the university and recruited its graduates. American government has supported the university financially...... and politically. The chapter compares the transnational relations of the AUB, the other classical American overseas universities with missionary roots in the Middle East (AUC and LAU), the more than 20 American higher education institutions founded in China around 1900 (which did not survive the Korean War...

  20. Discipline behaviors of Chinese American and European American mothers.

    Science.gov (United States)

    Hulei, Elaine; Zevenbergen, Andrea A; Jacobs, Sue C

    2006-09-01

    In any society, parenting beliefs are a reflection of that society's cultural values and traditions (J. U. Ogbu, 1981). Verbosity, a parenting behavior considered dysfunctional in European American culture, may not be problematic in Chinese culture. The authors recruited 31 Chinese American and 30 European American mothers and used questionnaires to measure parenting behaviors and child behavior problems. The Chinese American mothers also completed a questionnaire assessing their acculturation level. The Chinese American mothers had higher levels of verbosity than did the European American mothers; however, there were no differences between the groups in child behavior problems. The results also revealed higher levels of laxness in the Chinese American mothers compared to the European American mothers. Acculturation level did not predict verbosity or laxness levels. Results suggest that the effectiveness of a parenting style should be defined relative to cultural context.

  1. An American Paradox

    International Nuclear Information System (INIS)

    Jamieson, D.

    2006-01-01

    This paper explores the paradox that while Americans generally identify themselves as environmentalists, they show little willingness to voluntarily restrain their behavior or to support specific fiscal policies that would result in increased levels of environmental protection. I explore the role of values in the explanation of this paradox, and discuss some of the difficulties involved in studying values and their role in human behavior

  2. Asian American Adolescent Identity

    OpenAIRE

    Ohm, Julie Juhye

    1999-01-01

    The formation of ego identity in Asian American late adolescents attending Virginia Tech was examined within the frameworks of Erikson's psychosocial theory and Berry, Trimble, and Olmedo's model of acculturation. Ego identity was measured using the Achieved sub-scale of the Revised Version of the Extended Objective Measure of Ego Identity Status, an instrument based on the theoretical constructs of Erikson. Ethnic identity was measured using the Multigroup Ethnic Identity Measure and America...

  3. Improving American Innovation,

    Science.gov (United States)

    1984-03-01

    Why has Jap~m succeeded: western technology and the Japanese ethos. New York: Cambridge University Press, 1982. (NC 462 MO634 Norman , Colin...productivity growth. Review of Economics and Statistics 64:627-34, N~ovember 1982. Smith, G. W. and W. N. Smallwood . Preparing for breakthroughs: the rewards of...recommendations. Edited by Charles E. Larsen and WI. Novis Smith. Washington: American Chemical Society, 1980. Kobert, Norman . Agressivn management style

  4. American Studies in Russia

    OpenAIRE

    Antsyferova, Olga

    2006-01-01

    Interest in the USA, both general and specifically academic, has always existed in Russia, with its own ups and downs. But American studies as an academic discipline started gaining its popularity probably after WWII when there sporadically started to emerge the ever-increasing number of academic books, articles and dissertations in literary and historical research on the USA, the main centers of which were founded at the Academic Research Institute of the USA and Canada, headed by academicia...

  5. Rediscovering Interwar American Theorists

    Science.gov (United States)

    2017-05-25

    background, influences , and influence . It illuminates Robinson’s efforts to account for factors associated with an American citizen -army and the... influences , and assessing their influence on doctrine and leaders of the Second World War. Additionally, this paper contains recommendations to improve the...addresses this gap by analyzing the theories of Brigadier General William K. Naylor and Colonel Oliver P. Robinson, examining their influences , and

  6. A Native American Theatre Ensemble

    Science.gov (United States)

    Brown, Kent R.

    1973-01-01

    The ceremonial rituals American Indians have practiced for centuries are uncontestable testimony to how strongly they respond to theatre. These rituals, a pure and functional form of dramatic art, are practiced today by a Native American theater group. (FF)

  7. Mental Health and African Americans

    Science.gov (United States)

    ... Minority Population Profiles > Black/African American > Mental Health Mental Health and African Americans Poverty level affects mental health ... compared to 120% of non-Hispanic whites. 1 MENTAL HEALTH STATUS Serious psychological distress among adults 18 years ...

  8. Asian American Health - Multiple Languages

    Science.gov (United States)

    ... Are Here: Home → Multiple Languages → All Health Topics → Asian American Health URL of this page: https://medlineplus.gov/ ... V W XYZ List of All Topics All Asian American Health - Multiple Languages To use the sharing features ...

  9. Neuroimaging in cockroach phobia: An experimental study

    OpenAIRE

    Francisco Rivero; Manuel Herrero; Conrado Viña; Yolanda Álvarez-Pérez; Wenceslao Peñate

    2017-01-01

    Antecedentes/Objetivo: En este estudio se exploran las características en neuroimagen de personas con fobia específica a peque ̃ nos animales (cucarachas), para determinar si existen diferencias en la actividad cerebral entre personas con y sin fobia a las cucarachas, bajo condi- ciones de estimulación fóbica y no fóbica. Método : Se estudiaron 24 adultos (12 con fobia). El diagnóstico de fobia específica se obtuvo mediante una entrevista estructurada y cuestionarios. Todos fueron expuestos ...

  10. Neuroimaging in cockroach phobia: An experimental study

    Directory of Open Access Journals (Sweden)

    Francisco Rivero

    2017-01-01

    Full Text Available Antecedentes/Objetivo: En este estudio se exploran las características en neuroimagen de personas con fobia específica a peque ̃ nos animales (cucarachas, para determinar si existen diferencias en la actividad cerebral entre personas con y sin fobia a las cucarachas, bajo condi- ciones de estimulación fóbica y no fóbica. Método : Se estudiaron 24 adultos (12 con fobia. El diagnóstico de fobia específica se obtuvo mediante una entrevista estructurada y cuestionarios. Todos fueron expuestos a una presentación en video 3D durante una sesión de RMNf. Resultados: El grupo con fobia mostró activaciones diferenciales significativas, que fueron congruentes con el modelo de doble ruta en el procesamiento del miedo, a través del tálamo- amígdala (ruta I, y tálamo-corteza entorrinal-hipocampo-subículo-amígdala (ruta II. Además, se encontraron activaciones diferenciales en el globo pálido, en el giro hipocampal, ínsula, y en los pars orbitalis, triangularis y opercularis. Con respecto al grupo control, no se observaron activaciones de la ínsula ni el cingulado. Conclusiones: Parece evidenciarse un modelo de doble ruta en el procesamiento de estímulos fóbicos. Este doble proceso puede tener implicaciones para el tratamiento psicológico de las fobias específicas.

  11. Cryptochrome 2 mediates directional magnetoreception in cockroaches

    Czech Academy of Sciences Publication Activity Database

    Bazalová, Olga; Kvíčalová, M.; Válková, T.; Slabý, P.; Bartoš, P.; Netušil, R.; Tomanová, K.; Braeunig, P.; Lee, H.-J.; Šauman, Ivo; Damulewicz, Milena; Provazník, Jan; Pokorný, R.; Doležel, David; Vácha, M.

    2016-01-01

    Roč. 113, č. 6 (2016), s. 1660-1665 ISSN 0027-8424 R&D Projects: GA MŠk LH14029; GA ČR(CZ) GC13-11908J; GA ČR(CZ) GC206/07/J041 Institutional support: RVO:60077344 Keywords : magnetoreception * cryptochrome * light spectrum Subject RIV: CE - Biochemistry Impact factor: 9.661, year: 2016

  12. American Academy of Cosmetic Dentistry

    Science.gov (United States)

    ... AACD AACD 2018: A Masterpiece of Comprehensive Cosmetic Dentistry Education 34th Annual Scientific Session | April 18-21 ... 222.9540 Contact Us © 2017American Academy of Cosmetic Dentistry American Academy of Cosmetic Dentistry (AACD) © 2017American Academy ...

  13. American Food and World Hunger.

    Science.gov (United States)

    Czarra, Fred R.; Long, Cathryn J., Eds.

    1983-01-01

    Describes activities to help students in grades 7-9 learn about American food production and distribution. Students learn about the American diet over the centuries; the production of American Corn; the meaning of the term hunger; and the need for protein. (CS)

  14. Discrimination against Muslim American Adolescents

    Science.gov (United States)

    Aroian, Karen J.

    2012-01-01

    Although there is ample evidence of discrimination toward Muslim Americans in general, there is limited information specific to Muslim American adolescents. The few existing studies specific to this age group suggest that Muslim American adolescents encounter much discrimination from teachers, school administrators, and classmates. This…

  15. Facts about American Indian Education

    Science.gov (United States)

    American Indian College Fund, 2010

    2010-01-01

    As a result of living in remote rural areas, American Indians living on reservations have limited access to higher education. One-third of American Indians live on reservations, according to the U.S. Census Bureau. According to the most recent U.S. government statistics, the overall poverty rate for American Indians/Alaska Natives, including…

  16. Native American Ceremonial Athletic Games.

    Science.gov (United States)

    Pesavento, Wilma J.

    This is a report on the relationship of North American Indian athletic games to ceremonies. Data for this investigation were researched from 48 "Annual Reports of the Bureau of American Ethnology, Smithsonian Institution" published from 1881 to 1933, and the 84 volumes of the "American Anthropologist" published from 1888 to 1974. Observational…

  17. History of Asian American psychology.

    Science.gov (United States)

    Leong, Frederick T L; Okazaki, Sumie

    2009-10-01

    An overview of the history of Asian American psychology is provided by reviewing the context for the development of the field as well as the early founding of the Asian American Psychological Association (AAPA). The presidents of AAPA as well as key events and conferences are noted. The involvement of AAPA leaders in national mental health policies and activities are reviewed. The substantive areas of Asian American psychology and the education and training of Asian American psychologists are also discussed. The article ends with some comments about the future of Asian American psychology. Copyright 2009 APA, all rights reserved.

  18. The american dental dream.

    Science.gov (United States)

    Hodges, Nathan

    2015-01-01

    The American Dental Dream-the cultural desire for straight, white teeth-is difficult, if not impossible, for poor and working-class people to achieve. Using ethnographic fiction, autoethnography, poetry, and qualitative interviewing, I brush away the taken-for-granted assumptions about teeth. I explore the personal, relational, and structural consequences of this cultural desire, and show how social class writes itself on our bodies. I write these culture-centered teeth tales to show how one might cope with their teeth.

  19. Asthma and American Indians/Alaska Natives

    Science.gov (United States)

    ... Minority Population Profiles > American Indian/Alaska Native > Asthma Asthma and American Indians/Alaska Natives In 2015, 240, ... Native American adults reported that they currently have asthma. American Indian/Alaska Native children are 60% more ...

  20. Paul Graham, American Night

    Directory of Open Access Journals (Sweden)

    Catherine Bernard

    2006-12-01

    Full Text Available Le photographe britannique Paul Graham (1956- ne jouit pas encore en France de la notoriété de son compatriote Martin Parr et on ne peut, par conséquent, que se féliciter de voir l’une de ses plus puissantes séries — American Night — représentée à la Galerie Les Filles du Calvaire.Connu, avec Parr, pour avoir profondément influencé la photo documentaire anglaise en la faisant passer à la couleur avec virulence, Graham a été révélé il y a une vingtaine d’années par une série d’images prises à...

  1. American Nations, Latin States

    Directory of Open Access Journals (Sweden)

    Jorge Nelson Ahumada

    2016-02-01

    Full Text Available The nation, as artifact of modernity, assumes particularities in America such as the colonization and genocide of original peoples which still weighs as a never ending comeback. Nevertheless, capital, with its overwhelming force, destroyed peoples, cultures, traditions and landscapes. Latin America faces the challenge of uniting beyond the necessities of capital, and beyond two languages, spanish and portuguese. All of which has full validity at present with the blocks UNASUR and ALBA. Ethnocentricity is postulated as the exclusive condition of all possible humanity and, as programme, racism without races; Latin American miscegenation, as the potential for unity and the strength of emancipation as a project. Our intellectuals, who constructed a unique and superlative literature, are the lighthouses in the development of a nationalism without races. Anthropology in debate with psychoanalysis can become a compass in rethinking our America.

  2. "American Gothic" Revised: Positive Perceptions from a Young American Farmer

    Science.gov (United States)

    Joehl, Regan R.

    2008-01-01

    Grant Wood's "American Gothic," intended to represent the Depression Era, Midwestern farmer, has been regarded by many as the stereotypical representation of a true American farmer for decades. While this painting does represent farmers in the early part of the 20th century, the author feels obliged to say that it is time to drop this…

  3. Teaching about American Federal Democracy.

    Science.gov (United States)

    Schechter, Stephen L., Ed.

    Ten essays discuss federal democracy, the form of government of the United States. The first essay discusses the origins of American federalism. The second examines why we have a federal system, the functions federalism serves, and the consequences of federalism for the American political system. Federalism in the Constitution and constitutional…

  4. American uranium: Relic or reality?

    International Nuclear Information System (INIS)

    Anon.

    1994-01-01

    This article is a review of the American Uranium industry. Historical aspects are presented as the industry's history is outlined from the mid-1950's to the present day. Present capabilities are noted, as are a current comparison of American production costs vs. world costs. Future trends are analyzed

  5. Native American Foods and Cookery.

    Science.gov (United States)

    Taylor, Tom; Potter, Eloise F.

    Native Americans had a well-developed agriculture long before the arrival of the Europeans. Three staples--corn, beans, and squash--were supplemented with other gathered plants or cultivated crops such as white potatoes, sweet potatoes, pumpkins, and peanuts. Native Americans had no cows, pigs, or domesticated chickens; they depended almost…

  6. A Slice of American Life

    Science.gov (United States)

    Kirker, Sara Schmickle

    2009-01-01

    In this article, the author describes an art project for second-grade students based on American Regionalist Grant Wood's most famous painting, "American Gothic," which was modeled by his sister, Nan, and his dentist. This well-loved painting depicting a hard-working farmer and his daughter standing in front of their farmhouse is the project's…

  7. Family Values in American Drama.

    Science.gov (United States)

    Brown, Joanne

    When an educator was invited by a Chinese university to teach a seminar in American drama, she used "family drama" as the organizing theme of her course because she was (and is) convinced that from Eugene O'Neill on, American playwrights have been obsessed with family disintegration and the failure of family harmony. This paper is an…

  8. American Samoa: Energy Action Plan

    Energy Technology Data Exchange (ETDEWEB)

    Ness, J. Erik [National Renewable Energy Lab. (NREL), Golden, CO (United States); Haase, Scott [National Renewable Energy Lab. (NREL), Golden, CO (United States); Conrad, Misty [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2016-09-01

    This document outlines actions being taken to reduce American Samoa's petroleum consumption. It describes the four near-term strategies selected by the American Samoa Renewable Energy Committee during action-planning workshops conducted in May 2016, and describes the steps that will need to be taken to implement those strategies.

  9. The oxymoron of American pastoralism

    Science.gov (United States)

    G. Sayre

    2013-01-01

    Pastoralism has been variously defined in American literary studies. In European literature the pastoral persisted as a distinct genre and self-conscious literary tradition from Theocritus and Virgil through the eighteenth century. Major eighteenth and nineteenth-century American authors alluded to this tradition, but they could not really lay claim to it, for as this...

  10. Additional Resources on Asian Americans.

    Science.gov (United States)

    Kodama, Corinne Maekawa; Lee, Sunny; Liang, Christopher T. H.; Alvarez, Alvin N.; McEwen, Marylu K.

    2002-01-01

    The authors identify Asian American associations and organizations, academic journals, periodicals, and media resources. Selected annotated resources on Asian American activism and politics, counseling and psychology, educational issues, gender and sexual orientation, history, policy reports, and racial and ethnic identity are also included.…

  11. Elder Abuse among African Americans

    Science.gov (United States)

    Tauriac, Jesse J.; Scruggs, Natoschia

    2006-01-01

    Perceptions of extreme, moderate, and mild forms of elder abuse among African-American women (n=25) and men (n=10) were examined. African-American respondents emphasized physical abuse when giving examples of extremely abusive behavior. Along with physical abuse, verbal abuse was the most frequently identified form of abuse, and was significantly…

  12. African American Health PSA (:60)

    Centers for Disease Control (CDC) Podcasts

    This 60 second public service announcement is based on the May 2017 CDC Vital Signs report. The life expectancy of African Americans has improved, but it's still an average of four years less than whites. Learn what can be done so all Americans can have the opportunity to pursue a healthy lifestyle.

  13. On American Cultural Exportation Strategy

    Institute of Scientific and Technical Information of China (English)

    李德俊

    2015-01-01

    American government has been attaching great importance to the role that cultural values plays in international relationships and Culture Exportation has gradually become one of the important parts of American diplomatic strategy. This strategy,which is propelled by a variety of impetuses and conducted by different approaches,is mainly aimed to serve the overall national interests of the United States.

  14. On American Cultural Exportation Strategy

    Institute of Scientific and Technical Information of China (English)

    李德俊

    2015-01-01

    American government has been attaching great importance to the role that cultural values plays in international relationships and Culture Exportation has gradually become one of the important parts of American diplomatic strategy.This strategy,which is propelled by a variety of impetuses and conducted by different approaches,is mainly aimed to serve the overall national interests of the United States.

  15. Reconsidering Asian American Student Development

    Science.gov (United States)

    Kodama, Corinne M.; Maramba, Dina C.

    2017-01-01

    This chapter addresses the applicability of student development theories in light of empirical research on Asian American college students through a twofold approach: (a) revisiting the relevance of Kodama, McEwen, Liang, and Lee's (2001, 2002) theoretical work on Asian American student development; and (b) using Jones' and Stewart's (2016)…

  16. Native American youth and justice

    Directory of Open Access Journals (Sweden)

    Dr.Sc. Laurence A. French

    2012-12-01

    Full Text Available Youth and delinquency issues have long been problematic among Native Americans groups both on- and off-reservation. This phenomenon is further complicated by the cultural diversity among American Indians and Alaska Natives scattered across the United States. In address these issues, the paper begins with a historical overview of Native American youth. This history presents the long tradition of federal policies that, how well intended, have resulted in discriminatory practices with the most damages attacks being those directed toward the destruction of viable cultural attributes – the same attributes that make Native Americans unique within United States society. Following the historical material, the authors contrast the pervasive Native American aboriginal ethos of harmony with that of Protestant Ethic that dominates the ethos of the larger United States society. In addition to providing general information on Native American crime and delinquency, the paper also provides a case study of Native American justice within the Navajo Nation, the largest tribe, in both size and population, in the United States. The paper concludes with a discussion of issues specific to Native American youth and efforts to address these problems.

  17. Arab American Women Negotiating Identities

    Science.gov (United States)

    Mango, Oraib

    2012-01-01

    Compared to the literature available on other ethnic groups in the United States, there is very little information about school experiences of Arab Americans (Nieto, 2003). This study examines the ways that Arab American women reported positioning themselves when faced with difficult situations related to stereotypical images of Arabs and Arab…

  18. American Canine Hepatozoonosis

    Science.gov (United States)

    Ewing, S. A.; Panciera, R. J.

    2003-01-01

    American canine hepatozoonosis (ACH) is a tick-borne disease that is spreading in the southeastern and south-central United States. Characterized by marked leukocytosis and periosteal bone proliferation, ACH is very debilitating and often fatal. Dogs acquire infection by ingesting nymphal or adult Gulf Coast ticks (Amblyomma maculatum) that, in a previous life stage, ingested the parasite in a blood meal taken from some vertebrate intermediate host. ACH is caused by the apicomplexan Hepatozoon americanum and has been differentiated from Old World canine hepatozoonosis caused by H. canis. Unlike H. canis, which is transmitted by the ubiquitous brown dog tick (Rhipicephalus sanguineus), H. americanum is essentially an accidental parasite of dogs, for which Gulf Coast ticks are not favored hosts. The geographic portrait of the disease parallels the known distribution of the Gulf Coast tick, which has expanded in recent years. Thus, the endemic cycle of H. americanum involves A. maculatum as definitive host and some vertebrate intermediate host(s) yet to be identified. Although coyotes (Canis latrans) are known to be infected, it is not known how important this host is in maintaining the endemic cycle. This review covers the biology of the parasite and of the tick that transmits it and contrasts ACH with classical canine hepatozoonosis. Clinical aspects of the disease are discussed, including diagnosis and treatment, and puzzling epidemiologic issues are examined. Brief consideration is given to the potential for ACH to be used as a model for study of angiogenesis and of hypertrophic osteoarthropathy. PMID:14557294

  19. North American Regional Report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-11-15

    North America is an energy community fortunate to be endowed with a rich and varied resource base. It consumes about a third of the world's energy and produces about one quarter of world energy supply. North America depends on a mix of complementary energy sources that should remain competitive but not in conflict. The current supply mix varies between Canada, the United States and Mexico, but fossil fuels are dominant across the region, leaving the three member countries vulnerable to a myriad of risks associated with traditional supply sources. Energy trade between all three countries is also a major contributor to the region's economy. Thus, the impetus for collaboration across the region has grown out of the common goals of energy security and economic prosperity. The goal of the WEC regional group was to discuss avenues for advancing North American cooperation and coordination on a range of energy issues. An additional objective was to develop policy recommendations that will facilitate effective development and use of the region's energy resources. Results and recommendtaions are summarized from three forums that focused on the pertinent issues of energy trade, energy efficiency and energy diversification. The inaugural forum (Energy Trade) was held in Washington, D.C. in the fall of 2005. The following summer, the second forum (Energy Efficiency) took place in Mexico City. The third forum (Energy Diversification) was hosted in Halifax, Nova Scotia.

  20. North American Regional Report

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2007-11-15

    North America is an energy community fortunate to be endowed with a rich and varied resource base. It consumes about a third of the world's energy and produces about one quarter of world energy supply. North America depends on a mix of complementary energy sources that should remain competitive but not in conflict. The current supply mix varies between Canada, the United States and Mexico, but fossil fuels are dominant across the region, leaving the three member countries vulnerable to a myriad of risks associated with traditional supply sources. Energy trade between all three countries is also a major contributor to the region's economy. Thus, the impetus for collaboration across the region has grown out of the common goals of energy security and economic prosperity. The goal of the WEC regional group was to discuss avenues for advancing North American cooperation and coordination on a range of energy issues. An additional objective was to develop policy recommendations that will facilitate effective development and use of the region's energy resources. Results and recommendtaions are summarized from three forums that focused on the pertinent issues of energy trade, energy efficiency and energy diversification. The inaugural forum (Energy Trade) was held in Washington, D.C. in the fall of 2005. The following summer, the second forum (Energy Efficiency) took place in Mexico City. The third forum (Energy Diversification) was hosted in Halifax, Nova Scotia.

  1. North American Foreign Fighters

    Directory of Open Access Journals (Sweden)

    Michael Noonan

    2014-12-01

    Full Text Available While the phenomenon of so-called “foreign fighters” is in no way new the past thirty-plus years has shown a marked increase in the numbers of individuals traveling abroad to fight in civil conflicts in the Muslim world. The crisis in Syria (2011-present has created a massive influx of such individuals going to fight. Of particular concern in western capitals has been the numbers of individuals from those countries that have gone to fight in that conflict which has since crossed the border into neighboring Iraq with the establishment of the socalled “Islamic State” and threatens to broaden the conflict into a larger regional sectarian conflagration. While the numbers of such participants from Western Europe have been greater than those who have gone from the United States and Canada there are legitimate concerns in both Washington, DC, and Ottawa about American and Canadian citizens who have gone—or attempted to go—to fight there and in other locales such as the Maghreb and Somalia. The analysis here will provide some background on the foreign fighter phenomenon, discuss the foreign fighter flow model, explore the issue from both Canadian and US perspectives to include providing details of some original research categorizing the characteristics of a small sample of US and Canadian fighters and those who attempted to go and fight, discuss how both governments have attempted to deal with the issue, and offer some policy prescription for dealing with this issue that is of importance to both international security writ large and domestic security in the US and Canada.

  2. Agatoxin-like peptides in the neuroendocrine system of the honey bee and other insects.

    Science.gov (United States)

    Sturm, Sebastian; Ramesh, Divya; Brockmann, Axel; Neupert, Susanne; Predel, Reinhard

    2016-01-30

    We investigated the peptide inventory of the corpora cardiaca (CC) of the honey bee, Apis mellifera, by direct tissue profiling using MALDI-TOF MS combined with proteomic approaches focusing on cysteine-containing peptides. An agatoxin-like peptide (ALP) was identified as a component of the glandular part of the CC and was associated with the presence of the adipokinetic hormone in mass spectra. Although abundant in the CC, ALP does not belong to the toxins observed in the venom gland of A. mellifera. Homologs of ALP are highly conserved in major groups of arthropods and in line with this we detected ALP in the CC of non-venomous insects such as cockroaches and silverfish. In the American cockroach, Periplaneta americana, ALP was also identified in the CNS and stomatogastric nervous system. This is the first report that establishes the presence of ALPs in the neuroendocrine tissues of insects and further studies are necessary to reveal common functions of these peptides, e.g. as antimicrobial agents, ion channel modulators or classical neuropeptides. Among the messenger molecules of the nervous system, neuropeptides represent the structurally most diverse class and basically participate in the regulation of all physiological processes. The set of neuropeptides, their functions and spatial distribution are particularly well-studied in insects. Until now, however, several potential neuropeptide receptors remained orphan, which indicates the existence of so far unknown ligands. In our study, we used proteomic methods such as cysteine modification, enzymatic digestion and peptide derivatization, combined with direct tissue profiling by MALDI-TOF mass spectrometry, for the discovery of novel putative messenger molecules in the neuroendocrine system. The described presence of agatoxin-like peptides in the nervous system of the honey bee and other insects was overseen so far and is thus a remarkable addition to the very well studied neuropeptidome of insects. It is not

  3. Energy geopolitics, an American perspective

    International Nuclear Information System (INIS)

    Henderson, Simon

    2008-01-01

    Even if geopolitics can be said not to exist for Americans who, like for example in the field of energy, believe that any problem can find a solution with the help of money and of the American ingenuity, and who are in fact only interested in a lower energy price, the author comments how energy issues are addressed by the candidates to the President election of 2008. The author notices that American people may have to realise, at least for a while, that their country is accused to bear a large share of responsibilities in environmental problems

  4. North American oil demand outlook

    International Nuclear Information System (INIS)

    Stewart, M.B.

    1995-01-01

    An understanding of the relationship of economic growth and potential petroleum product demand is needed to forecast the potential for North American oil demand growth as well as knowledge of world supply and price. The bullish expectations for economic growth in the US and Canada auger well for North American refiners and marketeers. The growth in world economic output forecast, however, means a larger oil demand and an increase in OPEC's pricing power. Such price increases could depress North American oil demand growth. (author)

  5. American Samoa Energy Action Plan

    Energy Technology Data Exchange (ETDEWEB)

    Haase, Scott [National Renewable Energy Lab. (NREL), Golden, CO (United States); Esterly, Sean [National Renewable Energy Lab. (NREL), Golden, CO (United States); Herdrich, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Bodell, Tim [National Renewable Energy Lab. (NREL), Golden, CO (United States); Visser, Charles [National Renewable Energy Lab. (NREL), Golden, CO (United States)

    2013-08-01

    Describes the five near-term strategies selected by the American Samoa Renewable Energy Committee (ASREC) during action planning workshops conducted in May 2013, and outlines the actions being taken to implement those strategies. Each option is tied to a priority identified in the earlier draft American Samoa Strategic Energy Plan as being an essential component of reducing American Samoa'spetroleum energy consumption. The actions described for each strategy provide a roadmap to facilitate the implementation of each strategy. This document is intended to evolve along with the advancement of the projects, and will be updated to reflect progress.

  6. Status of and future research on thermosensory processing

    Directory of Open Access Journals (Sweden)

    Makoto eMizunami

    2016-04-01

    Full Text Available Thermosensation is critically important for survival of all animals. In the cockroach Periplaneta americana, thermoreceptor neurons on antennae and thermosensory interneurons in the antennal lobe have been characterized electrophysiologically, and recent studies using advanced transgenic technologies in the fruit fly Drosophila melanogaster have added much to the knowledge of these neurons, enabling us to discuss common principles of thermosensory processing systems in insects. Cockroaches and many other insects possess only one type of thermoreceptor neurons on antennae that are excited by cooling and inhibited by warming. In contrast, the antennae of fruit flies and other dipterans possess oppositely responding warm and cold receptor neurons. Despite differences in their thermoreceptive equipment, central processing of temperature information is much the same in flies and cockroaches. Axons of thermoreceptor neurons project to the margin of the antennal lobe and form glomeruli, from which cold, warm and cold-warm projection neurons originate, the last neurons being excited by both cooling and warming. Axons of antennal lobe thermosensory projection neurons of the antennal lobe terminate in three distinct areas of the protocerebrum, the mushroom body, lateral horn and posterior lateral protocerebrum, the last area also receiving termination of hygrosensory projection neurons. Such multiple thermosensory pathways may serve to control multiple forms of thermosensory behavior. Electrophysiological studies on cockroaches and transgenic approaches in flies are encouraged to complement each other for further elucidating general principles of thermosensory processing in the insect brain.

  7. Americanization of Non-American Storiesin Disney Films

    Directory of Open Access Journals (Sweden)

    Beta Setiawati

    2016-06-01

    Full Text Available The study is intended to know the Disney’s animation films characteristics which are adapted from non American stories that contain Americanization in order to be American popular culture products. This qualitative and library research is carried out within the field of American Studies. Disney’s animated films which are regarded as artifacts in order to identify American society and culture is used as her primary data. She then compares those Disney films with the original stories to discover the changes in making those stories become American popular products. She furthermore uses the sources such as books, magazines, journals, articles, and also internet data for her secondary data. The result of this study shows that most of folk narratives which were used in Disney films were adapted from other countries’ stories. However, Disney intentionally adapts foreign countries’ stories in its animated films by using Disney formula to blow up the sale of its products. Since Disney is one of the most powerful media conglomerates in the world, it works endlessly to set out world entertainment. Disney formula in its animated films which has dominated those adapted films are only intended to obtain as much profit as possible without paying attention to the values in children entertainment.

  8. Usage Notes in the Oxford American Dictionary.

    Science.gov (United States)

    Berner, R. Thomas

    1981-01-01

    Compares the "Oxford American Dictionary" with the "American Heritage Dictionary." Examines the dictionaries' differences in philosophies of language, introductory essays, and usage notes. Concludes that the "Oxford American Dictionary" is too conservative, paternalistic, and dogmatic for the 1980s. (DMM)

  9. American Association Of State Climatologists

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Records documenting the business, membership, and meetings of the American Association of State Climatologists, from 1976-92. Material donated in 2008 by the estate...

  10. Performing Transnational Arab American Womanhood

    DEFF Research Database (Denmark)

    Koegeler-Abdi, Martina

    2016-01-01

    The first Miss Lebanon-America, Rosemary Hakim, landed at Beirut Airport in July 1955 to start a public diplomacy tour. As an American beauty queen from Detroit visiting Lebanon, her parents' homeland, she was greeted enthusiastically by the local press and closely monitored by US government...... a transnational sense of Arab Americanness to negotiate her own gender and ethnic identity. This is significant because we currently lack a broader historical understanding of Arab American women’s public agency, particularly during the mid-twentieth century. Hakim’s memoir requires us to rethink the history...... of Arab American women’s strategies of self-representation in ways that acknowledge but are not confined within the terms of conventional orientalist discourses....

  11. Central American and Caribbean Observations

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Weather and soil temperature observations from foreign countries, taken by foreign and American observers. Includes NOAA forms collected and archived at NCDC, and...

  12. American Institute for Cancer Research

    Science.gov (United States)

    ... Phytochemicals in your food Red and processed meat Sugar and cancer risk Alcohol and cancer risk Physical Activity Are ... Updates: Diabetes Rates are High and Rising, That Links with Cancer Apples and Oranges, What Americans are Eating and ...

  13. Charting Transnational Native American Studies

    Directory of Open Access Journals (Sweden)

    Hsinya Huang

    2012-06-01

    Full Text Available Introduction to the Special Forum entitled "Charting Transnational Native American Studies: Aesthetics, Politics, Identity," edited by Hsinya Huang, Philip J. Deloria, Laura M. Furlan, and John Gamber

  14. American Head and Neck Society

    Science.gov (United States)

    ... research and insights. Comments This field is for validation purposes and should be left unchanged. This iframe ... and Announcements Copyright ©2016 · American Head and Neck Society · Privacy and Return Policy Managed by BSC Management, ...

  15. American Association of Tissue Banks

    Science.gov (United States)

    ... Committees Accreditation American Board of Tissue Banking Bylaws / Ethics Communications Donor Family Services Ad Hoc Committee Education Finance ... Bureau Accredited Bank Search Bookstore Bulletins Global Topics Communications & Media Job Center News Releases Patients and Community Useful ...

  16. Taxation and the American Indian

    Science.gov (United States)

    Brunt, David

    1973-01-01

    The article explores American Indian tribal rights to tax exemptions and self-imposed taxation; general recommendations on possible tribal tax alternatives; and evaluation of the probable economic effect of taxation. (FF)

  17. Geothermal energy for American Samoa

    Energy Technology Data Exchange (ETDEWEB)

    1980-03-01

    The geothermal commercialization potential in American Samoa was investigated. With geothermal energy harnessed in American Samoa, a myriad of possibilities would arise. Existing residential and business consumers would benefit from reduced electricity costs. The tuna canneries, demanding about 76% of the island's process heat requirements, may be able to use process heat from a geothermal source. Potential new industries include health spas, aquaculture, wood products, large domestic and transhipment refrigerated warehouses, electric cars, ocean nodule processing, and a hydrogen economy. There are no territorial statutory laws of American Samoa claiming or reserving any special rights (including mineral rights) to the territorial government, or other interests adverse to a land owner, for subsurface content of real property. Technically, an investigation has revealed that American Samoa does possess a geological environment conducive to geothermal energy development. Further studies and test holes are warranted.

  18. Pricing American and Asian Options

    OpenAIRE

    Pat Muldowney

    2015-01-01

    An analytic method for pricing American call options is provided; followed by an empirical method for pricing Asian call options. The methodology is the pricing theory presented in "A Modern Theory of Random Variation", by Patrick Muldowney, 2012.

  19. American Association for Geriatric Psychiatry

    Science.gov (United States)

    ... Position Statements Publications Bookstore American Journal of Geriatric Psychiatry Legislative & Regulatory Agenda AAGP eNews (Members Only) Tools ... Funding Training Resources and Curricula For Clinicians >> Geriatric Psychiatry Identifier Webinar: Billing and Coding Consumer Material Clinical ...

  20. American Association for Clinical Chemistry

    Science.gov (United States)

    ... Find the answer to your question IN CLINICAL CHEMISTRY Hs-cTnI as a Gatekeeper for Further Cardiac ... Online Harmonization.net Commission on Accreditation in Clinical Chemistry American Board of Clinical Chemistry Clinical Chemistry Trainee ...

  1. American acceptance of nuclear power

    International Nuclear Information System (INIS)

    Barrett, W.

    1980-01-01

    The characteristic adventurous spirit that built American technology will eventually lead to American acceptance of nuclear power unless an overpowering loss of nerve causes us to reject both nuclear technology and world leadership. The acceptance of new technology by society has always been accompanied by activist opposition to industralization. To resolve the debate between environmental and exploitive extremists, we must accept with humility the basic premise that human accomplishment is a finite part of nature

  2. African American Health PSA (:60)

    Centers for Disease Control (CDC) Podcasts

    2017-05-02

    This 60 second public service announcement is based on the May 2017 CDC Vital Signs report. The life expectancy of African Americans has improved, but it’s still an average of four years less than whites. Learn what can be done so all Americans can have the opportunity to pursue a healthy lifestyle.  Created: 5/2/2017 by Centers for Disease Control and Prevention (CDC).   Date Released: 5/2/2017.

  3. Examining Factors Influencing Asian American and Latino American Students' College Choice

    Science.gov (United States)

    Wang-Yeung, Leilani Weichun

    2016-01-01

    This dissertation examines the gap in college enrollment between Asian Americans and Latino Americans regarding the effects of family and school factors, classifying them into the six ethnic/generational status groups (Asian American first generation, Asian American second generation, Asian American third generation and plus, Latino American first…

  4. Transfusion medicine on American television.

    Science.gov (United States)

    Karp, J K

    2014-02-01

    Television is a beloved American pastime and a frequent American export. As such, American television shapes how the global public views the world. This study examines how the portrayal of blood transfusion and blood donation on American television may influence how domestic and international audiences perceive the field of transfusion medicine. American television programming of the last quarter-century was reviewed to identify programmes featuring topics related to blood banking/transfusion medicine. The included television episodes were identified through various sources. Twenty-seven television episodes airing between 1991 and 2013 were identified as featuring blood bank/transfusion medicine topics. Although some accurate representations of the field were identified, most television programmes portrayed blood banking/transfusion medicine inaccurately. The way in which blood banking/transfusion medicine is portrayed on American television may assist clinicians in understanding their patient's concerns about blood safety and guide blood collection organisations in improving donor recruitment. © 2013 The Author. Transfusion Medicine © 2013 British Blood Transfusion Society.

  5. Celebrating National American Indian Heritage Month

    National Research Council Canada - National Science Library

    Mann, Diane

    2004-01-01

    November has been designated National American Indian Heritage Month to honor American Indians and Alaska Natives by increasing awareness of their culture, history, and, especially, their tremendous...

  6. Native American Women: Living with Landscape.

    Science.gov (United States)

    Bales, Rebecca

    1997-01-01

    Discusses the role of Native American women in the spiritual and cultural life of American Indians. Native American spirituality is deeply connected to the land through daily use, ritual, and respect for sacred space. Often Native American women act as conduits and keepers of this knowledge. (MJP)

  7. Successfully Educating Our African-American Students

    Science.gov (United States)

    Moncree-Moffett, Kareem

    2013-01-01

    The purpose of this empirical study was to explore the lived experiences of African American retired female teachers who have prior experience with educating urban African American students in public schools. Also explored are the experiences of active African American female teachers of urban African American students and comparisons are…

  8. Sociolinguistics features of humor in american linguoculture ...

    African Journals Online (AJOL)

    In this article we study the characteristics of the language of representation and perception of American humour, its linguistic and cultural features in humorous texts of American comics from the American linguistic culture. The material for research is the humorous texts and fragments of the performances of American ...

  9. The Native American Experience. American Historical Images on File.

    Science.gov (United States)

    Wardwell, Lelia, Ed.

    This photo-documentation reference body presents more than 275 images chronicling the experiences of the American Indian from their prehistoric migrations to the present. The volume includes information and images illustrating the life ways of various tribes. The images are accompanied by historical information providing cultural context. The book…

  10. Disillusionment of the American Dream——On An American Tragedy

    Institute of Scientific and Technical Information of China (English)

    管秀丽

    2008-01-01

    Theodore Dreiser is now regarded as one of the pre-eminent American realistic novelists of the first half of the twentieth century.an anatomist of the American Dream.In his great work An American Tragedy,Dreis- er exposes and criticizes mercilessly the corruption and black side of American society.The disillusionment of the American Dream is an important theme of the fiction.This paper illustrates "An American Tragedy" is the re- flection of disillusionment of the American Dream in the perspectives of the tragedy of a mortal,the tragedy of American society,and the tragedy of the American Dream.

  11. Vasoconstrictive effect of Xinmailong injection in rat aorta | Yang ...

    African Journals Online (AJOL)

    Background: Cockroach has been traditionally utilized in China for the therapy of cardiovascular disorders, such as heart failure. The present study was aimed to assess the vasoconstrictive effect of Xinmailong Injection (XML), a bioactive composite from American cockroach. Methodology: The isometric tensions of rat aortic ...

  12. 75 FR 70300 - USEC, Inc.; American Centrifuge Lead Cascade Facility; American Centrifuge Plant; Notice of...

    Science.gov (United States)

    2010-11-17

    ... Centrifuge Lead Cascade Facility; American Centrifuge Plant; Notice of Receipt of a License Transfer... SNM-2011, for the American Centrifuge Lead Cascade Facility and the American Centrifuge Plant... USEC Inc., (the Licensee), for its American Centrifuge Lead Cascade Facility (LCF) and American...

  13. Marketing to Older American Consumers.

    Science.gov (United States)

    Mertz, Barbara; Stephens, Nancy

    1986-01-01

    Examined older adults as a potential market for American businesses. Data indicate that in terms of size and income, senior citizens comprise a substantial buying group. Their buying styles, product and service needs, and shopping behavior vary from younger adults and within the older adult population. Strategies for successful marketing are…

  14. American Indians in Graduate Education.

    Science.gov (United States)

    Kidwell, Clara Sue

    1989-01-01

    The number of American Indians enrolled in institutions of higher education is very small. Enrollment figures for fall 1984 show Indians made up .68% of the total enrollment in institutions of higher education in the country, but only 15% of them were in universities. Their largest representation was in two-year institutions, where 54% of Indian…

  15. The Evil that Americans Did

    Science.gov (United States)

    Smith, John David

    2007-01-01

    Slavery's unequivocal evil lies at the heart of debates over apologizing for America's "peculiar institution" and awarding reparations. In The Problem of Evil: Slavery, Freedom, and the Ambiguities of American Reform, a provocative collection of original essays, the editors Steven Mintz and John Stauffer, along with 23 contributors,…

  16. Communication; A Scientific American Book.

    Science.gov (United States)

    Scientific American, Inc., New York, NY.

    With present advances in communication technology, profound and qualitative changes in our civilization are taking place--in business and politics, in education, in entertainment, interpersonal relations, and the organization of society itself. In honor of the significance of such developments, an entire issue of "Scientific American" magazine…

  17. The American Inventors Protection Act

    NARCIS (Netherlands)

    Hoffmann, Arvid O.I.; Kleimeier, Stefanie; Mimiroglu, Nagihan; Pennings, Joost M.E.

    2018-01-01

    We examine the impact of innovation disclosure through patenting on firms' cost of debt, focusing on the American Inventors Protection Act (AIPA) as an exogenous shock in innovation disclosure regulation. Post-AIPA, firms have an incentive to apply for patents only if commercial success is likely.

  18. Foundation Networks and American Hegemony

    Directory of Open Access Journals (Sweden)

    Inderjeet Parmar

    2012-02-01

    Full Text Available The major American foundations constructed and sustained the rich texture of cooperative social, intellectual and political relations between key actors and institutions supportive of specific modes of thought that promoted US hegemony. Foundations also fostered and developed the attractive power-knowledge networks that not only radiated intellectual influence but also attracted some of the most creative minds. Finally, liberal internationalist foundations fostered globalism even when the American state was ‘isolationist’, and when US influence abroad unwelcome. Their significance in American hegemony building lay in their sustained, long-term cooperative relationship with the American state through which they helped build national, international and global institutions and networks. The latter process evidences the most significant impact of US foundations – the building of the domestic and international infrastructure for liberal internationalism which has transformed into a kind of “social neoliberalism”. Theoretical conclusions follow from these claims: the sustained and deep cooperation between the state and foundations suggests that we must revise our views of “how power works” in the United States and therefore influences its foreign relations. Therefore, the article shows that elite networks, consisting of state officials and private citizens are powerful means by which foreign policy shifts may be prepared, elite and mass opinion primed and mobilised, new consensus built, ‘old’ forces marginalised, and US hegemony constructed.

  19. Polish Americans. Second, Revised Edition.

    Science.gov (United States)

    Lopata, Helen Znaniecka

    This book examines Polonia, the Polish ethnic community in America created by three giant waves of immigration between 1880 and 1990. The complicated history of this ethnic group is reflected in the lives of increasing numbers of Polish Americans, including recent immigrants brought by political and economic changes, as they achieve middle class…

  20. Textbooks and the American Indian.

    Science.gov (United States)

    Costo, Rupert, Ed.

    An independent Indian publishing house has been formed to provide classroom instructional materials which deal accurately with the history, culture, and role of the American Indian. This book is a preliminary statement in that publishing program. General criteria, valid for instructional materials from elementary through high school, are applied…

  1. Filipino Americans: Transformation and Identity.

    Science.gov (United States)

    Root, Maria P. P., Ed.

    Throughout the United States, many Filipino Americans, especially students, are beginning to want to know more about their cultural heritage and future. Overall, there has been very little written to transmit knowledge about Filipino history, ideas, and values, even though Filipinos make up the largest Asian ethnic group in the United States.…

  2. Latin American Folk Art Prints

    Science.gov (United States)

    Navah, Jan

    2011-01-01

    Latin American customs and colors play an important role as second graders are introduced to multicultural experiences through food, music, dance, art, and craft. In this article, the author describes a printing project inspired by Guatemalan weavings and amate bark paintings. (Contains 2 online resources.)

  3. AMERICAN INDIANS AND EDUCATIONAL LABORATORIES.

    Science.gov (United States)

    BASS, WILLARD P.; BURGER, HENRY G.

    MANY OF THE DIVERSE EDUCATIONAL PROBLEMS OF THE AMERICAN INDIAN HAVE BEEN IDENTIFIED FOR YEARS, BUT HAVE BEEN PERMITTED TO LAY DORMANT. SOCIO-ECONOMIC DISADVANTAGEMENT IS EXHIBITED IN AREAS OF INCOME, UNEMPLOYMENT, SCHOOL DROPOUT RATE, EXPECTED LIFE SPAN, INFANT MORTALITY RATE, BIRTH RATE, AND HEALTH HISTORY. COMMUNICATION PROBLEMS BLOCK THE…

  4. Dimensions of Native American Stereotyping.

    Science.gov (United States)

    Hanson, Jeffery R.; Rouse, Linda P.

    1987-01-01

    Reports responses of 226 University of Texas undergraduates concerning their stereotypical perceptions of American Indians. Examines cultural stereotypes, personal stereotypes, perceived degree of Indian homogeneity, attitudes toward assimilation, and victim blaming. Suggests an emergent Indian stereotype based on cultural relativism prevailing…

  5. The American Way of Warfare

    Science.gov (United States)

    2012-05-17

    Military Experience: History and Learning,” The Journal of Interdisciplinary History, Vol. 1, No. 2 (Winter, 1971), 208. 19 Jerome S. Bruner , Jacqueline... Bruner , Jerome S., Goodnow, Jacqueline J, and Austin, George A. A Study of Thinking. New York: Wiley, 1956. Bruscino, Thomas A, “Our American

  6. American Elements in Czech Parody

    Czech Academy of Sciences Publication Activity Database

    Hemelíková, Blanka

    2015-01-01

    Roč. 48, č. 1 (2015), s. 102-113 ISSN 0022-3840 Institutional support: RVO:68378068 Keywords : Czech interwar literature * parody * Brdečka, Jiří * Kuděj, Zdeněk Matěj * americanism Subject RIV: AJ - Letters, Mass-media, Audiovision Impact factor: 0.070, year: 2015

  7. American options under stochastic volatility

    NARCIS (Netherlands)

    Chockalingam, A.; Muthuraman, K.

    2011-01-01

    The problem of pricing an American option written on an underlying asset with constant price volatility has been studied extensively in literature. Real-world data, however, demonstrate that volatility is not constant, and stochastic volatility models are used to account for dynamic volatility

  8. Ideas That Shaped American Schools.

    Science.gov (United States)

    Parker, Franklin

    1981-01-01

    Briefly discusses 10 books, or series of books, that represent major turning points in American education in the last 75 years. The authors include William H. McGuffey, Abraham Flexner, Lewis M. Terman, John Dewey, George S. Counts, Jerome S. Bruner, James S. Coleman, Michael B. Katz, and B. F. Skinner. (IRT)

  9. Sexism in modern American society

    Directory of Open Access Journals (Sweden)

    Ibraeva B. M.

    2016-12-01

    Full Text Available the authors of the article consider that modern life is still full of various stereotypes. One of the most controversial questions in this article is the issue of discrimination against women in contemporary American society, and it is hard to believe, because this country claims to be a main guarantor of the human rights and freedoms.

  10. Dietary Acculturation among Filipino Americans.

    Science.gov (United States)

    Vargas, Persephone; Jurado, Leo-Felix

    2015-12-22

    Acculturation, the subsequent changes that occur in one culture after continuous first hand contact with another culture, impacts the dietary habits and health risks of individuals. This study examines the acculturation, dietary habits and anthropometric measurements in a sample of 210 first generation Filipino American immigrants in New Jersey (NJ). Acculturation was measured using the Short Acculturation Scale for Filipino Americans (ASASFA). Dietary acculturation was measured using the Dietary Acculturation Questionnaire for Filipino Americans (DAQFA) and dietary intake was determined using the Block's Brief Food Frequency Questionnaire (BFFQ). Anthropometric measurements were obtained including weight, height and waist circumference. Acculturation had a significant negative relationship with Filipino Dietary acculturation. Western dietary acculturation was significantly correlated with caloric intake (r(208) = 0.193, p Filipino dietary acculturation, dietary intake and anthropometric measurements. The results showed that Filipino American immigrants have increased risks including increased BMI, waist circumference and increased fat intake. Over all, this research highlighted some dietary changes and their effects on dietary intake and health status.

  11. Dietary Acculturation among Filipino Americans

    Directory of Open Access Journals (Sweden)

    Persephone Vargas

    2015-12-01

    Full Text Available Acculturation, the subsequent changes that occur in one culture after continuous first hand contact with another culture, impacts the dietary habits and health risks of individuals. This study examines the acculturation, dietary habits and anthropometric measurements in a sample of 210 first generation Filipino American immigrants in New Jersey (NJ. Acculturation was measured using the Short Acculturation Scale for Filipino Americans (ASASFA. Dietary acculturation was measured using the Dietary Acculturation Questionnaire for Filipino Americans (DAQFA and dietary intake was determined using the Block’s Brief Food Frequency Questionnaire (BFFQ. Anthropometric measurements were obtained including weight, height and waist circumference. Acculturation had a significant negative relationship with Filipino Dietary acculturation. Western dietary acculturation was significantly correlated with caloric intake (r(208 = 0.193, p < 0.01, percentage fat intake (r(208 = 0.154, p < 0.05, percentage carbohydrate intake (r(208 = −0.172, p < 0.05, Body Mass Index (BMI (r(208 = 0.216, p < 0.01 and waist circumference (r(208 = 0.161, p < 0.01. There was no significant correlation between Filipino dietary acculturation, dietary intake and anthropometric measurements. The results showed that Filipino American immigrants have increased risks including increased BMI, waist circumference and increased fat intake. Over all, this research highlighted some dietary changes and their effects on dietary intake and health status.

  12. Proverbs in Mexican American Tradition.

    Science.gov (United States)

    Arora, Shirley L.

    1982-01-01

    Examines proverb use among 304 Mexican Americans (aged 16-85) of Los Angeles (California), assembling information on how or where particular proverbs were learned, with whom or what kind of individual their use is associated, the occasions on which they are used, and general attitudes toward the use of proverbs. (LC)

  13. American Akicita: Indigenous American warriors and military service.

    Science.gov (United States)

    McDonald, J Douglas

    2017-08-01

    Indigenous Americans (i.e., Native/American Indians, AK natives, Pacific Islanders) have consistently volunteered for military service at greater rates than any other ethnic group, including the majority culture, since the early days of the country. This article is an introduction to the special section which includes a number of outstanding papers that provide an innovative and compelling effort to overcome the challenges of casualties from war and render effective and culturally informed care. These manuscripts describe culturally appropriate considerations of suicide (O'Keefe), family involvement and access to care (Whealin), and telehealth for treatment of rural Native veterans (Goss). Challenging and complex treatment needs call for equally mindful and competent approaches. These authors and providers present compelling examples of addressing these needs in working with our Wounded Warriors. (PsycINFO Database Record (c) 2017 APA, all rights reserved).

  14. Asian American Education: Identities, Racial Issues, and Languages. Research on the Education of Asian Pacific Americans

    Science.gov (United States)

    Rong, Xue Lan, Ed.; Endo, Russell, Ed.

    2011-01-01

    Asian American Education--Asian American Identities, Racial Issues, and Languages presents groundbreaking research that critically challenges the invisibility, stereotyping, and common misunderstandings of Asian Americans by disrupting "customary" discourse and disputing "familiar" knowledge. The chapters in this anthology…

  15. 75 FR 49484 - Office of Postsecondary Education; Asian American and Native American Pacific Islander-Serving...

    Science.gov (United States)

    2010-08-13

    ... DEPARTMENT OF EDUCATION Office of Postsecondary Education; Asian American and Native American Pacific Islander-Serving Institutions (AANAPISI), Native American-Serving Nontribal Institutions (NASNTI), Hispanic Serving Institutions-STEM and Articulation (HSI-STEM), and Predominantly Black Institutions (PBI...

  16. American Indian Education Opportunities Program. Supplement 9

    Science.gov (United States)

    Molin, Paulette F.

    1997-01-01

    Activities of the American Indian Educational Opportunities Program (AIEOP) at Hampton University for this reporting period included the establishment of a student chapter of the American Indian Science & Engineering Society (AISES), a move to new office space, hosting events on campus for visiting students from the American Indian Education Program of Oxon Hill, Maryland and Onondaga Community College in Syracuse, New York, collaboration with the Multicultural Leadership Team at NASA Langley Research Center for a Native American elder to serve as a speaker, participation in Native American conferences and other events, and continuing efforts to recruit and retain American Indian students.

  17. Polydactyly in the American Indian.

    Science.gov (United States)

    Bingle, G J; Niswander, J D

    1975-01-01

    Polydactyly has an incidence in the American Indian twice that of Caucasians. A minimum estimate of this incidence is 2.40 per 1,000 live births. Preaxial type 1 has an incidence three to four times that reported for Caucasians or Negroes. The overall sex ratio in Indians is distorted with more males affected than females. The preaxial type 1 anomaly has a strong predilection for the hands and always is unilateral in contrast to postaxial type B where more than one-half are bilateral. The evidence to date, consisting of varying incidences of specific types of polydactyly among American whites, Negroes, and Indians in varying enviroments, suggests different gene-frequencies for polydactyly in each population. The incidence in Indians with 50% Caucasian admixture suggests that the factors controlling polydactyly are in large part genetically determined. Family studies and twin studies reported elsewhere offer no clear-cut genetic model which explains the highly variable gene frequencies.

  18. Cognitive Skill, Skill Demands of Jobs, and Earnings among Young European American, African American, and Mexican American Workers.

    Science.gov (United States)

    Farkas, George; And Others

    1997-01-01

    Analyses of National Longitudinal Survey data indicate that cognitive skill level affects access to high-skill occupations and earnings. Lower cognitive skill levels for African Americans and U.S.-born Mexican Americans explain a substantial proportion of income differences between these groups and European Americans but not the gender gap in pay…

  19. Parental Attachment, Self-Esteem, and Antisocial Behaviors among African American, European American, and Mexican American Adolescents.

    Science.gov (United States)

    Arbona, Consuelo; Power, Thomas G.

    2003-01-01

    Examines the relation of mother and father attachment to self-esteem and self-reported involvement in antisocial behaviors among African American, European American, and Mexican American high school students. Findings indicated that adolescents from the 3 ethnic/racial groups did not differ greatly in their reported attachment. (Contains 70…

  20. Perpetual American options within CTRWs

    Science.gov (United States)

    Montero, Miquel

    2008-06-01

    Continuous-time random walks are a well suited tool for the description of market behaviour at the smallest scale: the tick-to-tick evolution. We will apply this kind of market model to the valuation of perpetual American options: derivatives with no maturity that can be exercised at any time. Our approach leads to option prices that fulfill financial formulas when canonical assumptions on the dynamics governing the process are made, but it is still suitable for more exotic market conditions.

  1. Perpetual American options within CTRW's

    OpenAIRE

    Montero, Miquel

    2007-01-01

    Continuous-time random walks are a well suited tool for the description of market behaviour at the smallest scale: the tick-to-tick evolution. We will apply this kind of market model to the valuation of perpetual American options: derivatives with no maturity that can be exercised at any time. Our approach leads to option prices that fulfil financial formulas when canonical assumptions on the dynamics governing the process are made, but it is still suitable for more exotic market conditions.

  2. Destabilizing the American Racial Order

    OpenAIRE

    Hochschild, Jennifer L.; Weaver, Vesla; Burch, Traci

    2011-01-01

    Are racial disparities in the United States just as deep-rooted as they were before the 2008 presidential election, largely eliminated, or persistent but on the decline? One can easily find all of these pronouncements; rather than trying to adjudicate among them, this essay seeks to identify what is changing in the American racial order, what persists or is becoming even more entrenched, and what is likely to affect the balance between change and continuity. The authors focus on young America...

  3. The incunabula of American optometry.

    Science.gov (United States)

    Aitken, Michael J

    2012-04-01

    Only a very few American opticians (optometrists) wrote textbooks or manuals before the end of the 19th century. The important hand-book by William Bohne has already been excellently covered by David Goss but three others appear to have been largely unnoticed. These are manuals by Walter Alden, August Morck and J W Queen & Co.: pioneer works that can be regarded as the incunabula or cradle of printing of optometric publishing in the United States.

  4. American Psychological Association annual report.

    Science.gov (United States)

    2010-01-01

    Presents the 2009 American Psychological Association annual report. It highlights a very important year for APA and psychology by summarizing activities within each directorate. It describes strides made toward the goal of infusing psychology into the health care marketplace and of bringing psychology-and the unique skills of psychologists-to the attention of the public. This report aims to give insight into the contributions psychologists make to our communities and our country. 2010 APA, all rights reserved.

  5. Understanding American Identity: An Introduction

    Science.gov (United States)

    2017-12-01

    this leads to is, how can we begin this transformation ? D. HOW TO GET THERE: PATRIOTIC BUILDING BLOCKS 1. Civic Education Many have argued that civic... transformation of the U.S. public education system and writes, “High schools brought young people together into an adolescent world that helped to obscure...Revamped civic education and national service programs can serve to form those cross-cutting ties. 14. SUBJECT TERMS American identity, national identity

  6. Marks in Latin-American radiology

    International Nuclear Information System (INIS)

    Souza Almeida, S. de.

    1987-01-01

    An historical retrospective of Latin-American radiology is shortly presented. Several radiologic societies as well as personalities, scientists and doctors are reported emphasizing their contribuition to radiologic Latin-American culture. (M.A.C.) [pt

  7. American Academy of Dental Sleep Medicine

    Science.gov (United States)

    ... New Research AADSM Highlights Members More news... Dental Sleep Medicine: An area of dental practice that focuses on ... SomnoMed Silver Sponsors Copyright © American Academy of Dental Sleep Medicine, All Rights Reserved. American Academy of Dental Sleep ...

  8. Early Education for Asian American Children.

    Science.gov (United States)

    Kitano, Margie K.

    1980-01-01

    A review of early education for Asian American children (Japanese, Chinese, Filipinos, Vietnamese, Koreans, Hawaiians, and Samoans) focuses on the 1975 Asian American Education Project, a study of the learning characteristics of preschool age children and its educational implications. (CM)

  9. African Americans and High Blood Pressure

    Science.gov (United States)

    ANSWERS by heart Lifestyle + Risk Reduction High Blood Pressure What About African Americans and High Blood Pressure? African Americans in the U.S. have a higher prevalence of high blood pressure (HBP) than ...

  10. Fetal Alcohol Spectrum Disorders among Native Americans

    Science.gov (United States)

    ... A MERICANS Native American cultures, which encompass American Indian, Alaska Native and Native Hawaiian tribes, are rich with history, tradition, spirituality, and art. There are 562 Federally recognized tribes across the ...

  11. American Board of Obesity Medicine (ABOM)

    Science.gov (United States)

    ... not trained in how to manage it. The American Board of Obesity Medicine certifies physicians looking to bridge this gap. ... an ABOM diplomate. APPLY NOW OUR MISSION The American Board of Obesity Medicine (ABOM) serves the public and the field ...

  12. American Association for Marriage and Family Therapy

    Science.gov (United States)

    ... My Account Find Members Benefits American Association for Marriage and Family Therapy 112 South Alfred Street Alexandria, ... Fax: (703) 838-9805 © 2002 - American Association for Marriage and Family Therapy Terms of Use | Privacy Policy | ...

  13. THE DEPICTION OF HOMOSEXUALITY IN AMERICAN MOVIES

    OpenAIRE

    Rudy Rudy

    2016-01-01

    This study focuses on the depiction of homosexuality in American films. It is intended to identify the images of gays depicted in American films as well as the characteristics of American gay movies. It incorporates library research by applying an analytical descriptive approach in analyzing the data. The symbol and reflective theory is used to analyze 18 American movies and 14 gay films from other countries in the early 2000s. It shows that gay films can attract audiences by describing gays ...

  14. The Depiction Of Homosexuality In American Movies

    OpenAIRE

    Rudy, Rudy

    2016-01-01

    This study focuses on the depiction of homosexuality in American films. It is intended to identify the images of gays depicted in American films as well as the characteristics of American gay movies. It incorporates library research by applying an analytical descriptive approach in analyzing the data. The symbol and reflective theory is used to analyze 18 American movies and 14 gay films from other countries in the early 2000s. It shows that gay films can attract audiences by describing gays ...

  15. Understanding the Strengths of African American Families.

    Science.gov (United States)

    Littlejohn-Blake, Sheila M.; Darling, Carol Anderson

    1993-01-01

    Focuses on strengths of African-American families and how they function, relevant conceptual approaches, and trends and issues in studying African-American families that can facilitate understanding. A shift from studying dysfunctional families to more positive aspects can help African-American families meet societal challenges. (SLD)

  16. The Black Man in American Society.

    Science.gov (United States)

    Framingham Public Schools, MA.

    GRADE OR AGES: Junior high school. SUBJECT MATTER: The black man in American society. ORGANIZATION AND PHYSICAL APPEARANCE: There are four major parts each with an overview. The four parts concern a) the African heritage of the black man, b) the American exploitation of the black man, c) the black man's contribution to American society, d) the…

  17. Engaging African Americans in Smoking Cessation Programs

    Science.gov (United States)

    Wallen, Jacqueline; Randolph, Suzanne; Carter-Pokras, Olivia; Feldman, Robert; Kanamori-Nishimura, Mariano

    2014-01-01

    Background: African Americans are disproportionately exposed to and targeted by prosmoking advertisements, particularly menthol cigarette ads. Though African Americans begin smoking later than whites, they are less likely to quit smoking than whites. Purpose: This study was designed to explore African American smoking cessation attitudes,…

  18. Nostalgia and Educational History: An American Image

    Science.gov (United States)

    Rousmaniere, Kate

    2017-01-01

    This essay examines the way in which nostalgia informs the 1953 painting of a school setting by the popular American artist Norman Rockwell. "The Girl with Black Eye", the cover image of the American popular magazine "The Saturday Evening Post" on 23 May 1953, draws on traditional American iconography of the disciplining of…

  19. American Psychology "Is" Becoming More International

    Science.gov (United States)

    Webster, Gregory D.; Nichols, Austin Lee; Schember, Tatiana Orozco

    2009-01-01

    Comments on an article by J. J. Arnett regarding the assertion that American psychology focuses too narrowly on Americans while neglecting the other 95% of the world's population. The authors argue that while Arnett's assessment was poignant, and his call for a more inclusive, international, and cross-cultural representation in American psychology…

  20. Student Communities and Individualism in American Cinema

    Science.gov (United States)

    Warnick, Bryan R.; Dawson, Heather S.; Smith, D. Spencer; Vosburg-Bluem, Bethany

    2010-01-01

    Hollywood films partially construct how Americans think about education. Recent work on the representation of schools in American cinema has highlighted the role of class difference in shaping school film genres. It has also advanced the idea that a nuanced understanding of American individualism helps to explain why the different class genres are…

  1. Asian American Giving to US Higher Education

    Science.gov (United States)

    Tsunoda, Kozue

    2010-01-01

    Asian Americans have had significant impacts on and within mainstream US society, and their great efforts and gifts in the name of charitable causes are no exception. This study aims to examine perceptions within American university development offices about Asian American giving to US higher education. The article begins with a literature review…

  2. American Jazz Cathedra Enters into Beijing

    Institute of Scientific and Technical Information of China (English)

    2003-01-01

    <正> On the evening of 25 June, 2003, an American Music Cathedra was held in the In ternational Friendship Hall of Beijing Jintai Art Museum. And its theme is "a form of American Art-Jazz". The Economic Department, Press Department of American Embassy and Beijing Jueshi Culture Development Co.Ltd. sponsored the activity.

  3. Ethnic differences in inter- and intra-situational blood pressure variation: Comparisons among African-American, Hispanic-American, Asian-American, and European-American women.

    Science.gov (United States)

    James, Gary D; Bovbjerg, Dana H; Hill, Leah A

    2016-11-01

    The purpose of this study was to compare the daily inter- and intra-situational ambulatory blood pressure (BP) variation by ethnicity in women. The African-American (N = 82; Age = 39.7 + 8.9), Hispanic-American (N = 25; age = 37.5 + 9.4), Asian-American (N = 22; Age = 35.2 + 8.6), and European-American (N = 122; Age = 37.2+ 9.4) women in this study all worked in similar positions at two major medical centers in NYC. Each wore an ambulatory monitor during the course of one mid-week workday. Proportional BP changes from work or home to sleep, intra-situational BP variation (standard deviation [SD]) and mean situational BP levels were compared among the groups using ANOVA models. African-American and Asian-American women had significantly smaller proportional work-sleep systolic changes than either European- (P women, but the Asian-American women's changes tended to be smallest. The variability (SD) of diastolic BP at work was significantly greater among African- and Hispanic-American women compared to Asian- and European-American women (all P women had greater sleep variability than European-American women (P Asian-American women had the highest level of sleep diastolic pressure (all comparisons P Asian-American women have an attenuated proportional BP decline from waking environments to sleep compared to European-American and Hispanic-American women. Asian-American nocturnal BP may be elevated relative to all other groups. Am. J. Hum. Biol. 28:932-935, 2016. © 2016Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  4. 77 FR 9273 - USEC Inc. (American Centrifuge Lead Cascade Facility and American Centrifuge Plant); Direct...

    Science.gov (United States)

    2012-02-16

    ... NUCLEAR REGULATORY COMMISSION [NRC-2010-0355] USEC Inc. (American Centrifuge Lead Cascade Facility and American Centrifuge Plant); Direct Transfer of Licenses In the Matter of USEC INC. (American Centrifuge Lead Cascade Facility and American Centrifuge Plant); Order EA-12- [[Page 9274

  5. A psychometric revision of the European American Values Scale for Asian Americans using the Rasch model

    OpenAIRE

    Hong, S; Kim, Bryan S.K.; Wolfe, M M

    2005-01-01

    The 18-item European American Values Scale for Asian Americans (M. M. Wolfe, P H. Yang, E C. Wong, & D. R. Atkinson, 2001) was revised on the basis of results from a psychometric analysis using the Rasch Model (G. Rasch,1960). The results led to the establishment of the 25-item European AmericanValues Scale for Asian Americans-Revised.

  6. Mothers' Self-Reported Emotional Expression in Mainland Chinese, Chinese American and European American Families

    Science.gov (United States)

    Camras, Linda; Kolmodin, Karen; Chen, Yinghe

    2008-01-01

    This study compared Mainland Chinese, Chinese American and European American mothers' self-reported emotional expression within the family. Mothers of 3-year-old European American (n = 40), Chinese American (n = 39) and Mainland Chinese (n = 36) children (n = 20 girls per group) completed the Self-Expressiveness in the Family Questionnaire (SEFQ),…

  7. Chinese American and Caucasian American Family Interaction Patterns in Spatial Rotation Puzzle Solutions.

    Science.gov (United States)

    Hutsinger, Carol S.; Jose, Paul E.

    1995-01-01

    Examined sociocultural influences on mathematics achievement. First generation Chinese American and Caucasian American mother-father-daughter triads were audiotaped as the fifth- and sixth-grade girls solved a spatial puzzle. Chinese American triads were quieter, more respectful, more serious, and more orderly, whereas Caucasian American triads…

  8. 75 FR 10246 - Nationwide Categorical Waivers Under Section 1605 (Buy American) of the American Recovery and...

    Science.gov (United States)

    2010-03-05

    ... Waivers Under Section 1605 (Buy American) of the American Recovery and Reinvestment Act of 2009 (Recovery... nationwide categorical waivers of the Buy American requirements of the American Recovery and Reinvestment Act... domestic manufacturers for these products. This strategy will ensure that all future determinations of...

  9. 77 FR 17456 - Buy American Exception Under the American Recovery and Reinvestment Act of 2009

    Science.gov (United States)

    2012-03-26

    ...-2138-01] Buy American Exception Under the American Recovery and Reinvestment Act of 2009 AGENCY... exception to the Buy American Provisions of the American Recovery and Reinvestment Act of 2009 (ARRA or... future years on electricity. The contract specifications required that all exterior photovoltaic...

  10. Perpetual Cancellable American Call Option

    OpenAIRE

    Emmerling, Thomas J.

    2010-01-01

    This paper examines the valuation of a generalized American-style option known as a Game-style call option in an infinite time horizon setting. The specifications of this contract allow the writer to terminate the call option at any point in time for a fixed penalty amount paid directly to the holder. Valuation of a perpetual Game-style put option was addressed by Kyprianou (2004) in a Black-Scholes setting on a non-dividend paying asset. Here, we undertake a similar analysis for the perpetua...

  11. North American Natural Gas Markets

    Energy Technology Data Exchange (ETDEWEB)

    1988-12-01

    This report sunnnarizes the research by an Energy Modeling Forum working group on the evolution of the North American natural gas markets between now and 2010. The group's findings are based partly on the results of a set of economic models of the natural gas industry that were run for four scenarios representing significantly different conditions: two oil price scenarios (upper and lower), a smaller total US resource base (low US resource case), and increased potential gas demand for electric generation (high US demand case). Several issues, such as the direction of regulatory policy and the size of the gas resource base, were analyzed separately without the use of models.

  12. Taxation and the American Revolution

    Directory of Open Access Journals (Sweden)

    John Passant

    2017-09-01

    Full Text Available This article looks at the interrelationship between revolution and tax in the context of the American Revolution. It examines the role of ordinary people in demanding, among other things, as part of wider demands for democracy and equality, no taxation without representation. The article aims to reintroduce the neglected notions of class and class struggle into current discussions and debates about tax and history, putting the people back into academic narratives about the history of taxation and to their place as political actors on history’s stage.

  13. Space and the American imagination

    Science.gov (United States)

    Mccurdy, Howard E.

    1994-01-01

    The introduction will set out the principal theme of the book: that the rise of the U.S. space program was due to a concerted effort by science writers, engineers, industrialists, and civic and political leaders to create a popular culture of space exploration based on important elements of American social life (such as frontier mythology, fears about the cold war, and the rise of the consumer culture). Much of the disillusionment with the NASA space program which set in during the third decade of space flight can be traced to a widening gap between popular expectations and the reality of space exploration.

  14. North American Natural Gas Markets

    International Nuclear Information System (INIS)

    1989-02-01

    This report summarizes die research by an Energy Modeling Forum working group on the evolution of the North American natural gas markets between now and 2010. The group's findings are based partly on the results of a set of economic models of the natural gas industry that were run for four scenarios representing significantly different conditions: two oil price scenarios (upper and lower), a smaller total US resource base (low US resource case), and increased potential gas demand for electric generation (high US demand case). Several issues, such as the direction of regulatory policy and the size of the gas resource base, were analyzed separately without the use of models

  15. Redeeming American democracy in Sayonara

    Directory of Open Access Journals (Sweden)

    María Isabel Seguro

    2011-03-01

    Full Text Available Affection is perceived as something natural, pre-existing Culture and, therefore, free form discursive constructions. However, insofar as reality is mediated, if not given existence by language, human relationships are inevitably fashioned by narratives. Romance fictions and in particular heterosexual, interracial love stories have been used in U.S. popular culture as a means of promoting American democratic values of racial harmony at home and abroad. This will be exemplified by analyzing James A. Michener’s 1953 novel Sayonara together with Joshua Logan’s 1957 film adaptation.

  16. American cutaneous leishmaniasis triggered byelectrocoagulation

    Directory of Open Access Journals (Sweden)

    Sofia Sales Martins

    Full Text Available Abstract Cutaneous leishmaniasis is usually transmitted by infected phlebotomine sand fly bites that initiate local cutaneous lesions. Few reports in the literature describe other modes of transmission. We report a case of a previously healthy 59-year-old woman who underwent electrocoagulation to remove seborrheic keratosis confirmed by dermatoscopy. Three months later, a skin fragment tested positive for Leishmania culture; the parasite was identified as L. (V. braziliensis. Trauma may generate inflammatory cascades that favor Leishmania growth and lesion formation in previously infected patients. American cutaneous leishmaniasis is a dynamic disease with unclear pathophysiology because of continually changing environments, demographics, and human behaviors.

  17. North American Natural Gas Markets

    International Nuclear Information System (INIS)

    1988-12-01

    This report sunnnarizes the research by an Energy Modeling Forum working group on the evolution of the North American natural gas markets between now and 2010. The group's findings are based partly on the results of a set of economic models of the natural gas industry that were run for four scenarios representing significantly different conditions: two oil price scenarios (upper and lower), a smaller total US resource base (low US resource case), and increased potential gas demand for electric generation (high US demand case). Several issues, such as the direction of regulatory policy and the size of the gas resource base, were analyzed separately without the use of models

  18. North American Natural Gas Markets

    Energy Technology Data Exchange (ETDEWEB)

    1989-02-01

    This report summarizes die research by an Energy Modeling Forum working group on the evolution of the North American natural gas markets between now and 2010. The group's findings are based partly on the results of a set of economic models of the natural gas industry that were run for four scenarios representing significantly different conditions: two oil price scenarios (upper and lower), a smaller total US resource base (low US resource case), and increased potential gas demand for electric generation (high US demand case). Several issues, such as the direction of regulatory policy and the size of the gas resource base, were analyzed separately without the use of models.

  19. Health care expenditures among Asian American subgroups.

    Science.gov (United States)

    Chen, Jie; Vargas-Bustamante, Arturo; Ortega, Alexander N

    2013-06-01

    Using two nationally representative data sets, this study examined health care expenditure disparities between Caucasians and different Asian American subgroups. Multivariate analyses demonstrate that Asian Americans, as a group, have significantly lower total expenditures compared with Caucasians. Results also point to considerable heterogeneities in health care spending within Asian American subgroups. Findings suggest that language assistance programs would be effective in reducing disparities among Caucasians and Asian American subgroups with the exception of Indians and Filipinos, who tend to be more proficient in English. Results also indicate that citizenship and nativity were major factors associated with expenditure disparities. Socioeconomic status, however, could not explain expenditure disparities. Results also show that Asian Americans have lower physician and pharmaceutical costs but not emergency department or hospital expenditures. These findings suggest the need for culturally competent policies specific to Asian American subgroups and the necessity to encourage cost-effective treatments among Asian Americans.

  20. History of Latin American Archaeology

    Directory of Open Access Journals (Sweden)

    David L. Browman

    1995-11-01

    Full Text Available Two recent contributions (Oyuela-Caycedo 1994 and Politis 1995 to analyses of the intellectual development of archaeology in Latin America provide us with new perspectives. A theme shared by both is the perception by the authors of a need to distance the development of archaeology in Latin American countries from the overweening influence of Europe and especially U. S. archaeologists. Politis argues that U.S. influence has been tantamount to 'cultural imperialism' (1995:226. He sees U.S. archaeologists as having a history of appropriating and manipulating the knowledge of the past which ignores the local peoples own traditional perceptions of their patrimony, and argues that the U.S. perspective is designed to satisfy the needs of western scholarship but fails to enter a dialog with the legitimate concerns of the subject countries. Oyuela·Caycedo's introductory essay in his book "Nationalism and Archaeology" carries a very similar message. He faults U.S. archaeologists for failing to locate their studies in the areas social and local context, which he sees as leading the U.S. scholars to employ a model derived from "dependency theory" (1994:5, resulting in an overly simplistic perception of the context for the development of archaeological disciplines in respective Latin American countries.

  1. Smoking behavior in pregnant Arab Americans.

    Science.gov (United States)

    Kulwicki, Anahid; Smiley, Karen; Devine, Susan

    2007-01-01

    To determine the smoking behavior in pregnant Arab American women who attended a Women, Infant and Children (WIC) program at a local county public health clinic and compare the incidence of smoking behaviors of pregnant Arab American women with pregnant women who were not Arab Americans. Data were extracted from a computer database that contained information from health history charts of pregnant Arab and non-Arab American women. The study sample was 830 women, 823 of whom were Arab American participants enrolled in the WIC program in Michigan. Approximately 6% of pregnant Arab Americans smoked during pregnancy. The prevalence of smoking behavior among pregnant Arab American women was similar to that of smoking behaviors of Hispanics and Asian Americans in the United States. Although smoking behavior is a serious problem among Arab American immigrants in general and in the Arab world in particular, cultural factors that support healthy behavior during pregnancy in the Arab culture seem to limit the use of tobacco in pregnant women. Nurses who care for Arab American pregnant women can use this information to better inform their care of these patients.

  2. Perceived value in food selection when dining out: comparison of African Americans and Euro-Americans.

    Science.gov (United States)

    Vinci, Debra M; Philipp, Steven F

    2007-06-01

    This descriptive study compares African Americans' and Euro-Americans' perceived value of food selection pertaining to cost, portion size, and meal satisfaction when eating away from home. A stratified sample was drawn from a southern U.S. metropolitan area (N= 1,011; 486 African American, 525 Euro-American). Analysis showed no difference between African-American and Euro-American adults by sex or how often they dined out. These two groups significantly differed across years of education, age, and answering 14 of 18 rated statements on value perceptions. African-Americans' value perceptions were influenced more by lower cost foods and larger portion sizes than those of Euro-Americans. For meal satisfaction, African Americans were more likely to agree with statements that indicate preferring foods high in energy and low in essential micronutrient density. This study supports the need for more investigation.

  3. Horizontal and vertical dimensions of individualism-collectivism: a comparison of African Americans and European Americans.

    Science.gov (United States)

    Komarraju, Meera; Cokley, Kevin O

    2008-10-01

    The current study examined ethnic differences in horizontal and vertical dimensions of individualism and collectivism among 96 African American and 149 European American college students. Participants completed the 32-item Singelis et al. (1995) Individualism/Collectivism Scale. Multivariate analyses of variance results yielded a main effect for ethnicity, with African Americans being significantly higher on horizontal individualism and European Americans being higher on horizontal collectivism and vertical individualism. A moderated multiple regression analysis indicated that ethnicity significantly moderated the relationship between individualism and collectivism. Individualism and collectivism were significantly and positively associated among African Americans, but not associated among European Americans. In addition, collectivism was related to grade point average for African Americans but not for European Americans. Contrary to the prevailing view of individualism-collectivism being unipolar, orthogonal dimensions, results provide support for individualism-collectivism to be considered as unipolar, related dimensions for African Americans.

  4. Asian and European American cultural values and communication styles among Asian American and European American college students.

    Science.gov (United States)

    Park, Yong S; Kim, Bryan S K

    2008-01-01

    The present study examined the relationships between adherence to Asian and European cultural values and communication styles among 210 Asian American and 136 European American college students. A principal components analysis revealed that, for both Asian Americans and European Americans, the contentious, dramatic, precise, and open styles loaded onto the first component suggesting low context communication, and interpersonal sensitivity and inferring meaning styles loaded onto the second component suggesting high context communication. Higher adherence to emotional self-control and lower adherence to European American values explained Asian Americans' higher use of the indirect communication, while higher emotional self-control explained why Asian Americans use a less open communication style than their European American counterparts. When differences between sex and race were controlled, adherence to humility was inversely related to contentious and dramatic communication styles but directly related to inferring meaning style, adherence to European American values was positively associated with precise communication and inferring meaning styles, and collectivism was positively related to interpersonal sensitivity style. 2008 APA

  5. Experiences and perspectives of African American, Latina/o, Asian American, and European American psychology graduate students: A national study.

    Science.gov (United States)

    Maton, Kenneth I; Wimms, Harriette E; Grant, Sheila K; Wittig, Michele A; Rogers, Margaret R; Vasquez, Melba J T

    2011-01-01

    A national, Web-based survey of 1,219 African American, Latina/o, Asian American, and European American psychology graduate students revealed both similarities and differences in experiences and perspectives. Mentoring was found to be the strongest predictor of satisfaction across groups. Academic supports and barriers, along with perceptions of diversity within the academic environment, were also important predictors of satisfaction. Students of color perceived less fairness of representation of their ethnic group within psychology than European American students, and a greater linkage between aspects of the graduate school experience and their ethnicity. Limitations of the study and implications for future research and action are discussed.

  6. The Absence of Structural Americanization

    DEFF Research Database (Denmark)

    Nielsen, Rasmus Kleis

    2013-01-01

    . Theoretically, economic and technological forces were expected to drive convergence. The article suggests that the reason these forces have not driven convergence in recent years may be that the interplay between them have changed as part of a broader shift from the mass media, mass production, and mass markets......Several comparative media researchers have hypothesized that the media systems of affluent Western democracies are becoming more and more structurally homogeneous—that they are becoming “Americanized.” This article uses data on newspaper industry revenues, commercial television revenues, Internet...... characteristic of twentieth-century Western societies and toward the fragmented media landscapes, tailored production, and niche marketing increasingly characteristic of early-twenty-first century affluent democracies....

  7. An American hibakusha in Fukushima.

    Science.gov (United States)

    Nollet, Kenneth E

    2011-01-01

    A magnitude 9.0 earthquake and tsunami originating off the east coast of Japan triggered the explosive release of radioactive isotopes from one of four nuclear power plants in the affected area. This event has been compared with the 1986 nuclear accident at Chernobyl, the 1945 atomic bombing of Hiroshima and Nagasaki, and the intervening era of atmospheric nuclear weapons testing. The credibility of any comparison depends on the source, for which reason various specialists were invited to address an audience of media, healthcare, and disaster response professionals on July 18, 2011 in Fukushima City, Fukushima Prefecture. This article is based on a presentation given July 18, and interprets the Fukushima nuclear crisis from the perspective of an American doctor who grew up downwind of an atomic bomb test site, and who now works at Fukushima Medical University.

  8. Occupationally Acquired American Cutaneous Leishmaniasis

    Directory of Open Access Journals (Sweden)

    Maria Edileuza Felinto de Brito

    2012-01-01

    Full Text Available We report two occupationally acquired cases of American cutaneous leishmaniasis (ACL: one accidental laboratory autoinoculation by contaminated needlestick while handling an ACL lesion sample, and one acquired during field studies on bird biology. Polymerase chain reaction (PCR assays of patient lesions were positive for Leishmania, subgenus Viannia. One isolate was obtained by culture (from patient 2 biopsy samples and characterized as Leishmania (Viannia naiffi through an indirect immunofluorescence assay (IFA with species-specific monoclonal antibodies (mAbs and by multilocus enzyme electrophoresis (MLEE. Patients were successfully treated with N-methyl-glucamine. These two cases highlight the potential risks of laboratory and field work and the need to comply with strict biosafety procedures in daily routines. The swab collection method, coupled with PCR detection, has greatly improved ACL laboratory diagnosis.

  9. Grid for Meso american Archaeology

    International Nuclear Information System (INIS)

    Lucet, G.

    2007-01-01

    Meso american archaeology works with large amounts of disperse and diverse information, thus the importance of including new methods that optimise the acquisition, conservation, retrieval, and analysis of data to generate knowledge more efficiently and create a better understanding of history. Further, this information --which includes texts, coordinates, raster graphs, and vector graphs-- comes from a considerable geographical area --parts of Mexico, Nicaragua, Honduras and Costa Rica as well as Guatemala, El Salvador and Belize-- is constantly expanding. This information includes elements like shards, buildings, mural paintings, high and low reliefs, topography, maps, and information about the fauna and soil. Grid computing offers a solution to handle all this information: it respects researchers' need for independence while supplying a platform to share, process and compare the data obtained. Additionally, the Grid can enhance space-time analyses with remote visualisation techniques that can, in turn, incorporate geographical information systems and virtual reality. (Author)

  10. THE DEPICTION OF HOMOSEXUALITY IN AMERICAN MOVIES

    Directory of Open Access Journals (Sweden)

    Rudy Rudy

    2016-06-01

    Full Text Available This study focuses on the depiction of homosexuality in American films. It is intended to identify the images of gays depicted in American films as well as the characteristics of American gay movies. It incorporates library research by applying an analytical descriptive approach in analyzing the data. The symbol and reflective theory is used to analyze 18 American movies and 14 gay films from other countries in the early 2000s. It shows that gay films can attract audiences by describing gays as the objects for laughs; gays revealing their sexual identities; sexual scenes of gays; masculine gay men; and violence in gay life. They appear in genres like drama, comedy, romance, detective, western, and horror/mystery with two images of gay people shown in American gay movies; they are the portrait of gays as a minority and the pessimism. However, it also shows that some American gay films picture good gay life, happy gay couples, gay marriage, etc.

  11. Suicide among Arab-Americans.

    Directory of Open Access Journals (Sweden)

    Abdulrahman M El-Sayed

    2011-02-01

    Full Text Available Arab-American (AA populations in the US are exposed to discrimination and acculturative stress-two factors that have been associated with higher suicide risk. However, prior work suggests that socially oriented norms and behaviors, which characterize recent immigrant ethnic groups, may be protective against suicide risk. Here we explored suicide rates and their determinants among AAs in Michigan, the state with the largest proportion of AAs in the US.ICD-9/10 underlying cause of death codes were used to identify suicide deaths from among all deaths in Michigan between 1990 and 2007. Data from the 2000 U.S. Census were collected for population denominators. Age-adjusted suicide rates among AAs and non-ethnic whites were calculated by gender using the direct method of standardization. We also stratified by residence inside or outside of Wayne County (WC, the county with the largest AA population in the state. Suicide rates were 25.10 per 100,000 per year among men and 6.40 per 100,000 per year among women in Michigan from 1990 to 2007. AA men had a 51% lower suicide rate and AA women had a 33% lower rate than non-ethnic white men and women, respectively. The suicide rate among AA men in WC was 29% lower than in all other counties, while the rate among AA women in WC was 20% lower than in all other counties. Among non-ethnic whites, the suicide rate in WC was higher compared to all other counties among both men (12% and women (16%.Suicide rates were higher among non-ethnic white men and women compared to AA men and women in both contexts. Arab ethnicity may protect against suicide in both sexes, but more so among men. Additionally, ethnic density may protect against suicide among Arab-Americans.

  12. Diabetes in Hispanic American Youth

    Science.gov (United States)

    Lawrence, Jean M.; Mayer-Davis, Elizabeth J.; Reynolds, Kristi; Beyer, Jennifer; Pettitt, David J.; D'Agostino, Ralph B.; Marcovina, Santica M.; Imperatore, Giuseppina; Hamman, Richard F.

    2009-01-01

    OBJECTIVE—To report the 2001 prevalence and 2002–2005 incidence of type 1 and type 2 diabetes in Hispanic American youth and to describe the demographic, clinical, and behavioral characteristics of these youth. RESEARCH DESIGN AND METHODS—Data from the SEARCH for Diabetes in Youth Study, a population-based multicenter observational study of youth aged 0–19 years with physician-diagnosed diabetes, were used to estimate the prevalence and incidence of type 1 and type 2 diabetes. Information obtained by questionnaire, physical examination, and blood and urine collection was analyzed to describe the characteristics of youth who completed a study visit. RESULTS—Among Hispanic American youth, type 1 diabetes was more prevalent than type 2 diabetes, including in youth aged 10–19 years. There were no significant sex differences in type 1 or type 2 diabetes prevalence. The incidence of type 2 diabetes for female subjects aged 10–14 years was twice that of male subjects (P < 0.005), while among youth aged 15–19 years the incidence of type 2 diabetes exceeded that of type 1 diabetes for female subjects (P < 0.05) but not for male subjects. Poor glycemic control, defined as A1C ≥9.5%, as well as high LDL cholesterol and triglycerides were common among youth aged ≥15 years with either type of diabetes. Forty-four percent of youth with type 1 diabetes were overweight or obese. CONCLUSIONS—Factors such as poor glycemic control, elevated lipids, and a high prevalence of overweight and obesity may put Hispanic youth with type 1 and type 2 diabetes at risk for future diabetes-related complications. PMID:19246577

  13. Suicide among Arab-Americans.

    Science.gov (United States)

    El-Sayed, Abdulrahman M; Tracy, Melissa; Scarborough, Peter; Galea, Sandro

    2011-02-17

    Arab-American (AA) populations in the US are exposed to discrimination and acculturative stress-two factors that have been associated with higher suicide risk. However, prior work suggests that socially oriented norms and behaviors, which characterize recent immigrant ethnic groups, may be protective against suicide risk. Here we explored suicide rates and their determinants among AAs in Michigan, the state with the largest proportion of AAs in the US. ICD-9/10 underlying cause of death codes were used to identify suicide deaths from among all deaths in Michigan between 1990 and 2007. Data from the 2000 U.S. Census were collected for population denominators. Age-adjusted suicide rates among AAs and non-ethnic whites were calculated by gender using the direct method of standardization. We also stratified by residence inside or outside of Wayne County (WC), the county with the largest AA population in the state. Suicide rates were 25.10 per 100,000 per year among men and 6.40 per 100,000 per year among women in Michigan from 1990 to 2007. AA men had a 51% lower suicide rate and AA women had a 33% lower rate than non-ethnic white men and women, respectively. The suicide rate among AA men in WC was 29% lower than in all other counties, while the rate among AA women in WC was 20% lower than in all other counties. Among non-ethnic whites, the suicide rate in WC was higher compared to all other counties among both men (12%) and women (16%). Suicide rates were higher among non-ethnic white men and women compared to AA men and women in both contexts. Arab ethnicity may protect against suicide in both sexes, but more so among men. Additionally, ethnic density may protect against suicide among Arab-Americans.

  14. The Contributions of Immigrants to American Culture

    OpenAIRE

    Hirschman, Charles

    2013-01-01

    The standard account of American immigration focuses on the acculturation and assimilation of immigrants and their children to American society. This analysis typically ignores the significant contributions of immigrants to the creation of American culture through the performing arts, sciences, and other cultural pursuits. Immigrants and their children are not born with more creative talents than native-born citizens, but their selectivity and marginality may have pushed and pulled those with...

  15. HELEN brings Latin Americans to CERN

    CERN Multimedia

    Maximiliem Brice

    2006-01-01

    Latin American students who have arrived at CERN to take up fellowships during the first months of 2006 relax in front of the LHC collaboration buildings, together with the deputy coordinator of HELEN, Veronica Riquer (centre), from Rome University and INFN. The training programme supported by the High Energy Physics Latin American- European Network (HELEN) is in full swing. For 2006, the programme has assigned about 70 fellowships to be spent at CERN by Latin American students and young physicists.

  16. CONTEMPORARY CHALLENGES IN LATIN AMERICAN ADMINISTRATIVE JUSTICE

    OpenAIRE

    R. Perlingeiro

    2016-01-01

    This study consists of a critical comparative analysis of the administrative justice systems in eighteen Latin-American signatory countries of the American Convention on Human Rights (Argentina, Bolivia, Brazil, Chile, Colombia, Costa Rica, El Salvador, Ecuador, Guatemala, Honduras, Mexico, Nicaragua, Panama, Paraguay, Peru, the Dominican Republic, Uruguay, and Venezuela). According to this article, the excessive litigation in Latin-American courts that has seriously hampered the effectivenes...

  17. Effects of Alcohol Use and Anti-American Indian Attitudes on Domestic-Violence Culpability Decisions for American Indian and Euro-American Actors

    Science.gov (United States)

    Esqueda, Cynthia Willis; Hack, Lori; Tehee, Melissa

    2010-01-01

    Few studies have focused on the unique issues surrounding American Indian violence. Yet American Indian women are at high risk for domestic abuse, and domestic violence has been identified as the most important issue for American Indians now and in the future by the National Congress of American Indians. American Indian women suffer from domestic…

  18. The Zoogeography of North American freshwater fishes

    National Research Council Canada - National Science Library

    Hocutt, Charles H; Wiley, E. O

    1986-01-01

    ..., and Pleistoscene glaciation. The Zoogeography of North American Freshwater Fishes is a comprehensive treatment of the freshwater biogeography of North America, with implications for other disciplines...

  19. The North American Transborder Freight Database

    Data.gov (United States)

    Department of Transportation — The North American Transborder Freight Database, available since April 1993, contains freight flow data by commodity type and by mode of transportation (rail, truck,...

  20. Asian Americans and European Americans' stigma levels in response to biological and social explanations of depression.

    Science.gov (United States)

    Cheng, Zhen Hadassah

    2015-05-01

    Mental illness stigma is prevalent among Asian Americans, and it is a key barrier that prevents them from seeking psychological services. Limited studies have experimentally examined how Asian Americans respond to biological and social explanations of mental illness. Understanding how to educate and communicate about mental illness effectively is crucial in increasing service utilization among Asian Americans. To assess how genetic, neurobiological, and social explanations for the onset of depression affects Asian American and European American's mental illness stigma. 231 Asian Americans and 206 European Americans read about an individual with major depression and were randomly assigned to be informed that the cause was either genetic, neurobiological, social, or unknown. Various stigma outcomes, including social distance, fear, and depression duration were assessed. Consistent with prior research, Asian Americans had higher baseline levels of stigma compared to European Americans. Greater social essentialist beliefs predicted positive stigma outcomes for Asian Americans, such as a greater willingness to be near, help, and hire someone with depression, but genetic essentialist beliefs predicted negative stigma outcomes, such as fear. In addition, a social explanation for the etiology of depression led to lower stigma outcomes for Asian Americans; it decreased their fear of someone with depression and increased the perception that depression is treatable. For European Americans, both genetic and social essentialist beliefs predicted a greater perception of depression treatability. Although genetics do play a role in the development of depression, emphasizing a social explanation for the origin of depression may help reduce stigma for Asian Americans.

  1. An Official American Thoracic Society/American College of Chest Physicians Clinical Practice Guideline

    DEFF Research Database (Denmark)

    Girard, Timothy D; Alhazzani, Waleed; Kress, John P

    2017-01-01

    BACKGROUND: Interventions that lead to earlier liberation from mechanical ventilation can improve patient outcomes. This guideline, a collaborative effort between the American Thoracic Society (ATS) and the American College of Chest Physicians (CHEST), provides evidence-based recommendations to o...

  2. Heather Switzer named American Association of University Women American Dissertation Fellow

    OpenAIRE

    Chadwick, Heather Riley

    2008-01-01

    Heather Switzer, planning, governance, and globalization doctoral student in the School of Public and International Affairs at Virginia Tech, has been named an American Association of University Women American Dissertation Fellow.

  3. The relationship between momentary emotions and well-being across European Americans, Hispanic Americans, and Asian Americans.

    Science.gov (United States)

    Choi, Eunsoo; Chentsova-Dutton, Yulia E

    2017-09-01

    Cultural differences in the emphasis on positive and negative emotions suggest that the impact of these emotions on well-being may differ across cultural contexts. The present study utilised a momentary sampling method to capture average momentary emotional experiences. We found that for participants from cultural contexts that foster positive emotions (European Americans and Hispanic Americans), average momentary positive emotions predicted well-being better than average momentary negative emotions. In contrast, average momentary negative emotions were more strongly associated with well-being measures for Asian Americans, the group from a cultural context that emphasises monitoring of negative emotions. Furthermore, we found that acculturation to American culture moderated the association between average momentary positive emotions and well-being for Asian Americans. These findings suggest the importance of culture in studying the impact of daily emotional experiences on well-being.

  4. Smoking in contemporary American cinema.

    Science.gov (United States)

    Omidvari, Karan; Lessnau, Klaus; Kim, Jeannie; Mercante, Donald; Weinacker, Ann; Mason, Carol

    2005-08-01

    The true prevalence of smoking among characters portrayed in the movies is unknown. This study examines this prevalence objectively. The top 10 movies on the weekly box office charts were reviewed. Whether or not the top five characters in these movies smoked, was documented. It was determined prior to the start of the study that 300 male characters and 300 female characters were needed to detect any significant difference. A total of 447 movies, composed of 193 movies rated restricted (R) [children < 17 years of age must be accompanied by an adult], 131 movies rated PG13 for parental guidance suggested for children < 13 years of age (PG) and 123 movies rated PG for parental guidance suggested, were examined until the sample size was reached. Smoking prevalence is the same in contemporary American movies and in the general US population (23.3% vs 24.8%, respectively). However, there was more smoking in these movies among men than among women (25.5% vs 20.5%, respectively; p < 0.006), among antagonists than among protagonists (35.7% vs 20.6%, respectively; p < 0.001), lower vs middle vs upper socioeconomic class (SEC) [48.2%, 22.9%, and 10.5%, respectively; p < 0.001], among independent vs studio movies (46.2% vs 18.2%, respectively; p < 0.001); and among R-rated vs PG13-rated vs PG-rated movies (37.3%, 16.2%, and 8.1%, respectively; p < 0.001). In R-rated movies, and in both subcategories of R-rated studio movies and R-rated independent movies, smoking prevalence is higher than in the US population (37.3%, 30.5%, and 50.6% vs 24.8%, respectively; p < 0.001 for all). Additionally, compared to the US population, men, women and lower SEC members smoke more in R-rated movies, R-rated studio movies, and R-rated independent movies. In R-rated movies, antagonists smoke more than protagonists (43.9% vs 35.8%, respectively; p < 0.001), and whites smoke more than nonwhites (38.3% vs 26.4%, respectively; p < 0.001). In R-rated studio movies, antagonists smoke more than

  5. Successful anglo-american entrepreneurs and the american dream. A narrative analysis

    OpenAIRE

    Keijzer, Marian; Liñán, Francisco (Coordinador); Guzmán Cuevas, Joaquín J. (Coordinador)

    2011-01-01

    Some of the most successful entrepreneurs in the Anglo-American world have written their autobiographies. A narrative analysis of these autobiographies reveal the influence of the American Dream on their life and on the way they tell their lifestories. An emphasis on moral correctness as well as on working hard, perseverance and discipline justifies the success of the narrators. The American Myth seems to be a reality – at least for white, Anglo-American, male entrepreneur...

  6. 76 FR 9613 - USEC Inc. (American Centrifuge Lead Cascade Facility and American Centrifuge Plant); Order...

    Science.gov (United States)

    2011-02-18

    ... NUCLEAR REGULATORY COMMISSION [EA-11-013] USEC Inc. (American Centrifuge Lead Cascade Facility and American Centrifuge Plant); Order Approving Direct Transfer of Licenses and Conforming Amendment I USEC... Centrifuge Lead Cascade Facility (Lead Cascade) and American Centrifuge Plant (ACP), respectively, which...

  7. 76 FR 30966 - Buy American Exception Under the American Recovery and Reinvestment Act of 2009

    Science.gov (United States)

    2011-05-27

    ... the Buy American waiver requested by the Deschutes River Conservancy (DRC) to purchase foreign... project contract by more than 25 percent. The waiver process is initiated by a requesting organization... its Buy American decision is required pursuant to the Buy American Act, 2 CFR 176.80(b)(2). Upon...

  8. Extending Research on the Consequences of Parenting Style for Chinese Americans and European Americans.

    Science.gov (United States)

    Chao, Ruth K.

    2001-01-01

    Examined effects of parent-adolescent relationships on school performance for Chinese American and European American high school students. Found positive effects of both authoritative parenting and relationship closeness on school performance for European Americans and to some extent second-generation Chinese, but not first-generation Chinese. The…

  9. Native Americans in Cold War Public Diplomacy: Indian Politics, American History, and the US Information Agency

    Science.gov (United States)

    Denson, Andrew

    2012-01-01

    This essay examines the depiction of Native Americans by the US Information Agency (USIA), the bureau charged with explaining American politics to the international public during the Cold War. In the 1950s and 1960s, the USIA broadcast the message that Americans had begun to acknowledge their nation's history of conquest and were working to…

  10. Cultural Models of Education and Academic Performance for Native American and European American Students

    Science.gov (United States)

    Fryberg, Stephanie A.; Covarrubias, Rebecca; Burack, Jacob A.

    2013-01-01

    We examined the role of cultural representations of self (i.e., interdependence and independence) and positive relationships (i.e., trust for teachers) in academic performance (i.e., self-reported grades) for Native American ("N"?=?41) and European American ("N"?=?49) high school students. The Native American students endorsed…

  11. 76 FR 27182 - Pricing for American Eagle and American Buffalo Bullion Presentation Cases

    Science.gov (United States)

    2011-05-10

    ... DEPARTMENT OF THE TREASURY United States Mint Pricing for American Eagle and American Buffalo Bullion Presentation Cases AGENCY: United States Mint, Department of the Treasury. ACTION: Notice. SUMMARY: The United States Mint is announcing the price increase of the American Eagle/Buffalo Bullion...

  12. Asian American Middleman Minority Theory: The Framework of an American Myth.

    Science.gov (United States)

    Wong, Eugene F.

    1985-01-01

    Challenges the view of Chinese and Japanese Americans as middlemen with its assumptions that Asian Americans are sojourners and unassimilable. Questions the equation of a middle class minority with a middleman minority, examining the roots of this myth in the relationship of Asian Americans to the White-Black racial dyad. (RDN)

  13. Analytic American Option Pricing and Applications

    NARCIS (Netherlands)

    Sbuelz, A.

    2003-01-01

    I use a convenient value breakdown in order to obtain analytic solutions for finitematurity American option prices.Such a barrier-option-based breakdown yields an analytic lower bound for the American option price, which is as price-tight as the Barone-Adesi and Whaley (1987) analytic value proxy

  14. A Brief Introduction of American Political Cultrue

    Institute of Scientific and Technical Information of China (English)

    张晓杰

    2009-01-01

    @@ The American Constitution in 1787 After the repeated compromise, the work of drawing up a constitution was completed on September 17,1787, a day which has been designated as Constitution Day of America. The appearance of constitution was a great event in American history. It established the Federal System which was the first in the world at that time.

  15. American Indian Studies. Library Research Guide.

    Science.gov (United States)

    White, Phillip M.

    This guide to sources for students at San Diego State University doing library research in topics related to American Indian Studies begins by noting that information on North American Indians can be found in a variety of subject disciplines including history, anthropology, education, sociology, health care, law, business, and politics. The…

  16. Introductory American Government in Comparison: An Experiment

    Science.gov (United States)

    Engstrom, Richard N.

    2008-01-01

    Introduction to American Government classes can benefit from the addition of examples from comparative politics. Presenting students with examples of other democratic systems encourages them to confront the costs and benefits of choices made in the American context. Dealing with these "cognitive conflict" tasks facilitates higher level learning on…

  17. 75 FR 23559 - Older Americans Month, 2010

    Science.gov (United States)

    2010-05-04

    ... have contributed so much to our Nation. This year's theme for Older Americans Month, ``Age Strong, Live... Senior Corps. My Administration is committed to ensuring older Americans can age strong and live long. By.... Many of our Nation's older men and women have worked tirelessly and sacrificed so their children could...

  18. Exploring Aesthetics: Focus on Native Americans.

    Science.gov (United States)

    Sarrazin, Natalie

    1995-01-01

    Maintains that effectively presenting another culture in the classroom is one of the most fundamental problems facing teachers using a multicultural curriculum. Discusses the role of music and the arts in Native American culture. Provides suggestions for presenting traditional Native American music in Western classrooms. (CFR)

  19. American Indian Studies as an Academic Discipline

    Science.gov (United States)

    Kidwell, Clara Sue

    2011-01-01

    When American Indian/Native American studies (AI/NAS) programs began to emerge in the halls of academia during the late 1960s and early 1970s, some who served as faculty and staff questioned whether they would be one-generation phenomena. Would the programs survive, would they continue to draw students, and could they make an impact on…

  20. Consumerism and the Sister Carrie's American Dream

    Institute of Scientific and Technical Information of China (English)

    卢亚丽

    2017-01-01

    From the aspect of consumerism to this text analyze Sister Carrie's"American dream"destruction. The author wholly and deeply analyzes the embodiment of consumerism in Dreiser's Sister Carrie and Dreiser's outlook and values under the effect of consumerism. To prove that the reason for destruction of Carrie's American dream is consumerism.

  1. Rapid City Native American Population Needs Assessment.

    Science.gov (United States)

    Farrokhi, Abdollah

    1993-01-01

    Interviews with 301 Native American households in Rapid City, South Dakota, examined demographic variables and attitudes and needs in the areas of education, housing, transportation, health care, recreation, and employment. The ultimate goals for Native American people are achieving empowerment and group determination through greater cultural…

  2. Handbook for Teaching Korean-American Students.

    Science.gov (United States)

    California State Dept. of Education, Sacramento. Bilingual Education Office.

    This handbook is designed for teachers, administrators, and other school personnel. It provides an explanation of the sociocultural and linguistic characteristics of Korean-Americans so educators can address their needs more effectively and orchestrate a better teaching environment by understanding and supporting the Korean-American cultural…

  3. The carbon balance of North American wetlands

    Science.gov (United States)

    Scott D. Bridgham; J. Patrick Megonigal; Jason K. Keller; Norman b. Bliss; Carl Trettin

    2006-01-01

    We examine the carbon balance of North American wetlands by reviewing and synthesizing the published literature and soil databases. North American wetlands contain about 220 Pg C, most of which is in peat. They are a small to moderate carbon sink of about 49 Tg C yr-l, although the uncertainty around this estimate is greater than 100%, with the...

  4. Americans Split on Government Control of Tuition

    Science.gov (United States)

    Selingo, Jeffrey

    2008-01-01

    Nearly seven months before the November election, a plurality of Americans favor Barack Obama to tackle what they consider the most pressing issue in higher education: the runaway cost of a bachelor's degree. According to a new nationwide survey conducted through The Chronicle/Gallup Panel, 42 percent of Americans think that controlling college…

  5. Argumentative Strategies in American and Japanese English.

    Science.gov (United States)

    Kamimura, Taeko; Oi, Kyoko

    1998-01-01

    A study examined differences in argumentative strategies in Japanese and American English by analyzing English essays on capital punishment written by 22 American high school seniors and 30 Japanese college sophomores. Differences were found in the organizational patterns, content and use of rational appeals, preference for type of diction, and…

  6. Stennis Space Center celebrates Native American culture

    Science.gov (United States)

    2009-01-01

    Famie Willis (left), 2009-2010 Choctaw Indian Princess, displays artifacts during Native American Heritage Month activities at Stennis Space Center on Nov. 24. The celebration featured various Native American cultural displays for Stennis employees to view. Shown above are (l to r): Willis, Elaine Couchman of NASA Shared Services Center, John Cecconi of NSSC and Lakeisha Robertson of the Environmental Protection Agency.

  7. African American Males: Leaving the Nightmare.

    Science.gov (United States)

    Gill, Wali

    The plight of African American males has become a problem of alarming proportions in the United States. This paper reports serious disadvantage and risk for this group in terms of education, employment, poverty levels, family disintegration, criminal status, health, and death rates. The paper contends that the crisis for African American males…

  8. Inter-American Biodiversity Information Network (IABIN)

    Science.gov (United States)

    site. IABIN Inter-American Biodiversity Information Network (IABIN) OAS » SEDI » DSD » IABIN IABIN GEF Logo inbio natserve usgs polpar wcm The Inter-American Biodiversity Information Network (IABIN , and use of biodiversity information relevant to policy and decision-making on natural resources

  9. Discrimination of Arabic Contrasts by American Learners

    Science.gov (United States)

    Al Mahmoud, Mahmoud S.

    2013-01-01

    This article reports on second language perception of non-native contrasts. The study specifically tests the perceptual assimilation model (PAM) by examining American learners' ability to discriminate Arabic contrasts. Twenty two native American speakers enrolled in a university level Arabic language program took part in a forced choice AXB…

  10. Passage of American shad: paradigms and realities

    Science.gov (United States)

    Haro, Alex; Castro-Santos, Theodore

    2012-01-01

    Despite more than 250 years of development, the passage of American shad Alosa sapidissima at dams and other barriers frequently remains problematic. Few improvements in design based on knowledge of the swimming, schooling, and migratory behaviors of American shad have been incorporated into passage structures. Large-scale technical fishways designed for the passage of adult salmonids on the Columbia River have been presumed to have good performance for American shad but have never been rigorously evaluated for this species. Similar but smaller fishway designs on the East Coast frequently have poor performance. Provision of effective downstream passage for both juvenile and postspawning adult American shad has been given little consideration in most passage projects. Ways to attract and guide American shad to both fishway entrances and downstream bypasses remain marginally understood. The historical development of passage structures for American shad has resulted in assumptions and paradigms about American shad behavior and passage that are frequently unsubstantiated by supporting data or appropriate experimentation. We propose that many of these assumptions and paradigms are either unfounded or invalid and that significant improvements to American shad upstream and downstream passage can be made via a sequential program of behavioral experimentation, application of experimental results to the physical and hydraulic design of new structures, and controlled tests of large-scale prototype structures in the laboratory and field.

  11. CDC Vital Signs-African American Health

    Centers for Disease Control (CDC) Podcasts

    This podcast is based on the May 2017 CDC Vital Signs report. The life expectancy of African Americans has improved, but it's still an average of four years less than whites. Learn what can be done so all Americans can have the opportunity to pursue a healthy lifestyle.

  12. First Person Past: American Autobiographies, Volume 2

    DEFF Research Database (Denmark)

    American literature, biography, Tunis Campbell, Black Elk, Andrew Carnegie, Booker T. Washington, Mary Antin, Mary Jones, Frederic Howe, Anna Howard Shaw, Woody Guthrie, Monica Sone, Anne Moody, Ron Kovic......American literature, biography, Tunis Campbell, Black Elk, Andrew Carnegie, Booker T. Washington, Mary Antin, Mary Jones, Frederic Howe, Anna Howard Shaw, Woody Guthrie, Monica Sone, Anne Moody, Ron Kovic...

  13. American Red Cross: A History And Analysis

    Science.gov (United States)

    2016-12-01

    American war efforts through fundraising activities and by energizing the patriotism of the American citizenship (Rozario, 2003). Today, according...ANRC to communicate vital information to the public, but also a way for the ANRC Digital Disaster Operations Center to use information being passed by...ANRC Digital Operations Center monitors social media to gather and disseminate information regarding affected locations and requirements

  14. Teaching about Human Rights and American Indians.

    Science.gov (United States)

    Harvey, Karen D.

    1996-01-01

    Presents a flexible lesson plan integrating teaching about human rights into the existing curriculum about American Indians. Asserts that American Indians have the right to maintain their cultural ways and connects that subject to the United Nations Universal Declaration of Human Rights. Includes three lists of resources and references. (MJP)

  15. Congressional Social Darwinism and the American Indian

    Science.gov (United States)

    Blinderman, Abraham

    1978-01-01

    Summarizing a congressional report on civil and military treatment of American Indians, this article asserts that the social Darwinism of the day prevailed among all congressional committee members ("Even friends of the Indian... knew American expansionism, technology, and racial ideology would reduce the Indian to a pitiful remnant...) (JC)

  16. 78 FR 26225 - Older Americans Month, 2013

    Science.gov (United States)

    2013-05-03

    ... in medicine and health care, Americans are living longer and achieving more. Many seniors are using a... programs like Senior Corps, which connects more than half a million people to service opportunities from coast to coast. As older Americans strive to lift up their neighborhoods, my Administration is working...

  17. Native American Biographies. Multicultural Biographies Collection.

    Science.gov (United States)

    Seeley, Virginia, Ed.; And Others

    This book, appropriate for secondary students, includes brief biographies of 21 Native Americans of the 20th century. The biographies focus on childhood experiences, cultural heritage, and career goals. The book is divided into four units that feature Native Americans with successful careers in the fields of literature and drama; fine arts and…

  18. Using Text Documents from American Memory.

    Science.gov (United States)

    Singleton, Laurel R., Ed.

    2002-01-01

    This publication contains classroom-tested teaching ideas. For grades K-4, "'Blessed Ted-fred': Famous Fathers Write to Their Children" uses American Memory for primary source letters written by Theodore Roosevelt and Alexander Graham Bell to their children. For grades 5-8, "Found Poetry and the American Life Histories…

  19. Racism and Asian American Student Leadership

    Science.gov (United States)

    Chung, Jennifer Y.

    2014-01-01

    This article provides a theoretical analysis and ethnographic account of Asian American student leadership in higher education. Existing literature highlights Asian and Asian American leadership styles as cultural differences. I shift the analysis from culture to racism in order to work toward a more socially just conception of Asian American…

  20. Asian & Pacific Islander American Health Forum

    Science.gov (United States)

    ... Report.pdf [1.2MB] Obesity and Overweight Among Asian American Children and Adolescents 2016.04.28-OBESITY AND ... Month Stay Connected! Receive the latest APIAHF updates Asian & Pacific Islander American Health Forum. All rights reserved. One Kaiser Plaza, ...

  1. The Last Great American Picture Show

    NARCIS (Netherlands)

    Elsaesser, Thomas; King, Noel; Horwath, Alexander

    2004-01-01

    The Last Great American Picture Show brings together essays by scholars and writers who chart the changing evaluations of the American cinema of the 1970s, sometimes referred to as the decade of the lost generation, but now more and more recognized as the first New Hollywood, without which the

  2. American Adults' Knowledge of Exercise Recommendations

    Science.gov (United States)

    Morrow, James R., Jr.; Krzewinski-Malone, Jeanette A.; Jackson, Allen W.; Bungum, Timothy J.; FitzGerald, Shannon J.

    2004-01-01

    Physical inactivity is a major risk factor for cardiovascular disease, stroke, hypertension, diabetes, obesity, osteoporosis, and some cancers. Approximately 950,000 Americans die annually from cardiovascular diseases. The purpose of this study was to determine whether American adults know which traditional and lifestyle physical activities affect…

  3. Remembering Tocqueville: Reflections on the American Condition.

    Science.gov (United States)

    Keohane, Nannerl O.

    2000-01-01

    Presents the 2000 Robert H. Atwell Distinguished Lecture given at the 82nd Annual Meeting of the American Council on Education in Chicago (Illinois), which focuses on the ideas of Alexis de Tocqueville to find lessons for the current condition of higher education. These include American egalitarianism, homogeneity, individualism, and pragmatism.…

  4. Anxiety in Kuwaiti and American college students.

    Science.gov (United States)

    Abdel-Khalek, Ahmed M; Lester, David

    2006-10-01

    Samples of Kuwaiti (n=646) and American (n=320) undergraduates responded to the Kuwait University Anxiety Scale in Arabic and English, respectively. Differences by sex were significant, with women having a higher mean anxiety score than men and by country with Kuwaiti women having a higher anxiety score than American women.

  5. North American sturgeon otolith morphology

    Science.gov (United States)

    Chalupnicki, Marc A.; Dittman, Dawn E.

    2016-01-01

    Accurate expedient species identification of deceased sturgeon (Acipenseridae) when external physical characteristic analysis is inconclusive has become a high priority due to the endangered or threatened status of sturgeon species around the world. Examination of otoliths has provided useful information to aid in population management, age and size-class analysis, understanding predator–prey interactions, and archeological research in other fish species. The relationship between otolith characteristics and sturgeon species has remained unknown. Therefore, we analyzed the shape of otoliths from the eight species of sturgeon found in North America to test the utility of otolith characteristic morphology in species identification. There were distinct differences in the size and shape of the otoliths between species of sturgeon with little shape variation among individuals of the same species. The relationship between otolith length axes was linear, and most of the variability was explained by a Log (axis + 1) transformation of the x and y axes (r2 = 0.8983) using the equation y = 0.73x + 0.0612. Images of otoliths from all eight North American species are presented to assist in the identification process.

  6. Americans misperceive racial economic equality.

    Science.gov (United States)

    Kraus, Michael W; Rucker, Julian M; Richeson, Jennifer A

    2017-09-26

    The present research documents the widespread misperception of race-based economic equality in the United States. Across four studies ( n = 1,377) sampling White and Black Americans from the top and bottom of the national income distribution, participants overestimated progress toward Black-White economic equality, largely driven by estimates of greater current equality than actually exists according to national statistics. Overestimates of current levels of racial economic equality, on average, outstripped reality by roughly 25% and were predicted by greater belief in a just world and social network racial diversity (among Black participants). Whereas high-income White respondents tended to overestimate racial economic equality in the past, Black respondents, on average, underestimated the degree of past racial economic equality. Two follow-up experiments further revealed that making societal racial discrimination salient increased the accuracy of Whites' estimates of Black-White economic equality, whereas encouraging Whites to anchor their estimates on their own circumstances increased their tendency to overestimate current racial economic equality. Overall, these findings suggest a profound misperception of and unfounded optimism regarding societal race-based economic equality-a misperception that is likely to have any number of important policy implications.

  7. The crisis in american archeology.

    Science.gov (United States)

    Davis, H A

    1972-01-21

    The current crisis in American archeology has been brought about by a combination of the greatly increased rate of destruction of unique, irreplaceable archeological information and material, and the lack of adequate funding for salvage of what is being destroyed. Since World War II, land alteration has increased almost geometrically. Land leveling, urban development, inexperienced or ignorant diggers, commercial dealers in Indian relics-these and many other agents of destruction are obliterating traces of the past. Anything that disturbs the ground where people once lived destroys forever whatever information is left about them and their way of life. Interpretations of man's cultural development through time, of his ability to cope with and use the environment wisely, and of a long, fascinating, and irreplaceable heritage are only possible if the evidence left in the ground is undisturbed and is properly recorded when it is excavated. The problem of the destruction of archeological sites and information is a complex one, with no single solution. A combination of increased support for archeological research through increased funding, and development of a knowledgeable, interested public will go a long way toward assuring this country that a significant portion of the past will be available for the benefit of future generations. If solutions are not sought and found now, it will be too late-we will have committed ourselves, irretrievably and irreversibly, to the future, without benefit or knowledge of the mistakes and the lessons of the past.

  8. Ocular allergy latin american consensus

    Directory of Open Access Journals (Sweden)

    Myrna Serapião dos Santos

    2011-12-01

    Full Text Available PURPOSE: To establish current definition, classification and staging, and to develop diagnosis and treatment recommendations for ocular allergy, by using Delphi approach. METHODS: Ten Latin American experts on ocular allergy participated in a 4-round Delphi panel approach. Four surveys were constructed and answered by panelists. A two-thirds majority was defined as consensus. Definition, classification, staging and diagnosis and treatment recommendations were the main outcomes. RESULTS: "Ocular allergy" was proposed as the general term to describe ocular allergic diseases. Consensus regarding classification was not reached. Signs and symptoms were considered extremely important for the diagnosis. It was consensus that a staging system should be proposed based on the disease severity. Environmental control, avoidance of allergens and the use of artificial tears were recommended as first line treatment. The secondary treatment should include topical anti-histamines, mast cell stabilizers and multi actions drugs. Topical non-steroidal anti-inflammatory and vasoconstrictors were not recommended. Topical corticosteroids were recommended as third line of treatment for the most severe keratoconjunctivitis. Consensus was not reached regarding the use of systemic corticosteroids or immunosuppressant. Surgical approach and unconventional treatments were not recommended as routine. CONCLUSION: The task of creating guidelines for ocular allergies showed to be very complex. Many controversial topics remain unsolved. A larger consensus including experts from different groups around the world may be needed to further improve the current recommendations for several aspects of ocular allergy.

  9. Defining Tiger Parenting in Chinese Americans.

    Science.gov (United States)

    Kim, Su Yeong

    2013-09-01

    "Tiger" parenting, as described by Amy Chua [2011], has instigated scholarly discourse on this phenomenon and its possible effects on families. Our eight-year longitudinal study, published in the Asian American Journal of Psychology [Kim, Wang, Orozco-Lapray, Shen, & Murtuza, 2013b], demonstrates that tiger parenting is not a common parenting profile in a sample of 444 Chinese American families. Tiger parenting also does not relate to superior academic performance in children. In fact, the best developmental outcomes were found among children of supportive parents. We examine the complexities around defining tiger parenting by reviewing classical literature on parenting styles and scholarship on Asian American parenting, along with Amy Chua's own description of her parenting method, to develop, define, and categorize variability in parenting in a sample of Chinese American families. We also provide evidence that supportive parenting is important for the optimal development of Chinese American adolescents.

  10. Asian American Evangelicals in Multiracial Church Ministry

    Directory of Open Access Journals (Sweden)

    Kathleen Garces-Foley

    2013-04-01

    Full Text Available Since the 1990s, evangelical efforts to create multiracial churches (MRCs have grown exponentially. This article analyzes the experiences of Asian American evangelical ministers leading MRCs. Through interviews we explore how Asian American evangelicals came to be involved in MRC-ministry and how they approach issues of racial diversity in this context. We compare the racial attitudes of Asian American evangelical ministers leading MRCs with those of White and Black evangelicals delineated in Emerson and Smith’s Divide by Faith. Rather than conform to the colorblind approach of many White evangelicals, the majority of our respondents utilize structural explanations for social inequality and promote a colorconscious approach to diversity. We conclude that Asian American evangelicals utilize a unique framework for MRC-ministry, what we call a ‘racialized multiculturalism,’ that has much to offer American evangelicalism.

  11. THE GODFATHER AND THE AMERICAN DREAM

    Directory of Open Access Journals (Sweden)

    Goksu Gigi Akkan

    2017-01-01

    Full Text Available This paper tries to demonstrate how The Godfather by Francis Ford Coppola challenges the myth of the American Dream. The thesis of the paper is that The Godfather is not a film seeking to re-establish American norms and ideals, but that it tries to break down and shed light on the corrupt side of the modern American society through the myth of “the American Dream”. The structure of the paper is so that first, what other academics and critiques have to say about Coppola’s attempt to criticize the American society and ideals will be visited, as this will give the reader a clearer understanding of the film’s meaning and message. Then, analyses of how certain characters are built and how their presence and attributes contribute to the film’s meaning will be conducted, topped off with the usage of props.

  12. American marsupials chromosomes: why study them?

    Directory of Open Access Journals (Sweden)

    Marta Svartman

    2009-01-01

    Full Text Available Marsupials, one of the three main groups of mammals, are only found in Australia and in the American continent. Studies performed in Australian marsupials have demonstrated the great potential provided by the group for the understanding of basic genetic mechanisms and chromosome evolution in mammals. Genetic studies in American marsupials are relatively scarce and cytogenetic data of most species are restricted to karyotype descriptions, usually without banding patterns. Nevertheless, the first marsupial genome sequenced was that of Monodelphis domestica, a South American species. The knowledge about mammalian genome evolution and function that resulted from studies on M. domestica is in sharp contrast with the lack of genetic data on most American marsupial species. Here, we present an overview of the chromosome studies performed in marsupials with emphasis on the South American species.

  13. Cardiovascular Health in African Americans: A Scientific Statement From the American Heart Association.

    Science.gov (United States)

    Carnethon, Mercedes R; Pu, Jia; Howard, George; Albert, Michelle A; Anderson, Cheryl A M; Bertoni, Alain G; Mujahid, Mahasin S; Palaniappan, Latha; Taylor, Herman A; Willis, Monte; Yancy, Clyde W

    2017-11-21

    Population-wide reductions in cardiovascular disease incidence and mortality have not been shared equally by African Americans. The burden of cardiovascular disease in the African American community remains high and is a primary cause of disparities in life expectancy between African Americans and whites. The objectives of the present scientific statement are to describe cardiovascular health in African Americans and to highlight unique considerations for disease prevention and management. The primary sources of information were identified with PubMed/Medline and online sources from the Centers for Disease Control and Prevention. The higher prevalence of traditional cardiovascular risk factors (eg, hypertension, diabetes mellitus, obesity, and atherosclerotic cardiovascular risk) underlies the relatively earlier age of onset of cardiovascular diseases among African Americans. Hypertension in particular is highly prevalent among African Americans and contributes directly to the notable disparities in stroke, heart failure, and peripheral artery disease among African Americans. Despite the availability of effective pharmacotherapies and indications for some tailored pharmacotherapies for African Americans (eg, heart failure medications), disease management is less effective among African Americans, yielding higher mortality. Explanations for these persistent disparities in cardiovascular disease are multifactorial and span from the individual level to the social environment. The strategies needed to promote equity in the cardiovascular health of African Americans require input from a broad set of stakeholders, including clinicians and researchers from across multiple disciplines. © 2017 American Heart Association, Inc.

  14. The state of American management.

    Science.gov (United States)

    Wriston, W B

    1990-01-01

    Every year, the president of the United States offers his State of the Union address. Here, from one of the most respected managers in America, is a report on the State of American Management. The state of management, says Walter B. Wriston, is good. Despite the predictions of America's decline, our economy continues to prosper. That is because of this fundamental truth: the United States is the only country in the world that renews itself daily. This is the Age of Pluralism, and U.S. business is based on pluralism. The spirit of the entrepreneur has entered the mainstream of U.S. management, transforming bureaucracy and emphasizing leadership. Today's top executives need to be more like politicians than the number-crunchers of yesterday. At the same time, information is flowing more freely, so corporations are eliminating layers of managers who were really just transmission lines. And top managers are learning to listen to the people who are closest to the work. Everyone today is a knowledge worker. The accelerating pace of knowledge has put a greater premium than ever on talent. Globalization is a big part of this new world. From the manager's viewpoint, globalization means that "you're in a marketplace where you're suddenly waking up with a guy...from a country you're not too sure where it is, who's eating your lunch in your hometown." To understand global competition, managers in large and small companies need broad vision. Finally, to deal with change, U.S. managers must confront some issues at home. For instance, our accounting systems are obsolete, both in companies and in our national accounts.(ABSTRACT TRUNCATED AT 250 WORDS)

  15. The North American electricity markets

    International Nuclear Information System (INIS)

    Harvie, I.

    1999-01-01

    The wide ranging changes that will drive the evolution of the North American electricity industry in the future are discussed. Deregulation and the advent of competition in both the United States and Canada are the principal forces that will change the shape of the electricity market, bringing new players and new forms of doing business into the marketplace. A review of the current state of the business shows that especially in the United States where deregulation began earlier than in Canada, independent generators already constitute a multi-billion dollar industry. Non-utility generation capacity is about seven per cent of total U.S. capacity and accounts for about 10 per cent of total U. S. electricity supply, including imports. Examples from other industries clearly show that restructuring and the breakup of vertically integrated industries could be accomplished much faster than anticipated, that a decrease in prices followed rapidly as products became more like commodities, and that decreasing prices fostered product differentiation and competition. Major legislation affecting the electric power industry in the U.S. and Canada (U.S. National Energy Policy Act 1992, Alberta Electric Utilities Act 1995, Ontario Energy Competition Act 1998) decreeing open access transmission, unbundling of generation, transmission and ancillary services, and promoting competition, and the impacts of these legislative actions are also reviewed. The most visible impact is the explosion that can be seen in power marketing and energy trading on a scale unimaginable only a few short years ago, where the total volume of trade may be worth multiples of the value of the underlying commodity. At the same time, there is concern about the reliability of the system, and thus making it imperative to find new ways to manage reliability. Various suggestions are made as to how increased reliability of supply could be achieved by better management, new standards and better enforcement of

  16. Cultural in-group advantage: emotion recognition in African American and European American faces and voices.

    Science.gov (United States)

    Wickline, Virginia B; Bailey, Wendy; Nowicki, Stephen

    2009-03-01

    The authors explored whether there were in-group advantages in emotion recognition of faces and voices by culture or geographic region. Participants were 72 African American students (33 men, 39 women), 102 European American students (30 men, 72 women), 30 African international students (16 men, 14 women), and 30 European international students (15 men, 15 women). The participants determined emotions in African American and European American faces and voices. Results showed an in-group advantage-sometimes by culture, less often by race-in recognizing facial and vocal emotional expressions. African international students were generally less accurate at interpreting American nonverbal stimuli than were European American, African American, and European international peers. Results suggest that, although partly universal, emotional expressions have subtle differences across cultures that persons must learn.

  17. AMERICAN DREAM: THE AMERICAN HEGEMONIC CULTURE AND ITS IMPLICATIONS TO THE WORLD

    Directory of Open Access Journals (Sweden)

    Kasiyarno .

    2014-02-01

    Full Text Available A nation could be a great one as long as it has a great dream. The best example for this is America. Through its long history, it manages to realize a dream to be a superpower. It can be said that “American Dream” is one of the most significant features for the growth of a “constantly eyeing for winner” culture. American Studies experts call it as a “hegemonic culture” in which American norms, values and cultural practices are considered superior against the world culture. Globalizing the culture has been the most effective engine to spread American cultural values and to shape the global civilizations. Using American Studies perspective, this paper attempts to review the extent to which the “American Dream” has successfully established Americanization, as well as how the hegemonic culture has influenced the lives of peoples across the world in the form of popular culture.

  18. Excerpt from Dead Stars: American and Philippine Literary Perspectives on the American Colonization of the Philippines

    Directory of Open Access Journals (Sweden)

    Jennifer M. McMahon

    2011-12-01

    Full Text Available Dead Stars: American and Philippine Literary Perspectives on the American Colonization of the Philippines examines the American colonization of the Philippines from three distinct but related literary perspectives. The first is the reaction of anti-imperialist American writers Mark Twain, W. E. B. Du Bois, and William James to America’s first foray into the role of colonizer and how their varied essays, letters, and speeches provide an incisive delineation of fundamental conflicts in American identity at the turn of the twentieth century. The book then analyzes how these same conflicts surface in the colonial regime’s use of American literature as a tool to inculcate American values in the colonial educational system. Finally, Dead Stars considers the way three early and important Filipino writers—Paz Marquez Benitez, Maximo Kalaw, and Juan C. Laya—interpret and represent these same tensions in their fiction.

  19. Native American Music and Curriculum: Controversies and Cultural Issues.

    Science.gov (United States)

    Boyea, Andrea

    1999-01-01

    Discusses Native American music and curricula, the differences in Western and Native American perspectives of music, the role of music in Native American life, and music as art. Considers how Native Americans live in two worlds (the preserved and lived cultures) and how Native American music should be taught. (CMK)

  20. The Relationship between Native American Ancestry, Body Mass Index and Diabetes Risk among Mexican-Americans.

    Science.gov (United States)

    Hu, Hao; Huff, Chad D; Yamamura, Yuko; Wu, Xifeng; Strom, Sara S

    2015-01-01

    Higher body mass index (BMI) is a well-established risk factor for type 2 diabetes, and rates of obesity and type 2 diabetes are substantially higher among Mexican-Americans relative to non-Hispanic European Americans. Mexican-Americans are genetically diverse, with a highly variable distribution of Native American, European, and African ancestries. Here, we evaluate the role of Native American ancestry on BMI and diabetes risk in a well-defined Mexican-American population. Participants were randomly selected among individuals residing in the Houston area who are enrolled in the Mexican-American Cohort study. Using a custom Illumina GoldenGate Panel, we genotyped DNA from 4,662 cohort participants for 87 Ancestry-Informative Markers. On average, the participants were of 50.2% Native American ancestry, 42.7% European ancestry and 7.1% African ancestry. Using multivariate linear regression, we found BMI and Native American ancestry were inversely correlated; individuals with ancestry were 2.5 times more likely to be severely obese compared to those with >80% Native American ancestry. Furthermore, we demonstrated an interaction between BMI and Native American ancestry in diabetes risk among women; Native American ancestry was a strong risk factor for diabetes only among overweight and obese women (OR = 1.190 for each 10% increase in Native American ancestry). This study offers new insight into the complex relationship between obesity, genetic ancestry, and their respective effects on diabetes risk. Findings from this study may improve the diabetes risk prediction among Mexican-American individuals thereby facilitating targeted prevention strategies.

  1. Active antennal movement in cockroaches - towards understanding multimodal exploration

    DEFF Research Database (Denmark)

    Pequeno-Zurro, Alejandro; Nitschke, Jahn; Szyszka, Paul

    of antennal movements we employed an adaptive Hopf coupled oscillator model, with parameters fitted to kinematic data derived from high-speed recordings of antennal movement. In addition we mapped the structure of the odour plume that the antennae encountered and used the odour concentration map as driver...

  2. Activity of boric acid on German cockroaches: Analysis of residues ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-02-18

    Feb 18, 2009 ... Full Length Research Paper. Activity of ... In a previous study, we have shown that boric ... ing 300 µl of curcumin solution (12.5 mg curcumin, 10 ml acetic acid) ..... Schal C, Chiang AS, Burns EL, Gadot M, Cooper RA (1993).

  3. Cancer statistics for African Americans, 2013.

    Science.gov (United States)

    DeSantis, Carol; Naishadham, Deepa; Jemal, Ahmedin

    2013-05-01

    In this article, the American Cancer Society estimates the number of new cancer cases and deaths for African Americans and compiles the most recent data on cancer incidence, mortality, survival, and screening prevalence based upon incidence data from the National Cancer Institute, the Centers for Disease Control and Prevention, and the North American Association of Central Cancer Registries and mortality data from the National Center for Health Statistics. It is estimated that 176,620 new cases of cancer and 64,880 deaths will occur among African Americans in 2013. From 2000 to 2009, the overall cancer death rate among males declined faster among African Americans than whites (2.4% vs 1.7% per year), but among females, the rate of decline was similar (1.5% vs 1.4% per year, respectively). The decrease in cancer death rates among African American males was the largest of any racial or ethnic group. The reduction in overall cancer death rates since 1990 in men and 1991 in women translates to the avoidance of nearly 200,000 deaths from cancer among African Americans. Five-year relative survival is lower for African Americans than whites for most cancers at each stage of diagnosis. The extent to which these disparities reflect unequal access to health care versus other factors remains an active area of research. Overall, progress in reducing cancer death rates has been made, although more can and should be done to accelerate this progress through ensuring equitable access to cancer prevention, early detection, and state-of-the-art treatments. Copyright © 2013 American Cancer Society, Inc.

  4. [Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico].

    Science.gov (United States)

    Ramos-Elorduy, Julieta; Landero-Torres, Ivonne; Murguía-González, Joaquín; Pino, José M M

    2008-03-01

    Anthropoentomophagic biodiversity of the Zongolica region, Veracruz, Mexico. During two and a half years (2003-2005) we recorded the insect species used as food at Zongolica, Veracruz State, Mexico. Interviews were made among people (200) of this municipality to know which insects they consumed. The total of registered species was 57 (Orthoptera, Hemiptera, Homoptera, Megaloptera, Coleoptera, Lepidoptera and Hymenoptera). The Orthoptera was the most frequently ingested. Twenty-four of these species were new records for edible insects of Mexico. They are eaten in immature stages or as adults, generally only roasted. Consumption is seasonal. Some species are commercialized in the "tianguis" (little town markets) and/or in the larger Zongolica market. There is a "protoculture" of three species, one cockroach (Periplaneta australasiae Fabricius) and two moths (Latebraria amphipyroides Guenée and Arsenura armida armida Cramer). In Zongolica, anthropoentomophagy is an ancestral habit.

  5. American families: trends and correlates.

    Science.gov (United States)

    Davanzo, J; Rahman, M O

    1993-01-01

    Discussion focused on the nature of the roles of the family, a review of the major demographic changes (marriage, cohabitation, nonfamily households, remarriage, fertility, teenage pregnancy, and female employment) affecting the American family in the past decades, and the nature of the impact on women, men, and children. There were four major trends identified: 1) increased proportions of children living in single-parent families due to high rates of divorce and increased childbearing outside of marriage; 2) increased proportions of adults in nontraditional living arrangements; 3) increased female labor force participation during all stages of the life cycle; and 4) decreased proportions of children and increased proportions of older people out of total population due to declining mortality and fertility rates. Family formation arises out of childbearing and childrearing roles, the need for companionship and emotional support, and the opportunities for specialization and trade, and the economies of scale. The costs of family living may include the potential for disagreement, conflict, loss of privacy, and time and money. There were a number of reasons identified for not maintaining traditional families consisting of a married couple with children. The trends were for later age at marriage: 24.4 years in 1992 for women, increased cohabitation (almost 50% cohabiting prior to first marriage in 1985-86), decreased number of married couple households, and increased number of adults in non-family households. The divorce rate has risen over the past 100 years with peaks in the 1970s; the reasons were identified as increased baby boomers and new marriages, increased labor participation of women, and changes in gender roles. The stabilization and slight decline in rates may be due to a natural leveling, the likelihood of greater stability within new marriages, and the aging of the baby boomers. An anticipated increase in divorce rates in the future was also justified

  6. Infant Mortality and American Indians/Alaska Natives

    Science.gov (United States)

    ... American Indian/Alaska Native > Infant Health & Mortality Infant Mortality and American Indians/Alaska Natives American Indian/Alaska ... as compared to non-Hispanic white mothers. Infant Mortality Rate: Infant mortality rate per 1,000 live ...

  7. Proceedings of the American elm restoration workshop 2016

    Science.gov (United States)

    Cornelia C. Pinchot; Kathleen S. Knight; Linda M. Haugen; Charles E. Flower; James M. Slavicek

    2017-01-01

    Proceedings from the 2016 American Elm Restoration Workshop in Lewis Center, OH. The published proceedings include 16 papers pertaining to elm pathogens, American elm ecology, and American elm reintroduction.

  8. A Deafening Silence: Hizballah After the American Invasion of Iraq

    National Research Council Canada - National Science Library

    Wrona, Jr, Richard M

    2007-01-01

    ... American servicemen and twenty-three French soldiers. Further bombings, murders, and kidnappings greatly contributed to the American decision months later that the carnage and anarchy in Lebanon were not worth additional American lives...

  9. Bacterial Clearance and Endocarditis in American Opossums

    Science.gov (United States)

    Musher, Daniel M.; Richie, Yvonne

    1974-01-01

    The American opossum is the only experimental animal that regularly develops bacterial endocarditis spontaneously. There was no relation between the ability of opossums to clear bacteria from the bloodstream and the subsequent development of endocarditis. PMID:4208530

  10. American Evaluation Association Guiding Principles for Evaluators

    Energy Technology Data Exchange (ETDEWEB)

    None

    2009-01-18

    Five principles developed by American Evaluation Associ intended to guide professional practice of evaluators & to inform evaluation clients and the general public about principles they can expect to be upheld by professional evaluators.

  11. Latin American Research Consortiums : a Comparative Analysis ...

    International Development Research Centre (IDRC) Digital Library (Canada)

    Latin American countries are implementing several policies to enhance innovation. ... foster research collaboration between different actors in the innovation system. ... adaptive water management: Innovative solutions from the Global South”.

  12. School of Optometry at Inter American University.

    Science.gov (United States)

    Hofstetter, Henry W.

    1981-01-01

    The optometry program at the Inter American University in Puerto Rico is profiled, with highlights of admission criteria, temporary and permanent facilities, faculty, governance structure, curriculum, research opportunities, and relationship with the university as a whole. (MSE)

  13. The Contributions of Immigrants to American Culture.

    Science.gov (United States)

    Hirschman, Charles

    2013-01-01

    The standard account of American immigration focuses on the acculturation and assimilation of immigrants and their children to American society. This analysis typically ignores the significant contributions of immigrants to the creation of American culture through the performing arts, sciences, and other cultural pursuits. Immigrants and their children are not born with more creative talents than native-born citizens, but their selectivity and marginality may have pushed and pulled those with ability into high-risk career paths that reward creative work. The presence of large numbers of talented immigrants in Hollywood, academia, and the high-tech industries has pushed American institutions to be more meritocratic and open to innovation than they would be otherwise.

  14. British and American attitudes toward credit cards.

    Science.gov (United States)

    Yang, Bijou; James, Simon; Lester, David

    2006-04-01

    American university students owned more than twice as many credit cards as British university students. However, scores on a credit card attitude scale predicted the number of cards owned by respondents in both countries.

  15. NCEP North American Regional Reanalysis (NARR)

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — The NARR dataset is an extension of the NCEP Global Reanalysis which is run over the North American Region. The NARR model uses the very high resolution NCEP Eta...

  16. American Orthopaedic Society for Sports Medicine

    Science.gov (United States)

    ... Upcoming Meetings Online Education Archived Meetings Faculty Resources Sports Medicine Fellowships Traveling Fellowship Submit an Abstract Submit ... Support AOSSM Research Publications Toggle American Journal of Sports Medicine Sports Health: A Multidisciplinary Approach Orthopaedic Journal ...

  17. The collider calamity, publ. by Scientific American

    CERN Multimedia

    2006-01-01

    "For decades, the big guns of American science have been the U.S. Department of Energy's particle collider, which investigate the nature of matter by accelerating subatomic particles and smashing them together." (1 page)

  18. Nine American Lifestyles: Values and Societal Change.

    Science.gov (United States)

    Mitchell, Arnold

    1984-01-01

    Americans are a diverse people, but their values, dreams, and attitudes place them in distinct lifestyle groups. Nine adult lifestyles are described and how they may change in response to future economic, social, and political conditions is examined. (RM)

  19. 76 FR 25523 - Older Americans Month, 2011

    Science.gov (United States)

    2011-05-05

    ... enriching lives and contributing to our country. This theme also highlights how technology, including social..., older Americans have shaped the story of America and secured the promise of our future. We are...

  20. Jewish Culture and the American Military

    National Research Council Canada - National Science Library

    Goldberg, Adam M

    2006-01-01

    This study explores the Jewish experience within the American military. The history of military service by persons of the Jewish faith corresponds roughly to that of persons from many other ethnic or religious groups...