WorldWideScience

Sample records for ameixas prunus salicina

  1. Efeito do ácido indolbutírico no enraizamento de estacas de ramos de plantas de ameixeira (Prunus salicina, Lindl. Effect of indolbutyric acid on the rooting of plum branch cuttings (Prunus sofrena, Lindl.

    Directory of Open Access Journals (Sweden)

    E. Kersten

    1993-05-01

    Full Text Available O presente trabalho foi realizado com o objetivo de avaliar o efeito de quatro concentrações de ácido indolbutírico (IBA, no enraizamento de estacas de ramos de ameixeira (Prunus salicina, Lindl., coletadas de plantas tratadas com bórax e sulfato de zinco e controle, executado em quatro épocas. Os experimentos foram conduzidos em viveiros, sob condição de nebulização artificial intermitente. Os resultados obtidos mostram a influência de cultivar, época e concentração de IBA, não sendo verificado efeito de bórax ou sulfato de zinco na percentagem de estacas enraizadas.The objective of this work was to evaluate the effect of four concentrations of indolbutyric acid on the rooting of plum branch cuttings (Prunus salicina, Lindl. collected from plants treated with borax and zinc sulfate, in four periods. The experiments were conducted in a nursery with intermitent artificial mist conditions. The results showed a positive effect of cultivars, periods and IBA concentrations, and there was no effect of either borax or zinc sulfate on rooting of branch cuttings.

  2. Identification of volatile compounds in thinning discards from plum trees (Prunus salicina Lindl. cultivar Harry Pickstone

    Directory of Open Access Journals (Sweden)

    Rossana Podestá

    2011-09-01

    Full Text Available Plum (Prunus salicina Lindl. cv. Harry Pickstone, a China indigenous fruit, is widely produced and consumed in countries such as Japan and Brazil. The practice of thinning is common in horticulture and the fruits removed are discarded as waste. Like the great majority of vegetables, these thinning discards also contain essential oils which have not been investigated until the present time. The extraction of the plum thinning discards volatile oil, through the hydrodistillation method, produced a yield of 0.06% (m/m and a total of 21 components were identified, with 11 of them being responsible for 72,9% of the total oil composition. The major compounds determined through GC and GC-MS were Z-α-bisabolene (13.7%, n-hexadecanoic acid (12.7%, phytol (12.7%, and β-caryophyllene (10.4%.

  3. Microencapsulation of plum (Prunus salicina Lindl. phenolics by spray drying technology and storage stability

    Directory of Open Access Journals (Sweden)

    Yibin LI

    2017-10-01

    Full Text Available Abstract To improve the stability of the phenolic extracts from plum fruit (Prunus salicina Lindl., the microencapsulation conditions of spray drying were optimized by the response surface method. The Box-Behnken experimental results indicated the optimal conditions involved an inlet air temperature of 142.8 °C, a core material content of 23.7% and a feed solids content of 11.7%. The maximum microencapsulating efficiency was 87.7% at optimal conditions. Further, the physicochemical properties of the microcapsule powders were improved overall due to the addition of the coating agents. There were no statistically significant differences in phenolic content of the obtained microcapsules for the first 40 days of storage at 25 °C in dark condition (p > 0.05, and the retention rate of total phenol remained above 85% after 60 days. Microcapsules can be potentially developed as a source of natural pigment or functional food based on the advantages of rich phenolic compounds and red color.

  4. ARMAZENAMENTO REFRIGERADO DE AMEIXAS `REUBENNEL' (Prunus salicina Lindl.: EFEITOS DO ESTÁDIO DE MATURAÇÃO E DO POLIETILENO

    Directory of Open Access Journals (Sweden)

    R.A. Kluge

    1996-05-01

    Full Text Available Para verificar os efeitos do estádio de maturação e da embalagem de polietileno, ameixas `Reubennel' foram colhidas em dois estádios de maturação: verde (25-50% de coloração vermelha e semimaduro (50-75% de coloração vermelha e armazenadas à 0oC e 90-95% UR por 14, 28 e 42 dias (+ 3 dias de comercialização simulada à 25-26oC. A metade das frutas foi embalada em sacos de polietileno perfurado. O polietileno reduziu as perdas de peso das frutas durante o armazenamento, sem afetar outros parâmetros de qualidade estudados (firmeza de polpa, sólidos solúveis totais, acidez total titulável e relação sólidos solúveis totais/acidez total titulável. As frutas deste cultivar conservaram-se bem até 42 dias e o melhor estádio de maturação para o armazenamento foi o verde.To verify the effects of ripening stages and of polyethylene packing, `Reubennel' plums were picked at two ripening stages: green fruits with 25-50% red colour and semi-ripe fruits with 50-75% red colour, and stored for 14, 28 and 42 days at 0oC and 90-95% RH (+ 3 days of simulated marketing at 25-26oC. Half of the fruits were packed with perforated polyethylene bags. The polyethylene reduced fruit weight losses during cold storage, without affecting other parameters studied (firmness, total soluble solids, total titratable acidity and total soluble solids/total titratable acidity ratio. Fruits of this cultivar can be well stored up to 42 days and the best ripening stage during cold storage was the green stage.

  5. CLONING AND SEQUENCING OF PGIP FROM ‘JIN SERIES’ ALMOND (PRUNUS DULCIS

    Directory of Open Access Journals (Sweden)

    Yuhu Han

    2015-12-01

    Full Text Available Specific primers synthesized according to conservative regions of polygalacturonase inhibiting protein (PGIP gene were used to amplify Prunus Dulcis genomic DNA by polymerase-chain reaction (PCR. Six bands (pgip1, pgip2, pgip3, pgip4, pgip5 and pgip6 of genes were obtained and cloned into PBS-T vector. According to the length of bands, 717bp, 864bp, 796bp were A1 (pgip1, pgip2, pgip3, A2 (pgip4, A4 (pgip5, pgip6, respectively. DNA sequences showed that the fragments taken together were the gene encoding PGIP. A2 and A3 contained two exons interrupted by one intron, which has GT-AG sequence. Its DNA and amino acid sequences were highly homologies to those from Prunus Persica; Prunus Salicina; Prunus Americana; Prunus Mume, respectively. A conserved lencinerial fragment exists in the derived protein sequence.

  6. Effect of management (organic vs conventional) on volatile profiles of six plum cultivars (Prunus salicina Lindl.). A chemometric approach for varietal classification and determination of potential markers.

    Science.gov (United States)

    Cuevas, F J; Moreno-Rojas, J M; Arroyo, F; Daza, A; Ruiz-Moreno, M J

    2016-05-15

    The volatile profiles of six plum cultivars ('Laetitia', 'Primetime', 'Sapphire', 'Showtime', 'Songold' and 'Souvenir') produced under two management systems (conventional and organic) and harvested in two consecutive years were obtained by HS-SPME-GC-MS. Twenty-five metabolites were determined, five of which (pentanal, (E)-2-heptenal, 1-octanol, eucalyptol and 2-pentylfuran) are reported for the first time in Prunus salicina Lindl. Hexanal stood out as a major volatile compound affected by the management system. In addition, partial least square discriminant analysis (PLS-DA) achieved an effective classification of genotypes based on their volatile profiles. A high classification accuracy model was obtained with a sensitivity of 97.9% and a specificity of 99.6%. Furthermore, the application of a dual criterion, based on a method of variable selection, VIP (variable importance in projection) and the results of a univariate analysis (ANOVA), allowed the identification of potential volatile markers in 'Primetime', 'Showtime' and 'Souvenir' genotypes (cultivars not characterised to date). Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Study of the volatile compounds from plum (Prunus domestica L. cv. Horvin and estimation of their contribution to the fruit aroma Estudo de compostos voláteis de ameixa (Prunus domestica L. cv. Horvin e estimativa da sua contribuição ao aroma

    Directory of Open Access Journals (Sweden)

    Jorge Antonio Pino

    2012-03-01

    Full Text Available Simultaneous Distillation-Extraction (SDE and headspace-solid phase microextraction (HS-SPME combined with GC-FID and GC-MS were used to analyze volatile compounds from plum (Prunus domestica L. cv. Horvin and to estimate the most odor-active compounds by application of the Odor Activity Values (OAV. The analyses led to the identification of 148 components, including 58 esters, 23 terpenoids, 14 aldehydes, 11 alcohols, 10 ketones, 9 alkanes, 7 acids, 4 lactones, 3 phenols, and other 9 compounds of different structures. According to the results of SDE-GC-MS, SPME-GC-MS and OAV, ethyl 2-methylbutanoate, hexyl acetate, (E-2-nonenal, ethyl butanoate, (E-2-decenal, ethyl hexanoate, nonanal, decanal, (E-β-ionone, Γ-dodecalactone, (Z-3-hexenyl acetate, pentyl acetate, linalool, Γ-decalactone, butyl acetate, limonene, propyl acetate, Δ-decalactone, diethyl sulfide, (E-2-hexenyl acetate, ethyl heptanoate, (Z-3-hexenol, (Z-3-hexenyl hexanoate, eugenol, (E-2-hexenal, ethyl pentanoate, hexyl 2-methylbutanoate, isopentyl hexanoate, 1-hexanol, Γ-nonalactone, myrcene, octyl acetate, phenylacetaldehyde, 1-butanol, isobutyl acetate, (E-2-heptenal, octadecanal, and nerol are characteristic odor active compounds in fresh plums since they showed concentrations far above their odor thresholds.As técnicas de extração-destilação simultâneas (SDE e de headspace-microextração em fase sólida (HS-SPME combinadas com GC-FID e GC-MS foram usadas para analisar compostos voláteis da ameixa (Prunus domestica L. cv. Horvin e para estimar os compostos de aroma mais ativos, pela aplicação de valores de atividade olfativa (OAV, considerando os compostos voláteis presentes no headspace da fruta. As análises levaram à identificação de 148 componentes, incluindo 58 ésteres, 23 terpenoides, 14 aldeídos, 11 álcoois, 10 cetonas, 9 alcanos, 7 ácidos, 4 lactonas, 3 fenóis e 9 outros compostos de diferentes estruturas. De acordo om os resultados de SDE

  8. Self-compatible peach (Prunus persica) has mutant versions of the S haplotypes found in self-incompatible Prunus species.

    Science.gov (United States)

    Tao, Ryutaro; Watari, Akiko; Hanada, Toshio; Habu, Tsuyoshi; Yaegaki, Hideaki; Yamaguchi, Masami; Yamane, Hisayo

    2007-01-01

    This study demonstrates that self-compatible (SC) peach has mutant versions of S haplotypes that are present in self-incompatible (SI) Prunus species. All three peach S haplotypes, S (1), S (2), and S (2m), found in this study encode mutated pollen determinants, SFB, while only S (2m) has a mutation that affects the function of the pistil determinant S-RNase. A cysteine residue in the C5 domain of the S (2m)-RNase is substituted by a tyrosine residue, thereby reducing RNase stability. The peach SFB mutations are similar to the SFB mutations found in SC haplotypes of sweet cherry (P. avium) and Japanese apricot (P. mume). SFB (1) of the S (1) haplotype, a mutant version of almond (P. dulcis) S (k) haplotype, encodes truncated SFB due to a 155 bp insertion. SFB (2) of the S (2) and S (2m) haplotypes, both of which are mutant versions of the S (a) haplotype in Japanese plum (P. salicina), encodes a truncated SFB due to a 5 bp insertion. Thus, regardless of the functionality of the pistil determinant, all three peach S haplotypes are SC haplotypes. Our finding that peach has mutant versions of S haplotypes that function in almond and Japanese plum, which are phylogenetically close and remote species, respectively, to peach in the subfamily Prunoideae of the Roasaceae, provides insight into the SC/SI evolution in Prunus. We discuss the significance of SC pollen part mutation in peach with special reference to possible differences in the SI mechanisms between Prunus and Solanaceae.

  9. Basic RNases of wild almond (Prunus webbii): cloning and characterization of six new S-RNase and one "non-S RNase" genes.

    Science.gov (United States)

    Banović, Bojana; Surbanovski, Nada; Konstantinović, Miroslav; Maksimović, Vesna

    2009-03-01

    In order to investigate the S-RNase allele structure of a Prunus webbii population from the Montenegrin region of the Balkans, we analyzed 10 Prunus webbii accessions. We detected 10 different S-RNase allelic variants and obtained the nucleotide sequences for six S-RNases. The BLAST analysis showed that these six sequences were new Prunus webbii S-RNase alleles. It also revealed that one of sequenced alleles, S(9)-RNase, coded for an amino acid sequence identical to that for Prunus dulcis S(14)-RNase, except for a single conservative amino acid replacement in the signal peptide region. Another, S(3)-RNase, was shown to differ by only three amino acid residues from Prunus salicina Se-RNase. The allele S(7)-RNase was found to be inactive by stylar protein isoelectric focusing followed by RNase-specific staining, but the reason for the inactivity was not at the coding sequence level. Further, in five of the 10 analyzed accessions, we detected the presence of one active basic RNase (marked PW(1)) that did not amplify with S-RNase-specific DNA primers. However, it was amplified with primers designed from the PA1 RNase nucleotide sequence (basic "non-S RNase" of Prunus avium) and the obtained sequence showed high homology (80%) with the PA1 allele. Although homologs of PA1 "non-S RNases" have been reported in four other Prunus species, this is the first recorded homolog in Prunus webbii. The evolutionary implications of the data are discussed.

  10. Xylem development in prunus flower buds and the relationship to deep supercooling.

    Science.gov (United States)

    Ashworth, E N

    1984-04-01

    Xylem development in eight Prunus species was examined and the relationship to deep supercooling assessed. Dormant buds of six species, P. armeniaca, P. avium, P. cerasus, P. persica, P. salicina, and P. sargentii deep supercooled. Xylem vessel elements were not observed within the dormant floral primordia of these species. Instead, discrete bundles containing procambial cells were observed. Vascular differentiation resumed and xylem continuity was established during the time that the capacity to deep supercool was lost. In P. serotina and P. virginiana, two species which do not supercool, xylem vessels ran the length of the inflorescence and presumably provided a conduit for the spread of ice into the bud. The results support the hypothesis that the lack of xylem continuity is an important feature of buds which deep supercool.

  11. Prunus fruit juices

    NARCIS (Netherlands)

    Toydemir, Gamze; Boyacioglu, Dilek; Hall, R.D.; Beekwilder, M.J.; Capanoglu, Esra

    2017-01-01

    The juice drinks obtained from Prunus fruit species, apricot (Prunus armeniaca), cherry (sweet cherry (Prunus avium) and sour cherry (Prunus cerasus)), peach (Prunus persica), and plum (Prunus domestica), are gaining increasing interest as a convenient alternative to fresh fruits. The conventional

  12. Characterization of New Isolates of Apricot vein clearing-associated virus and of a New Prunus-Infecting Virus: Evidence for Recombination as a Driving Force in Betaflexiviridae Evolution.

    Directory of Open Access Journals (Sweden)

    Armelle Marais

    Full Text Available Double stranded RNAs from Prunus samples gathered from various surveys were analyzed by a deep-sequencing approach. Contig annotations revealed the presence of a potential new viral species in an Azerbaijani almond tree (Prunus amygdalus and its genome sequence was completed. Its genomic organization is similar to that of the recently described Apricot vein clearing associated virus (AVCaV for which two new isolates were also characterized, in a similar fashion, from two Japanese plums (Prunus salicina from a French germplasm collection. The amino acid identity values between the four proteins encoded by the genome of the new virus have identity levels with those of AVCaV which fall clearly outside the species demarcation criteria. The new virus should therefore be considered as a new species for which the name of Caucasus prunus virus (CPrV has been proposed. Phylogenetic relationships and nucleotide comparisons suggested that together with AVCaV, CPrV could define a new genus (proposed name: Prunevirus in the family Betaflexiviridae. A molecular test targeting both members of the new genus was developed, allowing the detection of additional AVCaV isolates, and therefore extending the known geographical distribution and the host range of AVCaV. Moreover, the phylogenetic trees reconstructed with the amino acid sequences of replicase, movement and coat proteins of representative Betaflexiviridae members suggest that Citrus leaf blotch virus (CLBV, type member of the genus Citrivirus may have evolved from a recombination event involving a Prunevirus, further highlighting the importance of recombination as a driving force in Betaflexiviridae evolution. The sequences reported in the present manuscript have been deposited in the GenBank database under accession numbers KM507061-KM504070.

  13. African Journal of Biotechnology - Vol 13, No 32 (2014)

    African Journals Online (AJOL)

    Storage of 'Laetitia' plums (Prunus salicina) under controlled atmosphere conditions · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. CA Steffens, CVT do Amarante, E de Oliveira Alves, A Brackmann, TR Correa, BP Espindola ...

  14. Genotyping by sequencing for SNP-based linkage analysis and identification of QTLs linked to fruit quality traits in Japanese plum (Prunus salicina Lindl.)

    Science.gov (United States)

    Marker-assisted selection (MAS) in stone fruit (Prunus species) breeding is currently difficult to achieve due to the polygenic nature of themost relevant agronomic traits linked to fruit quality. Genotyping by sequencing (GBS), however, provides a large quantity of useful data suitable for finemapp...

  15. Impact of Compost Application during 5 Years on Crop Production, Soil Microbial Activity, Carbon Fraction, and Humification Process

    NARCIS (Netherlands)

    Jindo, K.; Chocano, C.; Melgares de Aguilar, J.; González, D.; Hernandez, T.; García, C.

    2016-01-01

    Compost amendment is considered as a practical tool to increase the soil organic matter (SOM), which contributes to agricultural sustainability. The objective of the present work was to evaluate the impacts of organic soil management over 5 years on orchard prune production (Prunus salicina),

  16. Maturação e qualidade pós-colheita de ameixas 'laetitia' com a aplicação pré-colheita de AVG e GA3

    Directory of Open Access Journals (Sweden)

    Cristiano André Steffens

    2011-03-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da aplicação pré-colheita de aminoetoxivinilglicina (AVG; 0; 90; 125 mg L-1 e ácido giberélico (GA3; 0 e 100 mg L-1 sobre a maturação e a qualidade de ameixas 'Laetitia' após o armazenamento refrigerado. Foi utilizado o delineamento em blocos casualizados, com seis tratamentos (três doses de AVG x duas doses de GA3 e quatro repetições. A aplicação do GA3 e do AVG foi realizada 28 e 7 dias antes do início da primeira colheita, respectivamente. O experimento foi conduzido em 2007 e em 2009. Em cada ano foram realizadas três colheitas, sendo 11-01-2007, 17-01-2007 e 25-01-2007 (colheita comercial; 15-01-2009, 22-01-2009 (colheita comercial, e 29-01-2009. Em 2007, frutos da terceira colheita foram armazenados em uma câmara fria comercial durante 22 dias, a 0,5ºC, e umidade relativa de 92% e mais cinco dias de exposição em condição ambiente (temperatura média de 23ºC e umidade relativa média de 60%. A aplicação pré-colheita de AVG (125 mg L-1, isoladamente ou GA3, ou GA3 + AVG, retarda a maturação de ameixas 'Laetitia' na planta. O tratamento pré-colheita de ameixas 'Laetitia' com GA3, seguido da aplicação de AVG, manteve maior firmeza da polpa dos frutos após o armazenamento refrigerado.

  17. Modificação da atmosfera na qualidade pós-colheita de ameixas cv. Reubennel Modified atmosphere on postharvest quality of plums cv. Reubennel

    Directory of Open Access Journals (Sweden)

    Marcelo Barbosa Malgarim

    2005-12-01

    Full Text Available Ameixas, de modo geral, têm curto período de conservação pós-colheita, havendo necessidade de otimizar as condições de colheita e de armazenamento. Este trabalho objetivou avaliar o efeito de diferentes modificadores de atmosfera, durante o armazenamento refrigerado, na qualidade pós-colheita de ameixas cv. Reubennel. Frutas no estádio de maturação meio-maduro foram submetidas aos seguintes modificadores de atmosfera: filmes de polietileno de 12,5 e 15µm de espessura e cera à base de carnaúba e avaliadas após 10; 20; 30 e 40 dias de armazenamento a 0ºC e UR de 90-95%. Avaliaram-se a perda de massa, cor, firmeza da polpa, pH, sólidos solúveis (SS, acidez titulável (AT, relação SS/AT, incidência de podridões, escurecimento interno e características sensoriais. Essas avaliações foram realizadas 3 dias após a retirada das frutas da câmara fria. Verificou-se que a cera à base de carnaúba GARFRESH N (BL9,5, sem diluição, e filmes de polietileno de 12,5 e 15µm reduziram a perda de massa, porém são impróprios para a modificação da atmosfera, em ameixas cv. Reubennel durante o armazenamento refrigerado. Ameixas cv. Reubennel mantêm a qualidade quando armazenadas durante 30 dias a 0ºC sem atmosfera modificada.Plums quickly loose postharvest quality, which makes imperative to optimize harvest and storage conditions. The objective of this work was to determine the effects of various atmosphere modifiers on the postharvest quality of cold storage plums, cv. Reubennel. Semi-mature fruits were stored under the following atmosphere modifiers conditions: polyethylene films 12,5 or 15µm of thickness; or carnauba wax. After submitted to these conditions the fruits were stored for 10, 20, 30 and 40 days in a cold room at 0ºC and 90-95% RH. Three days after taken out from the cold storage, the fruits were evaluated about: weight loss; color; firmness; pH; soluble solids (SS; titratable acidity (TA; SS/TA ratio; incidence of

  18. Survey of Prunus necrotic ringspot virus in Rose and Its Variability in Rose and Prunus spp.

    Science.gov (United States)

    Moury, B; Cardin, L; Onesto, J P; Candresse, T; Poupet, A

    2001-01-01

    ABSTRACT A survey for viruses in rose propagated in Europe resulted in detection of only Prunus necrotic ringspot virus (PNRSV) among seven viruses screened. Four percent of cut-flower roses from different sources were infected with PNRSV. Progression of the disease under greenhouse conditions was very slow, which should make this virus easy to eradicate through sanitary selection. Comparison of the partial coat protein gene sequences for three representative rose isolates indicated that they do not form a distinct phylogenetic group and show close relations to Prunus spp. isolates. However, a comparison of the reactivity of monoclonal antibodies raised against these isolates showed that the most prevalent PNRSV serotype in rose was different from the most prevalent serotype in Prunus spp. All of the 27 rose isolates tested infected P. persica seedlings, whereas three of the four PNRSV isolates tested from Prunus spp. were poorly infectious in Rosa indica plants. These data suggest adaptation of PNRSV isolates from Prunus spp., but not from rose, to their host plants. The test methodologies developed here to evaluate PNRSV pathogenicity in Prunus spp. and rose could also help to screen for resistant genotypes.

  19. DIAGNOSTICS OF VIRUS PHYTOPATHOGENS FRUIT TREE PLUM POX VIRUS, PRUNUS NECROTIC RINGSPOT VIRUS AND PRUNUS DWARF VIRUS BY BIOLOGICAL AND MOLECULAR DIAGNOSTICS

    Directory of Open Access Journals (Sweden)

    Július Rozák

    2013-02-01

    Full Text Available The aim of this study was to determine the incidence of viral phytopathogen Plum pox virus, Prunus necrotic ringspot virus and Prunus dwarf virus in selected localities of Slovakia and diagnose them using a molecular and biological methods. Forty samples of fruit trees of the genus Prunus, twenty samples from intensive plantings and twenty samples from wild subject were analysed. Biological diagnostic by using biological indicators Prunus persica cv. GF 305, Prunus serrulata cv. Schirofugen and molecular diagnostic by mRT-PCR were applied. Five samples with Plum pox virus were infected. The two samples positive for Prunus necrotic ringspot virus and one sample for Prunus dwarf virus were confirmed. The two samples were found to be infected with two viruses Prunus necrotic ringspot virus and Prunus dwarf virus. This work focuses on two techniques, their application to the diagnosis of stone fruit viruses and their routinely used for sanitary and certification programmes.

  20. Novel Paraconiothyrium species on stone fruit trees and other woody hosts.

    Science.gov (United States)

    Damm, U; Verkley, G J M; Crous, P W; Fourie, P H; Haegi, A; Riccioni, L

    2008-06-01

    Coniothyrium-like fungi are common wood and soil inhabitants and hyperparasites on other fungi. They belong to different fungal genera within the Pleosporales. Several isolates were obtained on wood of different Prunus species (plum, peach and nectarine) from South Africa, on Actinidia species from Italy and on Laurus nobilis from Turkey. Morphological and cultural characteristics as well as DNA sequence data (5.8S nrDNA, ITS1, ITS2, partial SSU nrDNA) were used to characterise them. The isolates belonged to three species of the recently established genus Paraconiothyrium. This is the first report of Paraconiothyrium brasiliense on Prunus spp. from South Africa. Two new species are described, namely Paraconiothyrium variabile sp. nov. on Prunus persica and Prunus salicina from South Africa, on Actinidia spp. from Italy and on Laurus nobilis from Turkey, and Paraconiothyrium africanum sp. nov. on Prunus persica from South Africa. Although other known species of Paraconiothyrium commonly produce aseptate conidia, those of P. africanum and P. hawaiiense comb. nov. are predominantly two-celled.

  1. DIAGNOSTICS OF VIRUS PHYTOPATHOGENS FRUIT TREE PLUM POX VIRUS, PRUNUS NECROTIC RINGSPOT VIRUS AND PRUNUS DWARF VIRUS BY BIOLOGICAL AND MOLECULAR DIAGNOSTICS

    OpenAIRE

    Július Rozák; Zdenka Gálová

    2013-01-01

    The aim of this study was to determine the incidence of viral phytopathogen Plum pox virus, Prunus necrotic ringspot virus and Prunus dwarf virus in selected localities of Slovakia and diagnose them using a molecular and biological methods. Forty samples of fruit trees of the genus Prunus, twenty samples from intensive plantings and twenty samples from wild subject were analysed. Biological diagnostic by using biological indicators Prunus persica cv. GF 305, Prunus serrulata cv. Schirofugen a...

  2. Polar extracts from (Tunisian Acacia salicina Lindl. Study of the antimicrobial and antigenotoxic activities

    Directory of Open Access Journals (Sweden)

    Boubaker Jihed

    2012-04-01

    Full Text Available Abstract Background Methanolic, aqueous and Total Oligomer Flavonoids (TOF-enriched extracts obtained from the leaves of Acacia salicina 'Lindl.' were investigated for antibacterial, antimutagenic and antioxidant activities. Methods The antimicrobial activity was tested on the Gram positive and Gram negative reference bacterial strains. The Mutagenic and antimutagenic activities against direct acting mutagens, methylmethane sulfonate (MMS and 4-nitro-o-phenylenediamine (NOPD, and indirect acting mutagens, 2-aminoanthracene (2-AA and benzo[a]pyrene (B(aP were performed with S. typhimurium TA102 and TA98 assay systems. In addition, the enzymatic and nonenzymatic methods were employed to evaluate the anti-oxidative effects of the tested extracts. Results A significant effect against the Gram positive and Gram negative reference bacterial strains was observed with all the extracts. The mutagenic and antimutagenic studies revealed that all the extracts decreased the mutagenicity induced by B(aP (7.5 μg/plate, 2-AA (5 μg/plate, MMS (1.3 mg/plate and NOPD (10 μg/plate. Likewise, all the extracts showed an important free radical scavenging activity towards the superoxide anion generated by the xanthine/xanthine oxidase assay system, as well as high Trolox Equivalent Antioxidant Capacity (TEAC, against the 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid diammonium salt (ABTS+• radical. TOF-enriched extract exhibited the highest protective effect against free radicals, direct acting-mutagen and metabolically activated S9-dependent mutagens. Conclusions The present study indicates that the extracts from A. salicina leaves are a significant source of compounds with the antimutagenic and antioxidant activities, and this may be useful for developing potential chemopreventive substances.

  3. Genomic Sequencing of Japanese Plum (Prunus salicina Lindl. Mutants Provides a New Model for Rosaceae Fruit Ripening Studies

    Directory of Open Access Journals (Sweden)

    Angel Fernandez i Marti

    2018-02-01

    Full Text Available It has recently been described that the Japanese plum “Santa Rosa” bud sport series contains variations in ripening pattern: climacteric, suppressed-climacteric and non-climacteric types. This provides an interesting model to study the role of ethylene and other key mechanisms governing fruit ripening, softening and senescence. The aim of the current study was to investigate such differences at the genomic level, using this series of plum bud sports, with special reference to genes involved in ethylene biosynthesis, signal transduction, and sugar metabolism. Genomic DNA, isolated from leaf samples of six Japanese plum cultivars (“Santa Rosa”, “July Santa Rosa”, “Late Santa Rosa”, “Sweet Miriam”, “Roysum”, and “Casselman”, was used to construct paired-end standard Illumina libraries. Sequences were aligned to the Prunus persica genome, and genomic variations (SNPs, INDELS, and CNV's were investigated. Results determined 12 potential candidate genes with significant copy number variation (CNV, being associated with ethylene perception and signal transduction components. Additionally, the Maximum Likelihood (ML phylogenetic tree showed two sorbitol dehydrogenase genes grouping into a distinct clade, indicating that this natural group is well-defined and presents high sequence identity among its members. In contrast, the ethylene group, which includes ACO1, ACS1, ACS4, ACS5, CTR1, ERF1, ERF3, and ethylene-receptor genes, was widely distributed and clustered into 10 different groups. Thus, ACS, ERF, and sorbitol dehydrogenase proteins potentially share a common ancestor for different plant genomes, while the expansion rate may be related to ancestral expansion rather than species-specific events. Based on the distribution of the clades, we suggest that gene function diversification for the ripening pathway occurred prior to family extension. We herein report all the frameshift mutations in genes involved in sugar transport

  4. Genomic Sequencing of Japanese Plum (Prunus salicina Lindl.) Mutants Provides a New Model for Rosaceae Fruit Ripening Studies.

    Science.gov (United States)

    Fernandez I Marti, Angel; Saski, Christopher A; Manganaris, George A; Gasic, Ksenija; Crisosto, Carlos H

    2018-01-01

    It has recently been described that the Japanese plum "Santa Rosa" bud sport series contains variations in ripening pattern: climacteric, suppressed-climacteric and non-climacteric types. This provides an interesting model to study the role of ethylene and other key mechanisms governing fruit ripening, softening and senescence. The aim of the current study was to investigate such differences at the genomic level, using this series of plum bud sports, with special reference to genes involved in ethylene biosynthesis, signal transduction, and sugar metabolism. Genomic DNA, isolated from leaf samples of six Japanese plum cultivars ("Santa Rosa", "July Santa Rosa", "Late Santa Rosa", "Sweet Miriam", "Roysum", and "Casselman"), was used to construct paired-end standard Illumina libraries. Sequences were aligned to the Prunus persica genome, and genomic variations (SNPs, INDELS, and CNV's) were investigated. Results determined 12 potential candidate genes with significant copy number variation (CNV), being associated with ethylene perception and signal transduction components. Additionally, the Maximum Likelihood (ML) phylogenetic tree showed two sorbitol dehydrogenase genes grouping into a distinct clade, indicating that this natural group is well-defined and presents high sequence identity among its members. In contrast, the ethylene group, which includes ACO1, ACS1, ACS4, ACS5, CTR1, ERF1, ERF3, and ethylene-receptor genes, was widely distributed and clustered into 10 different groups. Thus, ACS, ERF, and sorbitol dehydrogenase proteins potentially share a common ancestor for different plant genomes, while the expansion rate may be related to ancestral expansion rather than species-specific events. Based on the distribution of the clades, we suggest that gene function diversification for the ripening pathway occurred prior to family extension. We herein report all the frameshift mutations in genes involved in sugar transport and ethylene biosynthesis detected as well

  5. Storage of 'Laetitia' plums ( Prunus salicina ) under controlled ...

    African Journals Online (AJOL)

    Upon removal from the cold storage chamber and after four days in ambient conditions (20±2°C/60±5% RH), the fruit were assessed in terms of: respiration and ethylene production rates; flesh firmness; texture; titrable acidity; red color index and hue angle (ho) of the skin; incidence of fruit cracking and internal breakdown ...

  6. Qualidade de ameixas 'Laetitia' em função da temperatura e da atmosfera de armazenamento

    Directory of Open Access Journals (Sweden)

    Erlani de Oliveira Alves

    2010-12-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da temperatura e de atmosferas de armazenamento sobre a manutenção da qualidade de ameixas 'Laetitia'. Os tratamentos avaliados constituíram-se na combinação de duas temperaturas (-0,5ºC e 0,5ºC, com três atmosferas de armazenamento: armazenamento refrigerado (AR, com 21,0 kPa de O2 + 0,03 kPa de CO2; atmosfera controlada (AC, com 1,0 kPa de O2 + 3,0 kPa de CO2; e AC, com 2,0 kPa de O2 + 5,0 kPa de CO2. Após 60 dias de armazenamento, foram avaliadas: taxas respiratória e de produção de etileno, acidez titulável (AT, firmeza de polpa, atributos de textura, índice de cor vermelha e ângulo 'hue' (hº da casca, e incidência de rachaduras, podridões e degenerescência da polpa. O armazenamento refrigerado a -0,5ºC resultou em menores valores para o índice de cor vermelha, taxa respiratória e de produção de etileno e incidência de frutos rachados. Em ambas as condições de AC, a temperatura de 0,5ºC resultou em menor índice de cor vermelha, cor da epiderme mais verde, maior firmeza de polpa e menor taxa de produção de etileno, tanto na abertura da câmara como após quatro dias em condição ambiente. As condições de AC retardaram o amadurecimento dos frutos e reduziram a incidência de degenerescência de polpa. O armazenamento em AC, com 2,0 kPa de O2 + 5,0 kPa de CO2, a 0,5ºC, proporcionou menor taxa respiratória e menor incidência de podridões na saída da câmara, mas maior AT e força para penetração da polpa, após quatro dias em condição ambiente. No entanto, o armazenamento da ameixa 'Laetitia', nas condições de AC avaliadas, por um período de 60 dias, não reduziu a incidência de degenerescência da polpa.

  7. Micropropagation of ornamental Prunus spp. and GF305 peach, a Prunus viral indicator.

    Science.gov (United States)

    Kalinina, Anna; Brown, Daniel C W

    2007-07-01

    A micropropagation approach was developed for nine ornamental Prunus species, P. americana, P. cistena, P. glandulosa, P. serrulata 'Kwanzan', P. laurocerasus, P. sargentii, P. tomentosa, P. triloba, P. virginiana 'Schubert', commercially important in North America, and GF305 peach, commonly used for Prunus virus indexing. The micropropagation cycle based on proliferation of vegetative tissues includes establishment of tissue culture through introduction of shoot meristems in vitro, shoot proliferation, root induction and plant acclimatization steps and can be completed in 5 months. A meristem sterilization protocol minimized bacterial and fungal contamination. Multiple shoot formation in ornamental Prunus was obtained through the use of 1 mg l(-1) 6-benzyladenine. For GF305 peach, alteration in the sugar composition, fructose instead of sucrose, and addition of 1 mg l(-1 )ferulic acid had a significant impact on the shoot proliferation rate and maintenance of long-term in vitro culture. Rooting and plant acclimatization conditions were improved using a two-step protocol with a 4-day root induction in indole-3-butiric acid (IBA)-containing media with consequent 3-week root elongation in IBA-free media. One-month incubation of rooted shoots in a vermiculite-based medium resulted in additional shoot and root growth and provided better acclimatization and plant recovery. The micropropagation approach can be used for maintenance of the clonal properties for Prunus spp. as well as a protocol to support meristem therapy against viral infection.

  8. Comportamento de duas cultivares de pessegueiro com interenxerto da ameixeira 'Januária' Behavior of two peach cultivars with 'Januária' as a Japanese plum interstock

    Directory of Open Access Journals (Sweden)

    JOÃO ALEXIO SCARPARE FILHO

    2000-04-01

    Full Text Available Os efeitos da utilização de interenxerto (filtro da ameixeira 'Januária' (Prunus salicina L. foram verificados em duas cultivares de pessegueiro (Prunus persica L., Tropical e Ouromel-2. O porta-enxerto básico utilizado foi o pessegueiro 'Okinawa'. Foram avaliadas duas safras, respectivamente, na 4ª e 5ª folha de plantas enxertadas e estabelecidas no campo em 1994. O uso do enxerto intermediário diminuiu o vigor das plantas -- perímetro e área da secção do tronco, perímetro das pernadas e comprimento dos entrenós -- e aumentou o peso do fruto e a produção por planta, em comparação com as copas-controle enxertadas diretamente no 'Okinawa'. A eficiência produtiva, o índice de fertilidade, o florescimento e a frutificação efetiva foram incrementados com o uso do filtro. A interenxertia com ameixeira 'Januária' apresenta adequadas características de compatibilidade com o pessegueiro, como forma de compactar as copas e aumentar a produtividade e o tamanho do fruto.The effects of interstock with 'Januária' Japanese plum (Prunus salicina L. were verified in the performance of peach (Prunus persica L. cultivars Tropical and Ouromel-2. The basic rootstock used was 'Okinawa' peach. Two crops were evaluated at fourth and fifth leaves of plants established in 1994. The interstock caused decrease of the vigour of the plants -- perimeter and cross-sectional area of the trunk, perimeter of the primary branches and length of the internodes -- and increased fruit weight and production per plant, in comparison to the plant control without interstock budded on 'Okinawa'. Yield efficiency, fertility index, flowering and fruit set were increased with 'Januária' interstock. This interstock process presents an adequate characteristic of compatibility for the peach tree, as a form of compacting the plants, increasing the productivity and the fruit size.

  9. OBTENÇÃO DE BARRAS DE CEREAIS DE CAJU AMEIXA COM ALTO TEOR DE FIBRAS

    Directory of Open Access Journals (Sweden)

    LUíSA HELENA ELLERY MOUR�O

    2010-03-01

    Full Text Available

    As barras de cereais vêm apresentando crescimento constante junto ao público consumidor. Considerando o crescimento do segmento de barras de cereais no setor de alimentos este trabalho teve como objetivos desenvolver barras de cereais de caju ameixa com alto teor de fi bras utilizando ingredientes funcionais e matéria-prima regional; inovar no uso de ingredientes não utilizados nas formulações convencionais; realizar análises físicas, físicoquímicas e químicas e avaliar as propriedades nutricionais. Formulou-se dois tipos de barras, (F1 e (F2 a partir de uma formulação básica (FB. A FB foi processada utilizando-se aveia, fl ocos de arroz, leite em pó desnatado, açúcar mascavo, glucose de milho, gordura vegetal hidrogenada, canela, lecitina de soja e fl ocos de milho. As formulações F1 e F2 diferiram da FB nas concentrações dos ingredientes, na adição de linhaça, de caju ameixa, de castanha de caju, na substituição da gordura vegetal hidrogenada por óleo de canola e na retirada dos fl ocos de milho. A FB resultou 94,39 kcal e F1 e F2 em 95,69 kcal e 101,06 kcal respectivamente em 25g utilizando os coefi cientes de ATWATER. A modifi - cação dos ingredientes provocou aumento signifi cativo no teor de fi bra alimentar tornando as barras F1 e F2 produtos com alto teor de fi bra alimentar (10,58g e 12,69g/100g, respectivamente. Conclui-se que as barras de cereais F1 e F2 podem ser indicadas para indivíduos com constipação intestinal, dislipidemias e sobrepeso. Além disso, ambas poderiam ser enquadradas no conceito de alimento funcional, devido ao fato de conterem um maior teor de fi bras dietéticas que contribuem para a manutenção da boa saúde.

  10. A molecular phylogeny of selected species of genus Prunus L ...

    African Journals Online (AJOL)

    (Syn. Prunus amygdalus) and Prunus cornuta (Wall. ex. Royle) Steudel. These are indigenous to Pakistan. In the ITS strict consensus results for example, the clade consisting of Laurocerasus, Padus and Cerasus subgenera are sister to the rest of the clades in the phylogenetic tree. Key words: Phylogeny, Prunus, Pakistan, ...

  11. Prunus dulcis, Batch

    African Journals Online (AJOL)

    STORAGESEVER

    2010-06-07

    Jun 7, 2010 ... almond (Prunus dulcis, Batch) genotypes as revealed by PCR analysis. Yavar Sharafi1*, Jafar Hajilou1, Seyed AbolGhasem Mohammadi2, Mohammad Reza Dadpour1 and Sadollah Eskandari3. 1Department of Horticulture, Faculty of Agriculture, University of Tabriz, Tabriz, 5166614766, Iran.

  12. Manejo do etileno em ameixas 'Laetitia' armazenadas sob atmosferas controlada e modificada ativa

    Directory of Open Access Journals (Sweden)

    Thais Roseli Corrêa

    2011-09-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito de condições de atmosfera controlada (AC e atmosfera modificada (AM ativa (filme PEBD de 40 µm, com duas perfurações de 1,0 mm de diâmetro, associadas ao manejo do etileno, sobre a manutenção da qualidade em ameixas 'Laetitia'. Os tratamentos avaliados consistiram no armazenamento refrigerado (60 dias a 0,5±0,1ºC em: atmosfera refrigerada (AR; 21,0 kPa O2 + <0,03 kPa CO2; AM; AM + baixo etileno (BE; AC; e AC + 1-MCP (1,0 µL L-1. As pressões parciais de O2 + CO2 (kPa foram de 1,0 + 1,0 e 2,5 + <0,1, em AC e AM, respectivamente. Os frutos armazenados em AC, independentemente do tratamento com 1-MCP, apresentaram retardo no amadurecimento, quando comparados aos frutos em AR. Contudo, os melhores resultados para a manutenção da textura da polpa e da acidez titulável foram obtidos em AC + 1-MCP. Os tratamentos não interferiram para a incidência de podridões, rachaduras e degenerescência da fruta. Frutos dos tratamentos AM + BE e AC + 1-MCP apresentaram menor escurecimento da polpa e maior aceitabilidade quanto à cor e ao sabor na análise sensorial em relação àqueles armazenados em AR.

  13. Maturação e qualidade pós-colheita de ameixas 'laetitia' com a aplicação pré-colheita de AVG e GA3

    OpenAIRE

    Cristiano André Steffens; Cassandro Vidal Talamini do Amarante; Ricardo Chechi; João Paulo Generoso Silveira; Thais Roseli Corrêa

    2011-01-01

    O objetivo deste trabalho foi avaliar o efeito da aplicação pré-colheita de aminoetoxivinilglicina (AVG; 0; 90; 125 mg L-1) e ácido giberélico (GA3; 0 e 100 mg L-1) sobre a maturação e a qualidade de ameixas 'Laetitia' após o armazenamento refrigerado. Foi utilizado o delineamento em blocos casualizados, com seis tratamentos (três doses de AVG x duas doses de GA3) e quatro repetições. A aplicação do GA3 e do AVG foi realizada 28 e 7 dias antes do início da primeira colheita, respectivamente. ...

  14. Early growth performances of various seed sources of black (Prunus ...

    African Journals Online (AJOL)

    Early growth performances of various seed sources of black (Prunus serotina Erhr.) and wild cherry ( Prunus avium L.) seedlings on low and high elevation sites in the western Black Sea Region of Turkey.

  15. Two Types of New Natural Materials for Fruit Vinegar in Prunus Plants

    Directory of Open Access Journals (Sweden)

    Zhao Han

    2017-01-01

    Full Text Available To increase Prunus armeniaca × P. sibirica and P. domestica × P. armeniaca added value; three natural fruit vinegars were designed. The results showed the nutrition of Prunus domestica × P. armeniaca cultivar Fengweimeigui vinegar (T1 had high minerals and microelements, especially the Ca and Mg reached to the 150.00mg/L, 85.40 mg/L, respectively; the vinegar of Prunus armeniaca × P. sibirica cultivar Zhongren No.1 (T2 not only have rich Na (2800.00 mg/L, P (123.00 mg/L, but also have plentiful amino acid that content reached to 200.08 mg/L. However, the mixture vinegar (T3 with pulps from Prunus domestica × P. armeniaca and Prunus armeniaca × P. sibirica had the middle nutrient contents, but the property was balanced. We therefore conclude that solid fermentation is a suitable method to preserve nutrients and value-added for Prunus plants fruit, and three types vinegars are suitable for different age people, and the difference nutrient contents and typical characteristic indicate that three vinegars are competitive products in market.

  16. Spatial heterogeneity in post-dispersal predation on Prunus and Uvularia seeds.

    Science.gov (United States)

    Webb, Sara L; Willson, Mary F

    1985-08-01

    We investigated effects of seed density, distance from parent, and habitat (woods, open field) on post-dispersal predation risk (chiefly by rodents) for seeds of Prunus virginiana (Rosaceae). Additional study of the habitat effect (woods, open field, treefall gap) was made with seeds of Prunus avium (Rosaceae) and Uvularia grandiflora (Liliaceae). Density of Prunus seeds (range 2-40 seeds/group) did not affect predation risk for individual seeds. Distance from parent plants did influence predation risk, which was greatest directly beneath parents. This distance effect primarily comprised a sharp drop in risk within 2 m of parents, a distance too small to generate a "spacing rule" for conspecifics.We found that habitat strongly influenced predation intensity. Rates of removal of Prunus seeds were higher in woods than in open fields, except when overall predation intensity was very low and no pattern could be discerned. Prunus seed removal rates were higher in closed woods than in treefall gaps. Consequently, a Prunus seed will more likely escape predation if dispersed to an open site. In contrast, Uvularia seed removal rates were higher in open fields than in woods but did not differ between closed woods and tree-fall gaps.Predation intensity was spatially patchy between and within experimental arrays, but was consistent over time at some specific points in space, possibly reflecting home ranges of seed predators.

  17. A fruit quality gene map of Prunus

    Directory of Open Access Journals (Sweden)

    Bliss Fredrick A

    2009-12-01

    Full Text Available Abstract Background Prunus fruit development, growth, ripening, and senescence includes major biochemical and sensory changes in texture, color, and flavor. The genetic dissection of these complex processes has important applications in crop improvement, to facilitate maximizing and maintaining stone fruit quality from production and processing through to marketing and consumption. Here we present an integrated fruit quality gene map of Prunus containing 133 genes putatively involved in the determination of fruit texture, pigmentation, flavor, and chilling injury resistance. Results A genetic linkage map of 211 markers was constructed for an intraspecific peach (Prunus persica progeny population, Pop-DG, derived from a canning peach cultivar 'Dr. Davis' and a fresh market cultivar 'Georgia Belle'. The Pop-DG map covered 818 cM of the peach genome and included three morphological markers, 11 ripening candidate genes, 13 cold-responsive genes, 21 novel EST-SSRs from the ChillPeach database, 58 previously reported SSRs, 40 RAFs, 23 SRAPs, 14 IMAs, and 28 accessory markers from candidate gene amplification. The Pop-DG map was co-linear with the Prunus reference T × E map, with 39 SSR markers in common to align the maps. A further 158 markers were bin-mapped to the reference map: 59 ripening candidate genes, 50 cold-responsive genes, and 50 novel EST-SSRs from ChillPeach, with deduced locations in Pop-DG via comparative mapping. Several candidate genes and EST-SSRs co-located with previously reported major trait loci and quantitative trait loci for chilling injury symptoms in Pop-DG. Conclusion The candidate gene approach combined with bin-mapping and availability of a community-recognized reference genetic map provides an efficient means of locating genes of interest in a target genome. We highlight the co-localization of fruit quality candidate genes with previously reported fruit quality QTLs. The fruit quality gene map developed here is a

  18. A molecular phylogeny of selected species of Genus Prunus L ...

    African Journals Online (AJOL)

    Administrator

    2011-05-30

    May 30, 2011 ... The genus Prunus L. is an important plant for fruit production and it includes plums, apricots, cherries, almonds ... classification and placement of different genera under different sub-families. ... cultivated primarily or their beautiful flowers, such as ..... described the character evolution in the 37 Prunus and 8.

  19. Crystal Macropattern Development in Prunus serotina (Rosaceae, Prunoideae) Leaves

    OpenAIRE

    LERSTEN, NELS R.; HORNER, HARRY T.

    2006-01-01

    • Background and Aims Prunus, subgenus Padus, exhibits two completely different calcium oxalate crystal macropatterns in mature leaves. Foliar macropattern development has been described previously in P. virginiana, representing one version. Prunus serotina, in the group exhibiting the second macropattern, is described here. The goal was to describe developmental details for comparison with P. virginiana, and to extend the sparse current knowledge of crystal macropatterns.

  20. Characterization of sour (Prunus cerasus L. and sweet cherry (Prunus avium L. varieties with five isozyme systems Caracterização de variedades de ginjeira (Prunus cerasus L. e cerejeira (Prunus avium L. em cinco sistemas isoenzimáticos

    Directory of Open Access Journals (Sweden)

    Remedios Morales Corts

    2008-03-01

    Full Text Available Extracts from young leaves of nine sweet cherry (Prunus avium L. and eight sour cherry (Prunus cerasus L. varieties, located in the germplasm collection of the 'Direção Regional de Agricultura da Beira Interior' (Fundão, Portugal, were analysed for five isozyme systems in order to characterise these varieties and detect problems of synonymies and homonymies that frequently present. The sweet and sour cherry varieties analyzed showed low isoenzymatic polymorphism, being PGM and PGI the systems with the highest discrimination power. These systems presented seven and five different zymogrames, respectively. IDH showed four patterns. SKDH and 6-PGD grouped the varieties only into two patterns. The evident and discriminant restrictions of this type of analysis had got results that have only been a complement for agronomical and morphological characterization.Nove extratos de folhas com desenvolvimento encompleto foram obtidos de 9 variedades de cerejeira (Prunus avium L. e 8 de ginjeira (Prunus cerasus L., localizados no campo de germoplasma da "Direcção Regional de Agricultura da Beira Interior" (Fundão, Portugal. Esses extratos foram analisados para 5 sistemas isoenzimáticos a fim de caracterizar essas variedades e simultaneamente detectar sinonímias e homonímias, freqüentes neste tipo de estudos. As variedades de cerejeira e ginjeira analisadas mostraram baixo polimorfismo isoenzimático, sendo que os sistemas PGM e PGI mostraram maior poder de discriminação. Estes sistemas apresentaram 7 e 5 zimogramas diferentes, respectivamente. IDH mostrou 4 padrões. SKDH e 6-PGD agruparam as variedades em 2 padrões. Os evidentes limites discriminatórios desse tipo de análise serviram somente de complemento para a caracterização agronômica e morfológica.

  1. Physicochemical characterisation of four cherry species (Prunus spp.) grown in China.

    Science.gov (United States)

    Cao, Jinping; Jiang, Qing; Lin, Juanying; Li, Xian; Sun, Chongde; Chen, Kunsong

    2015-04-15

    The physicochemical characteristics of four cherry species (Prunus avium, Prunus cerasus, Prunus pseudocerasus and Prunus tomentosa) were evaluated. Inter-species variability was greater than intra-species differences. Glucose and fructose were the main sugars, and malic acid was the main organic acid in all species. Combining HPLC-DAD and LC-ESI-MS/MS technologies, total 25 phenolic components were preliminarily identified. P. avium was characterised by high fruit weight, edible proportion, sugar content and low acid content, which made it suitable for fresh eating. P. cerasus was high in acid content and anthocyanins content, making it a good processing species. P. pseudocerasus had rich flavonols varieties and high proportion of hydrocinnamic acids. P. tomentosa was characterised by high total phenolics content (especially flavonols and tannins) and antioxidant activity, indicating a great developmental potential as a health fruit. The results of the present study might provide theoretical guidance for the further development and utilisation of cherries. Copyright © 2014 Elsevier Ltd. All rights reserved.

  2. Genomic segments RNA1 and RNA2 of Prunus necrotic ringspot virus codetermine viral pathogenicity to adapt to alternating natural Prunus hosts.

    Science.gov (United States)

    Cui, Hongguang; Hong, Ni; Wang, Guoping; Wang, Aiming

    2013-05-01

    Prunus necrotic ringspot virus (PNRSV) affects Prunus fruit production worldwide. To date, numerous PNRSV isolates with diverse pathological properties have been documented. To study the pathogenicity of PNRSV, which directly or indirectly determines the economic losses of infected fruit trees, we have recently sequenced the complete genome of peach isolate Pch12 and cherry isolate Chr3, belonging to the pathogenically aggressive PV32 group and mild PV96 group, respectively. Here, we constructed the Chr3- and Pch12-derived full-length cDNA clones that were infectious in the experimental host cucumber and their respective natural Prunus hosts. Pch12-derived clones induced much more severe symptoms than Chr3 in cucumber, and the pathogenicity discrepancy between Chr3 and Pch12 was associated with virus accumulation. By reassortment of genomic segments, swapping of partial genomic segments, and site-directed mutagenesis, we identified the 3' terminal nucleotide sequence (1C region) in RNA1 and amino acid K at residue 279 in RNA2-encoded P2 as the severe virulence determinants in Pch12. Gain-of-function experiments demonstrated that both the 1C region and K279 of Pch12 were required for severe virulence and high levels of viral accumulation. Our results suggest that PNRSV RNA1 and RNA2 codetermine viral pathogenicity to adapt to alternating natural Prunus hosts, likely through mediating viral accumulation.

  3. The genome of Prunus mume.

    Science.gov (United States)

    Zhang, Qixiang; Chen, Wenbin; Sun, Lidan; Zhao, Fangying; Huang, Bangqing; Yang, Weiru; Tao, Ye; Wang, Jia; Yuan, Zhiqiong; Fan, Guangyi; Xing, Zhen; Han, Changlei; Pan, Huitang; Zhong, Xiao; Shi, Wenfang; Liang, Xinming; Du, Dongliang; Sun, Fengming; Xu, Zongda; Hao, Ruijie; Lv, Tian; Lv, Yingmin; Zheng, Zequn; Sun, Ming; Luo, Le; Cai, Ming; Gao, Yike; Wang, Junyi; Yin, Ye; Xu, Xun; Cheng, Tangren; Wang, Jun

    2012-01-01

    Prunus mume (mei), which was domesticated in China more than 3,000 years ago as ornamental plant and fruit, is one of the first genomes among Prunus subfamilies of Rosaceae been sequenced. Here, we assemble a 280M genome by combining 101-fold next-generation sequencing and optical mapping data. We further anchor 83.9% of scaffolds to eight chromosomes with genetic map constructed by restriction-site-associated DNA sequencing. Combining P. mume genome with available data, we succeed in reconstructing nine ancestral chromosomes of Rosaceae family, as well as depicting chromosome fusion, fission and duplication history in three major subfamilies. We sequence the transcriptome of various tissues and perform genome-wide analysis to reveal the characteristics of P. mume, including its regulation of early blooming in endodormancy, immune response against bacterial infection and biosynthesis of flower scent. The P. mume genome sequence adds to our understanding of Rosaceae evolution and provides important data for improvement of fruit trees.

  4. Self-incompatibility of Prunus tenella and evidence that reproductively isolated species of Prunus have different SFB alleles coupled with an identical S-RNase allele.

    Science.gov (United States)

    Surbanovski, Nada; Tobutt, Kenneth R; Konstantinović, Miroslav; Maksimović, Vesna; Sargent, Daniel J; Stevanović, Vladimir; Bosković, Radovan I

    2007-05-01

    Many species of Prunus display an S-RNase-based gametophytic self-incompatibility (SI), controlled by a single highly polymorphic multigene complex termed the S-locus. This comprises tightly linked stylar- and pollen-expressed genes that determine the specificity of the SI response. We investigated SI of Prunus tenella, a wild species found in small, isolated populations on the Balkan peninsula, initially by pollination experiments and identifying stylar-expressed RNase alleles. Nine P. tenella S-RNase alleles (S(1)-S(9)) were cloned; their sequence analysis showed a very high ratio of non-synonymous to synonymous nucleotide substitutions (K(a)/K(s)) and revealed that S-RNase alleles of P. tenella, unlike those of Prunus dulcis, show positive selection in all regions except the conserved regions and that between C2 and RHV. Remarkably, S(8)-RNase, was found to be identical to S(1)-RNase from Prunus avium, a species that does not interbreed with P. tenella and, except for just one amino acid, to S(11) of P. dulcis. However, the corresponding introns and S-RNase-SFB intergenic regions showed considerable differences. Moreover, protein sequences of the pollen-expressed SFB alleles were not identical, harbouring 12 amino-acid replacements between those of P. tenella SFB(8) and P. avium SFB(1). Implications of this finding for hypotheses about the evolution of new S-specificities are discussed.

  5. Pegamento e crescimento inicial de enxertos do pessegueiro 'Aurora-1' em clones de umezeiro (Prunus mume Sieb. et Zucc. e 'Okinawa' [Prunus persica (L. Batsch] propagados por estacas herbáceas Tissue union and initial growth of 'Aurora-1' peach buds on mume clones (Prunus mume Sieb. et Zucc. and 'Okinawa' [Prunus persica (L. Batsch] propagated by herbaceous cuttings

    Directory of Open Access Journals (Sweden)

    Newton Alex Mayer

    2005-04-01

    Full Text Available O presente estudo teve por objetivo avaliar o pegamento e o crescimento inicial de enxertos do pessegueiro 'Aurora-1' em clones de umezeiro (Prunus mume Sieb. et Zucc. e 'Okinawa' [Prunus persica (L. Batsch] propagados por estacas herbáceas. Realizaram-se dois experimentos, adotando-se a enxertia de borbulhia por escudo (março e borbulhia por escudo modificada (julho. Com os resultados obtidos, pode-se concluir que é viável a realização da enxertia do 'Aurora-1' nos Clones 05; 10 e 15 de umezeiro e no 'Okinawa', tanto em março quanto em julho, com as metodologias utilizadas. O 'Okinawa' induz crescimento mais rápido ao enxerto, de forma que o ponto máximo do comprimento é atingido em tempo menor.This study aimed to evaluate the tissue union and initial growth of 'Aurora-1' peach buds on mume clones (Prunus mume Sieb. et Zucc. and 'Okinawa' [Prunus persica (L. Batsch] propagated by herbaceous cuttings. Two experiments were carried out, being adopted the chip budding (March and chip budding modified (July. The results showed that accomplishment of 'Aurora-1' peach bud on mume Clones 05, 10 and 15 and 'Okinawa' is viable, in both periods, with the methodologies used. The 'Okinawa' induces faster growth to the bud and the maximum length point is reached in a short time.

  6. Breeding rootstocks for Prunus species: Advances in genetic and genomics of peach and cherry as a model

    Directory of Open Access Journals (Sweden)

    Verónica Guajardo

    2015-08-01

    Full Text Available Prunus rootstock is an important choice in optimizing productivity of grafted cultivars. Nevertheless, many Prunus rootstocks are notoriously intolerant to hypoxia which is caused by waterlogging and/or heavy soils. There is no available information to help select Prunus rootstocks that are tolerant to stress conditions such as root hypoxia caused by excess moisture. Information from genetic maps has demonstrated a high level of synteny among Prunus species, and this suggests that they all share a similar genomic structure. It should be possible to identify the genetic determinants involved in tolerance to hypoxia and other traits in Prunus rootstocks by applying methods to identify regions of the genome involved in the expression of important traits; these have been developed mainly in peach which is the model species for the genus. Molecular markers that are tightly linked to major genes would be useful in marker-assisted selection (MAS to optimize new rootstock selection. This article provides insight on the advances in the development of molecular markers, genetic maps, and gene identification in Prunus, mainly in peach; the aim is to provide a general approach for identifying the genetic determinants of hypoxia stress in rootstocks.

  7. Molecular Variability Among Isolates of Prunus Necrotic Ringspot Virus from Different Prunus spp.

    Science.gov (United States)

    Aparicio, F; Myrta, A; Di Terlizzi, B; Pallás, V

    1999-11-01

    ABSTRACT Viral sequences amplified by polymerase chain reaction from 25 isolates of Prunus necrotic ringspot virus (PNRSV), varying in the symptomatology they cause in six different Prunus spp., were analyzed for restriction fragment polymorphisms. Most of the isolates could be discriminated by using a combination of three different restriction enzymes. The nucleotide sequences of the RNA 4 of 15 of these isolates were determined. Sequence comparisons and phylogenetic analyses of the RNA 4 and coat proteins (CPs) revealed that all of the isolates clustered into three different groups, represented by three previously sequenced PNRSV isolates: PV32, PE5, and PV96. The PE5-type group was characterized by a 5' untranslated region that was clearly different from that of the other two groups. The PV32-type group was characterized by an extra hexanucleotide consisting of a duplication of the six immediately preceding nucleotides. Although most of the variability was observed in the first third of the CP, the amino acid residues in this region, which were previously thought to be functionally important in the replication cycle of the virus, were strictly conserved. No clear correlation with the type of symptom or host specificity could be observed. The validity of this grouping was confirmed when other isolates recently characterized by other authors were included in these analyses.

  8. Genetic diversity in breonadia salicina based on intra-species sequence variation of chloroplast dna spacer sequence

    International Nuclear Information System (INIS)

    Qurainy, F.A.; Gaafar, A.R.Z.

    2014-01-01

    Assessment and knowledge of the genetic diversity and variation within and between populations of rare and endangered plants is very important for effective conservation. Intergenic spacer sequences variation of psbA-trnH locus of chloroplast genome was assessed within Breonadia salicina (Rubiaceae), a critically endangered and endemic plant species to South western part of Kingdom of Saudi Arabia. The obtained sequence data from 19 individuals in three populations revealed nine haplotypes. The aligned sequences obtained from the overall Saudi accessions extended to 355 bp, revealing nine haplotypes. A high level of haplotype diversity (Hd = 0.842) and low level of nucleotide diversity (Pi = 0.0058) were detected. Consistently, both hierarchical analysis of molecular variance (AMOVA) and constructed neighbor-joining tree indicated null genetic differentiation among populations. This level of differentiation between populations or between regions in psbA-trnH sequences may be due to effects of the abundance of ancestral haplotype sharing and the presence of private haplotypes fixed for each population. Furthermore, the results revealed almost the same level of genetic diversity in comparison with Yemeni accessions, in which Saudi accessions were sharing three haplotypes from the four haplotypes found in Yemeni accessions. (author)

  9. Wild Prunus Fruit Species as a Rich Source of Bioactive Compounds.

    Science.gov (United States)

    Mikulic-Petkovsek, Maja; Stampar, Franci; Veberic, Robert; Sircelj, Helena

    2016-08-01

    Sugars, organic acids, carotenoids, tocopherols, chlorophylls, and phenolic compounds were quantified in fruit of 4 wild growing Prunus species (wild cherry, bird cherry, blackthorn, and mahaleb cherry) using HPLC-DAD-MSn. In wild Prunus, the major sugars were glucose and fructose, whereas malic and citric acids dominated among organic acids. The most abundant classes of phenolic compounds in the analyzed fruit species were anthocyanins, flavonols, derivatives of cinnamic acids, and flavanols. Two major groups of anthocyanins measured in Prunus fruits were cyanidin-3-rutinoside and cyanidin-3-glucoside. Flavonols were represented by 19 derivatives of quercetin, 10 derivatives of kaempferol, and 2 derivatives of isorhamnetin. The highest total flavonol content was measured in mahaleb cherry and bird cherry, followed by blackthorn and wild cherry fruit. Total phenolic content varied from 2373 (wild cherry) to 11053 mg GAE per kg (bird cherry) and ferric reducing antioxidant power antioxidant activity from 7.26 to 31.54 mM trolox equivalents per kg fruits. © 2016 Institute of Food Technologists®

  10. Prunus hybrids rootstocks for flat peach

    Directory of Open Access Journals (Sweden)

    Pilar Legua

    2012-02-01

    Full Text Available Peach (Prunus persica L. is the most important stone fruit tree grown in Spain and is the second most important fruit crop in Europe. The influence of eight Prunus rootstocks (GF-677, Krymsk® 86, PADAC 97-36, PADAC 99-05, PADAC 9912-03, PADAC 0024-01, PAC 0021-01 and PAC 0022-01 on vigor, yield and fruit quality traits of 'UFO 3' flat peach cultivar was studied. The highest trunk cross sectional area was exhibited by GF-677 and the lowest by PADAC 99-05, while intermediate values were found on the other rootstocks. The highest yield efficiency was found on PADAC 99-05, PAC 0021-01, PAC 0022-01 and PADAC 0024-01 and the lowest was shown on Krymsk® 86. The fruit quality parameters measured were color, fruit and stone weights, equatorial diameter, pulp thickness, pulp yield, firmness, pH, soluble solids content and titratable acidity. 'UFO 3' grafted on GF-677 resulted in the largest fruit weight, while the smallest was on PADAC 99-05. Fruits of 'UFO 3' showed a tendency to have higher firmness, higher red colored skin and RI when grafted on PADAC 99-05.

  11. Accelerated solvent extraction of carotenoids from: Tunisian Kaki (Diospyros kaki L.), peach (Prunus persica L.) and apricot (Prunus armeniaca L.).

    Science.gov (United States)

    Zaghdoudi, Khalil; Pontvianne, Steve; Framboisier, Xavier; Achard, Mathilde; Kudaibergenova, Rabiga; Ayadi-Trabelsi, Malika; Kalthoum-Cherif, Jamila; Vanderesse, Régis; Frochot, Céline; Guiavarc'h, Yann

    2015-10-01

    Extraction of carotenoids from biological matrices and quantifications remains a difficult task. Accelerated solvent extraction was used as an efficient extraction process for carotenoids extraction from three fruits cultivated in Tunisia: kaki (Diospyros kaki L.), peach (Prunus persica L.) and apricot (Prunus armeniaca L.). Based on a design of experiment (DoE) approach, and using a binary solvent consisting of methanol and tetrahydrofuran, we could identify the best extraction conditions as being 40°C, 20:80 (v:v) methanol/tetrahydrofuran and 5 min of extraction time. Surprisingly and likely due to the high extraction pressure used (103 bars), these conditions appeared to be the best ones both for extracting xanthophylls such as lutein, zeaxanthin or β-cryptoxanthin and carotenes such as β-carotene, which present quite different polarities. Twelve surface responses were generated for lutein, zeaxanthin, β-cryptoxanthin and β-carotene in kaki, peach and apricot. Further LC-MS analysis allowed comparisons in carotenoids profiles between the fruits. Copyright © 2015 Elsevier Ltd. All rights reserved.

  12. Optimization of microwave roasting of almond (Prunus dulcis)

    Science.gov (United States)

    Microwave (MW) almond roasting was investigated as an alternative to hot air (HA) roasting. Nonpareil almonds (Prunus dulcis) were roasted at 140°C in a convection oven for different times to achieve light, medium, and dark roasting levels. Several instrumental measurements were taken, establishin...

  13. Mapping X-Disease Phytoplasma Resistance in Prunus virginiana.

    Science.gov (United States)

    Lenz, Ryan R; Dai, Wenhao

    2017-01-01

    Phytoplasmas such as " Candidatus Phytoplasma pruni," the causal agent of X-disease of stone fruits, lack detailed biological analysis. This has limited the understanding of plant resistance mechanisms. Chokecherry ( Prunus virginiana L.) is a promising model to be used for the plant-phytoplasma interaction due to its documented ability to resist X-disease infection. A consensus chokecherry genetic map "Cho" was developed with JoinMap 4.0 by joining two parental maps. The new map contains a complete set of 16 linkage groups, spanning a genetic distance of 2,172 cM with an average marker density of 3.97 cM. Three significant quantitative trait loci (QTL) associated with X-disease resistance were identified contributing to a total of 45.9% of the phenotypic variation. This updated genetic linkage map and the identified QTL will provide the framework needed to facilitate molecular genetics, genomics, breeding, and biotechnology research concerning X-disease in chokecherry and other Prunus species.

  14. Mapping X-Disease Phytoplasma Resistance in Prunus virginiana

    Directory of Open Access Journals (Sweden)

    Ryan R. Lenz

    2017-11-01

    Full Text Available Phytoplasmas such as “Candidatus Phytoplasma pruni,” the causal agent of X-disease of stone fruits, lack detailed biological analysis. This has limited the understanding of plant resistance mechanisms. Chokecherry (Prunus virginiana L. is a promising model to be used for the plant-phytoplasma interaction due to its documented ability to resist X-disease infection. A consensus chokecherry genetic map “Cho” was developed with JoinMap 4.0 by joining two parental maps. The new map contains a complete set of 16 linkage groups, spanning a genetic distance of 2,172 cM with an average marker density of 3.97 cM. Three significant quantitative trait loci (QTL associated with X-disease resistance were identified contributing to a total of 45.9% of the phenotypic variation. This updated genetic linkage map and the identified QTL will provide the framework needed to facilitate molecular genetics, genomics, breeding, and biotechnology research concerning X-disease in chokecherry and other Prunus species.

  15. Enraizamento in vitro de porta-enxertos de Prunus In vitro rooting of Prunus rootstocks

    Directory of Open Access Journals (Sweden)

    Marcelo Rogalski

    2003-08-01

    Full Text Available Na micropropagação de Prunus sp., o enraizamento tem sido considerado uma fase crítica, pois determina a sobrevivência das plantas durante a aclimatização. Dentre os fatores importantes ao enraizamento in vitro, destacam-se o genótipo e as auxinas por serem determinantes na indução e na formação de raízes. O objetivo deste trabalho foi avaliar o efeito de diferentes concentrações de IBA no enraizamento in vitro dos porta-enxertos de espécies do gênero Prunus: cultivares Capdeboscq e GF677, e seleções VP411 e VP417. Para o enraizamento in vitro, brotos com 2-3cm de comprimento foram introduzidos em meio de Lepoivre suplementado com 0,1; 0,5; 1,0 e 2,0 mg.L-1 IBA. Observou-se que o porta-enxerto 'Capdeboscq' apresentou maior taxa de enraizamento e maior número de raízes in vitro, sendo superior aos demais genótipos quanto a estas características. O nível de 1,0 mg.L-1 de IBA esteve associado à maior taxa média de enraizamento (100%, 64% e 64,0%, respectivamente para os porta-enxertos 'Capdeboscq', 'GF677' e VP411. O nível de 2,0 mg.L-1 de IBA foi superior para a seleção VP417 com taxa de 64% de enraizamento. Para os porta-enxertos 'Capdeboscq' e 'GF677', o número máximo de raízes foi de 9,6 e 5,2 raízes por broto, respectivamente, em resposta ao nível de 2,0 mg.L-1 de IBA, enquanto as seleções VP411 e VP417 apresentaram o maior número de raízes (3,6 e 3,9, respectivamente em resposta ao nível de 1,0 mg.L-1 de IBA.In Prunus sp. micropropagation of rooting is considered a critical stage, since it determines the plant survival during the acclimatization. Among important factors associated with rooting, the genotype and the auxins are considered important in the induction and formation of roots. The objective of the present work was to evaluate the effect of different IBA on the in vitro rooting of Prunus rootstocks Capdeboscq and GF677, and the selections VP411 and VP417. For the in vitro rooting stage, shoots of

  16. Synteny conservation between two distantly-related Rosaceae genomes: Prunus (the stone fruits and Fragaria (the strawberry

    Directory of Open Access Journals (Sweden)

    Sargent Daniel J

    2008-06-01

    Full Text Available Abstract Background The Rosaceae encompass a large number of economically-important diploid and polyploid fruit and ornamental species in many different genera. The basic chromosome numbers of these genera are x = 7, 8 and 9 and all have compact and relatively similar genome sizes. Comparative mapping between distantly-related genera has been performed to a limited extent in the Rosaceae including a comparison between Malus (subfamily Maloideae and Prunus (subfamily Prunoideae; however no data has been published to date comparing Malus or Prunus to a member of the subfamily Rosoideae. In this paper we compare the genome of Fragaria, a member of the Rosoideae, to Prunus, a member of the Prunoideae. Results The diploid genomes of Prunus (2n = 2x = 16 and Fragaria (2n = 2x = 14 were compared through the mapping of 71 anchor markers – 40 restriction fragment length polymorphisms (RFLPs, 29 indels or single nucleotide polymorphisms (SNPs derived from expressed sequence tags (ESTs and two simple-sequence repeats (SSRs – on the reference maps of both genera. These markers provided good coverage of the Prunus (78% and Fragaria (78% genomes, with maximum gaps and average densities of 22 cM and 7.3 cM/marker in Prunus and 32 cM and 8.0 cM/marker in Fragaria. Conclusion Our results indicate a clear pattern of synteny, with most markers of each chromosome of one of these species mapping to one or two chromosomes of the other. A large number of rearrangements (36, most of which produced by inversions (27 and the rest (9 by translocations or fission/fusion events could also be inferred. We have provided the first framework for the comparison of the position of genes or DNA sequences of these two economically valuable and yet distantly-related genera of the Rosaceae.

  17. Molecular characterization of the plum collection [Prunus domestica ...

    African Journals Online (AJOL)

    Eight Random Amplified Microsatellite markers (RAMs) were used to characterize the genetic diversity found in 14 Prunus materials belonging to the deciduous collection of the Pedagogical and Technological University of Colombia. A total of 121 bands were generated: they range from nine for the GT primer to 26 for the ...

  18. Analysis of Agromorphological Descriptors to Differentiate between Duke Cherry (Prunus x gondouinii (Poit. & TurpinRehd. and Its Progenitors: Sweet Cherry (Prunus avium L. and Sour Cherry (Prunus cerasus L. Análisis de Descriptores Agromorfológicos para Diferenciar entre Cerezo Duke (Prunus x gondouinii (Poit. & Turpin Rehd. y sus Progenitores: Cerezo (Prunus avium L. y Guindo (Prunus cerasus L.

    Directory of Open Access Journals (Sweden)

    Rodrigo Pérez

    2010-03-01

    Full Text Available The rapid identification of the hybrids between sweet cherry (Prunus avium L. and sour cherry (Prunus cerasus L. is not easy. In order to resolve this problem, 18 Spanish sweet, sour and duke cherry cultivars were surveyed and characterized using 43 agromorphological descriptors evaluated in flowers, leaves, dormant 1-yr-old shoots, fruits, and trees during 2005 and 2006. Based on quantitative parameters, ANOVA and stepwise discriminant analysis (SDA were carried out. For qualitative descriptors, statistical comparisons were done by means of the chi-square (χ2 test. As result of the study, two quantitative (titratable acidity and number of lenticels and six qualitative descriptors (shape of the central and lateral lobes in the internal bracts of the flower fascicles, leaf shape and margin, pubescence in the veins of the lower side of the leaf, and type of sulci of the seed coat were identified as differential parameters in P. avium, P. cerasus and P. x gondouinii(Poit. & Turpin Rehd. Also, another four qualitative descriptors (petal coloration at the end of blooming, leaf stipule type, and seed shape and viability were found to be useful for easy differentiation between sour and duke cherry. None of these parameters has been employed previously to discriminate among sweet, sour and duke cherry.Los híbridos de cerezo (Prunus avium L. y guindo (Prunus cerasus L. no son fáciles de identificar. Para resolver este problema, 18 cultivares de cerezo, guindo y sus híbridos fueron prospectados y caracterizados agromorfológicamente mediante el estudio de 43 descriptores evaluados en flores, hojas, frutos, ramas de 1 año y árbol durante los años 2005 y 2006. En base a los resultados obtenidos del estudio de los diferentes parámetros cuantitativos se realizaron un ANDEVA y un análisis discriminante escalonado (SDA. Los descriptores cualitativos fueron analizados mediante el test de Chi-cuadrado (χ². Como resultado del estudio se identificaron

  19. Slaat Xanthomonas dit jaar weer toe in Prunus laurocerasus

    NARCIS (Netherlands)

    Doorn, van J.; Dalfsen, van P.; Pham, K.T.K.

    2012-01-01

    Een diagnostische test moet duidelijk maken of er sprake is van Xanthomonas in Prunus laurocerasus. De bacterieziekte is namelijk makkelijk te verwarren met andere ziekten. Onderzoek, gefinancierd door het Productschap Tuinbouw, richt zich op het toetsen van moerplanten voordat hier van gestekt gaat

  20. Characterization of polymorphic SSRs among Prunus chloroplast genomes

    Science.gov (United States)

    An in silico mining process yielded 80, 75, and 78 microsatellites in the chloroplast genome of Prunus persica, P. kansuensis, and P. mume. A and T repeats were predominant in the three genomes, accounting for 67.8% on average and most of them were successful in primer design. For the 80 P. persica ...

  1. Anatomy and cell wall polysaccharides of almond (Prunus dulcis D. A. Webb) seeds.

    Science.gov (United States)

    Dourado, Fernando; Barros, António; Mota, Manuel; Coimbra, Manuel A; Gama, Francisco M

    2004-03-10

    The anatomy of Prunus dulcis was analyzed by applying several differential staining techniques and light microscopy. Prunus dulcis seed has a thin and structurally complex seed coat, with lignified cellulosic tissue. The embryo has two voluminous cotyledons. Cotyledon cells have a high number of protein and lipid bodies, some of which have phytin. The provascular tissue, located in the cotyledons, is oriented in small bundles perpendicular to the transverse embryonic axis. Prunus dulcis cell wall material is very rich in arabinose (45 mol %). Glucose (23%), uronic acids (12%), and xylose (12%) are also major sugar components. The polymers obtained from the imidazole and Na(2)CO(3) extracts contain mainly pectic substances rich in arabinose, but the sugar content of these extracts was very low. The majority of the pectic substances (also rich in arabinose) was recovered with the KOH extracts. These extracts, with high sugar content, yielded also xyloglucans and acidic xylans. The 4 M KOH + H(3)BO(3) extracts yielded polysaccharides rich in uronic acids and xylose and very rich in arabinose, accounting for 27% of the cell wall material.

  2. Micropropagation of Prunus species relevant to cherry fruit production.

    Science.gov (United States)

    Druart, Philippe

    2013-01-01

    Cherry tree micropropagation is limited to the production of healthy cultivars of Prunus avium and Prunus cerasus, and their rootstocks; mainly the dwarfing ones. By using meristem-tip (0.1 mm long) or healthy shoot tips/nodes, four successive steps are needed to obtain whole plants capable of growing in the nursery: multiplication by axillary branching, shoot elongation, rooting, and plantlet acclimation. Along this process, several parameters have to be adjusted for each phase of the culture, including media composition, environmental culture conditions and plant handling. These parameters vary depending on genotypic response and specific vulnerability to physiological disorders such as hyperhydricity, apex necrosis, unstable propagation, and rooting rates. Based on a 40 year-long experience of study and application of culture conditions to large-scale plant production, this document summarizes the main problems (variability of the propagation rate, hyperhydricity, apex necrosis, plant re-growth) and solutions encountered to solve them, with means validated on many mericlones.

  3. Allelic diversity of S-RNase at the self-incompatibility locus in natural flowering cherry populations (Prunus lannesiana var. speciosa).

    Science.gov (United States)

    Kato, S; Mukai, Y

    2004-03-01

    In the Rosaceae family, which includes Prunus, gametophytic self-incompatibility (GSI) is controlled by a single multiallelic locus (S-locus), and the S-locus product expressed in the pistils is a glycoprotein with ribonuclease activity (S-RNase). Two populations of flowering cherry (Prunus lannesiana var. speciosa), located on Hachijo Island in Japan's Izu Islands, were sampled, and S-allele diversity was surveyed based on the sequence polymorphism of S-RNase. A total of seven S-alleles were cloned and sequenced. The S-RNases of flowering cherry showed high homology to those of Prunus cultivars (P. avium and P. dulcis). In the phylogenetic tree, the S-RNases of flowering cherry and other Prunus cultivars formed a distinct group, but they did not form species-specific subgroups. The nucleotide substitution pattern in S-RNases of flowering cherry showed no excess of nonsynonymous substitutions relative to synonymous substitutions. However, the S-RNases of flowering cherry had a higher Ka/Ks ratio than those of other Prunus cultivars, and a subtle heterogeneity in the nucleotide substitution rates was observed among the Prunus species. The S-genotype of each individual was determined by Southern blotting of restriction enzyme-digested genomic DNA, using cDNA for S-RNase as a probe. A total of 22 S-alleles were identified. All individuals examined were heterozygous, as expected under GSI. The allele frequencies were, contrary to the expectation under GSI, significantly unequal. The two populations studied showed a high degree of overlap, with 18 shared alleles. However, the allele frequencies differed considerably between the two populations.

  4. Effects of fertilization and rootstock on nutrient status and fruit set in sour cherry Prunus cerasus 'Stevnsbaer'

    DEFF Research Database (Denmark)

    Jensen, N. L.; Toldam-Andersen, Torben; Dencker, Ivar Blücher

    2007-01-01

    The purpose of this experiment was to investigate the effects of two potassium fertilization treatments on fruit set and flower bud, flower and bract leaf nutrient concentrations in Prunus cerasus 'Stevnsbaer' on Prunus avium and 'Colt' rootstocks. Single applications of KNO3 or KCl were applied ...

  5. A molecular phylogeny of selected species of genus Prunus L ...

    African Journals Online (AJOL)

    USER

    2010-08-02

    Aug 2, 2010 ... 52 - 56°C with the primers ITS-9 and ITS-6 or Trn-L and Trn-F. Polymerase chain .... The sub-genus Prunus has also relatively good support (81%) including .... Stevens, Michael J, Donoghue (1999). Plant Systematics. A.

  6. [Analysis of total proteins in the seed of almond (Prunus dulcis) by two-dimensional electrophoresis].

    Science.gov (United States)

    Li, Dong-dong; He, Shao-heng

    2004-07-01

    To analyse the total proteins in the seeds of almond (Prunus dulcis), one of the popular ingestent allergens in China, by two-dimensional electrophoresis. The total proteins of the seeds were extracted by trichloracetic acid (TCA) method, and then separated by isoelectric focusing as first dimension and SDS-PAGE as the second dimension. The spots of proteins were visualized by staining with Coomassie Brilliant Blue R-250. After analysis with software (ImageMaster 2D), 188 different proteins were detected. The isoelectric points (pI) for approximately 28% of total proteins were between 4.5-5.5, and the relative molecular mass (M(r)) of approximately 62% total proteins were between (20-25)x10(3). This was the first high-resolution, two-dimensional protein map of the seed of almond (Prunus dulcis) in China. Our finding has laid a solid foundation for further identification, characterization, gene cloning and standardization of allergenic proteins in the seed of almond (Prunus dulcis).

  7. Cryopreservation of in vitro -grown shoot tips of apricot ( Prunus ...

    African Journals Online (AJOL)

    In vitro grown apricot (Prunus armeniaca L.) cv. El-Hamawey shoot tips were successfully cryopreserved using an encapsulation-dehydration procedure. Shoot tips were encapsulated in calcium-alginate beads before preculture on woody plant (WP) medium supplemented with different sucrose concentrations; 0.1, 0.3, 0.5, ...

  8. Novel Rosaceae plant elicitor peptides as sustainable tools to control Xanthomonas arboricola pv. pruni in Prunus spp.

    Science.gov (United States)

    Ruiz, Cristina; Nadal, Anna; Montesinos, Emilio; Pla, Maria

    2018-02-01

    Fruit crops are regarded as important health promoters and constitute a major part of global agricultural production, and Rosaceae species are of high economic impact. Their culture is threatened by bacterial diseases, whose control is based on preventative treatments using compounds of limited efficacy and negative environmental impact. One of the most economically relevant examples is the pathogen Xanthomonas arboricola pv. pruni (Xap) affecting Prunus spp. The plant immune response against pathogens can be triggered and amplified by plant elicitor peptides (Peps), perceived by specific receptors (PEPRs). Although they have been described in various angiosperms, scarce information is available on Rosaceae species. Here, we identified the Pep precursor (PROPEP), Pep and PEPR orthologues of 10 Rosaceae species and confirmed the presence of the Pep/PEPR system in this family. We showed the perception and elicitor activity of Rosaceae Peps using the Prunus-Xap pathosystem as proof-of-concept. Treatment with nanomolar doses of Peps induced the corresponding PROPEP and a set of defence-related genes in Prunus leaves, and enhanced resistance against Xap. Peps from the same species had the highest efficiencies. Rosaceae Peps could potentially be used to develop natural, targeted and environmentally friendly strategies to enhance the resistance of Prunus species against biotic attackers. © 2017 BSPP AND JOHN WILEY & SONS LTD.

  9. Growth and fruit bearing of the sweet cherry (Prunus avium L

    African Journals Online (AJOL)

    Radunic

    2011-06-06

    Jun 6, 2011 ... Modern intensive production of sweet cherry (Prunus avium L.) tends to planting of high ... the highest was recorded on "V", while the smallest was in Spanish bush. Training system and density did not affect the fruit weight.

  10. Rapid detection of Prunus necrotic ringspot virus using magnetic nanoparticle-assisted reverse transcription loop-mediated isothermal amplification.

    Science.gov (United States)

    Zong, Xiaojuan; Wang, Wenwen; Wei, Hairong; Wang, Jiawei; Chen, Xin; Xu, Li; Zhu, Dongzi; Tan, Yue; Liu, Qingzhong

    2014-11-01

    Prunus necrotic ringspot virus (PNRSV) has seriously reduced the yield of Prunus species worldwide. In this study, a highly efficient and specific two-step reverse transcription loop-mediated isothermal amplification (RT-LAMP) was developed to detect PNRSV. Total RNA was extracted from sweet cherry leaf samples using a commercial kit based on a magnetic nanoparticle technique. Transcripts were used as the templates for the assay. The results of this assay can be detected using agarose gel electrophoresis or by assessing in-tube fluorescence after adding SYBR Green I. The assay is highly specific for PNRSV, and it is more sensitive than reverse-transcription polymerase chain reaction (RT-PCR). Restriction enzyme digestion verified further the reliability of this RT-LAMP assay. To our knowledge, this is the first report of the application of RT-LAMP to PNRSV detection in Prunus species. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Looking into flowering time in almond (Prunus dulcis (Mill) D. A. Webb): the candidate gene approach.

    Science.gov (United States)

    Silva, C; Garcia-Mas, J; Sánchez, A M; Arús, P; Oliveira, M M

    2005-03-01

    Blooming time is one of the most important agronomic traits in almond. Biochemical and molecular events underlying flowering regulation must be understood before methods to stimulate late flowering can be developed. Attempts to elucidate the genetic control of this process have led to the identification of a major gene (Lb) and quantitative trait loci (QTLs) linked to observed phenotypic differences, but although this gene and these QTLs have been placed on the Prunus reference genetic map, their sequences and specific functions remain unknown. The aim of our investigation was to associate these loci with known genes using a candidate gene approach. Two almond cDNAs and eight Prunus expressed sequence tags were selected as candidate genes (CGs) since their sequences were highly identical to those of flowering regulatory genes characterized in other species. The CGs were amplified from both parental lines of the mapping population using specific primers. Sequence comparison revealed DNA polymorphisms between the parental lines, mainly of the single nucleotide type. Polymorphisms were used to develop co-dominant cleaved amplified polymorphic sequence markers or length polymorphisms based on insertion/deletion events for mapping the candidate genes on the Prunus reference map. Ten candidate genes were assigned to six linkage groups in the Prunus genome. The positions of two of these were compatible with the regions where two QTLs for blooming time were detected. One additional candidate was localized close to the position of the Evergrowing gene, which determines a non-deciduous behaviour in peach.

  12. Insights into the Prunus-Specific S-RNase-Based Self-Incompatibility System from a Genome-Wide Analysis of the Evolutionary Radiation of S Locus-Related F-box Genes.

    Science.gov (United States)

    Akagi, Takashi; Henry, Isabelle M; Morimoto, Takuya; Tao, Ryutaro

    2016-06-01

    Self-incompatibility (SI) is an important plant reproduction mechanism that facilitates the maintenance of genetic diversity within species. Three plant families, the Solanaceae, Rosaceae and Plantaginaceae, share an S-RNase-based gametophytic SI (GSI) system that involves a single S-RNase as the pistil S determinant and several F-box genes as pollen S determinants that act via non-self-recognition. Previous evidence has suggested a specific self-recognition mechanism in Prunus (Rosaceae), raising questions about the generality of the S-RNase-based GSI system. We investigated the evolution of the pollen S determinant by comparing the sequences of the Prunus S haplotype-specific F-box gene (SFB) with those of its orthologs in other angiosperm genomes. Our results indicate that the Prunus SFB does not cluster with the pollen S of other plants and diverged early after the establishment of the Eudicots. Our results further indicate multiple F-box gene duplication events, specifically in the Rosaceae family, and suggest that the Prunus SFB gene originated in a recent Prunus-specific gene duplication event. Transcriptomic and evolutionary analyses of the Prunus S paralogs are consistent with the establishment of a Prunus-specific SI system, and the possibility of subfunctionalization differentiating the newly generated SFB from the original pollen S determinant. © The Author 2016. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  13. Alternaria cerasidanica sp nov., isolated in Denmark from drupes of Prunus avium

    DEFF Research Database (Denmark)

    Roberts, R. G.; Reymond, S. T.; Andersen, Birgitte

    2010-01-01

    The ex-type strain of Alternaria cerasidanica was isolated in 2001 from an immature, asymptomatic drupe of Prunus avium collected at a commercial cherry orchard near Skaelskor, Denmark. Cultural morphology, sporulation pattern and cluster analyses of combined RAPD, RAMS (microsatellite), and AFLP...

  14. Mapping X-Disease Phytoplasma Resistance in Prunus virginiana

    OpenAIRE

    Ryan R. Lenz; Wenhao Dai

    2017-01-01

    Phytoplasmas such as “Candidatus Phytoplasma pruni,” the causal agent of X-disease of stone fruits, lack detailed biological analysis. This has limited the understanding of plant resistance mechanisms. Chokecherry (Prunus virginiana L.) is a promising model to be used for the plant-phytoplasma interaction due to its documented ability to resist X-disease infection. A consensus chokecherry genetic map “Cho” was developed with JoinMap 4.0 by joining two parental maps. The new map contains a com...

  15. Multiple Events of Allopolyploidy in the Evolution of the Racemose Lineages in Prunus (Rosaceae Based on Integrated Evidence from Nuclear and Plastid Data.

    Directory of Open Access Journals (Sweden)

    Liang Zhao

    Full Text Available Prunus is an economically important genus well-known for cherries, plums, almonds, and peaches. The genus can be divided into three major groups based on inflorescence structure and ploidy levels: (1 the diploid solitary-flower group (subg. Prunus, Amygdalus and Emplectocladus; (2 the diploid corymbose group (subg. Cerasus; and (3 the polyploid racemose group (subg. Padus, subg. Laurocerasus, and the Maddenia group. The plastid phylogeny suggests three major clades within Prunus: Prunus-Amygdalus-Emplectocladus, Cerasus, and Laurocerasus-Padus-Maddenia, while nuclear ITS trees resolve Laurocerasus-Padus-Maddenia as a paraphyletic group. In this study, we employed sequences of the nuclear loci At103, ITS and s6pdh to explore the origins and evolution of the racemose group. Two copies of the At103 gene were identified in Prunus. One copy is found in Prunus species with solitary and corymbose inflorescences as well as those with racemose inflorescences, while the second copy (II is present only in taxa with racemose inflorescences. The copy I sequences suggest that all racemose species form a paraphyletic group composed of four clades, each of which is definable by morphology and geography. The tree from the combined At103 and ITS sequences and the tree based on the single gene s6pdh had similar general topologies to the tree based on the copy I sequences of At103, with the combined At103-ITS tree showing stronger support in most clades. The nuclear At103, ITS and s6pdh data in conjunction with the plastid data are consistent with the hypothesis that multiple independent allopolyploidy events contributed to the origins of the racemose group. A widespread species or lineage may have served as the maternal parent for multiple hybridizations involving several paternal lineages. This hypothesis of the complex evolutionary history of the racemose group in Prunus reflects a major step forward in our understanding of diversification of the genus and has

  16. Crystal macropattern development in Prunus serotina (Rosaceae, Prunoideae) leaves.

    Science.gov (United States)

    Lersten, Nels R; Horner, Harry T

    2006-05-01

    Prunus, subgenus Padus, exhibits two completely different calcium oxalate crystal macropatterns in mature leaves. Foliar macropattern development has been described previously in P. virginiana, representing one version. Prunus serotina, in the group exhibiting the second macropattern, is described here. The goal was to describe developmental details for comparison with P. virginiana, and to extend the sparse current knowledge of crystal macropatterns. Leaves at various developmental stages were removed from local trees and from herbarium specimens. Early leaf stages and freehand leaf and stem sections were mounted directly in aqueous glycerine; larger leaves were processed whole or in representative pieces in household bleach, dehydrated in alcohol/xylol, and mounted in Permount. Crystals were detected microscopically between crossed polarizers. Bud scales have a dense druse population. Druses appear first at the stipule tip and proliferate basipetally but soon stop forming; growing stipules therefore have a declining density of druses. Druses appear at the tip of leaves virginiana, and shows that two closely related species can develop radically different modes of crystallization. The few detailed macropattern studies to date reveal striking variations that indicate a new level of organization that must be integrated with the anatomical, physiological and molecular approaches that have been dominant so far.

  17. Tractor-mounted, GPS-based spot fumigation system manages Prunus replant disease

    Science.gov (United States)

    Our research goal was to use recent advances in global positioning system (GPS) and computer technology to apply just the right amount of fumigant where it is most needed (i.e., in a small target treatment zone in and around each tree replanting site) to control Prunus replant disease (PRD). We deve...

  18. Transcriptomic analysis of Prunus domestica undergoing hypersensitive response to plum pox virus infection.

    Science.gov (United States)

    Rodamilans, Bernardo; San León, David; Mühlberger, Louisa; Candresse, Thierry; Neumüller, Michael; Oliveros, Juan Carlos; García, Juan Antonio

    2014-01-01

    Plum pox virus (PPV) infects Prunus trees around the globe, posing serious fruit production problems and causing severe economic losses. One variety of Prunus domestica, named 'Jojo', develops a hypersensitive response to viral infection. Here we compared infected and non-infected samples using next-generation RNA sequencing to characterize the genetic complexity of the viral population in infected samples and to identify genes involved in development of the resistance response. Analysis of viral reads from the infected samples allowed reconstruction of a PPV-D consensus sequence. De novo reconstruction showed a second viral isolate of the PPV-Rec strain. RNA-seq analysis of PPV-infected 'Jojo' trees identified 2,234 and 786 unigenes that were significantly up- or downregulated, respectively (false discovery rate; FDR≤0.01). Expression of genes associated with defense was generally enhanced, while expression of those related to photosynthesis was repressed. Of the total of 3,020 differentially expressed unigenes, 154 were characterized as potential resistance genes, 10 of which were included in the NBS-LRR type. Given their possible role in plant defense, we selected 75 additional unigenes as candidates for further study. The combination of next-generation sequencing and a Prunus variety that develops a hypersensitive response to PPV infection provided an opportunity to study the factors involved in this plant defense mechanism. Transcriptomic analysis presented an overview of the changes that occur during PPV infection as a whole, and identified candidates suitable for further functional characterization.

  19. Transcriptomic analysis of Prunus domestica undergoing hypersensitive response to plum pox virus infection.

    Directory of Open Access Journals (Sweden)

    Bernardo Rodamilans

    Full Text Available Plum pox virus (PPV infects Prunus trees around the globe, posing serious fruit production problems and causing severe economic losses. One variety of Prunus domestica, named 'Jojo', develops a hypersensitive response to viral infection. Here we compared infected and non-infected samples using next-generation RNA sequencing to characterize the genetic complexity of the viral population in infected samples and to identify genes involved in development of the resistance response. Analysis of viral reads from the infected samples allowed reconstruction of a PPV-D consensus sequence. De novo reconstruction showed a second viral isolate of the PPV-Rec strain. RNA-seq analysis of PPV-infected 'Jojo' trees identified 2,234 and 786 unigenes that were significantly up- or downregulated, respectively (false discovery rate; FDR≤0.01. Expression of genes associated with defense was generally enhanced, while expression of those related to photosynthesis was repressed. Of the total of 3,020 differentially expressed unigenes, 154 were characterized as potential resistance genes, 10 of which were included in the NBS-LRR type. Given their possible role in plant defense, we selected 75 additional unigenes as candidates for further study. The combination of next-generation sequencing and a Prunus variety that develops a hypersensitive response to PPV infection provided an opportunity to study the factors involved in this plant defense mechanism. Transcriptomic analysis presented an overview of the changes that occur during PPV infection as a whole, and identified candidates suitable for further functional characterization.

  20. Immunochemical and biological properties of a mouse monoclonal antibody reactive to prunus necrotic ringspot ilarvirus.

    Science.gov (United States)

    Aebig, J A; Jordan, R L; Lawson, R H; Hsu, H T

    1987-01-01

    A monoclonal antibody reacting with prunus necrotic ringspot ilarvirus was tested in immunochemical studies, neutralization of infectivity assays, and by immuno-electron microscopy. The antibody was able to detect the 27,000 Mr coat protein of prunus necrotic ringspot ilarvirus in western blots and also detected all polypeptide fragments generated after incubation of whole virus with proteolytic enzymes. In neutralization of infectivity studies, the antibody blocked virus infectivity, although it did not precipitate the antigen in agar gel Ouchterlony double diffusion tests. Immuno-electron microscopy confirmed that the antibody coats virions but does not cause clumping. The antibody may be a useful tool for investigating coat protein-dependent initiation of ilarvirus infection.

  1. Development and cross-species/genera transferability of microsatellite markers discovered using 454 genome sequencing in chokecherry (Prunus virginiana L.).

    Science.gov (United States)

    Wang, Hongxia; Walla, James A; Zhong, Shaobin; Huang, Danqiong; Dai, Wenhao

    2012-11-01

    Chokecherry (Prunus virginiana L.) (2n = 4x = 32) is a unique Prunus species for both genetics and disease-resistance research due to its tetraploid nature and X-disease resistance. However, no genetic and genomic information on chokecherry is available. A partial chokecherry genome was sequenced using Roche 454 sequencing technology. A total of 145,094 reads covering 4.8 Mbp of the chokecherry genome were generated and 15,113 contigs were assembled, of which 11,675 contigs were larger than 100 bp in size. A total of 481 SSR loci were identified from 234 (out of 11,675) contigs and 246 polymerase chain reaction (PCR) primer pairs were designed. Of 246 primers, 212 (86.2 %) effectively produced amplification from the genomic DNA of chokecherry. All 212 amplifiable chokecherry primers were used to amplify genomic DNA from 11 other rosaceous species (sour cherry, sweet cherry, black cherry, peach, apricot, plum, apple, crabapple, pear, juneberry, and raspberry). Thus, chokecherry SSR primers can be transferable across Prunus species and other rosaceous species. An average of 63.2 and 58.7 % of amplifiable chokecherry primers amplified DNA from cherry and other Prunus species, respectively, while 47.2 % of amplifiable chokecherry primers amplified DNA from other rosaceous species. Using random genome sequence data generated from next-generation sequencing technology to identify microsatellite loci appears to be rapid and cost-efficient, particularly for species with no sequence information available. Sequence information and confirmed transferability of the identified chokecherry SSRs among species will be valuable for genetic research in Prunus and other rosaceous species. Key message A total of 246 SSR primers were identified from chokecherry genome sequences. Of which, 212 were confirmed amplifiable both in chokecherry and other 11 other rosaceous species.

  2. Cinética de degradação do ácido ascórbico em ameixas liofilizadas Kinetic of ascorbic acid degradation in freeze-dried prunes

    Directory of Open Access Journals (Sweden)

    Ana Lúcia Gabas

    2003-12-01

    Full Text Available Realizou-se a modelagem da degradação de vitamina C em ameixas desidratadas e submetidas a diferentes condições de temperatura e umidade relativa, com o auxílio da equação de Bigelow. As ameixas in natura foram liofilizadas e acondicionadas em dessecadores contendo diferentes soluções salinas saturadas na temperatura de 4ºC. Após atingir o equilíbrio, os dessecadores foram submetidos a temperaturas na faixa que variou entre 40 e 80ºC. A degradação de vitamina C foi analisada ao longo de 5 dias, aplicando-se o método de titulação com solução padronizada de 2,6-diclorofenolindofenol 0,01%. As amostras apresentaram os seguintes conteúdos de umidade: 0,05; 0,11; 0,18; 0,38 e 1,40g água/g sólido seco. A partir dos parâmetros da equação de Bigelow, tempo de redução decimal (D T e valor z, os resultados indicaram que as amostras submetidas à faixa de temperatura entre 40 - 60ºC apresentaram uma perda mais lenta de vitamina C (D T no conteúdo de umidade de 0,05 apresentou valores na faixa de 1672 - 275h. Por outro lado, em altas temperaturas a degradação do ácido ascórbico ocorreu mais rapidamente (D T para X = 0,05 forneceu valores entre 110 e 47h. Os parâmetros z e D T apresentaram uma dependência linear e quadrática com o conteúdo de umidade das amostras, respectivamente. De modo geral, em altos teores de umidade, houve uma maior perda de vitamina C, devido a sua alta solubilidade.The degradation of vitamin C in prunes submitted to different conditions of temperature and moisture content was modeling by using the Bigelow equation. Firstly, plums were freeze-dried and conditioned in dessecators with different saturated salt solutions at 4ºC. After reaching the equilibrium, dessecators were submitted to a range of temperature between 40 to 80ºC. The vitamin C degradation was analyzed during 5 days, by applying the titration method with patronized solution of 2,6-dichlorophenolindophenol 0.01%. Samples presented

  3. Cloning and characterization of prunus serotina AGAMOUS, a putative flower homeotic gene

    Science.gov (United States)

    Xiaomei Liu; Joseph Anderson; Paula Pijut

    2010-01-01

    Members of the AGAMOUS subfamily of MADS-box transcription factors play an important role in regulating the development of reproductive organs in flowering plants. To help understand the mechanism of floral development in black cherry (Prunus serotina), PsAG (a putative flower homeotic identity gene) was isolated...

  4. Soil feedback and pathogen activity in Prunus serotina throughout its native range

    NARCIS (Netherlands)

    Reinhart, K.O.; Royo, A.A.; Putten, van der W.H.; Clay, K.

    2005-01-01

    1 Oomycete soil pathogens are known to have a negative effect on Prunus serotina seedling establishment and to promote tree diversity in a deciduous forest in Indiana, USA. Here, we investigate whether negative feedbacks operate widely in its native range in eastern USA. 2 In laboratory experiments,

  5. Multiyear evaluation of the durability of the resistance conferred by Ma and RMia genes to Meloidogyne incognita in Prunus under controlled conditions.

    Science.gov (United States)

    Khallouk, Samira; Voisin, Roger; Portier, Ulysse; Polidori, Joël; Van Ghelder, Cyril; Esmenjaud, Daniel

    2013-08-01

    Root-knot nematodes (RKNs) (Meloidogyne spp.) are highly polyphagous pests that parasitize Prunus crops in Mediterranean climates. Breeding for RKN-resistant Prunus cultivars, as an alternative to the now-banned use of nematicides, is a real challenge, because the perennial nature of these trees increases the risk of resistance breakdown. The Ma plum resistance (R) gene, with a complete spectrum, and the RMia peach R gene, with a more restricted spectrum, both provide total control of Meloidogyne incognita, the model parthenogenetic species of the genus and the most important RKN in terms of economic losses. We investigated the durability of the resistance to this nematode conferred by these genes, comparing the results obtained with those for the tomato Mi-1 reference gene. In multiyear experiments, we applied a high and continuous nematode inoculum pressure by cultivating nematode-infested susceptible tomato plants with either Prunus accessions carrying Ma or RMia R genes, or with resistant tomato plants carrying the Mi-1 gene. Suitable conditions for Prunus development were achieved by carrying out the studies in a glasshouse, in controlled conditions allowing a short winter leaf fall and dormancy. We first assessed the plum accession 'P.2175', which is heterozygous for the Ma gene, in two successive 2-year evaluations, for resistance to two M. incognita isolates. Whatever the isolate used, no nematodes reproducing on P.2175 were detected, whereas galls and nematodes reproducing on tomato plants carrying Mi-1 were observed. In a second experiment with the most aggressive isolate, interspecific full-sib material (P.2175 × ['Garfi' almond × 'Nemared' peach]), carrying either Ma or RMia (from Nemared) or both (in the heterozygous state) or neither of these genes, was evaluated for 4 years. No virulent nematodes developed on Prunus spp. carrying R genes, whereas galling and virulent individuals were observed on Mi-1-resistant tomato plants. Thus, the resistance to

  6. Rapid Detection of Prunus Necrotic Ringspot Virus by Reverse Transcription-cross-priming Amplification Coupled with Nucleic Acid Test Strip Cassette.

    Science.gov (United States)

    Huo, Ya-Yun; Li, Gui-Fen; Qiu, Yan-Hong; Li, Wei-Min; Zhang, Yong-Jiang

    2017-11-23

    Prunus necrotic ringspot virus (PNRSV) is one of the most devastating viruses to Prunus spp. In this study, we developed a diagnostic system RT-CPA-NATSC, wherein reverse transcription-cross-priming amplification (RT-CPA) is coupled with nucleic acid test strip cassette (NATSC), a vertical flow (VF) visualization, for PNRSV detection. The RT-CPA-NATSC assay targets the encoding gene of the PNRSV coat protein with a limit of detection of 72 copies per reaction and no cross-reaction with the known Prunus pathogenic viruses and viroids, demonstrating high sensitivity and specificity. The reaction is performed on 60 °C and can be completed less than 90 min with the prepared template RNA. Field sample test confirmed the reliability of RT-CPA-NATSC, indicating the potential application of this simple and rapid detection method in routine test of PNRSV.

  7. A Rapid and Efficient Method for Purifying High Quality Total RNA from Peaches (Prunus persica for Functional Genomics Analyses

    Directory of Open Access Journals (Sweden)

    LEE MEISEL

    2005-01-01

    Full Text Available Prunus persica has been proposed as a genomic model for deciduous trees and the Rosaceae family. Optimized protocols for RNA isolation are necessary to further advance studies in this model species such that functional genomics analyses may be performed. Here we present an optimized protocol to rapidly and efficiently purify high quality total RNA from peach fruits (Prunus persica. Isolating high-quality RNA from fruit tissue is often difficult due to large quantities of polysaccharides and polyphenolic compounds that accumulate in this tissue and co-purify with the RNA. Here we demonstrate that a modified version of the method used to isolate RNA from pine trees and the woody plant Cinnamomun tenuipilum is ideal for isolating high quality RNA from the fruits of Prunus persica. This RNA may be used for many functional genomic based experiments such as RT-PCR and the construction of large-insert cDNA libraries.

  8. Application of dietary fiber method AOAC 2011.25 in fruit and comparison with AOAC 991.43 method.

    Science.gov (United States)

    Tobaruela, Eric de C; Santos, Aline de O; Almeida-Muradian, Ligia B de; Araujo, Elias da S; Lajolo, Franco M; Menezes, Elizabete W

    2018-01-01

    AOAC 2011.25 method enables the quantification of most of the dietary fiber (DF) components according to the definition proposed by Codex Alimentarius. This study aimed to compare the DF content in fruits analyzed by the AOAC 2011.25 and AOAC 991.43 methods. Plums (Prunus salicina), atemoyas (Annona x atemoya), jackfruits (Artocarpus heterophyllus), and mature coconuts (Cocos nucifera) from different Brazilian regions (3 lots/fruit) were analyzed for DF, resistant starch, and fructans contents. The AOAC 2011.25 method was evaluated for precision, accuracy, and linearity in different food matrices and carbohydrate standards. The DF contents of plums, atemoyas, and jackfruits obtained by AOAC 2011.25 was higher than those obtained by AOAC 991.43 due to the presence of fructans. The DF content of mature coconuts obtained by the same methods did not present a significant difference. The AOAC 2011.25 method is recommended for fruits with considerable fructans content because it achieves more accurate values. Copyright © 2016 Elsevier Ltd. All rights reserved.

  9. Mining microsatellites in the peach genome: development of new long-core SSR markers for genetic analyses in five Prunus species.

    Science.gov (United States)

    Dettori, Maria Teresa; Micali, Sabrina; Giovinazzi, Jessica; Scalabrin, Simone; Verde, Ignazio; Cipriani, Guido

    2015-01-01

    A wide inventory of molecular markers is nowadays available for individual fingerprinting. Microsatellites, or simple sequence repeats (SSRs), play a relevant role due to their relatively ease of use, their abundance in the plant genomes, and their co-dominant nature, together with the availability of primer sequences in many important agricultural crops. Microsatellites with long-core motifs are more easily scored and were adopted long ago in human genetics but they were developed only in few crops, and Prunus species are not among them. In the present work the peach whole-genome sequence was used to select 216 SSRs containing long-core motifs with tri-, tetra- and penta-nucleotide repeats. Microsatellite primer pairs were designed and tested for polymorphism in the five diploid Prunus species of economic relevance (almond, apricot, Japanese plum, peach and sweet cherry). A set of 26 microsatellite markers covering all the eight chromosomes, was also selected and used in the molecular characterization, population genetics and structure analyses of a representative sample of the five diploid Prunus species, assessing their transportability and effectiveness. The combined probability of identity between two random individuals for the whole set of 26 SSRs was quite low, ranging from 2.30 × 10(-7) in peach to 9.48 × 10(-10) in almond, confirming the usefulness of the proposed set for fingerprinting analyses in Prunus species.

  10. Genome-wide association links candidate genes to resistance to Plum Pox Virus in apricot (Prunus armeniaca).

    Science.gov (United States)

    Mariette, Stéphanie; Wong Jun Tai, Fabienne; Roch, Guillaume; Barre, Aurélien; Chague, Aurélie; Decroocq, Stéphane; Groppi, Alexis; Laizet, Yec'han; Lambert, Patrick; Tricon, David; Nikolski, Macha; Audergon, Jean-Marc; Abbott, Albert G; Decroocq, Véronique

    2016-01-01

    In fruit tree species, many important traits have been characterized genetically by using single-family descent mapping in progenies segregating for the traits. However, most mapped loci have not been sufficiently resolved to the individual genes due to insufficient progeny sizes for high resolution mapping and the previous lack of whole-genome sequence resources of the study species. To address this problem for Plum Pox Virus (PPV) candidate resistance gene identification in Prunus species, we implemented a genome-wide association (GWA) approach in apricot. This study exploited the broad genetic diversity of the apricot (Prunus armeniaca) germplasm containing resistance to PPV, next-generation sequence-based genotyping, and the high-quality peach (Prunus persica) genome reference sequence for single nucleotide polymorphism (SNP) identification. The results of this GWA study validated previously reported PPV resistance quantitative trait loci (QTL) intervals, highlighted other potential resistance loci, and resolved each to a limited set of candidate genes for further study. This work substantiates the association genetics approach for resolution of QTL to candidate genes in apricot and suggests that this approach could simplify identification of other candidate genes for other marked trait intervals in this germplasm. © 2015 INRA, UMR 1332 BFP New Phytologist © 2015 New Phytologist Trust.

  11. Soil feedback and pathogen activity in Prunus serotina throughout its native range

    Science.gov (United States)

    Kurt O. Reinhart; Alejandro Royo; Wim H. Van der Putten; Keith Clay

    2005-01-01

    1 Oomycete soil pathogens are known to have a negative effect on Prunus serotina seedling establishment and to promote tree diversity in a deciduous forest in Indiana, USA. Here, we investigate whether negative feedbacks operate widely in its native range in eastern USA. 2 In laboratory experiments, soil sterilization was used to test the...

  12. Agrobacterium-medicated transformation of mature Prunus serotina (black cherry) and regeneration of trangenic shoots

    Science.gov (United States)

    Xiaomei Liu; Paula Pijut

    2010-01-01

    A protocol for Agrobacterium-mediated transformation was developed for in vitro leaf explants of an elite, mature Prunus serotina tree. Agrobacterium tumefaciens strain EHA105 harboring an RNAi plasmid with the black cherry AGAMOUS (AG) gene was used. Bacteria were induced...

  13. Kirsipuu (Prunus avium) : [luuletused] / R. W. Stedingh ; tlk. ja saatesõna: Jüri Talvet

    Index Scriptorium Estoniae

    Stedingh, R. W.

    2003-01-01

    Sisu: Kirsipuu (Prunus avium) ; Rubus spectabilis ; Rododendron (Rhododendron macrophyllum) ; Lysuchitum americanum ; Tulp (Tulipa gesneriana) ; Kanada hani (Branta canadensis) ; Metsorava pärastlõuna (Sciurus carolinensis) ; Ohakalind (Spinus tristis) ; Shakespeare'i mälestusmärk (kogust "Stanley pargi süit")

  14. Brown Rot Strikes Prunus Fruit: An Ancient Fight Almost Always Lost.

    Science.gov (United States)

    Oliveira Lino, Leandro; Pacheco, Igor; Mercier, Vincent; Faoro, Franco; Bassi, Daniele; Bornard, Isabelle; Quilot-Turion, Bénédicte

    2016-05-25

    Brown rot (BR) caused by Monilinia spp., has been an economic problem for the stone fruit market due to dramatic losses, mainly during the postharvest period. There is much literature about basic aspects of Monilinia spp. infection, which indicates that environment significantly influences its occurrence in the orchard. However, progress is needed to sustainably limit this disease: the pathogen is able to develop resistance to pesticides, and most of BR resistance research programs in plant models perish. Solving this problem becomes important due to the need to decrease chemical treatments and reduce residues on fruit. Thus, research has recently increased, exploring a wide range of disease control strategies (e.g., genetic, chemical, physical). Summarizing this information is difficult, as studies evaluate different Monilinia and Prunus model species, with diverse strategies and protocols. Thus, the purpose of this review is to present the diversity and distribution of agents causing BR, focusing on the biochemical mechanisms of Monilinia spp. infection both of the fungi and of the fruit, and report on the resistance sources in Prunus germplasm. This review comprehensively compiles the information currently available to better understand mechanisms related to BR resistance.

  15. Preparation of recombinant coat protein of Prunus necrotic ringspot virus.

    Science.gov (United States)

    Petrzik, K; Mráz, I; Kubelková, D

    2001-02-01

    The coat protein (CP) gene of Prunus necrotic ringspot virus (PNRSV) was cloned into pET 16b vector and expressed in Escherichia coli. CP-enriched fractions were prepared from whole cell lysate by differential centrifugation. The fraction sedimenting at 20,000 x g for 30 mins was used for preparation of a rabbit antiserum to CP. This antiserum had a titer of 1:2048 and reacted in a double-antibody sandwich ELISA (DAS-ELISA).

  16. Formulation and quality control of Prunus domestica syrup, prepared according to Iranian Traditional Medicine

    Directory of Open Access Journals (Sweden)

    M. Hamzeloo-Moghadam

    2015-05-01

    Full Text Available Background and objectives: Prunus domestica (plum has been considered as a useful remedy for several disorders in Iranian Traditional Medicine (ITM. It has cold and wet temperament and is used as syrup for hot temperament diseases such as hot headache and stomach disorders. In the present study, plum syrup has been formulated according to ITM manuscripts and quality control evaluations have been accomplished to present a suitable formulation. Methods: The fruits of Prunus domestica L. were macerated in water, then decocted. The mixture was filtered. The filtrate was concentrated to have a suitable viscosity. The extract was sweetened by adding sugar (1:2 and heated till sugar was completely dissolved. The final product was evaluated physicochemically and microbiologically according to standard protocols and total phenolics content of the syrup stability was determined. The syrup was assessed in accelerated condition (40 ºC during 6 months. Results: The prepared formulation was a viscose and brown syrup with plum flavor and fragrance. No precipitation and cap locking were observed in the syrup. Dry residue, pH, density, viscosity and total phenolics of the syrup were found 43.1%, 3.49, 1.27 g/ml, 6.5 cP and 152.3 mg/100ml, respectively. No microbial growth was observed in the formulation. In the accelerated stability tests, no remarkable changes were seen in the product. Total phenolics content was decreased 2.2% during 6 months in 40 ºC. Conclusion: The formulated Prunus domestica syrup could be introduced for further mass production after completing the final required evaluations.

  17. Industrial processing effects on phenolic compounds in sour cherry (Prunus cerasus L.) fruit

    NARCIS (Netherlands)

    Toydemir, G.; Capanoglu, E.; Gomez-Roldan, M.V.; Vos, de R.C.H.; Boyacioglu, D.; Hall, R.D.; Beekwilder, M.J.

    2013-01-01

    The processed juice (or nectar) of the sour cherry, Prunus cerasus L., is widely consumed in the Balkan region and Turkey. Sour cherry is known to be rich in polyphenolic compounds, such as anthocyanins and procyanidins. In this work, the effects of processing of sour cherry fruit to nectar on

  18. Can Prunus serotina be genetically engineered for reproductive sterility and insect pest resistance?

    Science.gov (United States)

    Ying Wang; Paula M. Pijut

    2014-01-01

    Black cherry (Prunus serotina) is a valuable hardwood timber species, and its value highly depends on the wood quality which is often threatened by insect pests. Transgenic black cherry plants that are more resistant to cambial-mining insects may reduce the occurrence of gummosis and have great economic benefits to landowners and the forest products...

  19. De novo transcriptome assembly of ‘Angeleno’ and ‘Lamoon’ Japanese plum cultivars (Prunus salicina

    Directory of Open Access Journals (Sweden)

    Máximo González

    2016-09-01

    De novo transcriptome assembly was performed using CLC Genome Workbench software and a total of 54,584 unique contigs were generated, with an N50 of 1343 base pair (bp and a mean length of 829 bp. This work contributed with a specific Japanese plum skin transcriptome, providing two libraries of contrasting fruit skin color phenotype (yellow and red and increasing substantially the GB of raw data available until now for this specie.

  20. Analysis of expressed sequence tags from Prunus mume flower and fruit and development of simple sequence repeat markers

    Directory of Open Access Journals (Sweden)

    Gao Zhihong

    2010-07-01

    Full Text Available Abstract Background Expressed Sequence Tag (EST has been a cost-effective tool in molecular biology and represents an abundant valuable resource for genome annotation, gene expression, and comparative genomics in plants. Results In this study, we constructed a cDNA library of Prunus mume flower and fruit, sequenced 10,123 clones of the library, and obtained 8,656 expressed sequence tag (EST sequences with high quality. The ESTs were assembled into 4,473 unigenes composed of 1,492 contigs and 2,981 singletons and that have been deposited in NCBI (accession IDs: GW868575 - GW873047, among which 1,294 unique ESTs were with known or putative functions. Furthermore, we found 1,233 putative simple sequence repeats (SSRs in the P. mume unigene dataset. We randomly tested 42 pairs of PCR primers flanking potential SSRs, and 14 pairs were identified as true-to-type SSR loci and could amplify polymorphic bands from 20 individual plants of P. mume. We further used the 14 EST-SSR primer pairs to test the transferability on peach and plum. The result showed that nearly 89% of the primer pairs produced target PCR bands in the two species. A high level of marker polymorphism was observed in the plum species (65% and low in the peach (46%, and the clustering analysis of the three species indicated that these SSR markers were useful in the evaluation of genetic relationships and diversity between and within the Prunus species. Conclusions We have constructed the first cDNA library of P. mume flower and fruit, and our data provide sets of molecular biology resources for P. mume and other Prunus species. These resources will be useful for further study such as genome annotation, new gene discovery, gene functional analysis, molecular breeding, evolution and comparative genomics between Prunus species.

  1. Genome-Wide Analysis Suggests the Relaxed Purifying Selection Affect the Evolution of WOX Genes in Pyrus bretschneideri, Prunus persica, Prunus mume, and Fragaria vesca

    Directory of Open Access Journals (Sweden)

    Yunpeng Cao

    2017-06-01

    Full Text Available WUSCHEL-related homeobox (WOX family is one of the largest group of transcription factors (TFs specifically found in plant kingdom. WOX TFs play an important role in plant development processes and evolutionary novelties. Although the roles of WOXs in Arabidopsis and rice have been well-studied, however, little are known about the relationships among the main clades in the molecular evolution of these genes in Rosaceae. Here, we carried out a genome-wide analysis and identified 14, 10, 10, and 9 of WOX genes from four Rosaceae species (Fragaria vesca, Prunus persica, Prunus mume, and Pyrus bretschneideri, respectively. According to evolutionary analysis, as well as amino acid sequences of their homodomains, these genes were divided into three clades with nine subgroups. Furthermore, due to the conserved structural patterns among these WOX genes, it was proposed that there should exist some highly conserved regions of microsynteny in the four Rosaceae species. Moreover, most of WOX gene pairs were presented with the conserved orientation among syntenic genome regions. In addition, according to substitution models analysis using PMAL software, no significant positive selection was detected, but type I functional divergence was identified among certain amino acids in WOX protein. These results revealed that the relaxed purifying selection might be the main driving force during the evolution of WOX genes in the tested Rosaceae species. Our result will be useful for further precise research on evolution of the WOX genes in family Rosaceae.

  2. Coniochaeta (Lecythophora), Collophora gen. nov. And Phaeomoniella species associated with wood necroses of Prunus trees

    NARCIS (Netherlands)

    Damm, U.; Fourie, P.H.; Crous, P.W.

    2010-01-01

    Species of the genus Coniochaeta (anamorph: Lecythophora) are known as pathogens of woody hosts, but can also cause opportunistic human infections. Several fungi with conidial stages resembling Lecythophora were isolated from necrotic wood samples of Prunus trees in South Africa. In order to reveal

  3. Caracterização de três genótipos de umezeiro (Prunus mume Sieb. et Zucc. por marcadores RAPD Characterization of three mume genotypes (Prunus mume Sieb. et Zucc. by RAPD markers

    Directory of Open Access Journals (Sweden)

    Newton Alex Mayer

    2008-12-01

    Full Text Available Um projeto de pesquisa visando à utilização de clones de umezeiro (Prunus mume Sieb. et Zucc. como porta-enxertos para pessegueiro [Prunus persica (L. Batsch] está sendo conduzido na FCAV/UNESP, Câmpus de Jaboticabal-SP, com promissoras perspectivas de sucesso. Três genótipos de umezeiro foram selecionados de acordo com características agronômicas desejáveis para esta finalidade. A distinção dos três genótipos entre si, baseada exclusivamente em características morfológicas, apresenta limitações. Dessa forma, o objetivo do presente trabalho foi identificar marcadores RAPD capazes de diferenciar e caracterizar os Clones 05, 15 e a cv. Rigitano (Clone 10 de umezeiro, utilizando-se das cultivares Aurora-1 e Okinawa de pessegueiro como outgroup. Dos 220 primers testados, foram selecionados 42, que amplificaram todos os cinco genótipos. Verificou-se que os marcadores RAPD permitiram a distinção entre o Clone 05, o Clone 15 e a cv. Rigitano de umezeiro, demonstrando a existência de variabilidade genética entre os mesmos. Dentre os três genótipos de umezeiro estudados, constatou-se que a similaridade genética é maior entre o Clone 05 e o Clone 15.A research project with the objective do develop mume clones (Prunus mume Sieb. et Zucc., to be used as rootstocks for peach tree [Prunus persica (L. Batsch] is been carried out at the Faculdade de Ciências Agrárias e Veterinárias (FCAV/UNESP, Jaboticabal Campus, São Paulo State, Brazil. These project showed promising perspectives of success, with three clones that were selected according to their characteristics for peach rootstock. But the distinction of the three clones among them, based only in morphologic characteristics, has presented limitations. The objective of the present research was to identify RAPD markers able to characterize and differentiate the 05 and 15 Clones and Rigitano mume cultivar, using Aurora-1 and Okinawa peach tree as outgroup. Among the 220 tested

  4. Polyphyly of the Padus group of Prunus (Rosaceae) and the evolution of biogeographic disjunctions between eastern Asia and eastern North America.

    Science.gov (United States)

    Liu, Xiao-Lin; Wen, Jun; Nie, Ze-Long; Johnson, Gabriel; Liang, Zong-Suo; Chang, Zhao-Yang

    2013-05-01

    Prunus subgenus Padus is a group with a wide distribution in temperate eastern Asia and eastern North America with one species extending to Europe and one to Central America. Phylogenetic relationships of subgenus Padus were reconstructed using sequences of nuclear ribosomal ITS, and plastid ndhF gene, and rps16 intron and rpl16 intron. Prunus subgenus Padus is shown to be polyphyletic. Taxa of subgenus Padus and subgenus Laurocerasus are highly intermixed in both the ITS and the plastid trees. The results support two disjunctions between eastern North America and Eurasia within the Padus group. One disjunction is between Prunus virginiana of eastern North America and P. padus of Eurasia, estimated to have diverged at 2.99 (95 % HPD 0.59-6.15)-4.1 (95 % HPD 0.63-8.59) mya. The other disjunction is between P. serotina and its Asian relatives. The second disjunction may have occurred earlier than the former one, but the age estimate is difficult due to the unresolved phylogenetic position of the P. serotina complex.

  5. Whole-Genome Characterization of Prunus necrotic ringspot virus Infecting Sweet Cherry in China.

    Science.gov (United States)

    Wang, Jiawei; Zhai, Ying; Zhu, Dongzi; Liu, Weizhen; Pappu, Hanu R; Liu, Qingzhong

    2018-03-01

    Prunus necrotic ringspot virus (PNRSV) causes yield loss in most cultivated stone fruits, including sweet cherry. Using a small RNA deep-sequencing approach combined with end-genome sequence cloning, we identified the complete genomes of all three PNRSV strands from PNRSV-infected sweet cherry trees and compared them with those of two previously reported isolates. Copyright © 2018 Wang et al.

  6. Molecular characterization of peach [Prunus persica (L.) Batsch] germplasm in the United States using microsatellite markers

    Science.gov (United States)

    Peach [Prunus persica (L.) Batsch] is an important medicinal fruit with immense health benefits and antioxidant activity. In this study, microsatellite markers were used as DNA fingerprinting tools for the identification and characterization of peach germplasm in the United States. Eleven microsatel...

  7. In situ volatiles from a single cultivar of Prunus dulcis and their relationship to navel orangeworm

    Science.gov (United States)

    Nonpareil almonds, Prunus dulcis, account for the largest percentage of almond varieties grown in the Central and San Joaquin valleys of California. Several studies have investigated the various non-volatile and volatile components of various plant parts; however, the volatile organic compound (VOC)...

  8. Endogenous hormones response to cytokinins with regard to organogenesis in explants of peach (Prunus persica L. Batsch) cultivars and rootstocks (P. persica × Prunus dulcis).

    Science.gov (United States)

    Pérez-Jiménez, Margarita; Cantero-Navarro, Elena; Pérez-Alfocea, Francisco; Cos-Terrer, José

    2014-11-01

    Organogenesis in peach (Prunus persica L. Batsch) and peach rootstocks (P. persica × Prunus dulcis) has been achieved and the action of the regeneration medium on 7 phytohormones, zeatin (Z), zeatin riboside (ZR), indole-3-acetic acid (IAA), abscisic acid (ABA), ethylene precursor 1-aminocyclopropane-1-carboxylic acid (ACC), salicylic acid (SA), and jasmonic acid (JA), has been studied using High performance liquid chromatography - mass spectrometry (HPLC-MS/MS). Three scion peach cultivars, 'UFO-3', 'Flariba' and 'Alice Bigi', and the peach × almond rootstocks 'Garnem' and 'GF677' were cultured in two different media, Murashige and Skoog supplemented with plant growth regulators (PGRs) (regeneration medium) and without PGRs (control medium), in order to study the effects of the media and/or genotypes in the endogenous hormones content and their role in organogenesis. The highest regeneration rate was obtained with the peach × almond rootstocks and showed a lower content of Z, IAA, ABA, ACC and JA. Only Z, ZR and IAA were affected by the action of the culture media. This study shows which hormones are external PGRs-dependent and what is the weight of the genotype and hormones in peach organogenesis that provide an avenue to manipulate in vitro organogenesis in peach. Copyright © 2014 Elsevier Masson SAS. All rights reserved.

  9. Tests for Transmission of Prunus Necrotic Ringspot and Two Nepoviruses by Criconemella xenoplax.

    Science.gov (United States)

    Yuan, W Q; Barnett, O W; Westcott, S W; Scott, S W

    1990-10-01

    In two of three trials, detectable color reactions in ELISA for Prunus necrotic ringspot virus (PNRSV) were observed for Criconemella xenoplax handpicked from the root zone of infected peach trees. Criconemella xenoplax (500/pot) handpicked from root zones of peach trees infected with PNRSV failed to transmit the virus to cucumber or peach seedlings. The nematode also failed to transmit tomato ringspot (TomRSV) or tobacco ringspot viruses between cucumbers, although Xiphinema americanum transmitted TomRSV under the same conditions. Plants of peach, cucumber, Chenopodium quinoa, and Catharanthus roseus were not infected by PNRSV when grown in soil containing C. xenoplax collected from root zones of PNRSV-infected trees. Shirofugen cherry scions budded on Mazzard cherry seedling rootstocks remained symptomless when transplanted into root zones of PNRSV-infected trees. Virus transmission was not detected by ELISA when C. xenoplax individuals were observed to feed on cucumber root explants that were infected with PNRSV and subsequently fed on roots of Prunus besseyi in agar cultures. Even if virus transmission by C. xenoplax occurs via contamination rather than by a specific mechanism, it must be rare.

  10. Genetic and molecular characterization of three novel S-haplotypes in sour cherry (Prunus cerasus L.).

    Science.gov (United States)

    Tsukamoto, Tatsuya; Potter, Daniel; Tao, Ryutaro; Vieira, Cristina P; Vieira, Jorge; Iezzoni, Amy F

    2008-01-01

    Tetraploid sour cherry (Prunus cerasus L.) exhibits gametophytic self-incompatibility (GSI) whereby the specificity of self-pollen rejection is controlled by alleles of the stylar and pollen specificity genes, S-RNase and SFB (S haplotype-specific F-box protein gene), respectively. As sour cherry selections can be either self-compatible (SC) or self-incompatible (SI), polyploidy per se does not result in SC. Instead the genotype-dependent loss of SI in sour cherry is due to the accumulation of non-functional S-haplotypes. The presence of two or more non-functional S-haplotypes within sour cherry 2x pollen renders that pollen SC. Two new S-haplotypes from sour cherry, S(33) and S(34), that are presumed to be contributed by the P. fruticosa species parent, the complete S-RNase and SFB sequences of a third S-haplotype, S(35), plus the presence of two previously identified sweet cherry S-haplotypes, S(14) and S(16) are described here. Genetic segregation data demonstrated that the S(16)-, S(33)-, S(34)-, and S(35)-haplotypes present in sour cherry are fully functional. This result is consistent with our previous finding that 'hetero-allelic' pollen is incompatible in sour cherry. Phylogenetic analyses of the SFB and S-RNase sequences from available Prunus species reveal that the relationships among S-haplotypes show no correspondence to known organismal relationships at any taxonomic level within Prunus, indicating that polymorphisms at the S-locus have been maintained throughout the evolution of the genus. Furthermore, the phylogenetic relationships among SFB sequences are generally incongruent with those among S-RNase sequences for the same S-haplotypes. Hypotheses compatible with these results are discussed.

  11. Antioxidant and antimicrobial activity of capulin (Prunus serotina subsp capuli) extracts

    OpenAIRE

    Jimenez, M.; Castillo, I.; Azuara, E.; Beristain, C.I.

    2011-01-01

    Capulin (Prunus serotina subsp. capuli) is an annual fruit widely used in Mexico for the elaboration of several traditional products, such as medicinal tea, which is considered to present antioxidant and antimicrobial properties. The aim of this work was to evaluate the antioxidant and antimicrobial properties of aqueous, acetone, ethanol and methanol extracts. The ethanol extract presented a high anthocyanin (102±7.70 mg Cyd-3-glu/100 g extract) and polyphenol (1732±43.40 mg GAE /100 g extra...

  12. Characterization of cytokinin signaling and homeostasis gene families in two hardwood tree species: Populus trichocarpa and Prunus persica.

    Science.gov (United States)

    Immanen, Juha; Nieminen, Kaisa; Duchens Silva, Héctor; Rodríguez Rojas, Fernanda; Meisel, Lee A; Silva, Herman; Albert, Victor A; Hvidsten, Torgeir R; Helariutta, Ykä

    2013-12-16

    Through the diversity of cytokinin regulated processes, this phytohormone has a profound impact on plant growth and development. Cytokinin signaling is involved in the control of apical and lateral meristem activity, branching pattern of the shoot, and leaf senescence. These processes influence several traits, including the stem diameter, shoot architecture, and perennial life cycle, which define the development of woody plants. To facilitate research about the role of cytokinin in regulation of woody plant development, we have identified genes associated with cytokinin signaling and homeostasis pathways from two hardwood tree species. Taking advantage of the sequenced black cottonwood (Populus trichocarpa) and peach (Prunus persica) genomes, we have compiled a comprehensive list of genes involved in these pathways. We identified genes belonging to the six families of cytokinin oxidases (CKXs), isopentenyl transferases (IPTs), LONELY GUY genes (LOGs), two-component receptors, histidine containing phosphotransmitters (HPts), and response regulators (RRs). All together 85 Populus and 45 Prunus genes were identified, and compared to their Arabidopsis orthologs through phylogenetic analyses. In general, when compared to Arabidopsis, differences in gene family structure were often seen in only one of the two tree species. However, one class of genes associated with cytokinin signal transduction, the CKI1-like family of two-component histidine kinases, was larger in both Populus and Prunus than in Arabidopsis.

  13. Changes in sour cherry (Prunus cerasus L.) antioxidants during nectar processing and in vitro gastrointestinal digestion.

    NARCIS (Netherlands)

    Toydemir, G.; Capanoglu, E.; Kamiloglu, S.; Boyacioglu, D.; Vos, de C.H.; Hall, R.D.; Beekwilder, M.J.

    2013-01-01

    Sour cherry (Prunus cerasus L.) is rich in polyphenols, and like its processed products, is especially rich in anthocyanins. We have applied HPLC, spectrophotometric and on-line antioxidant detection methods to follow the fate of cherry antioxidants during an entire multi-step industrial-scale

  14. Comparison of ELISA and RT-PCR for the detection of Prunus necrotic ring spot virus and prune dwarf virus in almond (Prunus dulcis).

    Science.gov (United States)

    Mekuria, Genet; Ramesh, Sunita A; Alberts, Evita; Bertozzi, Terry; Wirthensohn, Michelle; Collins, Graham; Sedgley, Margaret

    2003-12-01

    A technique based on the reverse transcriptase-polymerase chain reaction (RT-PCR) has been developed to detect the presence of Prunus necrotic ringspot virus (PNRSV) and prune dwarf virus (PDV) simultaneously in almond. This paper presents the results of a 3-year study comparing both enzyme-linked immunosorbent assay (ELISA) and RT-PCR for the detection of PNRSV and PDV using 175 almond leaf samples. Multiplex RT-PCR was found to be more sensitive than ELISA, especially when followed by nested PCR for the detection of PDV. The RT-PCR technique has the added advantage that plant material can be tested at any time throughout the growing season.

  15. Generic Amplicon Deep Sequencing to Determine Ilarvirus Species Diversity in Australian Prunus.

    Science.gov (United States)

    Kinoti, Wycliff M; Constable, Fiona E; Nancarrow, Narelle; Plummer, Kim M; Rodoni, Brendan

    2017-01-01

    The distribution of Ilarvirus species populations amongst 61 Australian Prunus trees was determined by next generation sequencing (NGS) of amplicons generated using a genus-based generic RT-PCR targeting a conserved region of the Ilarvirus RNA2 component that encodes the RNA dependent RNA polymerase (RdRp) gene. Presence of Ilarvirus sequences in each positive sample was further validated by Sanger sequencing of cloned amplicons of regions of each of RNA1, RNA2 and/or RNA3 that were generated by species specific PCRs and by metagenomic NGS. Prunus necrotic ringspot virus (PNRSV) was the most frequently detected Ilarvirus , occurring in 48 of the 61 Ilarvirus -positive trees and Prune dwarf virus (PDV) and Apple mosaic virus (ApMV) were detected in three trees and one tree, respectively. American plum line pattern virus (APLPV) was detected in three trees and represents the first report of APLPV detection in Australia. Two novel and distinct groups of Ilarvirus -like RNA2 amplicon sequences were also identified in several trees by the generic amplicon NGS approach. The high read depth from the amplicon NGS of the generic PCR products allowed the detection of distinct RNA2 RdRp sequence variant populations of PNRSV, PDV, ApMV, APLPV and the two novel Ilarvirus -like sequences. Mixed infections of ilarviruses were also detected in seven Prunus trees. Sanger sequencing of specific RNA1, RNA2, and/or RNA3 genome segments of each virus and total nucleic acid metagenomics NGS confirmed the presence of PNRSV, PDV, ApMV and APLPV detected by RNA2 generic amplicon NGS. However, the two novel groups of Ilarvirus -like RNA2 amplicon sequences detected by the generic amplicon NGS could not be associated to the presence of sequence from RNA1 or RNA3 genome segments or full Ilarvirus genomes, and their origin is unclear. This work highlights the sensitivity of genus-specific amplicon NGS in detection of virus sequences and their distinct populations in multiple samples, and the

  16. Generic Amplicon Deep Sequencing to Determine Ilarvirus Species Diversity in Australian Prunus

    Directory of Open Access Journals (Sweden)

    Wycliff M. Kinoti

    2017-06-01

    Full Text Available The distribution of Ilarvirus species populations amongst 61 Australian Prunus trees was determined by next generation sequencing (NGS of amplicons generated using a genus-based generic RT-PCR targeting a conserved region of the Ilarvirus RNA2 component that encodes the RNA dependent RNA polymerase (RdRp gene. Presence of Ilarvirus sequences in each positive sample was further validated by Sanger sequencing of cloned amplicons of regions of each of RNA1, RNA2 and/or RNA3 that were generated by species specific PCRs and by metagenomic NGS. Prunus necrotic ringspot virus (PNRSV was the most frequently detected Ilarvirus, occurring in 48 of the 61 Ilarvirus-positive trees and Prune dwarf virus (PDV and Apple mosaic virus (ApMV were detected in three trees and one tree, respectively. American plum line pattern virus (APLPV was detected in three trees and represents the first report of APLPV detection in Australia. Two novel and distinct groups of Ilarvirus-like RNA2 amplicon sequences were also identified in several trees by the generic amplicon NGS approach. The high read depth from the amplicon NGS of the generic PCR products allowed the detection of distinct RNA2 RdRp sequence variant populations of PNRSV, PDV, ApMV, APLPV and the two novel Ilarvirus-like sequences. Mixed infections of ilarviruses were also detected in seven Prunus trees. Sanger sequencing of specific RNA1, RNA2, and/or RNA3 genome segments of each virus and total nucleic acid metagenomics NGS confirmed the presence of PNRSV, PDV, ApMV and APLPV detected by RNA2 generic amplicon NGS. However, the two novel groups of Ilarvirus-like RNA2 amplicon sequences detected by the generic amplicon NGS could not be associated to the presence of sequence from RNA1 or RNA3 genome segments or full Ilarvirus genomes, and their origin is unclear. This work highlights the sensitivity of genus-specific amplicon NGS in detection of virus sequences and their distinct populations in multiple samples

  17. Risico voor fruitbomen en inheemse bomen na bestrijding van Amerikaanse vogelkers (Prunus serotina) met loodglansschimmel (Chondrostereum purpureum) = [Risk to fruit trees and native trees due to control of black cherry (Prunus serotina) by silverleaf fungus (Chondrostereum purpureum)

    NARCIS (Netherlands)

    Jong, de M.D.

    1988-01-01

    The shrub Prunus serotina , introduced from North America, became a forest pest in the Netherlands. Biological control was considered using the fungus Chondrostereum purpureum , commonly present as a saprophyte and parasite in wood. C. purpureum can cause

  18. Molecular characterization of Prunus necrotic ringspot virus isolated from rose in Brazil.

    OpenAIRE

    FAJARDO, T. V. M.; NASCIMENTO, M. B.; EIRAS, M.; NICKEL, O.; PIO-RIBEIRO, G.

    2016-01-01

    ABSTRACT: There is no molecular characterization of Brazilian isolates of Prunus necrotic ringspot virus (PNRSV), except for those infecting peach. In this research, the causal agent of rose mosaic was determined and the movement (MP) and coat (CP) protein genes of a PNRSV isolate from rose were molecularly characterized for the first time in Brazil. The nucleotide and deduced amino acid sequences of MP and CP complete genes were aligned and compared with other isolates. Molecular analysis of...

  19. A fissitunicate ascus mechanism in the Calosphaeriaceae, and novel species of Jattaea and Calosphaeria on Prunus wood

    NARCIS (Netherlands)

    Damm, U.; Crous, P.W.; Fourie, P.H.

    2008-01-01

    During a survey of Prunus wood from South Africa, isolations were made of three presumably Calosphaerialean fungi that formed hyphomycetous, phialidic anamorphs in culture. In order to reveal the phylogenetic relationship of these fungi, they were characterised on a morphological and molecular (LSU

  20. Complete chloroplast genome of Prunus yedoensis Matsum.(Rosaceae), wild and endemic flowering cherry on Jeju Island, Korea.

    Science.gov (United States)

    Cho, Myong-Suk; Hyun Cho, Chung; Yeon Kim, Su; Su Yoon, Hwan; Kim, Seung-Chul

    2016-09-01

    The complete chloroplast genome sequences of the wild flowering cherry, Prunus yedoensis Matsum., which is native and endemic to Jeju Island, Korea, is reported in this study. The genome size is 157 786 bp in length with 36.7% GC content, which is composed of LSC region of 85 908 bp, SSC region of 19 120 bp and two IR copies of 26 379 bp each. The cp genome contains 131 genes, including 86 coding genes, 8 rRNA genes and 37 tRNA genes. The maximum likelihood analysis was conducted to verify a phylogenetic position of the newly sequenced cp genome of P. yedoensis using 11 representatives of complete cp genome sequences within the family Rosaceae. The genus Prunus exhibited monophyly and the result of the phylogenetic relationship agreed with the previous phylogenetic analyses within Rosaceae.

  1. Engineering cherry rootstocks with resistance to Prunus necrotic ring spot virus through RNAi-mediated silencing.

    Science.gov (United States)

    Song, Guo-qing; Sink, Kenneth C; Walworth, Aaron E; Cook, Meridith A; Allison, Richard F; Lang, Gregory A

    2013-08-01

    Prunus necrotic ringspot virus (PNRSV) is a major pollen-disseminated ilarvirus that adversely affects many Prunus species. In this study, an RNA interference (RNAi) vector pART27-PNRSV containing an inverted repeat (IR) region of PNRSV was transformed into two hybrid (triploid) cherry rootstocks, 'Gisela 6' (GI 148-1) and 'Gisela 7'(GI 148-8)', which are tolerant and sensitive, respectively, to PNRSV infection. One year after inoculation with PNRSV plus Prune Dwarf Virus, nontransgenic 'Gisela 6' exhibited no symptoms but a significant PNRSV titre, while the transgenic 'Gisela 6' had no symptoms and minimal PNRSV titre. The nontransgenic 'Gisela 7' trees died, while the transgenic 'Gisela 7' trees survived. These results demonstrate the RNAi strategy is useful for developing viral resistance in fruit rootstocks, and such transgenic rootstocks may have potential to enhance production of standard, nongenetically modified fruit varieties while avoiding concerns about transgene flow and exogenous protein production that are inherent for transformed fruiting genotypes. © 2013 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.

  2. Incidence of Prunus necrotic ringspot virus in Jordan

    Directory of Open Access Journals (Sweden)

    N. Salem

    2003-12-01

    Full Text Available A survey of Prunus necrotic ringspot virus (PNRSV incidence in Jordan stone-fruit growing areas was conducted during 2000–2002. A total of 2552 samples were collected from 72 commercial orchards, a mother block, 15 nurseries, and a varietal collection. A total of 208 almond, 451 apricot, 149 cherry, 250 nectarine, 1016 peach, and 478 plum trees were tested individually for PNRSV by the double-antibody sandwich enzyme linked immunosorbent assay (DAS-ELISA. Around 15% of tested samples were infected with PNRSV. The virus incidence in almond, nectarine, plum, peach, cherry, and apricot was 24, 16, 16, 14, 13, and 10% of tested trees respectively. The level of viral infection was highest in the mother block (19%, and lowest in the samples from the nurseries (10%.

  3. Leaf age affects the responses of foliar injury and gas exchange to tropospheric ozone in Prunus serotina seedlings

    Science.gov (United States)

    Jianwei Zhang; Marcus Schaub; Jonathan A. Ferdinand; John M. Skelly; Kim C. Steiner; James E. Savage

    2010-01-01

    We investigated the effect of leaf age on the response of net photosynthesis (A), stomatal conductance (gwv), foliar injury, and leaf nitrogen concentration (NL) to tropospheric ozone (O3) on Prunus serotina seedlings grown in open-plots (AA) and open-top...

  4. Efeito do substrato e da época de coleta dos ramos no enraizamento de estacas de ameixeira (Prunus salicina Lindl. Effect of substrate and time of cutting collection on rooting of cuttings of plum (Prunus salicina Lindl.

    Directory of Open Access Journals (Sweden)

    Leonardo Ferreira Dutra

    1996-12-01

    Full Text Available O trabalho foi realizado em casa de vegetação do Departamento de Fitotecnia da Faculdade de Agronomia Eliseu Maciel, Universidade Federal de Pelotas, com o objetivo de verificar o efeito de diversos substratos no enraizamento de estacas de ameixeira em diferentes épocas de coleta dos ramos. Foram utilizadas estacas medianas da cultivar Frontier, com comprimento de 15cm e um par de folhas, coletadas nos meses de novembro de 1993, janeiro e março de 1994, obtidas em um pomar comercial com 8 anos de idade. Todas as estacas utilizadas foram tratadas com ácido indolbutirico na concentração de 3000ppm, introduziu-se em torno delem da base das estacas em ácido indolbutirico, na forma de pó e colocou-se em tubetes, acondicionados em bandejas de isopor, contendo diferentes substratos: areia média lavada; vermiculila de grânulos médios; cinza de casca de arroz e serragem de eucalipto, utilizados isolados e em misturas (1: 1v/v. O período de permanência das estacas na casa de vegetação foi de 60 dias. Observou-se maiores índices de enraizamento na coleta dos ramos realizadas em janeiro e março, e que o substrato areia + serragem proporcionou os maiores percentuais de estacas enraizadas com 68,22% e 65,99% nos meses de janeiro e março.This work was carried out in a greenhouse with intermittent mist out at the plant Science Department, Eliseu Maciel Agronomy College of Federal University of Pelotas (Brazil, aiming to evaluate the effect of different substratos and time of cutting on rooting of pium cuttings. Mild cuttings with 15cm length andapair of ieaves of Frontier cultivar were coilected from a commercial orchard eight years old in November 1993, January and March 1994. All cuttings were treated with indolbutiric acid (IBA at 3000ppm concentration introducing about 1.0cm of their basal end in IBA powder and placed in tubes on isopor trays containing different substratos: washed mild sand: vermiculite of medium grains; rice husk ash and saw dust, utilized as isolated or as mixtures (1:1 v/v. Cuttings were kept on substratos for 60 days. The results demonstrated that the higher rooted cuttings percentage were obtained for cuttings collected in January and in March. The mixture of sand and saw dust gave the higher number of cuttings rooting with 68.22% and 65.99% for January and March.

  5. Ilarviruses of Prunus spp.: a continued concern for fruit trees.

    Science.gov (United States)

    Pallas, V; Aparicio, F; Herranz, M C; Amari, K; Sanchez-Pina, M A; Myrta, A; Sanchez-Navarro, J A

    2012-12-01

    Prunus spp. are affected by a large number of viruses, causing significant economic losses through either direct or indirect damage, which results in reduced yield and fruit quality. Among these viruses, members of the genus Ilarvirus (isometric labile ringspot viruses) occupy a significant position due to their distribution worldwide. Although symptoms caused by these types of viruses were reported early in the last century, their molecular characterization was not achieved until the 1990s, much later than for other agronomically relevant viruses. This was mainly due to the characteristic liability of virus particles in tissue extracts. In addition, ilarviruses, together with Alfalfa mosaic virus, are unique among plant viruses in that they require a few molecules of the coat protein in the inoculum in order to be infectious, a phenomenon known as genome activation. Another factor that has made the study of this group of viruses difficult is that infectious clones have been obtained only for the type member of the genus, Tobacco streak virus. Four ilarviruses, Prunus necrotic ringspot virus, Prune dwarf virus, Apple mosaic virus, and American plum line pattern virus, are pathogens of the main cultivated fruit trees. As stated in the 9th Report of the International Committee on Taxonomy of Viruses, virions of this genus are "unpromising subjects for the raising of good antisera." With the advent of molecular approaches for their detection and characterization, it has been possible to get a more precise view of their prevalence and genome organization. This review updates our knowledge on the incidence, genome organization and expression, genetic diversity, modes of transmission, and diagnosis, as well as control of this peculiar group of viruses affecting fruit trees.

  6. Hanseniaspora nodinigri, a new yeast species found in black knots (Dibotryon morbosum) of Prunus virginiana.

    Science.gov (United States)

    Lachance, M A

    1981-07-01

    The new yeast species Hanseniaspora nodinigri is described to accommodate members of the genus Hanseniaspora that are unable to assimilate glucono-sigma-lactone and isolated from stromatal tissue of black knots (Dobotryon morbosum) of chokecherry, Prunus virginiana. The newly described taxon shows much resemblance, by other criteria, to H. vineae van der Walt et Tscheuschner and H. osmophila (Niehaus) Phaff, Miller et Shifrine.

  7. Differentiation among isolates of prunus necrotic ringspot virus by transcript conformation polymorphism.

    Science.gov (United States)

    Rosner, A; Maslenin, L; Spiegel, S

    1998-09-01

    A method based on differences in electrophoretic mobility of RNA transcripts made from polymerase chain reaction (PCR) products was used for differentiation among virus isolates. A T7 RNA polymerase promoter was attached to amplified prunus necrotic ringspot virus (PNRSV) sequences by PCR. The PCR products then served as a template for transcription. Single-stranded transcripts originated from different PNRSV isolates varied in electrophoretic mobility in polyacrylamide gels, presumably because of transcript conformation polymorphism (TCP). This procedure was applied for the differentiation of PNRSV isolates.

  8. Genetic diversity of the movement and coat protein genes of South American isolates of Prunus necrotic ringspot virus.

    Science.gov (United States)

    Fiore, Nicola; Fajardo, Thor V M; Prodan, Simona; Herranz, María Carmen; Aparicio, Frederic; Montealegre, Jaime; Elena, Santiago F; Pallás, Vicente; Sánchez-Navarro, Jesús

    2008-01-01

    Prunus necrotic ringspot virus (PNRSV) is distributed worldwide, but no molecular data have been previously reported from South American isolates. The nucleotide sequences corresponding to the movement (MP) and coat (CP) proteins of 23 isolates of PNRSV from Chile, Brazil, and Uruguay, and from different Prunus species, have been obtained. Phylogenetic analysis performed with full-length MP and CP sequences from all the PNRSV isolates confirmed the clustering of the isolates into the previously reported PV32-I, PV96-II and PE5-III phylogroups. No association was found between specific sequences and host, geographic origin or symptomatology. Comparative analysis showed that both MP and CP have phylogroup-specific amino acids and all of the motifs previously characterized for both proteins. The study of the distribution of synonymous and nonsynonymous changes along both open reading frames revealed that most amino acid sites are under the effect of negative purifying selection.

  9. Composition and antioxidant properties of fresh and frozen stored blackthorn fruits (Prunus spinosa L.)

    OpenAIRE

    Elżbieta Sikora; Małgorzata I. Bieniek; Barbara Borczak

    2013-01-01

      Aim. Blackthorn (Prunus spinosa L.) is quite widespread bush occurring in Poland. Its fruits are easily available food products. The aim of this study was to investigate the basal chemical composition, especially antioxidant compounds in fresh and frozen stored blackthorn fruits. Material  and methods. Research material consisted of blackthorn fruits collected from the wild grown bushes, near Łącko. In the wash-out, dried and stone-loss fruits, the content of dry matter, protein, ...

  10. Resistance to Plum Pox Virus (PPV) in apricot (Prunus armeniaca L.) is associated with down-regulation of two MATHd genes.

    Science.gov (United States)

    Zuriaga, Elena; Romero, Carlos; Blanca, Jose Miguel; Badenes, Maria Luisa

    2018-01-27

    Plum pox virus (PPV), causing Sharka disease, is one of the main limiting factors for Prunus production worldwide. In apricot (Prunus armeniaca L.) the major PPV resistance locus (PPVres), comprising ~ 196 kb, has been mapped to the upper part of linkage group 1. Within the PPVres, 68 genomic variants linked in coupling to PPV resistance were identified within 23 predicted transcripts according to peach genome annotation. Taking into account the predicted functions inferred from sequence homology, some members of a cluster of meprin and TRAF-C homology domain (MATHd)-containing genes were pointed as PPV resistance candidate genes. Here, we have characterized the global apricot transcriptome response to PPV-D infection identifying six PPVres locus genes (ParP-1 to ParP-6) differentially expressed in resistant/susceptible cultivars. Two of them (ParP-3 and ParP-4), that encode MATHd proteins, appear clearly down-regulated in resistant cultivars, as confirmed by qRT-PCR. Concurrently, variant calling was performed using whole-genome sequencing data of 24 apricot cultivars (10 PPV-resistant and 14 PPV-susceptible) and 2 wild relatives (PPV-susceptible). ParP-3 and ParP-4, named as Prunus armeniaca PPVres MATHd-containing genes (ParPMC), are the only 2 genes having allelic variants linked in coupling to PPV resistance. ParPMC1 has 1 nsSNP, while ParPMC2 has 15 variants, including a 5-bp deletion within the second exon that produces a frameshift mutation. ParPMC1 and ParPMC2 are adjacent and highly homologous (87.5% identity) suggesting they are paralogs originated from a tandem duplication. Cultivars carrying the ParPMC2 resistant (mutated) allele show lack of expression in both ParPMC2 and especially ParPMC1. Accordingly, we hypothesize that ParPMC2 is a pseudogene that mediates down-regulation of its functional paralog ParPMC1 by silencing. As a whole, results strongly support ParPMC1 and/or ParPMC2 as host susceptibility genes required for PPV infection which

  11. Virulence and molecular polymorphism of Prunus necrotic ringspot virus isolates.

    Science.gov (United States)

    Hammond, R W; Crosslin, J M

    1998-07-01

    Prunus necrotic ringspot virus (PNRSV) occurs as numerous strains or isolates that vary widely in their pathogenic, biophysical and serological properties. Prior attempts to distinguish pathotypes based upon physical properties have not been successful; our approach was to examine the molecular properties that may distinguish these isolates. The nucleic acid sequence was determined from 1.65 kbp RT-PCR products derived from RNA 3 of seven distinct isolates of PNRSV that differ serologically and in pathology on sweet cherry. Sequence comparisons of ORF 3a (putative movement protein) and ORF 3b (coat protein) revealed single nucleotide and amino acid differences with strong correlations to serology and symptom types (pathotypes). Sequence differences between serotypes and pathotypes were also reflected in the overall phylogenetic relationships between the isolates.

  12. Variability and molecular typing of the woody-tree infecting prunus necrotic ringspot ilarvirus.

    Science.gov (United States)

    Vasková, D; Petrzik, K; Karesová, R

    2000-01-01

    The 3'-part of the movement protein gene, the intergenic region and the complete coat protein gene of sixteen isolates of Prunus necrotic ringspot virus (PNRSV) from five different host species from the Czech Republic were sequenced in order to search for the bases of extensive variability of viroses caused by this pathogen. According to phylogenetic analyses all the 46 isolates sequenced to date split into three main groups, which correlated to a certain extend with their geographic origin. Modelled serological properties showed that all the new isolates belong to one serotype.

  13. Propagation of the endangered Azorean cherry Prunus azorica using stem cuttings and air layering

    OpenAIRE

    Moreira, Orlanda; Martins, José; Silva, Luís; Moura, Mónica

    2009-01-01

    Prunus azorica (Hort. ex Mouillef.) Rivas Mart., Lousã, Fern. Prieto, E. Dias, J.C. Costa & C. Aguiar is an endangered tree endemic to the Azores, with an ecological and ornamental interest. The objective of this study was to determine the conditions necessary for the successful propagation of P. azorica by stem cuttings and air-layering. Stem cuttings collected in March with two apical leaf pairs pruned to 1/3 of their leaf area were submitted to different treatments, including a basal split...

  14. Novel Prunus rootstock somaclonal variants with divergent ability to tolerate waterlogging.

    Science.gov (United States)

    Pistelli, Laura; Iacona, Calogero; Miano, Dario; Cirilli, Marco; Colao, Maria Chiara; Mensuali-Sodi, Anna; Muleo, Rosario

    2012-03-01

    Plants require access to free water for nutrient uptake, but excess water surrounding the roots can be injurious or even lethal because it blocks the transfer of free oxygen between the soil and the atmosphere. Genetic improvement efforts in this study were focused on the increased tolerance in roots to waterlogging. Among a pool of clones generated in vitro from leaf explants of rootstock Mr.S.2/5 of Prunus cerasifera L., the S.4 clone was flood tolerant whereas the S.1 clone was sensitive. The S.4 clone formed adventitious roots on exposure to flooding. Moreover, the chlorophyll content and mitochondrial activity in the leaf and root, soluble sugar content, alcohol dehydrogenase activity and ethylene content were different between the clones. The sorbitol transporter gene (SOT1) was up-regulated during hypoxia, the alcohol dehydrogenase genes (ADH1 and ADH3) were up-regulated in the leaves and down-regulated in the roots of the S.4 clone during hypoxia, and the 1-aminocyclopropane-1-oxidase gene (ACO1) was up-regulated in the leaves and roots of the S.4 clone during hypoxia and down-regulated in the wild-type roots. In addition, in the S.4 root, hypoxia induced significant down-regulation of a glycosyltransferase-like gene (GTL), which has a yet-undefined role. Although the relevant variation in the S.4 genome has yet to be determined, genetic alteration clearly conferred a flooding-tolerant phenotype. The isolation of novel somaclonals with the same genomic background but with divergent tolerance to flooding may offer new insights in the elucidation of the genetic machinery of resistance to flooding and aid in the selection of new Prunus rootstocks to be used in various adverse environments.

  15. Qualidade de ameixas 'Laetitia' em função da temperatura e da atmosfera de armazenamento Quality of 'Laetitia' plums as affected by temperature and storage atmosphere

    Directory of Open Access Journals (Sweden)

    Erlani de Oliveira Alves

    2010-12-01

    Full Text Available O objetivo deste trabalho foi avaliar o efeito da temperatura e de atmosferas de armazenamento sobre a manutenção da qualidade de ameixas 'Laetitia'. Os tratamentos avaliados constituíram-se na combinação de duas temperaturas (-0,5ºC e 0,5ºC, com três atmosferas de armazenamento: armazenamento refrigerado (AR, com 21,0 kPa de O2 + 0,03 kPa de CO2; atmosfera controlada (AC, com 1,0 kPa de O2 + 3,0 kPa de CO2; e AC, com 2,0 kPa de O2 + 5,0 kPa de CO2. Após 60 dias de armazenamento, foram avaliadas: taxas respiratória e de produção de etileno, acidez titulável (AT, firmeza de polpa, atributos de textura, índice de cor vermelha e ângulo 'hue' (hº da casca, e incidência de rachaduras, podridões e degenerescência da polpa. O armazenamento refrigerado a -0,5ºC resultou em menores valores para o índice de cor vermelha, taxa respiratória e de produção de etileno e incidência de frutos rachados. Em ambas as condições de AC, a temperatura de 0,5ºC resultou em menor índice de cor vermelha, cor da epiderme mais verde, maior firmeza de polpa e menor taxa de produção de etileno, tanto na abertura da câmara como após quatro dias em condição ambiente. As condições de AC retardaram o amadurecimento dos frutos e reduziram a incidência de degenerescência de polpa. O armazenamento em AC, com 2,0 kPa de O2 + 5,0 kPa de CO2, a 0,5ºC, proporcionou menor taxa respiratória e menor incidência de podridões na saída da câmara, mas maior AT e força para penetração da polpa, após quatro dias em condição ambiente. No entanto, o armazenamento da ameixa 'Laetitia', nas condições de AC avaliadas, por um período de 60 dias, não reduziu a incidência de degenerescência da polpa.The aim of this work was to evaluate the effect of temperature and storage atmospheres on the quality of 'Laetitia' plums. The treatments were obtained from the combination of two temperatures (-0.5ºC and 0.5ºC with three storage atmospheres: cold

  16. Wintercuring of Prunus dulcis cv ‘Butte,’ P. webbii and their interspecific hybrid in response to Xylella fastidiosa infections

    Science.gov (United States)

    Clonal replicates of Prunus dulcis cv ‘Butte,’ P. webbii and their interspecific hybrid P 63-61 were inoculated with Xylella fastidiosa strain M23 and evaluated for Almond Leaf Scorch Disease and subsequent wintercuring of infections during three growing seasons. Initial inoculations established gr...

  17. Microclonal Multiplication of wild Cherry (Prunus avium L.) from Shoot Tips and Root Sucker Buds

    OpenAIRE

    Pevalek-Kozlina, Branka; Michler, Charles H.; Jelaska, Sibila

    1994-01-01

    The effects of different combinations and concentrations of the growth regulators: 6-benzylaminopurine (BA), 6-furfurylaminopurine (KIN), N6- (2-isopentenyl) adenine (2iP), indole-3-butyric acid (IBA), indole-3-acetic acid (IAA) and a-naphthaleneacetic acid (NAA) on axillary shoot multiplication rates for wild cherry (Prunus avium L.) shoot explants were determined. Apical shoot tips and axillary buds from juvenile trees (5-year old) and from root suckers of mature trees (55-year old) were us...

  18. An in situ, seasonal study of volatiles from a single cultivar of Prunus dulcis, and their relationship to navel orangeworm moth

    Science.gov (United States)

    Nonpareil almonds, Prunus dulcis, account for the largest percentage of almond varieties grown in the Central and San Joaquin valleys of California. Several studies have investigated the various non-volatile and volatile components of various plant parts; however, the volatile organic compound (VOC)...

  19. Seed washing, exogenous application of gibberellic acid, and cold stratification enhance the germination of sweet cherry (Prunus avium L.) seed

    NARCIS (Netherlands)

    Javanmard, T.; Zamani, Z.; Keshavarz Afshar, R.; Hashemi, M.; Struik, P.C.

    2014-01-01

    Seed germination in sweet cherry (Prunus avium L.) is a slow and lengthy process which has delayed breeding efforts. In this study, seed from ripe fruit of the sweet cherry cultivar ‘Lambert’ were collected and, after removing the endocarp, various dormancy-breaking treatments such as seed washing,

  20. Analysis of intra-host genetic diversity of Prunus necrotic ringspot virus (PNRSV) using amplicon next generation sequencing.

    Science.gov (United States)

    Kinoti, Wycliff M; Constable, Fiona E; Nancarrow, Narelle; Plummer, Kim M; Rodoni, Brendan

    2017-01-01

    PCR amplicon next generation sequencing (NGS) analysis offers a broadly applicable and targeted approach to detect populations of both high- or low-frequency virus variants in one or more plant samples. In this study, amplicon NGS was used to explore the diversity of the tripartite genome virus, Prunus necrotic ringspot virus (PNRSV) from 53 PNRSV-infected trees using amplicons from conserved gene regions of each of PNRSV RNA1, RNA2 and RNA3. Sequencing of the amplicons from 53 PNRSV-infected trees revealed differing levels of polymorphism across the three different components of the PNRSV genome with a total number of 5040, 2083 and 5486 sequence variants observed for RNA1, RNA2 and RNA3 respectively. The RNA2 had the lowest diversity of sequences compared to RNA1 and RNA3, reflecting the lack of flexibility tolerated by the replicase gene that is encoded by this RNA component. Distinct PNRSV phylo-groups, consisting of closely related clusters of sequence variants, were observed in each of PNRSV RNA1, RNA2 and RNA3. Most plant samples had a single phylo-group for each RNA component. Haplotype network analysis showed that smaller clusters of PNRSV sequence variants were genetically connected to the largest sequence variant cluster within a phylo-group of each RNA component. Some plant samples had sequence variants occurring in multiple PNRSV phylo-groups in at least one of each RNA and these phylo-groups formed distinct clades that represent PNRSV genetic strains. Variants within the same phylo-group of each Prunus plant sample had ≥97% similarity and phylo-groups within a Prunus plant sample and between samples had less ≤97% similarity. Based on the analysis of diversity, a definition of a PNRSV genetic strain was proposed. The proposed definition was applied to determine the number of PNRSV genetic strains in each of the plant samples and the complexity in defining genetic strains in multipartite genome viruses was explored.

  1. Analysis of intra-host genetic diversity of Prunus necrotic ringspot virus (PNRSV using amplicon next generation sequencing.

    Directory of Open Access Journals (Sweden)

    Wycliff M Kinoti

    Full Text Available PCR amplicon next generation sequencing (NGS analysis offers a broadly applicable and targeted approach to detect populations of both high- or low-frequency virus variants in one or more plant samples. In this study, amplicon NGS was used to explore the diversity of the tripartite genome virus, Prunus necrotic ringspot virus (PNRSV from 53 PNRSV-infected trees using amplicons from conserved gene regions of each of PNRSV RNA1, RNA2 and RNA3. Sequencing of the amplicons from 53 PNRSV-infected trees revealed differing levels of polymorphism across the three different components of the PNRSV genome with a total number of 5040, 2083 and 5486 sequence variants observed for RNA1, RNA2 and RNA3 respectively. The RNA2 had the lowest diversity of sequences compared to RNA1 and RNA3, reflecting the lack of flexibility tolerated by the replicase gene that is encoded by this RNA component. Distinct PNRSV phylo-groups, consisting of closely related clusters of sequence variants, were observed in each of PNRSV RNA1, RNA2 and RNA3. Most plant samples had a single phylo-group for each RNA component. Haplotype network analysis showed that smaller clusters of PNRSV sequence variants were genetically connected to the largest sequence variant cluster within a phylo-group of each RNA component. Some plant samples had sequence variants occurring in multiple PNRSV phylo-groups in at least one of each RNA and these phylo-groups formed distinct clades that represent PNRSV genetic strains. Variants within the same phylo-group of each Prunus plant sample had ≥97% similarity and phylo-groups within a Prunus plant sample and between samples had less ≤97% similarity. Based on the analysis of diversity, a definition of a PNRSV genetic strain was proposed. The proposed definition was applied to determine the number of PNRSV genetic strains in each of the plant samples and the complexity in defining genetic strains in multipartite genome viruses was explored.

  2. Radiation induced cerebellum impairments in Swiss albino mice and its modulation by dietary Prunus domestica

    International Nuclear Information System (INIS)

    Sharma, Garima; Sisodia, Rashmi

    2012-01-01

    To study the biochemical, quantitative histopathological and behavioural changes after 5 Gy whole body irradiation and its modulation by supplementation of Prunus domestica extract (PDE) for 15 consecutive days on male Swiss albino. For this study healthy mice from an inbred colony were divided into five groups: (i) Control; (ii) PDE treated - mice in this group were orally supplemented with PDE (400 mg/kg body weight (bw)/day) once daily for 15 consecutive days; (iii) Irradiated-mice were whole body exposed to 5 Gy irradiated; (iv) PDE + irradiated-mice in this group were orally supplemented PDE for 15 days (once a day) prior to irradiation; and (v) irradiated+PDE -mice in this group were administered PDE orally for 15 days (once a day) consequently after irradiation. Marked radiation induced changes in the amount of cerebellar lipid peroxidation (LPO), glutathione (GSH), protein, superoxide dismutase (SOD), catalase and histopathological changes (molecular layer, granular layer and purkinje cell numbers) could be significantly ameliorated supplementation of PDE prior/post irradiation. Radiation induced deficits in learning and memory were also significantly ameliorated. PDE was found to have strong radical scavenging activity in 2,2-diphenyl-1-picrylhydrazyl (DPPH) and also showed in vitro radioprotective activity. The result of present study showed that prior/post-supplementation of Prunus domestica has radioprotective potential as well as neuroprotective properties against the radiation. (author)

  3. Physiological and foliar symptom response of Prunus serotina, Fraxinus americana and Acer rubrum canopy trees to ozone under differing site conditions

    Science.gov (United States)

    M. Schaub; J.M. Skelly; J.W. Zhang; J.A. Ferdinand; J.E. Savage; R.E. Stevenson; D.D. Davis; K.C. Steiner

    2005-01-01

    The crowns of five canopy dominant black cherry ( Prunus serotina Ehrh.), five white ash ( Fraxinus americana L.), and six red maple ( Acer rubrum L.) trees on naturally differing environmental conditions were accessed with scaffold towers within a mixed hardwood forest stand in central Pennsylvania....

  4. Food and biomass potential of Prunus virginiana L. (chokecherry).

    Science.gov (United States)

    Wang, Sunmin; Young, Lester; Faye, Amberly; Li, Bonnie; Clancy, Johanna; Bors, Bob; Reaney, Martin

    2012-03-14

    Prunus virginiana L. (chokecherry) fruit has potential to provide both food and energy and as annual yield of biomass and energy are much greater than annual crops such as canola and wheat. We determined chokecherry fruit weight fractions as well as pit and extracted seed oil concentrations and fatty acid composition. Gross energy for each of the fractions was determined, as were carbon and nitrogen content. Extrapolation of these data suggests that gross energy from pits alone over a 24-year period (890 GJ·ha(-1)) is equivalent to that from an entire canola/wheat rotation (850 GJ·ha(-1)). After maturity, pulp contributes an additional 1130 GJ·ha(-1) over 21 years from ~3.4 t·ha(-1)·year(-1) (dw), while wood from pruning could add another 60 GJ·ha(-1)·year(-1). Over this time period, chokecherry would produce 1.5-2.5 times the amount of oil produced by a canola/wheat rotation.

  5. PHYSIOLOGICAL AND FOLIAR INJURY RESPONSES OF PRUNUS SEROTINA, FRAXINUS AMERICANA, AND ACER RUBRUM SEEDLINGS TO VARYING SOIL MOISTURE AND OZONE. (R825244)

    Science.gov (United States)

    Sixteen black cherry (Prunus serotina, Ehrh.), 10 white ash (Fraxinus americana, L.) and 10 red maple (Acer rubrum, L.) 1-year old seedlings were planted per plot in 1997 on a former nursery bed within 12 open-top chambers and six open plots. Seedlings wer...

  6. Pomological and technological characteristics of collected selections of cherry plum Prunus cerasifera Erhr.

    Directory of Open Access Journals (Sweden)

    Miletić Rade

    2005-01-01

    Full Text Available A plantation collection containing 32 genotypes selected from spontaneous populations of cherry plum Prunus cerasifera Erhr. was set up in the region of the Eastern Serbian town of Svrljig. The fruit trees budded from Prunus cerasifera seedlings and were planted at 5x4 m spacing on a mild slope of south-western aspect. This study shows the most important characteristics of the 19 selections in the collection, and the average results recorded in the 2000-2003 period. The most significant characteristics of the trees, their productivity, and fruit and stone characteristics are presented. The average coarseness of fruits, i.e. their length, width and thickness, measured 25.0x 24.4x25.0 mm, while stone coarseness was 14.4x10.3x3.6 mm. The average fruit weight was 12.1 g (24.3-4.8 g, and stone weight 0.85 g (2.2-0.3 g. Depending on fruit and stone weight, the mesocarp content was 93% (96.3-90.3%. Taking into consideration the possibility of fruit exploitation for the production of biologically high-quality food, the mesocarp chemical composition was thoroughly examined. The fruits were found to have increased contents of total acids, achieving an average of 3.09% (3.44-2.60%, which was the initial objective of this selection. Total solids content was 13.5% (16.2-10.3%, total soluble solids 12.5% (14.5-9.5% and total sugars 6.00% (11.45-3.14%. Considering these characteristics, the selections that were singled out deserve more attention in terms of preserving their biodiversity, forming a gene bank and commercial cultivation.

  7. Using Perls Staining to Trace the Iron Uptake Pathway in Leaves of a Prunus Rootstock Treated with Iron Foliar Fertilizers.

    Science.gov (United States)

    Rios, Juan J; Carrasco-Gil, Sandra; Abadía, Anunciación; Abadía, Javier

    2016-01-01

    The aim of this study was to trace the Fe uptake pathway in leaves of Prunus rootstock (GF 677; Prunus dulcis × Prunus persica) plants treated with foliar Fe compounds using the Perls blue method, which detects labile Fe pools. Young expanded leaves of Fe-deficient plants grown in nutrient solution were treated with Fe-compounds using a brush. Iron compounds used were the ferrous salt FeSO4, the ferric salts Fe2(SO4)3 and FeCl3, and the chelate Fe(III)-EDTA, all of them at concentrations of 9 mM Fe. Leaf Fe concentration increases were measured at 30, 60, 90 min, and 24 h, and 70 μm-thick leaf transversal sections were obtained with a vibrating microtome and stained with Perls blue. In vitro results show that the Perls blue method is a good tool to trace the Fe uptake pathway in leaves when using Fe salts, but is not sensitive enough when using synthetic Fe(III)-chelates such as Fe(III)-EDTA and Fe(III)-IDHA. Foliar Fe fertilization increased leaf Fe concentrations with all Fe compounds used, with inorganic Fe salts causing larger leaf Fe concentration increases than Fe(III)-EDTA. Results show that Perls blue stain appeared within 30 min in the stomatal areas, indicating that Fe applied as inorganic salts was taken up rapidly via stomata. In the case of using FeSO4 a progression of the stain was seen with time toward vascular areas in the leaf blade and the central vein, whereas in the case of Fe(III) salts the stain mainly remained in the stomatal areas. Perls stain was never observed in the mesophyll areas, possibly due to the low concentration of labile Fe pools.

  8. In silico and experimental evaluation of DNA-based detection methods for the ability to discriminate almond from other Prunus spp.

    Science.gov (United States)

    Brežná, Barbara; Šmíd, Jiří; Costa, Joana; Radvanszky, Jan; Mafra, Isabel; Kuchta, Tomáš

    2015-04-01

    Ten published DNA-based analytical methods aiming at detecting material of almond (Prunus dulcis) were in silico evaluated for potential cross-reactivity with other stone fruits (Prunus spp.), including peach, apricot, plum, cherry, sour cherry and Sargent cherry. For most assays, the analysis of nucleotide databases suggested none or insufficient discrimination of at least some stone fruits. On the other hand, the assay targeting non-specific lipid transfer protein (Röder et al., 2011, Anal Chim Acta 685:74-83) was sufficiently discriminative, judging from nucleotide alignments. Empirical evaluation was performed for three of the published methods, one modification of a commercial kit (SureFood allergen almond) and one attempted novel method targeting thaumatin-like protein gene. Samples of leaves and kernels were used in the experiments. The empirical results were favourable for the method from Röder et al. (2011) and a modification of SureFood allergen almond kit, both showing cross-reactivity <10(-3) compared to the model almond. Copyright © 2014 Elsevier Ltd. All rights reserved.

  9. Studies on induced mutation in maitres (Prunus mume Sieb et. Zucc) through irradiation

    International Nuclear Information System (INIS)

    Niu Chuantang; He Daoyi; Li Yazhi

    1995-01-01

    Five varieties of maitre were treated with different doses of 60 Co γ-ray, then grafted to stock (Prunus armeniaca L.). Survival rate of grafting reduced with the increase of the doses. Optimum level of dose is 20∼30 Gy. At base of grafted seedling from scion woods irradiated by 30 Gy, a mutant shoot was found. the mutant has shorter inter-node than mother plant and lance-shaped leaves. All morphological characters and colour of flower of the mutant are not significantly different from mother plant. It is shown that the mutant differs from it's mother plant in leaf microstructure and on biochemistry level

  10. Post-storage cell wall metabolism in two sweet cherry (Prunus avium L.) cultivars displaying different postharvest performance

    OpenAIRE

    Belge, Burcu; Comabella, Eva; Graell i Sarle, Jordi; Lara Ayala, Isabel

    2015-01-01

    The biochemical processes underlying firmness loss of sweet cherry (Prunus avium L.) fruit are poorly understood.Studies on cell wall metabolism of sweet cherry have been generally undertaken during on-tree development or at harvest maturity, while published reports on postharvest changes are scarce and fragmentary. In this work, cell wall modifications after storage at 0 ºC were studied in two cherry cultivars ('Celeste' and 'Somerset') displaying different postharvest potential. Firmness wa...

  11. Authenticity assessment of gamma- and delta-decalactone from prunus fruits by gas chromatography combustion/pyrolysis isotope ratio mass spectrometry (GC-C/P-IRMS).

    Science.gov (United States)

    Tamura, Hirotoshi; Appel, Markus; Richling, Elke; Schreier, Peter

    2005-06-29

    Authenticity assessment of gamma-decalactone (1) and delta-decalactone (2) from peach (Prunus persica var. persica), apricot (Prunus armeniaca), and nectarine (Prunus persica var. nectarina) was performed using gas chromatography-isotope ratio mass spectrometry (GC-IRMS) in the combustion (C) and pyrolysis (P) mode. In addition, commercially available synthetic (nature-identical) 1 and 2 as well as biotechnologically produced samples (declared to be "natural") were characterized by their delta(2)H(V)(-)(SMOW) and delta(13)C(V)(-)(PDB) values. For the Prunus fruits under study, rather narrow ranges of delta(13)C(V)(-)(PDB) and delta(2)H(V)(-)(SMOW) data of 1, varying from - 34.6 per thousand to - 38.4 per thousand and -160 per thousand to -206 per thousand, respectively, were obtained. Synthetic references of 1 showed delta(13)C(V)(-)(PDB) and delta(2)H(V)(-)(SMOW) data ranging from -27.4 per thousand to -28.3 per thousand and -151 per thousand to -184 per thousand, respectively. Samples of 1 declared to be "natural" exhibited ranges from -28.1 per thousand to -29.2 per thousand and -192 per thousand to -286 per thousand for delta(13)C(V)(-)(PDB) and delta(2)H(V)(-)(SMOW), respectively. For 2 from peach, apricot, and nectarine, delta(13)C(V)(-)(PDB) values ranging from -34.0 per thousand to -37.9 per thousand were determined; the delta(2)H(V)(-)(SMOW) values ranged from -171 per thousand to -228 per thousand. The delta(13)C(V)(-)(PDB) and delta(2)H(V)(-)(SMOW) data for synthetic 2 were -28.2 per thousand and -171 per thousand, respectively, that is, similar to those of 2 from "natural" origin, ranging from -27.7 per thousand to -30.1 per thousand and -185 per thousand to -230 per thousand for delta(13)C(V)(-)(PDB) and delta(2)H(V)(-)(SMOW), respectively. GC-C/P-IRMS allowed clear-cut analytical differentiation of the synthetic and "ex-plant" origin of 1 and 2, whereas narrow ranges of delta(13)C(V)(-)(PDB) and delta(2)H(V)(-)(SMOW) data were found for samples of

  12. Molecular characterization of Prunus necrotic ringspot virus isolated from rose in Brazil

    Directory of Open Access Journals (Sweden)

    Thor Vinícius Martins Fajardo

    2015-12-01

    Full Text Available ABSTRACT: There is no molecular characterization of Brazilian isolates of Prunus necrotic ringspot virus (PNRSV, except for those infecting peach. In this research, the causal agent of rose mosaic was determined and the movement (MP and coat (CP protein genes of a PNRSV isolate from rose were molecularly characterized for the first time in Brazil. The nucleotide and deduced amino acid sequences of MP and CP complete genes were aligned and compared with other isolates. Molecular analysis of the MP and CP nucleotide sequences of a Brazilian PNRSV isolate from rose and others from this same host showed highest identities of 96.7% and 98.6%, respectively, and Rose-Br isolate was classified in PV32 group.

  13. Investigation of the aroma of commercial peach (Prunus persica L. Batsch) types by Proton Transfer Reaction-Mass Spectrometry (PTR-MS) and sensory analysis

    NARCIS (Netherlands)

    Cardoso Ferreira Pinhancos de Bianchi, Tiago; Weesepoel, Yannick; Koot, Alex; Iglesias, Ignasi; Eduardo, Iban; Gratacós-Cubarsí, Marta; Guerrero, Luis; Hortós, Maria; Ruth, van Saskia

    2017-01-01

    The aim of this study was to investigate the aroma and sensory profiles of various types of peaches (Prunus persica L. Batsch.). Forty-three commercial cultivars comprising peaches, flat peaches, nectarines, and canning peaches (pavías) were grown over two consecutive harvest years. Fruits were

  14. Plum pox virus accumulates mutations in different genome parts during a long-term maintenance in Prunus host plants and passage in Nicotiana benthamiana.

    Science.gov (United States)

    Vozárová, Z; Kamencayová, M; Glasa, M; Subr, Z

    2013-01-01

    Plum pox virus (PPV) isolates of the strain PPV-M prevalently infect peaches under natural conditions in Middle Europe. Comparison of complete genome sequences obtained from subisolates of a PPV-M isolate maintained experimentally over a 6-year period in different Prunus host species and passaged in Nicotiana benthamiana was performed with the aim to highlight the mutations potentially connected with the virus-host adaptation. The results showed that the lowest number of non-silent mutations was accumulated in PPV-M maintained in peach (original host species), approximately two times higher diversity was recorded in plum, apricot and N. benthamiana, indicating the genetic determination of the PPV host preference. The sequence variability of Prunus subisolates was distributed more or less evenly along the PPV genome and no amino acid motif could be outlined as responsible for the host adaptation. In N. benthamiana the mutations were accumulated notably in the P1 and P3 genes indicating their non-essentiality in the infection of this experimental host plant.

  15. Propagation and Growth of Chokecherry (Prunus virginaiana) as an Alternative, Water-wise, Fruit Crop for the Intermountain West

    OpenAIRE

    Crook, Jeremy R.

    2010-01-01

    Utah fruit growers have shown interest in chokecherry (Prunus virginiana) as an alternative crop that has low requirements for water and soil fertility. Consumers want native fruits like chokecherry that are healthy and taste good. Currently, the limiting factor in developing a chokecherry industry in Utah is the ability to propagate large numbers of plants for orchard establishment. Chokecherries are difficult to propagate by traditional means because of their low rooting percentages. Plant ...

  16. Molecular characterization of two prunus necrotic ringspot virus isolates from Canada.

    Science.gov (United States)

    Cui, Hongguang; Hong, Ni; Wang, Guoping; Wang, Aiming

    2012-05-01

    We determined the entire RNA1, 2 and 3 sequences of two prunus necrotic ringspot virus (PNRSV) isolates, Chr3 from cherry and Pch12 from peach, obtained from an orchard in the Niagara Fruit Belt, Canada. The RNA1, 2 and 3 of the two isolates share nucleotide sequence identities of 98.6%, 98.4% and 94.5%, respectively. Their RNA1- and 2-encoded amino acid sequences are about 98% identical to the corresponding sequences of a cherry isolate, CH57, the only other PNRSV isolate with complete RNA1 and 2 sequences available. Phylogenetic analysis of the coat protein and movement protein encoded by RNA3 of Pch12 and Chr3 and published PNRSV isolates indicated that Chr3 belongs to the PV96 group and Pch12 belongs to the PV32 group.

  17. EVALUATION OF GAS EXCHANGES IN DIFFERENT Prunus SPP. ROOTSTOCKS UNDER DROUGHT AND FLOODING STRESS

    Directory of Open Access Journals (Sweden)

    ELSA KUHN KLUMB

    2017-10-01

    Full Text Available ABSTRACT The state of Rio Grande do Sul is the largest peach productor in Brazil; however, it still possesses poor yield values when compared with other states. One of the problems associated with this is the occurrence of soils with drainage problems, mainly in Pelotas region, which depending on the year period, may undergo water deficit or flooding situations in the great majority of the years, which harm the crop development and yield. Among the harmful effects caused by these stresses stand out, the decrease in the net assimilation rate, closure of stomata, reduction of the cell activities, production of reactive oxygen species, membrane and protein destabilization. Thus, the aim of this study was to investigate in what magnitude of the gaseous exchange parameters of Prunus spp. rootstocks are influenced under drought and flood stress. In the experiment, gas exchange parameters net photosynthetic rate (A stomata conductance (gs, intercellular carbon (Ci and transpiration (E] were evaluated in three Prunus spp. rootstocks (peach tree ‘Capdeboscq’ and plum trees ‘Julior’ and ‘Marianna 2624’ under three water conditions (control, water deficit and soil flooding for seven days. The three rootstocks proved more susceptible to flooding than to water deficit, only varying in response time, which is intrinsic to each genotype, and that there is a genetic variability for the tolerance to the studied stresses. The variation on physiological response to the water deficit stress was later in both evaluated genotypes. However, in general, ‘Julior’ presented greater tolerance to both stresses when compared to the other rootstocks evaluated. Such information is useful to help in the choice of rootstocks for plant production, in the orchard management and for plant breeding programs, aiming at the selection of new genotypes with increased tolerance to these water stresses.

  18. Vegetative and seedling regeneration of pin cherry (Prunus pensylvanica): Efficacy of herbicide treatment. NODA note No. 21

    Energy Technology Data Exchange (ETDEWEB)

    Mallik, A U; Bell, F W; Peterson, G W

    1996-11-01

    Pin cherry (Prunus pensylvanica L.) is a major competing plant commonly found in young conifer plantations in both boreal and northern hardwood forests. This note describes and presents results of a study conducted to determine, for pin cherry, the ratio of the current year`s seedling recruitment versus the previous year`s stem density; seed production; the soil seed bank; and the efficacy of a glyphosate herbicide treatment to control this competitor. The study was carried out in a seven-year-old jack pine plantation north of Atikokan, Ontario.

  19. Estabelecimento e multiplicação in vitro de Prunus sp. em diferentes meios de cultivo Establishment and multiplication in vitro of Prunus sp. in different culture media

    Directory of Open Access Journals (Sweden)

    Alexandre Couto Rodrigues

    2003-04-01

    Full Text Available O trabalho foi realizado com o objetivo de avaliar diferentes meios de cultivo no estabelecimento e multiplicação in vitro de espécies do gênero Prunus. Os segmentos nodais de 1,0 cm foram mantidos sob luz fluorescente com radiação de 20 mE.m-2.s-1, fotoperíodo de 16 horas e temperatura de 25±2ºC. No estabelecimento, testaram os meios MS, MS ¾, SH e Villegas, e na multiplicação: SH e MS ¾. O meio MS ¾ foi testado em diferentes concentrações de ágar (4,5; 5,5; 6,5 g.L-1. Avaliaram-se as percentagens de estabelecimento dos explantes, contaminação, oxidação e segmentos não brotados. O meio Villegas apresentou menor oxidação durante o período de estabelecimento in vitro. Com o meio MS ¾, verificou-se maior percentagem de estabelecimento dos explantes. Na fase de multiplicação, avaliaram-se a percentagem de crescimento, a taxa de multiplicação e o número de brotações. O meio MS ¾, com 5,5 g.L-1 de ágar, apresentou os melhores resultados.The work was performed aiming to evaluate different media for the establishment and in vitro multiplication of some rootstocks species of Prunus. Microcutings of 1,0cm long were incubated under 20 mE.m-2.s-1 radiation provided by white fluorescent lamps, 16-hour photoperiod and temperature of 25±2ºC. The establishment media used were as follow: MS, ¾ MS, SH and Villegas, and the multiplication media used were: SH and ¾ MS. The ¾ MS medium was also tested with different agar concentrations (4.5; 5.5; 6.5 g.L-1. The percentage of establishment, contamination, oxidation and growing of the explants were evaluated. The Villegas medium provided low oxidation during the period of in vitro establishment. The ¾ MS medium provided higher percentage of establishment of explants. In the multiplication phase, the highest growth percentage, multiplication rate and bud number, were found in ¾ MS medium with 5.5 g.L-1 agar.

  20. Compared leaf anatomy and water relations of commercial and traditional Prunus dulcis (Mill.) cultivars under rain-fed conditions

    DEFF Research Database (Denmark)

    Oliveira, I.; Meyer, A.; Afonso, S.

    2018-01-01

    Leaf anatomy and water relations of seven almond (Prunus dulcis Mill.) cultivars, traditional (Bonita, Casanova, Parada, Pegarinhos and Verdeal) and commercial (Ferragnès and Glorieta), grown under rain-fed conditions, were studied. The performed measurements included thickness of leaf tissues...... cuticle thickness, while Pegarinhos adds a thicker epidermis and palisade parenchyma to increase protection to water loss. These data is one of the first comparative approaches to the leaf characterization of these cultivars, and should now be combined with physiological and biochemical studies...

  1. Desiccation tolerance of seeds of Bunchosia armenica (Cav. DC.Tolerância à dessecação em sementes de Bunchosia armenica (Cav. DC.

    Directory of Open Access Journals (Sweden)

    Edson de Almeida Cardoso

    2012-08-01

    Full Text Available The seeds have different behaviors and tolerance to moisture loss. In order to determine desiccation tolerance in seeds of Bunchosia armenia (Cav. DC. (Ameixa-do-Pará was collected a lot of fruits of this species in Areia-PB. After the manual pulping the seeds were exposed to dry on paper towel, under laboratory conditions (22°C and 85% RH and greenhouse (24°C and 80% RH. Treatments consisted of sampling for the determination of water content and seedling emergence tests at baseline and after 24, 48, 72, 96 and 120 hours. The water content was measured by the oven method at 105 ± 3°C for 24 hours using four replicates of 10 seeds for each treatment. The seedling emergence test was conducted in a greenhouse with four replications of 25 seeds. The count of emergence has beenheld every two days, for a period of 35th day and calculated the IVE, length and dry mass of seedlings. The drying of the seeds of B.armenica, in both environments is viable for up to 24 hours; After 24 hours of drying the water content of seeds is reduced from 62.6% to 57%, a level considered critical to the desiccation of the seeds of Ameixa-do-Pará in both environments; Ameixa-do-Pará seeds nuts are dispersed with very high water content, and small reduction in physiological quality compromises their value, allowing the seeds to characterize this species as recalcitrant.As sementes têm comportamentos diferenciados quanto à tolerância à perda de umidade. Com o objetivo de determinar a tolerância à dessecação em sementes de Bunchosia armenica (Cav. DC. (ameixa-dopará foi coletado um lote de frutos desta espécie no município de Areia-PB. Após o despolpamento manual as sementes foram expostas para a secagem, sobre papel toalha, em condições de laboratório (22 ºC e 85% UR e casa de vegetação (24 ºC e 80% UR. Os tratamentos consistiram na amostragem para a determinação do teor de água e testes de emergência de plântulas no início do experimento e ap

  2. Genotyping-by-sequencing in an orphan plant species Physocarpus opulifolius helps identify the evolutionary origins of the genus Prunus.

    Science.gov (United States)

    Buti, Matteo; Sargent, Daniel J; Mhelembe, Khethani G; Delfino, Pietro; Tobutt, Kenneth R; Velasco, Riccardo

    2016-05-11

    The Rosaceae family encompasses numerous genera exhibiting morphological diversification in fruit types and plant habit as well as a wide variety of chromosome numbers. Comparative genomics between various Rosaceous genera has led to the hypothesis that the ancestral genome of the family contained nine chromosomes, however, the synteny studies performed in the Rosaceae to date encompass species with base chromosome numbers x = 7 (Fragaria), x = 8 (Prunus), and x = 17 (Malus), and no study has included species from one of the many Rosaceous genera containing a base chromosome number of x = 9. A genetic linkage map of the species Physocarpus opulifolius (x = 9) was populated with sequence characterised SNP markers using genotyping by sequencing. This allowed for the first time, the extent of the genome diversification of a Rosaceous genus with a base chromosome number of x = 9 to be performed. Orthologous loci distributed throughout the nine chromosomes of Physocarpus and the eight chromosomes of Prunus were identified which permitted a meaningful comparison of the genomes of these two genera to be made. The study revealed a high level of macro-synteny between the two genomes, and relatively few chromosomal rearrangements, as has been observed in studies of other Rosaceous genomes, lending further support for a relatively simple model of genomic evolution in Rosaceae.

  3. Development of novel techniques to extract phenolic compounds from Romanian cultivars of Prunus domestica L. and their biological properties.

    Science.gov (United States)

    Mocan, Andrei; Diuzheva, Alina; Carradori, Simone; Andruch, Vasil; Massafra, Chiara; Moldovan, Cadmiel; Sisea, Cristian; Petzer, Jacobus P; Petzer, Anél; Zara, Susi; Marconi, Guya Diletta; Zengin, Gokhan; Crișan, Gianina; Locatelli, Marcello

    2018-04-21

    In the present work, fourteen cultivars of Prunus domestica were analysed to investigate their phenolic pattern with the purpose of using the leaves as potential resources of bioactive compounds in the pharmaceutical and food industry. Microwave-assisted extraction (MAE), dispersive liquid-liquid microextraction and sugaring-out liquid-liquid extraction techniques were optimized in order to obtain an exhaustive multi-component panel of phenolic compounds. The best phenolic-enriched recovery was achieved using MAE in water:methanol (30:70), and this procedure was further applied for quantitative analysis of phenolic compounds in real samples. In order to prove the safeness of these extracts, the biological potential of the Prunus cultivars was tested by several in vitro antioxidant and enzyme inhibitory assays. Moreover, their cytotoxicity was evaluated on human gingival fibroblasts (HGFs), and in most of the cases the treatment with different concentrations of extracts didn't show cytotoxicity up to 500 μg/mL. Only 'Carpatin' and 'Minerva' cultivars, at 250 and 500 μg/mL, reduced partially cell viability of HGFs population. Noteworthy, Centenar cultivar was the most active for the α-glucosidase inhibition (6.77 mmolACAE/g extract), whereas Ialomița cultivar showed the best antityrosinase activity (23.07 mgKAE/g extract). Overall, leaves of P. domestica represent a rich alternative source of bioactive compounds. Copyright © 2018. Published by Elsevier Ltd.

  4. SSR allelic variation in almond (Prunus dulcis Mill.).

    Science.gov (United States)

    Xie, Hua; Sui, Yi; Chang, Feng-Qi; Xu, Yong; Ma, Rong-Cai

    2006-01-01

    Sixteen SSR markers including eight EST-SSR and eight genomic SSRs were used for genetic diversity analysis of 23 Chinese and 15 international almond cultivars. EST- and genomic SSR markers previously reported in species of Prunus, mainly peach, proved to be useful for almond genetic analysis. DNA sequences of 117 alleles of six of the 16 SSR loci were analysed to reveal sequence variation among the 38 almond accessions. For the four SSR loci with AG/CT repeats, no insertions or deletions were observed in the flanking regions of the 98 alleles sequenced. Allelic size variation of these loci resulted exclusively from differences in the structures of repeat motifs, which involved interruptions or occurrences of new motif repeats in addition to varying number of AG/CT repeats. Some alleles had a high number of uninterrupted repeat motifs, indicating that SSR mutational patterns differ among alleles at a given SSR locus within the almond species. Allelic homoplasy was observed in the SSR loci because of base substitutions, interruptions or compound repeat motifs. Substitutions in the repeat regions were found at two SSR loci, suggesting that point mutations operate on SSRs and hinder the further SSR expansion by introducing repeat interruptions to stabilize SSR loci. Furthermore, it was shown that some potential point mutations in the flanking regions are linked with new SSR repeat motif variation in almond and peach.

  5. Vasorelaxant effect of Prunus yedoensis bark

    Directory of Open Access Journals (Sweden)

    Lee Kyungjin

    2013-02-01

    Full Text Available Abstract Background Prunus yedoensis Matsum. is used as traditional medicine—‘Yaeng-Pi’ or ‘Hua-Pi’—in Japan and Korea. However, no studies have examined the pharmacological activities of the P. yedoensis bark. Only the antioxidant and antiviral activities of P. yedoensis fruit and the anti-hyperglycaemic effect of P. yedoensis leaf have been investigated. While studying the antihypertensive effects of several medicinal plants, we found that a methanol extract of P. yedoensis bark (MEPY had distinct vasorelaxant effects on rat aortic rings. Methods The aortic rings were removed from Sprague–Dawley rats and suspended in organ chambers containing 10 ml Krebs-Henseleit solution. The aortic rings were placed between 2 tungsten stirrups and connected to an isometric force transducer. Changes in tension were recorded via isometric transducers connected to a data acquisition system. Results MEPY relaxed the contraction induced by phenylephrine (PE both in endothelium-intact and endothelium-denuded aortic rings concentration dependently. However, the vasorelaxant effects of MEPY on endothelium-denuded aortic rings were lower than endothelium-intact aortic rings. The vasorelaxant effects of MEPY on endothelium-intact aortic rings were reduced by pre-treatment with l-NAME, methylene blue, or ODQ. However, pre-treatment with indomethacin, atropine, glibenclamide, tetraethylammonium, or 4-aminopyridine had no affection. In addition, MEPY inhibited the contraction induced by extracellular Ca2+ in endothelium-denuded rat thoracic aorta rings pre-contracted by PE (1 μM or KCl (60 mM in Ca2+-free solution. Conclusions Our results suggest that MEPY exerts its vasorelaxant effects via the activation of NO formation by means of l-Arg and NO-cGMP pathways and via the blockage of extracellular Ca2+ channels.

  6. Sucrose and light effects on in vitro cultures of potato (Solanum tuberosum L.), chokecherry (Prunus virginiana L.) and Saskatoon berry (Amelanchier alnifolia Nutt.) during low temperature storage

    NARCIS (Netherlands)

    Pruski, K.; Kozai, T.; Lewis, T.; Astatkie, T.; Nowak, J.

    2000-01-01

    Cultures of potato (Solanum tuberosum) cv. Atlantic, chokecherry ( Prunus virginiana L.) cv. Garrington and saskatoon berry (Amelancher alnifolia Nutt.) cv. Northline grown in vitro for 3 weeks at 24/22 °C, 16-h photoperiod, 150 μmol m-2 s-1 photosynthetic photon flux density (PPFD) mixed

  7. Effects of processing techniques on oxidative stability of Prunus pedunculatus seed oil

    Directory of Open Access Journals (Sweden)

    J. Yan

    2017-09-01

    Full Text Available This paper investigated the effects of Prunus pedunculatus (P. pedunculatus seed pre-treatment, including microwaving (M, roasting (R, steaming (S and roasting plus steaming (RS on crude oil quality in terms of yield, color change, fatty acid composition, and oxidative stability. The results showed an increase in monounsaturated fatty acid content and oxidative stability of the oils obtained from different processing treatments compared to the oil obtained from raw seeds (RW without processing. The oils, obtained from pretreated seeds, had higher conjugated diene (CD and 2-thiobarbituric acid (2-TBA values, compared to that obtained from RW when stored in a Schaal oven at 65 °C for 168 h. However, polyphenol and tocopherol contents decreased in all oil samples, processed or unprocessed. The effect of pre-treating the seeds was more prominent in the oil sample obtained through the RS technique, and showed higher oxidative stability than the other processed oils and the oil from RW.

  8. Future Applications of Apricot (Prunus Armeniaca Kaisa ß Galactosidase in Dairy Industry

    Directory of Open Access Journals (Sweden)

    Ansari Shakeel Ahmed

    2014-09-01

    Full Text Available The present study demonstrates the immobilization of β galactosidase from apricots (Prunus armeniaca kaisa on an inexpensive concanavalin A layered cellulose-alginate hybrid gel. Immobilized β galactosidase retained 78% of the initial activity after crosslinking by glutaraldehyde. It exhibited greater fraction of activity at both acidic and basic pH, and showed broad spectrum temperature optimum as compared to free enzyme. Moreover, immobilized enzyme exhibited higher thermal stability at 60°C and retained 80% of the original enzyme activity in presence of 3% galactose. The crosslinked immobilized enzyme showed improved hydrolysis of lactose from milk and whey in batch processes at 50°C as well as in continuous reactors operated at fl ow rate of 20 mL/h and 30 mL/h even after one month. Moreover, crosslinked adsorbed β galactosidase retained 76% activity even after its sixth repeated use, thereby promoting its use for lactose hydrolysis in various dairy products even for longer durations.

  9. Efeito do comprimento de estacas herbáceas de dois clones de umezeiro (Prunus mume Sieb & Zucc. no enraizamento adventício Effect of the length of herbaceous cuttings of two clones of japanese apricot (Prunus mume Sieb & Zucc. in adventicious rooting

    Directory of Open Access Journals (Sweden)

    NEWTON ALEX MAYER

    2002-08-01

    Full Text Available O umezeiro (Prunus mumeSieb & Zucc. é uma rosácea de folhas caducas, nativa da China, cujos frutos e flores são muito apreciados pelos povos orientais. No Brasil, alguns estudos foram realizados visando a sua utilização como porta-enxerto para pessegueiro e nectarineira, dadas as suas características de adaptação, rusticidade, redução do porte da planta e compatibilidade com algumas cultivares de Prunus persica. O presente estudo foi conduzido em câmara de nebulização sob ripado, pertencente ao Departamento de Produção Vegetal da FCAV/UNESP, Câmpus de Jaboticabal-SP. Objetivou-se verificar a influência de quatro comprimentos de estacas herbáceas no enraizamento de dois clones de umezeiro. O material vegetal, identificado como Clone 10 e Clone 15, foi oriundo do Programa de Melhoramento Genético do Instituto Agronômico de Campinas-SP. O experimento foi constituido de fatorial 2 x 4, em blocos casualizados, sendo o fator clone em 2 níveis (Clone 10 e Clone 15 e o fator comprimento de estaca em 4 níveis (12; 15; 18 e 25cm. Pelos resultados observados, verificou-se diferença entre os clones somente na porcentagem de estacas brotadas e número de raízes por estaca. O comprimento da estaca influenciou na porcentagem de enraizamento e na mortalidade das estacas, sendo que estacas maiores tenderam a apresentar maiores porcentagens de enraizamento e menores de mortalidade. As estacas com 12cm, embora apresentando menor número de raízes por estaca, são recomendadas por permitirem a obtenção de um maior número de estacas por planta-matriz. Houve efeito significativo da interação entre os fatores para número e comprimento de raízes.The japanese apricot (Prunus mume Sieb & Zucc. is a Rosaceae of falling leaves, native of China, whose fruits and flowers are quite appreciated by the oriental people. In Brazil, some studies were accomplished seeking its use as rootstock for peach and nectarine trees, due its adaptation

  10. Effects of cadmium on lipids of almond seedlings (Prunus dulcis).

    Science.gov (United States)

    Elloumi, Nada; Zouari, Mohamed; Chaari, Leila; Jomni, Chiraz; Marzouk, Brahim; Ben Abdallah, Ferjani

    2014-12-01

    Cadmium uptake and distribution, as well as its effects on lipid composition was investigated in almond seedlings (Prunus dulcis) grown in culture solution supplied with two concentrations of Cd (50 and 150 μM). The accumulation of Cd increased with external metal concentrations, and was considerably higher in roots than in leaves. Fourteen days after Cd treatment, the membrane lipids were extracted and separated on silica-gel thin layer chromatography (TLC). Fatty acid methyl esters were analyzed by FID-GC on a capillary column. Our results showed that Cd stress decreased the quantities of all lipids classes (phospholipids, galactolipids and neutral lipids). Galactolipid, phospholipid and neutral lipid concentrations decreased more in roots than in leaves by Cd-treatment. In almost all lipid classes the proportion of palmitic acid (16:0), linoleic (18: 2) and that of linolenic (18: 3) acid decreased, suggesting that heavy metal treatment induced an alteration in the fatty acid synthesis processes. In conclusion, our results show that the changes found in total fatty acids, in the quantities of all lipids classes, and in the in the profiles of individual polar lipids suggest that membrane structure and function might be altered by Cd stress.

  11. Some physico-chemical properties of Prunus armeniaca L. gum exudates.

    Science.gov (United States)

    Fathi, Morteza; Mohebbi, Mohebbat; Koocheki, Arash

    2016-01-01

    The objectives of this paper were to investigate some physicochemical properties of Prunus armeniaca L. gum exudates (PAGE). PAGE had, on average, 66.89% carbohydrate, 10.47% uronic acids, 6.9% moisture (w.b.), 2.91% protein, 4% ash and 1.59% fat. PAGE was composed of monosaccharides including l-arabinose, d-galactose, xylose, mannose and rhamnose in molar percentages of 41.52%, 23.72%, 17.82%, 14.40% and 2.54%, respectively. Elemental analysis showed that PAGE had high values of nutrients. FTIR analysis demonstrated the presence of carboxyl, hydroxyl and methyl groups and glycoside bonds. The weight average molecular weight, number average molecular weight and polydispersity index were found to be approximately 5.69 × 10(5)g/mol, 4.33 g/mol and 1.31, respectively. Rheological measurement of PAGE solutions as a function of concentration (8, 10 and 12% (w/w)) and temperature (10, 20, 30 and 40°C) demonstrated that the gum solutions had a non Newtonian shear thinning behaviour. Intrinsic viscosity for PAGE in deionized water was 3.438 dl/g based on Kramer equation. Copyright © 2015 Elsevier B.V. All rights reserved.

  12. AVALIAÇÃO DA COMPATIBILIDADE DA ENXERTIA EM Prunus sp. EVALUATION OF THE GRAFT COMPATIBILITY IN Prunus sp.

    Directory of Open Access Journals (Sweden)

    ALEXANDRE COUTO RODRIGUES

    2001-08-01

    Full Text Available A atividade de peroxidase e concentração de fenóis foi determinada com o objetivo de se avaliar aspectos de compatibilidade entre porta-enxertos e enxertos. As amostras foram processadas e obtidas a partir da casca e lenho dos porta-enxertos de pessegueiros (GF 677, Okinawa, Capdeboscq e Aldrighi e de ameixeiras (Mirabolano e Marianna, enxertados ou não com as cultivares Diamante, Eldorado e Santa Rosa. Concluiu-se que a atividade de peroxidase e a concentração de fenóis foram relacionadas com união entre enxerto e porta-enxerto, particularmente, em Marianna e Mirabolano, onde a atividade de peroxidase e a concentração de fenóis foram mais elevados. A cultivar Santa Rosa foi compatível tanto com os porta-enxertos de ameixeiras quanto com os de pessegueiros.The work was accomplished aiming to quantify the peroxidase activity and total phenols, in order to verify the physiological and biochemical processes in grafting of Prunus sp. cultivars. The samples were processed and obtained in bark and wood of the peach rootstocks (GF 677, Okinawa, Capdeboscq and Aldrighi and plum rootstocks (Mirabolano and Marianna, after they had or not been grafted with the stock Diamante, Eldorado and Santa Rosa. It could be concluded that the peroxidase and the total phenols activity influenced the union between stock and rootstock; after grafting, the incompatibility degree is related with high peroxidase activity and total phenols in the rootstock Marianna and Mirabolano. The Santa Rosa plum graft is as compatible to plum rootstocks as to the peach ones.

  13. Tractor-mounted, GPS-based spot fumigation system manages Prunus replant disease

    Directory of Open Access Journals (Sweden)

    V. Udompetaikul

    2013-10-01

    Full Text Available Our research goal was to use recent advances in global positioning system (GPS and computer technology to apply just the right amount of fumigant where it is most needed (i.e., in a small target treatment zone in and around each tree replanting site to control Prunus replant disease (PRD. We developed and confirmed the function of (1 GPS-based software that can be used on cleared orchard land to flexibly plan and map all of an orchard's future tree sites and associated spot fumigation treatment zones and 2 a tractor-based GPS-controlled spot fumigation system to quickly and safely treat the targeted tree site treatment zones. In trials in two almond orchards and one peach orchard, our evaluations of the composite mapping and application system, which examined spatial accuracy of the spot treatments, delivery rate accuracy of the spot treatments, and tree growth responses to the spot treatments, all indicated that GPS spot fumigation has excellent potential to greatly reduce fumigant usage while adequately managing the PRD complex.

  14. Characterisation of stilbenes in California almonds (Prunus dulcis) by UHPLC-MS.

    Science.gov (United States)

    Xie, Liyang; Bolling, Bradley W

    2014-04-01

    Stilbene polyphenols are present in some fruits and nuts, but their abundance in many foods, such as almonds, is unknown. Therefore, we characterised stilbenes from Nonpareil, Butte and Carmel almond (Prunus dulcis) varieties from California. UHPLC-MS conditions were optimised to resolve cis- and trans-resveratrol, d4-resveratrol, dienestrol, hexestrol, oxyresveratrol, piceatannol, pterostilbene, and resveratrol-3-β-glucoside (polydatin). Stilbenes were isolated from ethanolic almond extracts by solid-phase extraction and identified with UHPLC-MS by comparison of retention times, mass spectra, in-source CID spectra, and enzymatic hydrolysis to authentic standards. Polydatin was identified in almond extracts, with 7.19-8.52 μg/100 g almond. Piceatannol+oxyresveratrol was tentatively identified in almond blanch water, at 0.19-2.55 μg/100 g almond. Polydatin was concentrated in almond skins, which contained 95.6-97.5% of the total almond content. Therefore, almonds contain the stilbene class of polyphenols in addition to the previously identified proanthocyanidin, hydrolysable tannin, flavonoid, and phenolic acid classes. Copyright © 2013 Elsevier Ltd. All rights reserved.

  15. Antioxidant Defenses in Plants with Attention to Prunus and Citrus spp.

    Directory of Open Access Journals (Sweden)

    Milvia Luisa Racchi

    2013-11-01

    Full Text Available This short review briefly introduces the formation of reactive oxygen species (ROS as by-products of oxidation/reduction (redox reactions, and the ways in which the antioxidant defense machinery is involved directly or indirectly in ROS scavenging. Major antioxidants, both enzymatic and non enzymatic, that protect higher plant cells from oxidative stress damage are described. Biochemical and molecular features of the antioxidant enzymes superoxide dismutase (SOD, catalase (CAT, and ascorbate peroxidase (APX are discussed because they play crucial roles in scavenging ROS in the different cell compartments and in response to stress conditions. Among the non enzymatic defenses, particular attention is paid to ascorbic acid, glutathione, flavonoids, carotenoids, and tocopherols. The operation of ROS scavenging systems during the seasonal cycle and specific developmental events, such as fruit ripening and senescence, are discussed in relation to the intense ROS formation during these processes that impact fruit quality. Particular attention is paid to Prunus and Citrus species because of the nutritional and antioxidant properties contained in these commonly consumed fruits.

  16. Diversità funzionale in cloni di ciliegio da legno (Prunus avium L. di provenienza Appennino toscano

    Directory of Open Access Journals (Sweden)

    Andrea Cutini

    2009-12-01

    Full Text Available Functionality in wild cherry (Prunus avium L. clones of Tuscany Appenines provenances. Results of a research regarding the functionality of already selected wild cherry (Prunus avium L. clones are reported. The main target was to select the genotypes with the best ecological efficiency and less sensible to environmental stress, in order to give concrete indications for arboriculture for wood productions. Starting from 2002, measurements were carried out in the experimental plot of Papiano (Stia, AR, where the following clones with provenance from the Tuscan Apennines were compared: Casina Alpe 1 (A, Casina Alpe 2 (D, Puzzòlo (C, Paradisino (E, Piantata Catenaia (F. Dendrometrical data were collected at the beginning and at the end of each season, in order to evaluate the growth and the individual current increment of the clones. To better characterize the canopies of each clone, measurements of photosynthetic active radiation (PAR and of the leaf area index (LAI where carried out with ceptometers and PCA LAI 2000. In order to evaluate differences between the clones regarding functionality and response to environmental stress, growth and productivity were related to the most important canopy characteristics. Ecological efficiency was calculated for the different clones using the net assimilation rate (NAR. The results show that the clone E has the most developed canopies and the best results in terms of growth. But at the same time it also presents densely branched round canopies and results more sensible to the effects of summer drought. These elements contribute to advise against the use of this clone in future genetic improvement programs and in high quality wood productions. On the contrary, the clones C and A have both good growth characteristics and a better general architecture and are therefore advised for high quality wood productions especially in the same geographic region.

  17. Green synthesis of nitrogen-doped graphitic carbon sheets with use of Prunus persica for supercapacitor applications

    Energy Technology Data Exchange (ETDEWEB)

    Atchudan, Raji, E-mail: atchudanr@yu.ac.kr [School of Chemical Engineering, Yeungnam University, Gyeongsan 38541 (Korea, Republic of); Edison, Thomas Nesakumar Jebakumar Immanuel [School of Chemical Engineering, Yeungnam University, Gyeongsan 38541 (Korea, Republic of); Perumal, Suguna [Department of Applied Chemistry, Kyungpook National University, Daegu 41566 (Korea, Republic of); Lee, Yong Rok, E-mail: yrlee@yu.ac.kr [School of Chemical Engineering, Yeungnam University, Gyeongsan 38541 (Korea, Republic of)

    2017-01-30

    Highlights: • N-GCSs was synthesized from the unripe Prunus persica by direct hydrothermal method. • The resulting N-GCSs-2 exhibit an excellent graphitization with 9.33% of nitrogen. • N-GCSs-2 provide high C{sub s} of 176 F g{sup −1} at current density of 0.1 A g{sup −1} in 1 M H{sub 2}SO{sub 4}. • N-GCSs-2 have high capacitance retention and 20% capacity growth after 2000 cycles. • First time, N-GCSs resulted from peach via green route for flexible supercapacitors. - Abstract: Nitrogen-doped graphitic carbon sheets (N-GCSs) were prepared from the extract of unripe Prunus persica fruit by a direct hydrothermal method. The synthesized N-GCSs were examined by high resolution transmission electron microscopy (HRTEM), nitrogen adsorption-desorption isotherms, X-ray diffraction (XRD), Raman spectroscopy, X-ray photoelectron spectroscopy (XPS), and Fourier transform infrared (FT-IR) spectroscopy. HRTEM showed that the synthesized carbon sheets were graphitic with lattice fringes and an inter-layer distance of 0.36 nm. Doping with the nitrogen moiety present over the synthesized GCSs was confirmed by XPS, FT-IR spectroscopy, and energy dispersive X-ray spectroscopy elemental mapping. The fruit extract associated with hydrothermal-carbonization method is economical and eco-friendly with a single step process. The resulting carbon sheets could be modified and are promising candidates for nano-electronic applications, including supercapacitors. The synthesized N-GCSs-2 provided a high specific capacitance of 176 F g{sup −1} at a current density of 0.1 A g{sup −1}. This electrode material has excellent cyclic stability, even after 2000 cycles of charge-discharge at a current density of 0.5 A g{sup −1}.

  18. Effects of processing techniques on oxidative stability of Prunus pedunculatus seed oil; Efectos de las técnicas de procesamiento sobre la estabilidad oxidativa del aceite de semilla de Prunus pedunculatus

    Energy Technology Data Exchange (ETDEWEB)

    Yan, J.; Guo, M.M.; Shen, Y. H.; Wang, Y.Y.; Luan, X.; Li, C.

    2017-07-01

    This paper investigated the effects of Prunus pedunculatus (P. pedunculatus) seed pre-treatment, including microwaving (M), roasting (R), steaming (S) and roasting plus steaming (RS) on crude oil quality in terms of yield, color change, fatty acid composition, and oxidative stability. The results showed an increase in monounsaturated fatty acid content and oxidative stability of the oils obtained from different processing treatments compared to the oil obtained from raw seeds (RW) without processing. The oils, obtained from pretreated seeds, had higher conjugated diene (CD) and 2-thiobarbituric acid (2-TBA) values, compared to that obtained from RW when stored in a Schaal oven at 65 °C for 168 h. However, polyphenol and tocopherol contents decreased in all oil samples, processed or unprocessed. The effect of pre-treating the seeds was more prominent in the oil sample obtained through the RS technique, and showed higher oxidative stability than the other processed oils and the oil from RW. [Spanish] Se investigó los efectos del pretratamiento de las semillas de Prunus pedunculatus, incluyendo microondas (M), tostado (R), cocción al vapor (S) y torrefacción más vapor (RS), sobre la calidad del aceite crudo, el rendimiento, cambio de color, composición en ácidos grasos y estabilidad oxidativa. Los resultados mostraron un aumento en el contenido de ácidos grasos monoinsaturados y en la estabilidad oxidativa de los aceites obtenidos con diferentes tratamientos de procesamiento en comparación con el aceite obtenido a partir de semillas crudas (RW) sin procesamiento. Los aceites obtenidos a partir de semillas pretratadas presentaron mayores valores de dienos conjugados (CD) y de ácido 2-tiobarbitúrico (2-TBA), comparado con el obtenido de RW cuando se almacenaron en horno a 65 °C durante 168 h. Sin embargo, el contenido de polifenoles y tocoferoles disminuyó en todas las muestras de aceites, procesadas o no procesadas. El efecto del pretratamiento de las

  19. Proteome analysis of the almond kernel (Prunus dulcis).

    Science.gov (United States)

    Li, Shugang; Geng, Fang; Wang, Ping; Lu, Jiankang; Ma, Meihu

    2016-08-01

    Almond (Prunus dulcis) is a popular tree nut worldwide and offers many benefits to human health. However, the importance of almond kernel proteins in the nutrition and function in human health requires further evaluation. The present study presents a systematic evaluation of the proteins in the almond kernel using proteomic analysis. The nutrient and amino acid content in almond kernels from Xinjiang is similar to that of American varieties; however, Xinjiang varieties have a higher protein content. Two-dimensional electrophoresis analysis demonstrated a wide distribution of molecular weights and isoelectric points of almond kernel proteins. A total of 434 proteins were identified by LC-MS/MS, and most were proteins that were experimentally confirmed for the first time. Gene ontology (GO) analysis of the 434 proteins indicated that proteins involved in primary biological processes including metabolic processes (67.5%), cellular processes (54.1%), and single-organism processes (43.4%), the main molecular function of almond kernel proteins are in catalytic activity (48.0%), binding (45.4%) and structural molecule activity (11.9%), and proteins are primarily distributed in cell (59.9%), organelle (44.9%), and membrane (22.8%). Almond kernel is a source of a wide variety of proteins. This study provides important information contributing to the screening and identification of almond proteins, the understanding of almond protein function, and the development of almond protein products. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.

  20. AVALIAÇÃO DA VIABILIDADE DAS BACTÉRIAS LÁCTICAS E VARIAÇAO DA ACIDEZ TITULÁVEL EM IOGURTES COM SABOR DE FRUTAS Evaluation of lactic acid bacteria viability and titratable acidity variation in fruit flavor yogurt

    Directory of Open Access Journals (Sweden)

    Ariane Bonani Nogarotto da Silva

    2013-02-01

    Full Text Available Este trabalho teve como objetivo avaliar a viabilidade das bactérias lácticas, acidez titulável e o pH, em iogurtes nos sabores: natural, coco, ameixa e morango, pertencentes a 4 marcas,coletadas em 4 supermercados localizados em Taubaté-SP. A contagem de bactérias lácticas mostrou tendência de diminuição da viabilidade celular com o decorrer da vida útil; 41,7% das amostras apresentaram população menor que 107 UFC/ml. As amostras de iogurte sabor ameixa apresentaram as maiores contagens de bactérias lácticas. A acidez titulável variou entre 0,58 e 1,60 g de ácido láctico/100g de iogurte. O pH variou entre 3,3 e 4,5 e iogurtes sabor coco apresentaram os maiores valores de pH e as menores contagens de bactérias lácticas.

  1. An efficient viral vector for functional genomic studies of Prunus fruit trees and its induced resistance to Plum pox virus via silencing of a host factor gene.

    Science.gov (United States)

    Cui, Hongguang; Wang, Aiming

    2017-03-01

    RNA silencing is a powerful technology for molecular characterization of gene functions in plants. A commonly used approach to the induction of RNA silencing is through genetic transformation. A potent alternative is to use a modified viral vector for virus-induced gene silencing (VIGS) to degrade RNA molecules sharing similar nucleotide sequence. Unfortunately, genomic studies in many allogamous woody perennials such as peach are severely hindered because they have a long juvenile period and are recalcitrant to genetic transformation. Here, we report the development of a viral vector derived from Prunus necrotic ringspot virus (PNRSV), a widespread fruit tree virus that is endemic in all Prunus fruit production countries and regions in the world. We show that the modified PNRSV vector, harbouring the sense-orientated target gene sequence of 100-200 bp in length in genomic RNA3, could efficiently trigger the silencing of a transgene or an endogenous gene in the model plant Nicotiana benthamiana. We further demonstrate that the PNRSV-based vector could be manipulated to silence endogenous genes in peach such as eukaryotic translation initiation factor 4E isoform (eIF(iso)4E), a host factor of many potyviruses including Plum pox virus (PPV). Moreover, the eIF(iso)4E-knocked down peach plants were resistant to PPV. This work opens a potential avenue for the control of virus diseases in perennial trees via viral vector-mediated silencing of host factors, and the PNRSV vector may serve as a powerful molecular tool for functional genomic studies of Prunus fruit trees. © 2016 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.

  2. Produção de etileno em frutos de ameixeira ‘Prunus domestica’ sujeitos a duas temperaturas de conservação Ethylene production by ‘Prunus domestica’ plums during storage at two different temperatures

    Directory of Open Access Journals (Sweden)

    A.E. Rato

    2007-01-01

    Full Text Available A síntese de etileno em frutos climatéricos tem sido bastante estudada pela influência que tem na conservação dos mesmos. Por esse motivo tem-se tentado através de alterações das condições ambientais, influenciar a produção de etileno. Em muitas espécies a exposição dos frutos ao frio favorece a síntese de etileno, quando estes são transferidos para a temperatura ambiente, também a actividade enzimática da ACC sintetase aumenta rapidamente nos frutos quando da sua passagem para a temperatura ambiente. Em algumas variedades de pêras e maçãs têm-se mesmo utilizado a exposição a baixas temperaturas apenas com o objectivo de conseguir uma maturação mais homogénea e uma textura aceitável. Relativamente à ameixeira Prunus domestica L. ‘Rainha Claudia Verde’ existe pouca informação acerca da expressão dos genes que controlam a maturação, mais concretamente das enzimas ACC sintetase e ACC oxidase. Durante a maturação da ameixa ‘Rainha Claudia Verde’ observa-se um aumento na produção de etileno e na taxa de respiração, paralelamente a um decréscimo da acidez e da firmeza dos frutos. No entanto, contrariamente à maioria das espécies fruteiras, nesta variedade observa-se uma diminuição na taxa de produção de etileno quando os frutos, sujeitos à conservação pelo frio, são posteriormente retirados para a temperatura ambiente. Este decréscimo é tanto mais acentuado quanto maior for o período de exposição ao frio. Esta variedade é habitualmente conservada entre os 0-2 ºC e apresentando um período de comercialização de 2 semanas após a colheita. Pretendeu-se com este trabalho perceber que tipo de efeito existe relativamente à produção de etileno nesta variedade. Estudou-se a influência de duas temperaturas de conservação, (1 ºC e 7 ºC ± 1 ºC, na produção de etileno. Os frutos foram sujeitos a diferentes períodos de conservação frigorífica: 0, 2, 5, 8 e 14 dias, ao fim dos

  3. Evaluation of multiple approaches to identify genome-wide polymorphisms in closely related genotypes of sweet cherry (Prunus avium L.

    Directory of Open Access Journals (Sweden)

    Seanna Hewitt

    Full Text Available Identification of genetic polymorphisms and subsequent development of molecular markers is important for marker assisted breeding of superior cultivars of economically important species. Sweet cherry (Prunus avium L. is an economically important non-climacteric tree fruit crop in the Rosaceae family and has undergone a genetic bottleneck due to breeding, resulting in limited genetic diversity in the germplasm that is utilized for breeding new cultivars. Therefore, it is critical to recognize the best platforms for identifying genome-wide polymorphisms that can help identify, and consequently preserve, the diversity in a genetically constrained species. For the identification of polymorphisms in five closely related genotypes of sweet cherry, a gel-based approach (TRAP, reduced representation sequencing (TRAPseq, a 6k cherry SNParray, and whole genome sequencing (WGS approaches were evaluated in the identification of genome-wide polymorphisms in sweet cherry cultivars. All platforms facilitated detection of polymorphisms among the genotypes with variable efficiency. In assessing multiple SNP detection platforms, this study has demonstrated that a combination of appropriate approaches is necessary for efficient polymorphism identification, especially between closely related cultivars of a species. The information generated in this study provides a valuable resource for future genetic and genomic studies in sweet cherry, and the insights gained from the evaluation of multiple approaches can be utilized for other closely related species with limited genetic diversity in the breeding germplasm. Keywords: Polymorphisms, Prunus avium, Next-generation sequencing, Target region amplification polymorphism (TRAP, Genetic diversity, SNParray, Reduced representation sequencing, Whole genome sequencing (WGS

  4. Unusual behavior of growing pollen tubes in the ovary of plum culture (Prunus domestica L.

    Directory of Open Access Journals (Sweden)

    Đorđević Milena

    2010-01-01

    Full Text Available Unusual behavior of growing pollen tubes in different combinations of pollination was observed in the ovary of the plum (Prunus domestica L. cv 'Čačanska Lepotica'. It primarily refers to several issues, i.e. the curling up of pollen tubes within the micropyle, the growth of two pollen tubes into the nucellus of an ovule, the occurrence of a bundle above the nucellar cap and fluorescence of the part of the embryo sac containing the egg apparatus. Upon the growth of pollen tubes into the nucellus of the ovule, subsequently penetrating pollen tubes form a bundle either above the micropyle entrance or above the nucellus. Branching and bending of pollen tubes by 180o upon their growth into the micropyle was also observed.

  5. Ectopic expression of class 1 KNOX genes induce and adventitious shoot regeneration and alter growth and development of tobacco (Nicotiana tabacum L) and European plum (Prunus domestica L)

    Science.gov (United States)

    Transgenic plants of tobacco (Nicotiana tabacum L) and plum (Prunus domestica L) were produced by transforming with apple class 1 KNOX genes (MdKN1 and MdKN2) or corn KN1 gene. Transgenic tobacco plants were regenerated in vitro from transformed leaf discs cultured in a tissue medium lacking cytoki...

  6. Adsorption Properties of Low-Cost Biomaterial Derived from Prunus amygdalus L. for Dye Removal from Water

    Science.gov (United States)

    Deniz, Fatih

    2013-01-01

    The capability of Prunus amygdalus L. (almond) shell for dye removal from aqueous solutions was investigated and methyl orange was used as a model compound. The effects of operational parameters including pH, ionic strength, adsorbent concentration and mesh size, dye concentration, contact time, and temperature on the removal of dye were evaluated. The adsorption kinetics conformed to the pseudo-second-order kinetic model. The equilibrium data pointed out excellent fit to the Langmuir isotherm model with maximum monolayer adsorption capacity of 41.34 mg g−1 at 293 K. Thermodynamic analysis proved a spontaneous, favorable, and exothermic process. It can be concluded that almond shell might be a potential low-cost adsorbent for methyl orange removal from aqueous media. PMID:23935442

  7. Purification, identification and preliminary crystallographic studies of Pru du amandin, an allergenic protein from Prunus dulcis.

    Science.gov (United States)

    Gaur, Vineet; Sethi, Dhruv K; Salunke, Dinakar M

    2008-01-01

    Food allergies appear to be one of the foremost causes of hypersensitivity reactions. Nut allergies account for most food allergies and are often permanent. The 360 kDa hexameric protein Pru du amandin, a known allergen, was purified from almonds (Prunus dulcis) by ammonium sulfate fractionation and ion-exchange chromatography. The protein was identified by a BLAST homology search against the nonredundant sequence database. Pru du amandin belongs to the 11S legumin family of seed storage proteins characterized by the presence of a cupin motif. Crystals were obtained by the hanging-drop vapour-diffusion method. The crystals belong to space group P4(1) (or P4(3)), with unit-cell parameters a = b = 150.7, c = 164.9 A.

  8. Phylogeny of isolates of Prunus necrotic ringspot virus from the Ilarvirus Ringtest and identification of group-specific features.

    Science.gov (United States)

    Hammond, R W

    2003-06-01

    Isolates of Prunus necrotic ringspot virus (PNRSV) were examined to establish the level of naturally occurring sequence variation in the coat protein (CP) gene and to identify group-specific genome features that may prove valuable for the generation of diagnostic reagents. Phylogenetic analysis of a 452 bp sequence of 68 virus isolates, 20 obtained from the European Union Ilarvirus Ringtest held in October 1998, confirmed the clustering of the isolates into three distinct groups. Although no correlation was found between the sequence and host or geographic origin, there was a general trend for severe isolates to cluster into one group. Group-specific features have been identified for discrimination between virus strains.

  9. Antiproliferative terpenoids from almond hulls (Prunus dulcis): identification and structure-activity relationships.

    Science.gov (United States)

    Amico, Vincenzo; Barresi, Vincenza; Condorelli, Daniele; Spatafora, Carmela; Tringali, Corrado

    2006-02-08

    Bioassay-guided fractionation of the EtOAc crude extract from Sicilian almond hulls, a waste material from Prunus dulcis crop, allowed identification of 10 constituents, isolated as pure compounds (1-5, 7, and 10) or unseparable mixtures (5 + 6 and 8 + 9). All compounds were subjected to spectroscopic analysis and 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyl tetrazolium bromide bioassay on MCF-7 human breast cancer cells. In addition to the main components oleanolic (1), ursolic (2), and betulinic (3) acids, the 2-hydroxy analogues alphitolic (4), corosolic (5), and maslinic (6) acids, as well as the related aldehydes, namely, betulinic (7), oleanolic (8), and ursolic (9), were identified. From a more polar fraction, the beta-sitosterol 3-O-glucoside (10) was also identified. A sample of commercially available betulin (11) was also included in bioassays as further support to a structure-activity relationship study. Betulinic acid showed antiproliferative activity toward MCF-7 cells (GI50 = 0.27 microM), higher than the anticancer drug 5-fluorouracil.

  10. [Procedure of seed quality testing and seed grading standard of Prunus humilis].

    Science.gov (United States)

    Wen, Hao; Ren, Guang-Xi; Gao, Ya; Luo, Jun; Liu, Chun-Sheng; Li, Wei-Dong

    2014-11-01

    So far there exists no corresponding quality test procedures and grading standards for the seed of Prunus humilis, which is one of the important source of base of semen pruni. Therefor we set up test procedures that are adapt to characteristics of the P. humilis seed through the study of the test of sampling, seed purity, thousand-grain weight, seed moisture, seed viability and germination percentage. 50 cases of seed specimens of P. humilis tested. The related data were analyzed by cluster analysis. Through this research, the seed quality test procedure was developed, and the seed quality grading standard was formulated. The seed quality of each grade should meet the following requirements: for first grade seeds, germination percentage ≥ 68%, thousand-grain weight 383 g, purity ≥ 93%, seed moisture ≤ 5%; for second grade seeds, germination percentage ≥ 26%, thousand-grain weight ≥ 266 g, purity ≥ 73%, seed moisture ≤9%; for third grade seeds, germination percentage ≥ 10%, purity ≥ 50%, thousand-grain weight ≥ 08 g, seed moisture ≤ 13%.

  11. Chlorophyll Catabolites in Senescent Leaves of the Plum Tree (Prunus domestica).

    Science.gov (United States)

    Erhart, Theresia; Mittelberger, Cecilia; Vergeiner, Clemens; Scherzer, Gerhard; Holzner, Barbara; Robatscher, Peter; Oberhuber, Michael; Kräutler, Bernhard

    2016-11-01

    In cold extracts of senescent leaves of the plum tree (Prunus domestica ssp. domestica), six colorless non-fluorescent chlorophyll catabolites (NCCs) were characterized, named Pd-NCCs. In addition, several minor NCC fractions were tentatively classified. The structure of the most polar one of the NCCs, named Pd-NCC-32, featured an unprecedented twofold glycosidation pattern. Three of the NCCs are also functionalized at their 3 2 -position by a glucopyranosyl group. In addition, two of these glycosidated NCCs carry a dihydroxyethyl group at their 18-position. In the polar Pd-NCC-32, the latter group is further glycosidated at the terminal 18 2 -position. Four other major Pd-NCCs and one minor Pd-NCC were identified with five NCCs from higher plants known to belong to the 'epi'-series. In addition, tentative structures were derived for two minor fractions, classified as yellow chlorophyll catabolites, which represented (formal) oxidation products of two of the observed Pd-NCCs. The chlorophyll catabolites in leaves of plum feature the same basic structural pattern as those found in leaves of apple and pear trees. © 2016 The Authors. Chemistry & Biodiversity Published by Wiley-VHCA AG, Zurich, Switzerland.

  12. Characterization of a new (R)-hydroxynitrile lyase from the Japanese apricot Prunus mume and cDNA cloning and secretory expression of one of the isozymes in Pichia pastoris.

    Science.gov (United States)

    Fukuta, Yasuhisa; Nanda, Samik; Kato, Yasuo; Yurimoto, Hiroya; Sakai, Yasuyoshi; Komeda, Hidenobu; Asano, Yasuhisa

    2011-01-01

    PmHNL, a hydroxynitrile lyase from Japanese apricot ume (Prunus mume) seed was purified to homogeneity by ammonium sulfate fractionation and chromatographic steps. The purified enzyme was a monomer with molecular mass of 58 kDa. It was a flavoprotein similar to other hydroxynitrile lyases of the Rosaceae family. It was active over a broad temperature, and pH range. The N-terminal amino acid sequence (20 amino acids) was identical with that of the enzyme from almond (Prunus dulcis). Based on the N-terminal sequence of the purified enzyme and the conserved amino acid sequences of the enzymes from Pr. dulcis, inverse PCR method was used for cloning of a putative PmHNL (PmHNL2) gene from a Pr. mume seedling. Then the cDNA for the enzyme was cloned. The deduced amino acid sequence was found to be highly similar (95%) to that of an enzyme from Pr. serotina, isozyme 2. The recombinant Pichia pastoris transformed with the PmHNL2 gene secreted an active enzyme in glycosylated form.

  13. Seasonal variation of Prunus necrotic ringspot virus concentration in almond, peach, and plum cultivars

    Directory of Open Access Journals (Sweden)

    N. Salem

    2003-08-01

    Full Text Available Levels of Prunus necrotic ringspot virus (PNRSV infection in almond, peach, and plum cultivars over the course of an entire year were determined by testing different plant parts of naturally infected trees, using the double antibody sandwich-enzyme linked immunosorbent assay (DAS-ELISA. The data showed that spring was the best time of year for PNRSV detection in flowers, active growing buds, and young leaves. PNRSV detection was less reliable during the summer months. Young leaves of all cultivars were the most reliable source for distinguishing between healthy and infected plants, while flowers and buds yielded high values in some cultivars but not in others. Seasonal fluctuations in virus concentration did not follow the same pattern in all cultivars. It is therefore impossible to distinguish between infected and healthy trees on the basis of one single sampling time for all cultivars.

  14. GENETIC DIVERSITY OF SOME IRANIAN SWEET CHERRY (PRUNUS AVIUM) CULTIVARS USING MICROSATELLITE MARKERS AND MORPHOLOGICAL TRAITS.

    Science.gov (United States)

    Farsad, A; Esna-Ashari, M

    2016-01-01

    The aim of this study was to characterize 23 important Iranian sweet cherry (Prunus avium) cultivars collected from different provinces of Iran and 1 foreign cultivar, which was used as control, considered for breeding programs by using 21 microsatellite markers and 27 morphological traits. In sweet cherry (Prunus avium) accessions, leaf, fruit, and stone morphological characters were evaluated during two consecutive years. The study revealed a high variability in the set of evaluated sweet cherry accessions. The majority of important correlations were determined among variables representing fruit and leaf size and variables related to color. Cluster analysis distinguished sweet cherry accessions into two distinct groups. Principal component analysis (PCA) of qualitative and quantitative morphological parameters explained over 86.59% of total variability in the first seven axes. In PCA, leaf traits such as leaf length and width, and fruit traits such as length, width, and weight, and fruit flesh and juice color were predominant in the first two components, indicating that they were useful for the assessment of sweet cherry germplasm characterization. Out of 21 SSR markers, 16 were polymorphic, producing 177 alleles that varied from 4 to 16 alleles (9.35 on average) with a mean heterozygosity value of 0.82 that produced successful amplifications and revealed DNA polymorphisms. Allele size varied from 95 to 290 bp. Cluster analyses showed that the studied sweet cherry genotypes were classified intofive main groups based mainly on their species characteristics and SSR data. In general, our results did not show a clear structuring of genetic variability within the Iranian diffusion area of sweet cherry, so it was not possible to draw any indications on regions of provenance delimitation. The results of this study contribute to a better understanding of sweet cherry genetic variations in Iran, thus making for more efficient programs aimed at preserving biodiversity and

  15. Evolutionary patterns at the RNase based gametophytic self - incompatibility system in two divergent Rosaceae groups (Maloideae and Prunus).

    Science.gov (United States)

    Vieira, Jorge; Ferreira, Pedro G; Aguiar, Bruno; Fonseca, Nuno A; Vieira, Cristina P

    2010-06-28

    Within Rosaceae, the RNase based gametophytic self-incompatibility (GSI) system has been studied at the molecular level in Maloideae and Prunus species that have been diverging for, at least, 32 million years. In order to understand RNase based GSI evolution within this family, comparative studies must be performed, using similar methodologies. It is here shown that many features are shared between the two species groups such as levels of recombination at the S-RNase (the S-pistil component) gene, and the rate at which new specificities arise. Nevertheless, important differences are found regarding the number of ancestral lineages and the degree of specificity sharing between closely related species. In Maloideae, about 17% of the amino acid positions at the S-RNase protein are found to be positively selected, and they occupy about 30% of the exposed protein surface. Positively selected amino acid sites are shown to be located on either side of the active site cleft, an observation that is compatible with current models of specificity determination. At positively selected amino acid sites, non-conservative changes are almost as frequent as conservative changes. There is no evidence that at these sites the most drastic amino acid changes may be more strongly selected. Many similarities are found between the GSI system of Prunus and Maloideae that are compatible with the single origin hypothesis for RNase based GSI. The presence of common features such as the location of positively selected amino acid sites and lysine residues that may be important for ubiquitylation, raise a number of issues that, in principle, can be experimentally addressed in Maloideae. Nevertheless, there are also many important differences between the two Rosaceae GSI systems. How such features changed during evolution remains a puzzling issue.

  16. Evolutionary patterns at the RNase based gametophytic self - incompatibility system in two divergent Rosaceae groups (Maloideae and Prunus

    Directory of Open Access Journals (Sweden)

    Fonseca Nuno A

    2010-06-01

    Full Text Available Abstract Background Within Rosaceae, the RNase based gametophytic self-incompatibility (GSI system has been studied at the molecular level in Maloideae and Prunus species that have been diverging for, at least, 32 million years. In order to understand RNase based GSI evolution within this family, comparative studies must be performed, using similar methodologies. Result It is here shown that many features are shared between the two species groups such as levels of recombination at the S-RNase (the S-pistil component gene, and the rate at which new specificities arise. Nevertheless, important differences are found regarding the number of ancestral lineages and the degree of specificity sharing between closely related species. In Maloideae, about 17% of the amino acid positions at the S-RNase protein are found to be positively selected, and they occupy about 30% of the exposed protein surface. Positively selected amino acid sites are shown to be located on either side of the active site cleft, an observation that is compatible with current models of specificity determination. At positively selected amino acid sites, non-conservative changes are almost as frequent as conservative changes. There is no evidence that at these sites the most drastic amino acid changes may be more strongly selected. Conclusions Many similarities are found between the GSI system of Prunus and Maloideae that are compatible with the single origin hypothesis for RNase based GSI. The presence of common features such as the location of positively selected amino acid sites and lysine residues that may be important for ubiquitylation, raise a number of issues that, in principle, can be experimentally addressed in Maloideae. Nevertheless, there are also many important differences between the two Rosaceae GSI systems. How such features changed during evolution remains a puzzling issue.

  17. Mutational analysis of the RNA-binding domain of the Prunus necrotic ringspot virus (PNRSV) movement protein reveals its requirement for cell-to-cell movement

    OpenAIRE

    Herranz, M. Carmen; Sánchez Navarro, Jesús A.; Saurí Peris, Ana; Mingarro Muñoz, Ismael; Pallás Benet, Vicente

    2005-01-01

    The movement protein (MP) of Prunus necrotic ringspot virus (PNRSV) is required for cell-to-cell movement. MP subcellular localization studies using a GFP fusion protein revealed highly punctate structures between neighboring cells, believed to represent plasmodesmata. Deletion of the RNA-binding domain (RBD) of PNRSV MP abolishes the cell-to-cell movement. A mutational analysis on this RBD was performed in order to identify in vivo the features that govern viral transport. Loss of positive c...

  18. Sobrevivencia del duraznillo (Prunus annularis en plantación forestal y en sistemas agroforestales

    Directory of Open Access Journals (Sweden)

    Javier Monge

    2005-01-01

    Full Text Available Se estudió la sobrevivencia inicial (30 meses del duraznillo (Prunus annularis en plantación forestal y en sistema agroforestal en la zona de vida Bosque muy Húmedo Montano Bajo, en Costa Rica. Se evaluó 5 tratamientos, en 2 lotes con 2 repeticiones en cada lote, en parcelas de 25 árboles (722 ha-1. Los sistemas de producción evaluados fueron: plantación forestal, con manejo de eliminación de malezas cada 4 meses (PF-4 y cada 2 meses (PF-2, y sistemas agroforestales duraznillo-naranjilla (Solanum quitoense, duraznillo-menta (Satureja viminea y duraznillo-maíz (Zea mays. La sobrevivencia a los 30 meses osciló entre 56 y 81% siendo menor en plantación forestal (PF-4. La sobrevivencia mostrada por el duraznillo se consideró intermedia con respecto a otras especies establecidas en sitios con la misma zona de vida.

  19. VPLIV UPORABE RASTNIH HORMONOV V RAZLIČNIH RAZVOJNIH FAZAH PLODOV NA KOLIČINO IN KAKOVOST PRIDELKA ČEŠNJE (Prunus avium L.)

    OpenAIRE

    Pelc, David

    2015-01-01

    V letu 2008 smo v Sadjarskem centru Maribor – Gačnik spremljali vpliv uporabe rastnih hormonov v različnih razvojnih fazah plodov na količino in kakovost pridelka češnje (Prunus avium L.). Namen poskusa je bil ugotoviti, ali rastni hormoni (avksini, citokinini) lahko pri češnji vplivajo na kakovost, velikost in na količino pridelka. Vključenih je bilo 6 obravnavanj, od katerih so 3 obravnavanja predstavljala tretiranje z avksini (Amid-thin, Maxim), 1 obravnavanje s citokinini (CPPU), 1 obravn...

  20. Effect of Hydroxypropyl Methylcellulose-Beeswax Composite Edible Coatings Formulated with or without Antifungal Agents on Physicochemical Properties of Plums during Cold Storage

    Directory of Open Access Journals (Sweden)

    Sule Gunaydin

    2017-01-01

    Full Text Available The influence of hydroxypropyl methylcellulose- (HPMC- beeswax (BW composite edible coatings formulated with or without food additives with antifungal properties on physicochemical and sensory properties of plums (Prunus salicina cv. “Friar” stored for 11 and 22 d at 1°C followed by a shelf life period of 5 d at 20°C was evaluated. Food preservatives selected from previous research included potassium sorbate (PS, sodium methyl paraben (SMP, and sodium ethyl paraben (SEP. Emulsions had 7% of total solid content and were prepared with glycerol and stearic acid as plasticizer and emulsifier, respectively. All the coatings reduced plum weight and firmness loss and coated fruit showed higher titratable acidity, soluble solids content, and hue angle values at the end of the storage period. In addition, physiological disorders such as flesh browning and bleeding were reduced in coated samples compared to uncoated controls. Paraben-based coatings were the most effective in controlling weight loss and the SMP-based coating was the most effective in maintaining plum firmness. Respiration rate, sensory flavor, off-flavors, and fruit appearance were not adversely affected by the application of antifungal coatings. Overall, these results demonstrated the potential of selected edible coatings containing antifungal food additives to extend the postharvest life of plums, although further studies should focus on improving some properties of the coatings to enhance gas barrier properties and further increase storability.

  1. Adaptive covariation between the coat and movement proteins of prunus necrotic ringspot virus.

    Science.gov (United States)

    Codoñer, Francisco M; Fares, Mario A; Elena, Santiago F

    2006-06-01

    The relative functional and/or structural importance of different amino acid sites in a protein can be assessed by evaluating the selective constraints to which they have been subjected during the course of evolution. Here we explore such constraints at the linear and three-dimensional levels for the movement protein (MP) and coat protein (CP) encoded by RNA 3 of prunus necrotic ringspot ilarvirus (PNRSV). By a maximum-parsimony approach, the nucleotide sequences from 46 isolates of PNRSV varying in symptomatology, host tree, and geographic origin have been analyzed and sites under different selective pressures have been identified in both proteins. We have also performed covariation analyses to explore whether changes in certain amino acid sites condition subsequent variation in other sites of the same protein or the other protein. These covariation analyses shed light on which particular amino acids should be involved in the physical and functional interaction between MP and CP. Finally, we discuss these findings in the light of what is already known about the implication of certain sites and domains in structure and protein-protein and RNA-protein interactions.

  2. Molecular mechanisms regulating flowering time in sweet cherry (Prunus avium L.)

    DEFF Research Database (Denmark)

    Ionescu, Irina Alexandra

    The timing of flowering is a well-researched but at the same time incredibly complex process in angiosperms. Although we are in possession of detailed knowledge on the genetic level of flowering time regulation in the model plant Arabidopsis thaliana, it is often difficult to transfer this knowle......The timing of flowering is a well-researched but at the same time incredibly complex process in angiosperms. Although we are in possession of detailed knowledge on the genetic level of flowering time regulation in the model plant Arabidopsis thaliana, it is often difficult to transfer...... as a result of hydrogen cyanamide treatment: the jasmonate pathway, the hydrogen cyanide pathway and the cytokinin pathway. We further analyzed the levels of cyanogenic glucosides and their derivatives during endodormancy and its release in sweet cherry and almond (Prunus dulcis (Mill.) D. A. Webb). Prunasin...... and its amide coincided with flowering time in both species. Taken together, these results contribute to elucidating parts of the complex network regulating flowering time in perennial plants....

  3. Wound Healing Effects of Prunus yedoensis Matsumura Bark in Scalded Rats

    Directory of Open Access Journals (Sweden)

    Jin-Ho Lee

    2017-01-01

    Full Text Available Pruni Cortex has been used to treat asthma, measles, cough, urticaria, pruritus, and dermatitis in traditional Korean medicine. The objective of this study was to investigate the effects of Prunus yedoensis Matsumura bark methanol extract (PYE on scald-induced dorsal skin wounds in rats. Scalds were produced in Sprague-Dawley rats with 100°C water and treated with 5% and 20% PYE (using Vaseline as a base, silver sulfadiazine (SSD, and Vaseline once a day for 21 days, beginning 24 hours after scald by treatment group allocation. The PYE-treated groups showed accelerated healing from 12 days after scald, demonstrated by rapid eschar exfoliation compared to the control and SSD groups. PYE-treated groups showed higher wound contraction rates and better tissue regeneration in comparison with the control group. Serum analysis showed that transforming growth factor beta 1 and vascular endothelial growth factor levels remained high or gradually increased up to day 14 in both PYE groups and then showed a sharp decline by day 21, implying successful completion of the inflammatory phase and initiation of tissue regeneration. These findings suggested that PYE is effective in promoting scald wound healing in the inflammation and tissue proliferation stages.

  4. De novo transcriptome assembly and comparative analysis of differentially expressed genes in Prunus dulcis Mill. in response to freezing stress.

    Directory of Open Access Journals (Sweden)

    Sadegh Mousavi

    Full Text Available Almond (Prunus dulcis Mill., one of the most important nut crops, requires chilling during winter to develop fruiting buds. However, early spring chilling and late spring frost may damage the reproductive tissues leading to reduction in the rate of productivity. Despite the importance of transcriptional changes and regulation, little is known about the almond's transcriptome under the cold stress conditions. In the current research, we used RNA-seq technique to study the response of the reproductive tissues of almond (anther and ovary to frost stress. RNA sequencing resulted in more than 20 million reads from anther and ovary tissues of almond, individually. About 40,000 contigs were assembled and annotated de novo in each tissue. Profile of gene expression in ovary showed significant alterations in 5,112 genes, whereas in anther 6,926 genes were affected by freezing stress. Around two thousands of these genes were common altered genes in both ovary and anther libraries. Gene ontology indicated the involvement of differentially expressed (DE genes, responding to freezing stress, in metabolic and cellular processes. qRT-PCR analysis verified the expression pattern of eight genes randomly selected from the DE genes. In conclusion, the almond gene index assembled in this study and the reported DE genes can provide great insights on responses of almond and other Prunus species to abiotic stresses. The obtained results from current research would add to the limited available information on almond and Rosaceae. Besides, the findings would be very useful for comparative studies as the number of DE genes reported here is much higher than that of any previous reports in this plant.

  5. De novo transcriptome assembly and comparative analysis of differentially expressed genes in Prunus dulcis Mill. in response to freezing stress.

    Science.gov (United States)

    Mousavi, Sadegh; Alisoltani, Arghavan; Shiran, Behrouz; Fallahi, Hossein; Ebrahimie, Esameil; Imani, Ali; Houshmand, Saadollah

    2014-01-01

    Almond (Prunus dulcis Mill.), one of the most important nut crops, requires chilling during winter to develop fruiting buds. However, early spring chilling and late spring frost may damage the reproductive tissues leading to reduction in the rate of productivity. Despite the importance of transcriptional changes and regulation, little is known about the almond's transcriptome under the cold stress conditions. In the current research, we used RNA-seq technique to study the response of the reproductive tissues of almond (anther and ovary) to frost stress. RNA sequencing resulted in more than 20 million reads from anther and ovary tissues of almond, individually. About 40,000 contigs were assembled and annotated de novo in each tissue. Profile of gene expression in ovary showed significant alterations in 5,112 genes, whereas in anther 6,926 genes were affected by freezing stress. Around two thousands of these genes were common altered genes in both ovary and anther libraries. Gene ontology indicated the involvement of differentially expressed (DE) genes, responding to freezing stress, in metabolic and cellular processes. qRT-PCR analysis verified the expression pattern of eight genes randomly selected from the DE genes. In conclusion, the almond gene index assembled in this study and the reported DE genes can provide great insights on responses of almond and other Prunus species to abiotic stresses. The obtained results from current research would add to the limited available information on almond and Rosaceae. Besides, the findings would be very useful for comparative studies as the number of DE genes reported here is much higher than that of any previous reports in this plant.

  6. Efficient removal of Acid Green 25 dye from wastewater using activated Prunus Dulcis as biosorbent: Batch and column studies.

    Science.gov (United States)

    Jain, Suyog N; Gogate, Parag R

    2018-03-15

    Biosorbent synthesized from dead leaves of Prunus Dulcis with chemical activation during the synthesis was applied for the removal of Acid Green 25 dye from wastewater. The obtained biosorbent was characterized using Brunauer-Emmett-Teller analysis, Fourier transform-infrared spectroscopy and scanning electron microscopy measurements. It was demonstrated that alkali treatment during the synthesis significantly increased surface area of biosorbent from 67.205 to 426.346 m 2 /g. The effect of various operating parameters on dye removal was investigated in batch operation and optimum values of parameters were established as pH of 2, 14 g/L as the dose of natural biosorbent and 6 g/L as the dose of alkali treated biosorbent. Relative error values were determined to check fitting of obtained data to the different kinetic and isotherm models. It was established that pseudo-second order kinetic model and Langmuir isotherm fitted suitably to the obtained batch experimental data. Maximum biosorption capacity values were estimated as 22.68 and 50.79 mg/g for natural biosorbent and for alkali activated Prunus Dulcis, respectively. Adsorption was observed as endothermic and activation energy of 6.22 kJ/mol confirmed physical type of adsorption. Column experiments were also conducted to probe the effectiveness of biosorbent for practical applications in continuous operation. Breakthrough parameters were established by studying the effect of biosorbent height, flow rate of dye solution and initial dye concentration on the extent of dye removal. The maximum biosorption capacity under optimized conditions in the column operation was estimated as 28.57 mg/g. Thomas and Yoon-Nelson models were found to be suitably fitted to obtained column data. Reusability study carried out in batch and continuous column operations confirmed that synthesized biosorbent can be used repeatedly for dye removal from wastewater. Copyright © 2018 Elsevier Ltd. All rights reserved.

  7. Purification, identification and preliminary crystallographic studies of Pru du amandin, an allergenic protein from Prunus dulcis

    International Nuclear Information System (INIS)

    Gaur, Vineet; Sethi, Dhruv K.; Salunke, Dinakar M.

    2007-01-01

    The purification, identification, crystallization and preliminary crystallographic studies of an allergy-related protein, Pru du amandin, from P. dulcis nuts are reported. Food allergies appear to be one of the foremost causes of hypersensitivity reactions. Nut allergies account for most food allergies and are often permanent. The 360 kDa hexameric protein Pru du amandin, a known allergen, was purified from almonds (Prunus dulcis) by ammonium sulfate fractionation and ion-exchange chromatography. The protein was identified by a BLAST homology search against the nonredundant sequence database. Pru du amandin belongs to the 11S legumin family of seed storage proteins characterized by the presence of a cupin motif. Crystals were obtained by the hanging-drop vapour-diffusion method. The crystals belong to space group P4 1 (or P4 3 ), with unit-cell parameters a = b = 150.7, c = 164.9 Å

  8. Préparation et caractérisation d'un charbon actif à partir de la coquille d'amande (Prunus amygdalus amère

    Directory of Open Access Journals (Sweden)

    Trachi, M.

    2014-01-01

    Full Text Available Preparation and characterization of activated coal from bitter almond shells (Prunus amygdalus. Description of the subject. The present study concerns the preparation of activated coal (AC from bitter almond (Prunus amygdalus shells (BASh, a fruit that grows spontaneously in the Setif region (northeast Algeria. Obtaining and characterizing activated coal was the valorization method adopted here. Objectives. The aim of this study was to elucidate the feasibility of the chemical activation of BASh in order to obtain two types of activated coal (AC. Method. The two ACs were obtained from BASh by acid (CAa and basic (CAb activation. The final products were investigated for their different physicochemical characteristics: angle of repose, ash, differential screening calorimetry, etc. In the case of CAa, the modeling of the adsorption kinetic of methylene blue (MB, as well as of adsorption isotherms, was also performed. Results. The activation mode seemed to affect unequally the different physicochemical characteristics of both the obtained coals. On the other hand, the adsorption kinetics of the MB by CAa was correctly described by the pseudo-2nd-order model (R² = 0.999. Concerning the modeling of the adsorption isotherm, of the three models tested, the Freundlich model appeared to be the most appropriate to fit the experimental data (R2 = 0.898, mean relative error (MRE = 38.638 and root mean square error (RMSE = 1.039. In addition, the activated shell showed an interesting capacity for MB adsorption, estimated at 99.05%.

  9. Genome wide identification of chilling responsive microRNAs in Prunus persica

    Directory of Open Access Journals (Sweden)

    Barakat Abdelali

    2012-09-01

    Full Text Available Abstract Background MicroRNAs (miRNAs are small RNAs (sRNAs approximately 21 nucleotides in length that negatively control gene expression by cleaving or inhibiting the translation of target gene transcripts. Within this context, miRNAs and siRNAs are coming to the forefront as molecular mediators of gene regulation in plant responses to annual temperature cycling and cold stress. For this reason, we chose to identify and characterize the conserved and non-conserved miRNA component of peach (Prunus persica (L. Batsch focusing our efforts on both the recently released whole genome sequence of peach and sRNA transcriptome sequences from two tissues representing non-dormant leaves and dormant leaf buds. Conserved and non-conserved miRNAs, and their targets were identified. These sRNA resources were used to identify cold-responsive miRNAs whose gene targets co-localize with previously described QTLs for chilling requirement (CR. Results Analysis of 21 million peach sRNA reads allowed us to identify 157 and 230 conserved and non-conserved miRNA sequences. Among the non-conserved miRNAs, we identified 205 that seem to be specific to peach. Comparative genome analysis between peach and Arabidopsis showed that conserved miRNA families, with the exception of miR5021, are similar in size. Sixteen of these conserved miRNA families are deeply rooted in land plant phylogeny as they are present in mosses and/or lycophytes. Within the other conserved miRNA families, five families (miR1446, miR473, miR479, miR3629, and miR3627 were reported only in tree species (Populustrichocarpa, Citrus trifolia, and Prunus persica. Expression analysis identified several up-regulated or down-regulated miRNAs in winter buds versus young leaves. A search of the peach proteome allowed the prediction of target genes for most of the conserved miRNAs and a large fraction of non-conserved miRNAs. A fraction of predicted targets in peach have not been previously reported in other

  10. Immunocapture reverse transcription-polymerase chain reaction combined with nested PCR greatly increases the detection of Prunus necrotic ring spot virus in the peach.

    Science.gov (United States)

    Helguera, P R; Taborda, R; Docampo, D M; Ducasse, D A

    2001-06-01

    A detection system based on nested PCR after IC-RT-PCR (IC-RT-PCR-Nested PCR) was developed to improve indexing of Prunus necrotic ringspot virus in peach trees. Inhibitory effects and inconsistencies of the standard IC-RT-PCR were overcome by this approach. IC-RT-PCR-Nested PCR improved detection by three orders of magnitude compared with DAS-ELISA for the detection of PNRSV in leaves. Several different tissues were evaluated and equally consistent results were observed. The main advantages of the method are its consistency, high sensitivity and easy application in quarantine programs.

  11. Evaluación productiva, económica y social del agua de riego de durazno (Prunus persica L. Batsch) en Zacatecas (México)

    OpenAIRE

    José Luis Ríos-Flores; Miriam Torres-Moreno; José Ruiz-Torres; Marco Antonio Torres-Moreno; Jesús Enrique Cantú-Brito

    2015-01-01

    La escasez de agua limita la agricultura, por lo que su uso debe ser más eficiente en la producción de alimentos. El objetivo de este trabajo fue determinar la productividad económica, física y social del agua del cultivo de durazno (Prunus persica L. Batsch), en la región del Distrito de Desarrollo Rural 183 —correspondiente a Fresnillo, Zacatecas— para el ciclo 2012; se desarrollaron modelos matemáticos para estimar la productividad y eficiencia del agua. En Zacatecas se cosecharon 817 ha d...

  12. Caracterización con RAMs de la colección de durazno (Prunus persica L. Batsch existente en la Universidad Pedagógica y Tecnológica de Colombia

    Directory of Open Access Journals (Sweden)

    Ana Cruz Morillo Coronado

    2014-12-01

    Full Text Available Utilizando ocho cebadores Microsatélites Amplificados al Azar (RAMs fue evaluada la diversidad genética de 31 materiales de Prunus de la colección de caducifolios existente en la Universidad Pedagógica y Tecnológica de Colombia. Se generaron un total de 121 amplicones con pesos moleculares entre 260 y 1000 Kb. Con un coeficiente de similitud de 0.75, se formaron tres grupos, de acuerdo principalmente con las características del fruto, encontrando en el grupo 2 las variedades de importancia económica. El número de loci polimórficos varió entre 5 y 16 para los cebadores GT y CCA, respectivamente. El valor promedio de heterocigosidad fue de 0.22, más bajo que los encontrados en otros estudios de diversidad genética en el género Prunus; por tanto, se deben buscar estrategias para incrementar la variabilidad genética de la colección como la introducción de nuevos materiales o híbridos interespecíficos. La técnica RAMs es útil para evaluar la diversidad genética en especies caducifolias.

  13. Almond (Prunus dulcis (Mill.) D.A. Webb) skins as a potential source of bioactive polyphenols.

    Science.gov (United States)

    Monagas, Maria; Garrido, Ignacio; Lebrón-Aguilar, Rosa; Bartolome, Begoña; Gómez-Cordovés, Carmen

    2007-10-17

    An exhaustive study of the phenolic composition of almond ( Prunus dulcis (Mill.) D.A. Webb) skins was carried out in order to evaluate their potential application as a functional food ingredient. Using the HPLC-DAD/ESI-MS technique, a total of 33 compounds corresponding to flavanols, flavonols, dihydroflavonols and flavanones, and other nonflavonoid compounds were identified. Peaks corresponding to another 23 structure-related compounds were also detected. MALDI-TOF MS was applied to characterize almond skin proanthocyanidins, revealing the existence of a series of A- and B-type procyanidins and propelargonidins up to heptamers, and A- and B-type prodelphinidins up to hexamers. Flavanols and flavonol glycosides were the most abundant phenolic compounds in almond skins, representing up to 38-57% and 14-35% of the total quantified phenolics, respectively. Due to their antioxidant properties, measured as oxygen-radical absorbance capacity (ORAC) at 0.398-0.500 mmol Trolox/g, almond skins can be considered as a value-added byproduct for elaborating dietary antioxidant ingredients.

  14. Incidência e severidade do "furo de bala" em folhas da ameixeira sob doses de nitrogênio e potássio Incidence and severity of 'shot hole' in plum´s leaves related into nitrogen and potassium doses

    Directory of Open Access Journals (Sweden)

    Inês Tutida

    2007-10-01

    Full Text Available A produção integrada (PI vem suprir uma demanda crescente de frutos de qualidade, garantir segurança alimentar, produção com qualidade ambiental e rastreabilidade. Na visão da PI, as práticas da adubação e do controle de doenças estão intimamente relacionadas; no entanto, tem sido negligenciadas e pouco estudadas, principalmente para a doença "furo de bala" (Wilsonomyces carpophilus em folhas de ameixeira (Prunus salicina. O objetivo deste trabalho foi avaliar a incidência e severidade dessa doença em doses combinadas de adubação com N e K em dois ciclos de cultivo comercial de ameixeira cv "Reubennel", no município de Araucária (PR. Foram utilizadas cinco doses de N (40, 80, 120, 160 e 200kg ha-1ano-1 e duas de K (55 e 110kg ha-1ano-1. Realizaram-se sete avaliações para incidência e severidade a cada 20 dias, no período de novembro/2004 a março/2005 e em data única em outubro/2005. Os dados da primeira safra foram integralizados no tempo, constituindo a área abaixo da curva de progresso da doença (AACPD da incidência e severidade, e os dados foram analisados estatisticamente pela teoria dos modelos lineares generalizados para dados longitudinais. A doença foi mais severa no segundo ano de avaliação, sendo observado o máximo de 0,70 e 2,25 para o primeiro e o segundo ano, respectivamente. A incidência e a severidade de "furo de bala" em folhas de ameixeira são superiores nas doses de 160 e 200kg ha-1ano-1 de nitrogênio. O potássio não interfere na incidência e severidade da doença devido ao seu elevado teor encontrado no solo e na planta.Integrated Production (IP can provide the growing demand for quality fruit, food safety, environmental protection, and product traceability. In IP, fertilization practices and disease control are viewed as being closely related. However, this linkage has been mostly ignored and few studies are available concerning the 'shot hole' phytopathogen (Wilsonomyces carpophilus in

  15. UTILIZACION DE ISOENZIMAS DE EXTRACTOS DE HOJAS EN LA CARACTERIZACION DE CULTIVARES DE DURAZNERO (Prunus persica (L Batsch THE USE OF ISOZYME LEAF EXTRACTS IN THE CHARACTERIZATION OF PEACH CULTIVARS (Prunus persica L Batsch

    Directory of Open Access Journals (Sweden)

    HECTOR ABEL ALTUBE

    2001-08-01

    Full Text Available La caracterización de cultivares de duraznero (Prunus persica (L Batsch se hace por medio de la descripción de caracteres agronómicos y morfológicos codificados por organizaciones internacionales, los cuales están fuertemente influenciados por el ambiente. Se han buscado métodos alternativos de caracterización y las isoenzimas han sido utilizadas por su independencia de las condiciones del ambiente, además de identificar individuos en etapas tempranas de su desarrollo. El objetivo del presente estudio es caracterizar cultivares de duraznero mediante el análisis isoenzimático de catecol oxidasas, fosfatasas ácidas, esterazas y peroxidazos en extractos de hojas. Los cultivares de duraznero analizados presentaron bajo polimorfismo isoenzimático, las esterazas caracterizaron diez cultivares, las catecol oxidasas un cultivar agrupándose el resto en cinco modelos, las fosfatasas ácidas caracterizaron dos cultivares agrupándose los otros en siete modelos y las peroxidazos formaron tres grupos. Ello puede explicarse ya que el duraznero es una especie autofértil y presenta una base genética muy reducida. Los evidentes límites discriminatorios de este tipo de análisis hacen que su aporte sea sólo complementario a los métodos de los caracteres agronómicos y morfológicos.Characterization of peach cultivars (Prunus persica (L Batsh was made by description of agronomical and morphological characters codified from international organizations, which are strongly affected by environmental conditions. Alternative methods of characterization have been searched, and isoenzymes have been used as independent of environmental conditions in addition to identify some individuals in early stages of development. The goal of this study is the peach cultivars characterization by isoenzymatic analysis of catecol oxidases, acid phosphatases, esterases and peroxidases within the leaf extracts. The peach cultivars analyzed have showed low isoenzymatic

  16. Purification, identification and preliminary crystallographic studies of Pru du amandin, an allergenic protein from Prunus dulcis

    Energy Technology Data Exchange (ETDEWEB)

    Gaur, Vineet; Sethi, Dhruv K.; Salunke, Dinakar M., E-mail: dinakar@nii.res.in [National Institute of Immunology, Aruna Asaf Ali Marg, New Delhi 110 067 (India)

    2008-01-01

    The purification, identification, crystallization and preliminary crystallographic studies of an allergy-related protein, Pru du amandin, from P. dulcis nuts are reported. Food allergies appear to be one of the foremost causes of hypersensitivity reactions. Nut allergies account for most food allergies and are often permanent. The 360 kDa hexameric protein Pru du amandin, a known allergen, was purified from almonds (Prunus dulcis) by ammonium sulfate fractionation and ion-exchange chromatography. The protein was identified by a BLAST homology search against the nonredundant sequence database. Pru du amandin belongs to the 11S legumin family of seed storage proteins characterized by the presence of a cupin motif. Crystals were obtained by the hanging-drop vapour-diffusion method. The crystals belong to space group P4{sub 1} (or P4{sub 3}), with unit-cell parameters a = b = 150.7, c = 164.9 Å.

  17. Comparative effects of prolonged administration of cyanide, thiocyanate and chokecherry (Prunus virginiana) to goats.

    Science.gov (United States)

    Soto-Blanco, B; Stegelmeier, B L; Pfister, J A; Gardner, D R; Panter, K E

    2008-04-01

    The aim of the present study was to determine and compare the clinical, hematological, biochemical and histopathological changes induced by cyanide, thiocyanate and chokecherry (Prunus virginiana) in goats. Sixteen Boer-Spanish cross-bred female goats were divided into four treatment groups: (1) control, (2) potassium cyanide (KCN) at 3.8 mg kg(-1) day(-1), (3) potassium thiocyanate (KSCN) at 4.5 mg kg(-1) day(-1) and (4) ground frozen chokecherry leaves and flowers at a target dose of 2.5 mg HCN kg(-1) day(-1), all for 4 weeks. Clinical signs were observed in two goats treated with chokecherry. Only sporadic changes were found in the hematological and blood chemical panel. Goats treated with chokecherry and thiocyanate had an increased number of vacuoles in the colloid of thyroid glands. Spongiosis and spheroids were found in the mesencephalon from goats treated with KCN and chokecherry. These findings suggest the thyroid lesions can be attributed to thiocyanate, whereas the effects on the nervous system were most likely caused by cyanide.

  18. Vertical transmission of Prunus necrotic ringspot virus: hitch-hiking from gametes to seedling.

    Science.gov (United States)

    Amari, Khalid; Burgos, Lorenzo; Pallás, Vicente; Sánchez-Pina, Maria Amelia

    2009-07-01

    The aim of this work was to follow Prunus necrotic ringspot virus (PNRSV) infection in apricot reproductive tissues and transmission of the virus to the next generation. For this, an analysis of viral distribution in apricot reproductive organs was carried out at different developmental stages. PNRSV was detected in reproductive tissues during gametogenesis. The virus was always present in the nucellus and, in some cases, in the embryo sac. Studies within infected seeds at the embryo globular stage revealed that PNRSV infects all parts of the seed, including embryo, endosperm and testa. In the torpedo and bent cotyledon developmental stages, high concentrations of the virus were detected in the testa and endosperm. At seed maturity, PNRSV accumulated slightly more in the embryo than in the cotyledons. In situ hybridization showed the presence of PNRSV RNA in embryos obtained following hand-pollination of virus-free pistils with infected pollen. Interestingly, tissue-printing from fruits obtained from these pistils showed viral RNA in the periphery of the fruits, whereas crosses between infected pistils and infected pollen resulted in a total invasion of the fruits. Taken together, these results shed light on the vertical transmission of PNRSV from gametes to seedlings.

  19. Recent advancements to study flowering time in almond and other Prunus species.

    Science.gov (United States)

    Sánchez-Pérez, Raquel; Del Cueto, Jorge; Dicenta, Federico; Martínez-Gómez, Pedro

    2014-01-01

    Flowering time is an important agronomic trait in almond since it is decisive to avoid the late frosts that affect production in early flowering cultivars. Evaluation of this complex trait is a long process because of the prolonged juvenile period of trees and the influence of environmental conditions affecting gene expression year by year. Consequently, flowering time has to be studied for several years to have statistical significant results. This trait is the result of the interaction between chilling and heat requirements. Flowering time is a polygenic trait with high heritability, although a major gene Late blooming (Lb) was described in "Tardy Nonpareil." Molecular studies at DNA level confirmed this polygenic nature identifying several genome regions (Quantitative Trait Loci, QTL) involved. Studies about regulation of gene expression are scarcer although several transcription factors have been described as responsible for flowering time. From the metabolomic point of view, the integrated analysis of the mechanisms of accumulation of cyanogenic glucosides and flowering regulation through transcription factors open new possibilities in the analysis of this complex trait in almond and in other Prunus species (apricot, cherry, peach, plum). New opportunities are arising from the integration of recent advancements including phenotypic, genetic, genomic, transcriptomic, and metabolomics studies from the beginning of dormancy until flowering.

  20. Safety and efficacy of a novel Prunus domestica extract (Sitoprin, CR002) on testosterone-induced benign prostatic hyperplasia (BPH) in male Wistar rats.

    Science.gov (United States)

    Swaroop, Anand; Bagchi, Manashi; Kumar, Pawan; Preuss, Harry G; Bagchi, Debasis

    2015-01-01

    The efficacy of a novel Prunus domestica bark extract (Sitoprin, CR002) was investigated on testosterone propionate (TP)-induced benign prostatic hyperplasia (BPH) in male Wistar rats. BPH was induced by daily subcutaneous administration of TP (3.0 mg/kg) over a period of 15 days (interim sacrifice group) and for an additional 21 days (terminal sacrifice group). We evaluated the dose-dependent efficacy (0, 50, 100 and 200 mg/kg body weight/day) of CR002 and a control group against BPH, and compared with a reference standard Prunus africana extract (CR001). Extensive clinical examinations were carried out on days 1, 7, 14, 21, 28 and 35 of treatment period to determine the onset, duration and severity of clinical signs. Clinical pathology, hematology, biochemistry and histopathology were performed on days 15 and 35, prior to necropsy. Animals were fasted overnight prior to blood collection. Prostate glands and tissues were examined. On day 36, histopathology of ventral prostrate of control rats demonstrates single layer of columnar mucin secreting epithelial cells along with a lumen occupied with eosinophilic secretion. In contrast, CR002 and CR001 groups (100 and 200 mg/kg/day) exhibited no hyperplasia and proliferation of epithelial cells. Prostate histopathology of these treated groups was comparable with control rats. The hyperplasia and hypertrophy of prostrate was reduced to single-layered cell indicating the efficacy of CR002 and CR001. Overall, results demonstrate that CR002 exhibits therapeutic efficacy/activity in TP-induced BPH in rats, which is comparable to CR001.

  1. Sweet almond (Prunus amygdalus “dulcis” seeds as a potential feedstock for Nigerian Biodiesel Automotive Project

    Directory of Open Access Journals (Sweden)

    Solomon Giwa

    2014-01-01

    Full Text Available This work presents sweet almond (Prunus amygdalus “dulcis” seed oil (SASO as a non-conventional feedstock for the preparation of biodiesel in Nigeria, rather than the traditional oils of palm, groundnut and palm kernel. SASO was extracted via the solvent method, pretreated to reduce the acid value, and transesterified using methanol (solvent and sodium hydroxide (catalyst. The oil content and acid value of SASO were 51.45 ± 3.92% and 1.07 mg KOH/g, respectively. The fatty acid composition of SASO reveals the predominance of oleic acid (69.7%, linoleic acid (18.2% and palmitic acid (9.3%. Specific fuel properties of sweet almond oil methyl esters (SAOME were determined using standard test methods and were found to satisfy both EN 14214 and ASTM D6751 biodiesel standards; the cold flow properties were particularly outstanding (cloud point; -3ºC and pour point; -9ºC. SASO appears to offer great promise as a potential feedstock for biodiesel production in Nigeria.

  2. Effect of Temperature and Moisture on the Development of Concealed Damage in Raw Almonds (Prunus dulcis).

    Science.gov (United States)

    Rogel-Castillo, Cristian; Zuskov, David; Chan, Bronte Lee; Lee, Jihyun; Huang, Guangwei; Mitchell, Alyson E

    2015-09-23

    Concealed damage (CD) is a brown discoloration of nutmeat that appears only after kernels are treated with moderate heat (e.g., roasting). Identifying factors that promote CD in almonds is of significant interest to the nut industry. Herein, the effect of temperature (35 and 45 °C) and moisture (almonds (Prunus dulcis var. Nonpareil) was studied using HS-SPME-GC/MS. A CIE LCh colorimetric method was developed to identify raw almonds with CD. A significant increase in CD was demonstrated in almonds exposed to moisture (8% kernel moisture content) at 45 °C as compared to 35 °C. Elevated levels of volatiles related to lipid peroxidation and amino acid degradation were observed in almonds with CD. These results suggest that postharvest moisture exposure resulting in an internal kernel moisture ≥ 8% is a key factor in the development of CD in raw almonds and that CD is accelerated by temperature.

  3. The effect of the time of budding of mahaleb cherry (Prunus mahaleb L. seedlings on the quality of maiden trees of sour cherry (Prunus cerasus L. 'Łutówka'

    Directory of Open Access Journals (Sweden)

    Piotr Baryła

    2012-12-01

    Full Text Available The present study was conducted at the Felin Experi- mental Farm, belonging to the University of Life Sciences in Lublin, during the period 2005–2008. The experimental material consisted of maiden trees of sour cherry 'Łutówka' budded on seedlings of mahaleb cherry (Prunus mahaleb L. of unknown origin. The experiment evaluated the effect of four budding times: 15 July, 1 August, 15 August, and 1 September, on the quality of cherry trees in a nursery. The mean for the three years showed that budding time did not have a significant effect on the quality of cherry trees in the nursery. It was observed that the budding of mahaleb cherry performed on the two August dates (1st and 15th had a more beneficial effect on the growth and branching of trees than the budding done on 15 July and 1 September. The quality of maiden cherry trees 'Łutówka' in the nursery was primarily dependent on weather conditions in a given growing season, which is evidenced by the significant differences between production cycles, high variation in the quantitative results in individual years, and the absence of significant differences in the mean for 2006–2008.

  4. Enantioselective Synthesis of Various Cyanohydrins Using Covalently Immobilized Preparations of Hydroxynitrile Lyase from Prunus dulcis.

    Science.gov (United States)

    Alagöz, Dilek; Tükel, S Seyhan; Yildirim, Deniz

    2015-11-01

    The carrier-based and carrier-free (cross-linked enzyme aggregate) covalent immobilizations of Prunus dulcis hydroxynitrile lyase were investigated. The immobilized preparations were tested for enantioselective carbon-carbon bond formation activity in the biphasic medium. Of the tested preparations, only cross-linked enzyme aggregate of P. dulcis hydroxynitrile lyase (PdHNL-CLEA) achieved the synthesis of (R)-mandelonitrile with 93% yield and 99% enantiopurity. PdHNL-CLEA was also used in the synthesis of various (R)-cyanohydrins from corresponding aldehydes/ketones and hydrocyanic acid. When 4-methoxybenzaldehyde, 4-methyl benzaldehyde, and 4-hydroxybenzaldehyde were used as substrates, the yield-enantiomeric excess of corresponding (R)-cyanohydrins were obtained as 95-95, 85-79, and 2-25%, respectively, after 96 h at pH 4.0 and 5 °C. For acetophenone, 4-fluoroacetophenone, 4-chloroacetophenone, 4-bromoacetophenone, and 4-iodoacetophenone, the yield-enantiomeric excess of corresponding (R)-cyanohydrins were 1-99, 20-84, 11-95, 5-99, and 3-24%, respectively at the same conditions. The results demonstrate PdHNL-CLEA can be effectively used in the synthesis of (R)-mandelonitrile.

  5. Pollination Requirements of Almond (Prunus dulcis): Combining Laboratory and Field Experiments.

    Science.gov (United States)

    Henselek, Yuki; Eilers, Elisabeth J; Kremen, Claire; Hendrix, Stephen D; Klein, Alexandra-Maria

    2018-03-08

    Almond (Prunus dulcis (Mill.) D. A. Webb; Rosales: Rosaceae) is a cash crop with an estimated global value of over seven billion U.S. dollars annually and commercial varieties are highly dependent on insect pollination. Therefore, the understanding of basic pollination requirements of the main varieties including pollination efficiency of honey bees (Apis mellifera, Linnaeus, Hymenoptera: Apidae) and wild pollinators is essential for almond production. We first conducted two lab experiments to examine the threshold number of pollen grains needed for successful pollination and to determine if varietal identity or diversity promotes fruit set and weight. Further, we examined stigma and ovules of flowers visited by Apis and non-Apis pollinators in the field to study the proportion of almond to non-almond pollen grains deposited, visitation time per flower visit, and tube set. Results indicate that the threshold for successful fertilization is around 60 pollen grains, but pollen can be from any compatible variety as neither pollen varietal identity nor diversity enhanced fruit set or weight. Andrena cerasifolii Cockerell (Hymenoptera: Andrenidae) was a more effective pollinator on a per single visit basis than Apis and syrphid flies. Nevertheless, Apis was more efficient than A. cerasifolii and syrphid flies as they spent less time on a flower during a single visit. Hence, planting with two compatible varieties and managing for both Apis and non-Apis pollinators is likely to be an optimal strategy for farmers to secure high and stable pollination success.

  6. Aroma peculiarities of apricot (Armeniaca vulgaris Lam. and cherry-plum (Prunus cerasifera Ehrh. flowers

    Directory of Open Access Journals (Sweden)

    В. М. Горіна

    2013-02-01

    Full Text Available In the component composition of volatile solutions determining fragrance of the flowers in apricot and cherry-plum varieties and Prunus brigantiaca Vill. x Armeniaca vulgaris Lam. hybrids there are 36 highest hydrocarbons and benzaldehyde that prevail. There are fewer amounts of the solutions which scare bees (benzaldehyde in the fragrance of cherry-plum varieties as compared to the flowers of apricot and hybrids. At the same time, the content of tricosane, pentacosane, docosane, heneycosane, eicosane, nonadecan that probably attract bees is higher in the cherry-plum flowers than in the fragrance of apricot and hybrid flowers. The average three years yield of cherry-plum plants (Nikitska Zhovta 10,7 and Salgirskaya Rumjanaya 28,5 t/ ha is higher than for apricot (Recolte de Schatene 0,3; Rodnik 2,9; Ananasniy Tsurupinsky 7,4 t/ha and hybrids (8110 – 5,2; 8098 – 6,4 t/ha that could be explained with better pollination of flowers and better fruit formation. Prevailing components of flower aroma of these plants    and their possible link with yield of the objects in questions have been analyzed.

  7. Nutraceutical Value of Black Cherry Prunus serotina Ehrh. Fruits: Antioxidant and Antihypertensive Properties

    Directory of Open Access Journals (Sweden)

    Francisco J. Luna-Vázquez

    2013-11-01

    Full Text Available In Mexico black cherry (Prunus serotina Ehrh. fruits are consumed fresh, dried or prepared in jam. Considering the evidence that has linked intake of fruits and vegetables rich in polyphenols to cardiovascular risk reduction, the aim of this study was to characterize the phenolic profile of black cherry fruits and to determine their antioxidant, vasorelaxant and antihypertensive effects. The proximate composition and mineral contents of these fruits were also assessed. Black cherry fruits possess a high content of phenolic compounds and display a significant antioxidant capacity. High-performance liquid chromatography/mass spectrometric analysis indicated that hyperoside, anthocyanins and chlorogenic acid were the main phenolic compounds found in these fruits. The black cherry aqueous extract elicited a concentration-dependent relaxation of aortic rings and induced a significant reduction on systolic blood pressure in L-NAME induced hypertensive rats after four weeks of treatment. Proximate analysis showed that black cherry fruits have high sugar, protein, and potassium contents. The results derived from this study indicate that black cherry fruits contain phenolic compounds which elicit significant antioxidant and antihypertensive effects. These findings suggest that these fruits might be considered as functional foods useful for the prevention and treatment of cardiovascular diseases.

  8. In Vitro Pollen Viability and Pollen Germination in Cherry Laurel (Prunus laurocerasus L.

    Directory of Open Access Journals (Sweden)

    Melekber Sulusoglu

    2014-01-01

    Full Text Available Pollen quality is important for growers and breeders. This study was carried out to determine in vitro pollen viability and pollen germination in seven genotypes of cherry laurel (Prunus laurocerasus L.. Two pollen viability tests, TTC (2,3,5-triphenyl tetrazolium chloride and IKI (iodine potassium iodide, were used. Pollen traits of genotypes were studied using an in vitro medium containing 0%, 5%, 10%, 15%, and 20% sucrose to determine the best sucrose concentrations for germination. In the second step, the germinated pollen was counted 1, 4, 6, 10, 12, 24, and 48 hours later until there was no further germination. The viability rates were different according to genotypes and tests used. The IKI and TTC staining tests and pollen germination had low correlation (r2 = 0.0614 and r2 = 0.0015, resp.. Painted pollen rate was higher and pollen was well-stained with IKI test and pollen viability estimated with TTC staining test was better than that estimated with the IKI staining test. 15% sucrose gave the best germination rates in most of the genotypes. Pollen germination rates were recorded periodically from one hour to 48 hours in 15% sucrose and the results showed that pollen germination rates increased after 6 hours of being placed in culture media.

  9. In vitro pollen viability and pollen germination in cherry laurel (Prunus laurocerasus L.).

    Science.gov (United States)

    Sulusoglu, Melekber; Cavusoglu, Aysun

    2014-01-01

    Pollen quality is important for growers and breeders. This study was carried out to determine in vitro pollen viability and pollen germination in seven genotypes of cherry laurel (Prunus laurocerasus L.). Two pollen viability tests, TTC (2,3,5-triphenyl tetrazolium chloride) and IKI (iodine potassium iodide), were used. Pollen traits of genotypes were studied using an in vitro medium containing 0%, 5%, 10%, 15%, and 20% sucrose to determine the best sucrose concentrations for germination. In the second step, the germinated pollen was counted 1, 4, 6, 10, 12, 24, and 48 hours later until there was no further germination. The viability rates were different according to genotypes and tests used. The IKI and TTC staining tests and pollen germination had low correlation (r(2) = 0.0614 and r(2) = 0.0015, resp.). Painted pollen rate was higher and pollen was well-stained with IKI test and pollen viability estimated with TTC staining test was better than that estimated with the IKI staining test. 15% sucrose gave the best germination rates in most of the genotypes. Pollen germination rates were recorded periodically from one hour to 48 hours in 15% sucrose and the results showed that pollen germination rates increased after 6 hours of being placed in culture media.

  10. Predicción científica y prescripción en mejora genética vegetal en cuanto Ciencia Aplicada de Diseño: El caso de la mejora de frutales del género Prunus

    Directory of Open Access Journals (Sweden)

    Pedro Martínez-Gómez

    2017-01-01

    Full Text Available La mejora genética vegetal tiene una doble índole científica: Ciencia Empírica de la Naturaleza y Ciencia Aplicada de Diseño. En este contexto el presente trabajo pretende indagar en la predicción científica como rasgo esencial de esta disciplina en cuanto Ciencia Aplicada de Diseño con especial referencia la mejora de frutales de hueso (del género Prunus. En mejora genética vegetal podemos hablar de tres niveles de conocimiento asociados a la biología molecular (nivel micro, la constitución genética de un individuo (nivel meso y al fenotipo o aspecto global de la nueva variedad (nivel macro, que afectan tanto a los tipos de predicción como a las metodologías a aplicar. La predicción constituye el objetivo principal de la mejora genética como Ciencia de Diseño. Es clave tener un conocimiento del futuro posible para poder hacer un nuevo diseño que estará completo al cabo de algunos años, más de 12 años en el caso de los frutales de hueso que es el objeto de este trabajo. Asimismo, es necesario tener en cuenta en el desarrollo de esta predicción científica aplicada a la mejora de Prunus diversas variables internas (la naturaleza genética del material vegetal de partida, las metodologías disponibles, etc. y externas (la aceptación social, los factores medioambientales, los estreses bióticos y abióticos, etc. a la hora de llevar a cabo esta predicción. El grado de conocimiento de estas variables determinará la calidad de la predicción en el diseño de nuevas variedades de Prunus.

  11. Aplicação pré-colheita de reguladores vegetais visando retardar a maturação de ameixas 'Laetitia' Preharvest spraying with plant regulators aiming fruit maturity delay of 'Laetitia' plums

    Directory of Open Access Journals (Sweden)

    Cristiano André Steffens

    2009-08-01

    Full Text Available O objetivo deste trabalho foi avaliar os efeitos de reguladores vegetais e da data de colheita sobre a maturação de ameixas 'Laetitia'. Os tratamentos avaliados foram: controle, aminoetoxivinilglicina (AVG; 125mg L-1, 1-metilciclopropeno (1-MCP; 70µg L-1 e ácido giberélico (GA3; 100mg.L-1, em combinação com duas datas de colheita (11/01/2007 e 25/01/2007. O GA3 foi aplicado 14 dias antes da primeira colheita, enquanto AVG e 1-MCP foram aplicados sete dias antes da primeira colheita. O experimento seguiu o delineamento em blocos ao acaso com quatro repetições. Os reguladores de crescimento, em geral, retardaram as alterações da cor da epiderme e mantiveram a textura dos frutos, com os maiores valores de resistências à compressão e à penetração de polpa. A força necessária para a ruptura da epiderme foi maior no tratamento com 1-MCP. O tratamento controle apresentou os maiores teores de sólidos solúveis (SS. O atraso na colheita reduziu a textura dos frutos, a acidez titulável e o teor de SS, mas proporcionou frutos mais vermelhos. No entanto, nos frutos tratados com os reguladores, a evolução da maturação foi retardada.The objective this research was to evaluate the effects of preharvest spraying with plant regulators and harvest date on the fruit maturity of 'Laetitia' plums. The treatments evaluated were: control (untreated, aminoethoxyvinylglycine [AVG; at 125mg (a.i. L-1], giberellic acid [GA3; at 100mg (a.i. L-1] and 1-Methylcyclopropene [1-MCP; at 70µg (a.i. L-1], combined with two harvest dates (01/11/2007 and 01/25/2007. The GA3 was sprayed 14 days before the first harvest, while AVG and 1-MCP were sprayed 7 days before the first harvest. The experiment followed the randomized block design with four replications. In general, the plant regulators delayed changes in skin color and preserved fruit texture, providing the highest resistances values for flesh compression and fresh penetration. The force for skin

  12. Environ: E00442 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available E00442 Prunus humilis, Prunus japonica seed Crude drug ... Prunus humilis [TAX:434060], Prunus jap...onica [TAX:97319] ... Rosaceae (rose family) Prunus humilis, Prunus japonica mature seed (dried) ...

  13. Enhancing the polyphenol content of a red-fleshed Japanese plum (Prunus salicina Lindl.) nectar by incorporating a polyphenol-rich extract from the skins.

    Science.gov (United States)

    de Beer, Dalene; Steyn, Naomi; Joubert, Elizabeth; Muller, Nina

    2012-10-01

    Plum skins are a waste product generated during production of plum juice or pulp. Polyphenols, shown to have various health-promoting properties, can be recovered from this waste product. Red-fleshed plum nectar formulations containing plum skin extract in varying amounts were characterised in terms of intensity of sensory attributes, consumer acceptability, colour, polyphenol content and antioxidant activity. Commercial beverages containing red fruits were used as benchmarks. The polyphenolic profile of the plum skin extract was similar to that of the pulp, including anthocyanins, flavonols, flavan-3-ols and a phenolic acid. Addition of the extract to plum nectar, which enhanced the colour, polyphenol content and antioxidant capacity, was limited by its negative sensory impact. The formulations were deemed acceptable by consumers, although a decrease in positive sensory attributes (plum flavour, plum aroma and sweetness) and an increase in negative sensory attributes (plant-like flavour, plant-like aroma, acidity and astringency) were observed with increasing skin extract content. The formulations compared favourably with commercial beverages in terms of colour total polyphenol content and antioxidant activity. Plum skins were successfully used to enhance the functional status of plum nectar. Use of a functional ingredient from plum skins is, therefore, a feasible value-addition strategy. Copyright © 2012 Society of Chemical Industry.

  14. Manejo y síndromes de domesticación del capulín (Prunus serotina Ehrh ssp. capuli (Cav.) Mc Vaugh) en comunidades del estado de Tlaxcala

    OpenAIRE

    Avendaño-Gómez, Aidé; Lira-Saade, Rafael; Madrigal-Calle, Beatriz; García-Moya, Edmundo; Soto-Hernández, Marcos; Romo de Vivar-Romo, Alfonso

    2015-01-01

    Existen alrededor de 5000 a 7000 especies de plantas en México en estados evolutivos tempranos e intermedios hasta llegar a los domesticados y un ejemplo es el capulín (Prunus serótina Ehrh ssp. capuli (Cav.) Mc Vaugh) clasificado como domesticado, pero sin estudios sobre los mecanismos de selección e intervención que lo llevaron a este grado de manejo. Por lo tanto, el objetivo de este estudio fue describir aspectos etnobotánicos relacionados con el uso, reconocimiento de la variación y el m...

  15. Genome-wide analysis of the GRAS gene family in Prunus mume.

    Science.gov (United States)

    Lu, Jiuxing; Wang, Tao; Xu, Zongda; Sun, Lidan; Zhang, Qixiang

    2015-02-01

    Prunus mume is an ornamental flower and fruit tree in Rosaceae. We investigated the GRAS gene family to improve the breeding and cultivation of P. mume and other Rosaceae fruit trees. The GRAS gene family encodes transcriptional regulators that have diverse functions in plant growth and development, such as gibberellin and phytochrome A signal transduction, root radial patterning, and axillary meristem formation and gametogenesis in the P. mume genome. Despite the important roles of these genes in plant growth regulation, no findings on the GRAS genes of P. mume have been reported. In this study, we discerned phylogenetic relationships of P. mume GRAS genes, and their locations, structures in the genome and expression levels of different tissues. Out of 46 identified GRAS genes, 45 were located on the 8 P. mume chromosomes. Phylogenetic results showed that these genes could be classified into 11 groups. We found that Group X was P. mume-specific, and three genes of Group IX clustered with the rice-specific gene Os4. We speculated that these genes existed before the divergence of dicotyledons and monocotyledons and were lost in Arabidopsis. Tissue expression analysis indicated that 13 genes showed high expression levels in roots, stems, leaves, flowers and fruits, and were related to plant growth and development. Functional analysis of 24 GRAS genes and an orthologous relationship analysis indicated that many functioned during plant growth and flower and fruit development. Our bioinformatics analysis provides valuable information to improve the economic, agronomic and ecological benefits of P. mume and other Rosaceae fruit trees.

  16. A remarkable synergistic effect at the transcriptomic level in peach fruits doubly infected by prunus necrotic ringspot virus and peach latent mosaic viroid.

    Science.gov (United States)

    Herranz, Mari Carmen; Niehl, Annette; Rosales, Marlene; Fiore, Nicola; Zamorano, Alan; Granell, Antonio; Pallas, Vicente

    2013-05-28

    Microarray profiling is a powerful technique to investigate expression changes of large amounts of genes in response to specific environmental conditions. The majority of the studies investigating gene expression changes in virus-infected plants are limited to interactions between a virus and a model host plant, which usually is Arabidopsis thaliana or Nicotiana benthamiana. In the present work, we performed microarray profiling to explore changes in the expression profile of field-grown Prunus persica (peach) originating from Chile upon single and double infection with Prunus necrotic ringspot virus (PNRSV) and Peach latent mosaic viroid (PLMVd), worldwide natural pathogens of peach trees. Upon single PLMVd or PNRSV infection, the number of statistically significant gene expression changes was relatively low. By contrast, doubly-infected fruits presented a high number of differentially regulated genes. Among these, down-regulated genes were prevalent. Functional categorization of the gene expression changes upon double PLMVd and PNRSV infection revealed protein modification and degradation as the functional category with the highest percentage of repressed genes whereas induced genes encoded mainly proteins related to phosphate, C-compound and carbohydrate metabolism and also protein modification. Overrepresentation analysis upon double infection with PLMVd and PNRSV revealed specific functional categories over- and underrepresented among the repressed genes indicating active counter-defense mechanisms of the pathogens during infection. Our results identify a novel synergistic effect of PLMVd and PNRSV on the transcriptome of peach fruits. We demonstrate that mixed infections, which occur frequently in field conditions, result in a more complex transcriptional response than that observed in single infections. Thus, our data demonstrate for the first time that the simultaneous infection of a viroid and a plant virus synergistically affect the host transcriptome in

  17. Evaluation of apricot (Prunus armeniaca L.) seed kernel as a potential feedstock for the production of liquid bio-fuels and activated carbons

    International Nuclear Information System (INIS)

    Fadhil, Abdelrahman B.

    2017-01-01

    Highlights: • Apricot (Prunus armeniaca L.) is presented as a source for biodiesel, bio-oil and activated carbon. • Methylic and ethylic esters of apricot seed kernel oil conformed to ASTM (D6751) standards. • High yield (43.66% w/w) of bio-oil was produced by pyrolysis of de-oiled seed kernel. • High quality of activated carbon was obtained from the biochar. - Abstract: Production of liquid bio-fuels (biodiesel and bio-oil) as well as activated carbon from one non-edible feedstock, apricot (Prunus armeniaca L.) seed kernel was the main objective of the present research work. The oil was extracted from apricot seed kernel with a yield of 49.44% w/w of kernels. Potassium hydroxide-catalyzed transesterification of apricot (Prunus armeniaca L.) seed kernel oil with methanol and ethanol was then applied to produce methylic and ethylic, respectively. Properties of the obtained biodiesels were evaluated and found conformed to ASTM D 6751 limits. The apricot de-oiled seed kernel was pyrolyzed in a semi-batch reactor for bio-oil production. The effect of the pyrolysis temperatures (350, 400, 450, 500, 550 and 600 °C), pyrolysis time (30, 60, 90, 120 and 150 min) and feed particles size (0.25, 0.40, 0.59 and 0.84 mm) on the bio-oil yield was investigated. The maximum production of bio-oil (43.66% w/w) was achieved at a pyrolysis temperature of 450 °C, 60 min pyrolysis time and a feed particles size of 0.25 mm. The bio-oil obtained under the optimal conditions was characterized by the elemental analysis, FTIR spectroscopy and column chromatography. The FTIR analysis of the produced bio-fuel indicated that it composes mainly of alkanes, alkenes, ketones, carboxylic acids and amines. Properties of the resulting bio-oil were analyzed in terms of calorific value, density, flash point, pH, acid value, pour point and refractive index. The properties were close to those of petroleum fractions and comparable to those of other bio-oils published in literature. Referring to

  18. Differentiation of closely related but biologically distinct cherry isolates of Prunus necrotic ringspot virus by polymerase chain reaction.

    Science.gov (United States)

    Hammond, R W; Crosslin, J M; Pasini, R; Howell, W E; Mink, G I

    1999-07-01

    Prunus necrotic ringspot ilarvirus (PNRSV) exists as a number of biologically distinct variants which differ in host specificity, serology, and pathology. Previous nucleotide sequence alignment and phylogenetic analysis of cloned reverse transcription-polymerase chain reaction (RT-PCR) products of several biologically distinct sweet cherry isolates revealed correlations between symptom type and the nucleotide and amino acid sequences of the 3a (putative movement protein) and 3b (coat protein) open reading frames. Based upon this analysis, RT-PCR assays have been developed that can identify isolates displaying different symptoms and serotypes. The incorporation of primers in a multiplex PCR protocol permits rapid detection and discrimination among the strains. The results of PCR amplification using type-specific primers that amplify a portion of the coat protein gene demonstrate that the primer-selection procedure developed for PNRSV constitutes a reliable method of viral strain discrimination in cherry for disease control and will also be useful for examining biological diversity within the PNRSV virus group.

  19. Synthesis of disaccharides using β-glucosidases from Aspergillus niger, A. awamori and Prunus dulcis.

    Science.gov (United States)

    da Silva, Ayla Sant'Ana; Molina, Javier Freddy; Teixeira, Ricardo Sposina Sobral; Valdivieso Gelves, Luis G; Bon, Elba P S; Ferreira-Leitão, Viridiana S

    2017-11-01

    Glucose conversion into disaccharides was performed with β-glucosidases from Prunus dulcis (β-Pd), Aspergillus niger (β-An) and A. awamori (β-Aa), in reactions containing initial glucose of 700 and 900 g l -1 . The reactions' time courses were followed regarding glucose and product concentrations. In all cases, there was a predominant formation of gentiobiose over cellobiose and also of oligosaccharides with a higher molecular mass. For reactions containing 700 g glucose l -1 , the final substrate conversions were 33, 38, and 23.5% for β-An, β-Aa, and β-Pd, respectively. The use of β-An yielded 103 g gentiobiose l -1 (15.5% yield), which is the highest reported for a fungal β-glucosidase. The increase in glucose concentration to 900 g l -1 resulted in a significant increase in disaccharide synthesis by β-Pd, reaching 128 g gentiobiose l -1 (15% yield), while for β-An and β-Aa, there was a shift toward the synthesis of higher oligosaccharides. β-Pd and the fungal β-An and β-Aa β-glucosidases present quite dissimilar kinetics and selective properties regarding the synthesis of disaccharides; while β-Pd showed the highest productivity for gentiobiose synthesis, β-An presented the highest specificity.

  20. Selection of autochthonous sour cherry (Prunus cerasus L. genotypes in Feketić region

    Directory of Open Access Journals (Sweden)

    Radičević Sanja

    2012-01-01

    Full Text Available Autochthonous genotypes of fruit species are very important source of genetic variability and valuable material for breeding work. Fruit Research Institute-Čačak has a long tradition of studying autochthonous genotypes of temperate fruits sporadically spread and preserved in some localities in Serbia. Over 2005-2006, the following properties of nine autochthonous sour cherry genotypes grown in Feketic region were investigated: flowering and ripening time, pomological properties, biochemical composition of fruits and field resistance to causal agents of cherry diseases - cherry leaf spot (Blumeriella jaapii (Rehm. v. Arx., shot-hole (Clasterosporium carpophilum (Lév. Aderh. and brown rot (Monilinia laxa /Ader et Ruhl./ Honey ex Whetz.. The genotypes were tested for the presence of Prune dwarf virus and Prunus necrotic ring spot virus. In majority of genotypes fruits were large, with exceptional organoleptical properties, whereas ripening time was in the first ten or twenty days of June. The highest fruit weight was observed in F-1 genotype (8.1 g. The highest soluble solids and total sugars content were found in F- 4 genotype (17.60% and 14.25%, respectively. As for field resistance to causal agents of diseases and good pomo-technological properties, F-1, F-2, F-3, F-7 and F-8 genotypes were singled out. [Projekat Ministarstva nauke Republike Srbije, br. TR31064

  1. Chemical characterization and thermal properties of kernel oils from Tunisian peach and nectarine varieties of Prunus persica

    International Nuclear Information System (INIS)

    Chamli, D.; Bootello, M.A.; Bouali, I.; Jouhri, S.; Boukhchina, S.; Martínez-Force, S.

    2017-01-01

    A comparative study was conducted to determine the fatty acids, triacylglycerol compositions and thermal properties of Tunisian kernel oils from the Prunus persica varieties, peach and nectarine, grown in two areas of Tunisia, Gabes and Morneg. Qualitatively, the fatty acids composition and triacylglycerol species were identical for all samples. Oleic acid (67.7-75.0%) was the main fatty acid, followed by linoleic (15.7-22.1%) and palmitic (5.6-6.3%) acids. The major triacylglycerol species were triolein, OOO (38.4-50.5%), followed by OOL (18.2-23.2%), POO (8.3-9.7%) and OLL (6.3-10.1%). The thermal profiles were highly influenced by the high content of triolein due to the importance of oleic acid in these oils. Moreover, the fatty acids distribution in TAG external positions was determined as corresponding to an α asymmetry coefficient that was between 0.10 and 0.12, indicating a high asymmetry in the distribution of saturated fatty acids in the position sn-1 and sn-3 in the TAG species of all samples. [es

  2. Chemical characterization and thermal properties of kernel oils from Tunisian peach and nectarine varieties of Prunus persica

    Directory of Open Access Journals (Sweden)

    D. Chamli

    2017-09-01

    Full Text Available A comparative study was conducted to determine the fatty acids, triacylglycerol compositions and thermal properties of Tunisian kernel oils from the Prunus persica varieties, peach and nectarine, grown in two areas of Tunisia, Gabes and Morneg. Qualitatively, the fatty acids composition and triacylglycerol species were identical for all samples. Oleic acid (67.7-75.0% was the main fatty acid, followed by linoleic (15.7-22.1% and palmitic (5.6-6.3% acids. The major triacylglycerol species were triolein, OOO (38.4-50.5%, followed by OOL (18.2-23.2%, POO (8.3-9.7% and OLL (6.3-10.1%. The thermal profiles were highly influenced by the high content of triolein due to the importance of oleic acid in these oils. Moreover, the fatty acids distribution in TAG external positions was determined as corresponding to an α asymmetry coefficient that was between 0.10 and 0.12, indicating a high asymmetry in the distribution of saturated fatty acids in the position sn-1 and sn-3 in the TAG species of all samples.

  3. Plant size and abiotic factors determine the intra-specific variation in the multi-stemmed architecture of Prunus lusitanica in the Northeast limit of its global distribution

    Directory of Open Access Journals (Sweden)

    A. Muñoz Costa

    2013-12-01

    Full Text Available Aim of study: The present work provides novel insights on factors (either intrinsic or extrinsic that trigger sprouting in woody species living at range margins. We aim to explain the inter-individual variability in the multi-stemmed architecture of Prunus lusitanica L., an Iberian evergreen relict tree related to the Tertiary flora.Area of study: Northeastern Mediterranean mountains of the Iberian Peninsula, the Northeast limit of the global distribution of the species.Material and Methods: We gathered data on two modes of vegetative reproduction, basal and layering sprouts, in 288 clumps of Prunus lusitanica from four populations. We modeled and analyzed the effect of environmental factors (topography, canopy cover, soil moisture and disturbances and plant size (diameter at breast height on sprouting by means of Generalized Linear Model and other statistical approaches.Main results: Plant size arises as the principal factor to explain the variability of the numbers of both types of sprouts yet it is not a trigger factor. Natural and anthropogenic disturbances promote basal and layering shoots, while tree canopy is mainly relevant for basal shoots, and slope and soil moisture are significant factors for layering shoots.Research highlights: The multi-stemmed architecture of P. lusitanica at the Northeastern limit of its worldwide distribution is triggered by local environmental factors and disturbances. Each external factor shows different levels of influence on the variability and type of vegetative reproduction yet the intensity of the response is driven by the size of the largest trunk of each clump.Key words: vegetative reproduction; sprouting; disturbances; woody plants; relict tree; subtropical; Iberian Peninsula.

  4. In situ seasonal study of the volatile production of almonds (Prunus dulcis) var. 'Nonpareil' and relationship to navel orangeworm.

    Science.gov (United States)

    Beck, John J; Merrill, Glory B; Higbee, Bradley S; Light, Douglas M; Gee, Wai S

    2009-05-13

    Nonpareil almonds, Prunus dulcis , account for the largest percentage of almond varieties grown in the Central Valley of California. Several studies have investigated the various nonvolatile and volatile components of various plant parts; however, the volatile organic compound (VOC) emission of almonds from a single cultivar has not been studied over the course of a growing season. This aspect is particularly relevant to research concerning the navel orangeworm (NOW), a major insect pest of almonds and other tree nuts. Despite the continued presence of NOW, the identification of particular VOCs and their relationship to NOW have not been addressed. The VOC emission of Nonpareil almonds was collected in situ over the course of a growing season by solid-phase microextraction (SPME). The VOCs (Z)-hex-3-enyl acetate, (Z)-hex-3-enyl butyrate, undecan-2-ol, beta-bourbonene, and tetradecane were present for the majority of the days investigated. Several VOCs exhibited positive electroantennographic signals from male and/or female NOW moths.

  5. 3,4-Dihydroxybenzaldehyde Derived from Prunus mume Seed Inhibits Oxidative Stress and Enhances Estradiol Secretion in Human Ovarian Granulosa Tumor Cells

    International Nuclear Information System (INIS)

    Kono, Ryohei; Nomura, Sachiko; Okuno, Yoshiharu; Nakamura, Misa; Maeno, Akihiro; Kagiya, Tomoko; Tokuda, Akihiko; Inada, Ken-ichi; Matsuno, Akira; Utsunomiya, Tomoko; Utsunomiya, Hirotoshi

    2014-01-01

    Granulosa cells form ovarian follicles and play important roles in the growth and maturation of oocytes. The protection of granulosa cells from cellular injury caused by oxidative stress is an effective therapy for female infertility. We here investigated an effective bioactive compound derived from Prunus mume seed extract that protects granulosa cells from hydrogen peroxide (H 2 O 2 )-induced apoptosis. We detected the bioactive compound, 3,4-dihydroxybenzaldehyde (3,4-DHBA), via bioactivity-guided isolation and found that it inhibited the H 2 O 2 -induced apoptosis of granulosa cells. We also showed that 3,4-DHBA promoted estradiol secretion in granulosa cells and enhanced the mRNA expression levels of steroidogenic factor 1, a promoter of key steroidogenic enzymes. These results suggest that P. mume seed extract may have clinical potential for the prevention and treatment of female infertility

  6. Investigation on the pollen morphology of traditional cultivars of Prunus species in Sicily

    Directory of Open Access Journals (Sweden)

    Anna Geraci

    2012-08-01

    Full Text Available In this study pollen grains of 13 cultivars and 3 rootstocks belonging to 5 species (P. armeniaca, P. domestica, P. dulcis, P. persica, P. avium of the genus Prunus collected from North-East Sicily were examined for the micromorphological characterization through the scanning electron microscopy (SEM. The length of polar axis (P and the equatorial diameter (E of grain, P/E ratio, the length of colpi (C, diameter of perforations (DP and the number of perforations in 25 μm2 (PN, the width of muri (WM, the distance between muri (DM and their number in 25 μm2 (MN, the width of grooves (WG were measured and their variation was compared among studied taxa. Moreover multivariate statistical analysis was carried out to distinguish morphometric information from measured parameters. All pollen grains are trizonocolpate, isopolar, medium-large sized and their shape varies from prolate to perprolate. Regarding outline pollen grains are subtriangular in polar view and elliptic in equatorial view. Exine sculpturing is striate with perforations on grain surface. The arrangement of ridges appears roughly parallel but too sloped (sometimes curved compared to polar axis, or branched and oriented in different directions, or perfectly parallel or more irregular with bifurcated ridges often sinuous. The analyses showed a great variability (particularly in P. domestica cultivars related in some cases to the diversity in the morphological features of the leaves and the fruits of the investigated entities.

  7. Prunus necrotic ringspot virus Early Invasion and Its Effects on Apricot Pollen Grain Performance.

    Science.gov (United States)

    Amari, Khalid; Burgos, Lorenzo; Pallas, Vicente; Sanchez-Pina, María Amelia

    2007-08-01

    ABSTRACT The route of infection and the pattern of distribution of Prunus necrotic ringspot virus (PNRSV) in apricot pollen were studied. PNRSV was detected both within and on the surface of infected pollen grains. The virus invaded pollen during its early developmental stages, being detected in pollen mother cells. It was distributed uniformly within the cytoplasm of uni- and bicellular pollen grains and infected the generative cell. In mature pollen grains, characterized by their triangular shape, the virus was located mainly at the apertures, suggesting that PNRSV distribution follows the same pattern as the cellular components required for pollen tube germination and cell wall tube synthesis. PNRSV also was localized inside pollen tubes, especially in the growth zone. In vitro experiments demonstrated that infection with PNRSV decreases the germination percentage of pollen grains by more than half and delays the growth of pollen tubes by approximately 24 h. However, although PNRSV infection affected apricot pollen grain performance during germination, the presence of the virus did not completely prevent fertilization, because the infected apricot pollen tubes, once germinated, were able to reach the apricot embryo sacs, which, in the climatic conditions of southeastern Spain, mature later than in other climates. Thus, infected pollen still could play an important role in the vertical transmission of PNRSV in apricot.

  8. Propagation of the endangered Azorean cherry Prunus azorica using stem cuttings and air layering

    Directory of Open Access Journals (Sweden)

    MOREIRA, O.

    2009-01-01

    Full Text Available Prunus azorica (Hort. ex Mouillef. Rivas Mart., Lousã, Fern. Prieto, E. Dias, J.C. Costa &C. Aguiar is an endangered tree endemic to the Azores, with an ecological and ornamentalinterest. The objective of this study was to determine the conditions necessary for thesuccessful propagation of P. azorica by stem cuttings and air-layering. Stem cuttingscollected in March with two apical leaf pairs pruned to 1/3 of their leaf area were submittedto different treatments, including a basal split wound, two rooting mixtures, namely, perlite and peat (1:1 or perlite and natural soil (1:1, and dipping of the base in indole-3-butyric acid (IBA solution at four concentrations (0, 2500, 5000 or 7000 mg/L. After eight weeks 75% rooting was achieved with 75 to 88% survival, without addition of IBA and with split wound using both substrate mixtures. Air layering was conducted in June in branches of adult trees with the addition of 0, 2500 or 3000 mg/L of IBA. After 12 months 100%rooting and survival was recorded in all treatments. Our study thus indicates that P. azorica is a taxon amenable for vegetative propagation by stem cuttings and air layering withoutrequiring addition of IBA to induce rooting. Both methods should be used in order to recover natural populations, when seeds are not available or are available in reduced amounts.

  9. Controle da infestação natural de ceratitis capitata (Wied., 1824 (Diptera, Tephritidae em pêssegos(Prunus persica através das radiações gama Control of naturally infested peaches (Prunus persica by mediterranean fruit fly (Ceratitis capitata through the use of gamma radiation

    Directory of Open Access Journals (Sweden)

    V. Arthur

    1993-12-01

    Full Text Available Determinou-se a dose desinfestante de radiações gama para pêssegos, Prunus persica, infestados com larvas da mosca do Mediterrâneo, Ceratitis capitata. Utilizaram-se frutas de procedência conhecida no campo fazendo-se uma amostragem prévia, constatando-se que cada fruta continha em média nove larvas do último ínstar da mosca praga. As frutas foram irradiadas em uma fonte de Cobalto-60 com as seguintes doses de radiação gama: 0 (test., 25, 50, 100, 200, 400, 600, 800, 1000 e 1200 Gy, sob uma taxa de 58 Gy por minuto. Após a irradiação as frutas foram colocadas em câmaras climatizadas com a temperatura variando entre 23 e 27°C e a umidade relativa variando entre 65 e 75%. Aguardou-se que as larvas deixassem as frutas e se transformassem em pupas e adultos. A dose letal para larvas, pelos resultados obtidos no experimento, concluiu-se ser de 600 Gy. A dose letal para pupas provenientes de larvas irradiadas dentro das frutas foi de 50 Gy, impedindo totalmente a emergência de adultos.Determination of the dose of gamma radiation to disinfest peaches, Prunus pérsica infested with larvae of Ceratitis capitata (Wied., 1824 was made. Fruits were collected in the field, each one holding about nine larvae of the last instar of the fruit-fly. The fruits were irradiated with Cobalt-60 gamma radiation source at the following doses: 0 (control, 25, 50, 100, 200, 400, 600, 800, 1000 and 1200 Gy; at a dose rate of 58 Gy per minute. After irradiation the fruits were kept in a climatic chamber with the temperature adjusted between 23 and 27°C, and relative humidity between 65 and 75 percent, until the larvae left the fruits and were transformed into pupae and adults. It was concluded that the lethal dose of gamma radiation for larvae at the last instar, in naturally infested peaches, was 600 Gy and the dose of 50 Gy inhibited completely the emergency of adults.

  10. The molecular variability analysis of the RNA 3 of fifteen isolates of Prunus necrotic ringspot virus sheds light on the minimal requirements for the synthesis of its subgenomic RNA.

    Science.gov (United States)

    Aparicio, Frederic; Pallás, Vicente

    2002-01-01

    The nucleotide sequences of the RNA 3 of fifteen isolates of Prunus necrotic ringspot virus (PNRSV) varying in the symptomatology they cause in six different Prunus spp. were determined. Analysis of the molecular variability has allowed, in addition to study the phylogenetic relationships among them, to evaluate the minimal requirements for the synthesis of the subgenomic RNA in Ilarvirus genus and their comparison to other members of the Bromoviridae family. Computer assisted comparisons led recently to Jaspars (Virus Genes 17, 233-242, 1998) to propose that a hairpin structure in viral minus strand RNA is required for subgenomic promoter activity of viruses from at least two, and possibly all five, genera in the family of Bromoviridae. For PNRSV and Apple mosaic virus two stable hairpins were proposed whereas for the rest of Ilarviruses and the other four genera of the Bromoviridae family only one stable hairpin was predicted. Comparative analysis of this region among the fifteen PNRSV isolates characterized in this study revealed that two of them showed a 12-nt deletion that led to the disappearance of the most proximal hairpin to the initiation site. Interestingly, the only hairpin found in these two isolates is very similar in primary and secondary structure to the one previously shown in Brome mosaic virus to be required for the synthesis of the subgenomic RNA. In this hairpin, the molecular diversity was concentrated mostly at the loop whereas compensatory mutations were observed at the base of the stem strongly suggesting its functional relevance. The evolutionary implications of these observations are discussed.

  11. Prunus mume leaf extract lowers blood glucose level in diabetic mice.

    Science.gov (United States)

    Lee, Min Woo; Kwon, Jung Eun; Lee, Young-Jong; Jeong, Yong Joon; Kim, Inhye; Cho, Young Mi; Kim, Yong-Min; Kang, Se Chan

    2016-10-01

    Context Diabetes is a common metabolic disease with long-term complications. Prunus mume Sieb. et Zucc. (Rosaceae) fruits have shown to ameliorate glucose intolerance. However, the antidiabetic effects of P. mume leaves have not been investigated. Objective This study evaluated the effects of P. mume leaf 70% ethanol extract (PMLE) on alleviating diabetes in vivo and in vitro. Materials and methods PMLE was fractionated into n-hexane, dichloromethane (CH2Cl2), ethyl acetate (EtOAc), n-butanol (BuOH) and water. Polyphenol and flavonoid contents in PMLE fractions were determined using Folin-Ciocalteu reagent and the aluminium chloride colorimetric method, respectively. We evaluated α-glucosidase inhibition using a microplate reader at 400 nm. Adipocyte differentiation by lipid accumulation was measured using Nile Red staining. Male imprinting control region (ICR) mice were injected with streptozotocin (STZ, 100 mg/kg, i.p.). High-fat diets were provided for three weeks prior to PMLE treatments to induce type 2 diabetes. PMLE (0, 5, 25 or 50 mg/kg) was administrated for four weeks with high-fat diets. Results The EtOAc fraction of PMLE inhibited α-glucosidase activity (IC50 = 68.2 μg/mL) and contained 883.5 ± 14.9 mg/g of polyphenols and 820.1 ± 7.7 mg/g of flavonoids. The 50 mg/kg PMLE supplement reduced 40% of blood glucose level compared to obese/diabetes mice. Obese/diabetic mice treated with 50 mg/kg PMLE showed a lower level of triacylglycerol (320.7 ± 20.73 mg/dL) compared to obese/diabetes mice (494.9 ± 14.80 mg/dL). Conclusion The data demonstrate that P. mume leaves exert antidiabetic effects that may be attributable to high concentrations of polyphenols and flavonoids.

  12. Towards further understanding on the antioxidative activities of Prunus persica fruit: A comparative study with four different fractions

    Science.gov (United States)

    Dhingra, Naveen; Sharma, Rajesh; Kar, Anand

    2014-11-01

    In the present study we have evaluated the antioxidant activities of different fractions (hexane, ethyl acetate, n-butanol and aqueous fractions) of Prunus persica fruit. For extraction simple warring blender method was employed and total phenolic and flavonoid contents were correlated with different antioxidant activities (total antioxidant, 2,2-diphenyl-1-picrylhydrazyl (DPPH), H2O2 scavenging, superoxide radical scavenging, iron chelating and their reducing power properties). Different in vitro antioxidant studies showed that ethyl acetate and n-butanol fractions had the maximum activities that were well correlated with total phenolic and flavonoid contents. Maximum yield (25.14 ± 2.2%) was obtained in its aqueous fraction. Both ethyl acetate and n-butanol fractions showed significant inhibitory effects on different antioxidant activities. A significantly high correlation coefficient existed between total antioxidant activities and with total phenolic as well as total flavonoid contents. It appears that ethyl acetate and n-butanol fractions of P. persica may serve as new potential sources of natural antioxidants and could be of therapeutic use in treating several diseases.

  13. In vitro and in vivo mapping of the Prunus necrotic ringspot virus coat protein C-terminal dimerization domain by bimolecular fluorescence complementation.

    Science.gov (United States)

    Aparicio, Frederic; Sánchez-Navarro, Jesús A; Pallás, Vicente

    2006-06-01

    Interactions between viral proteins are critical for virus viability. Bimolecular fluorescent complementation (BiFC) technique determines protein interactions in real-time under almost normal physiological conditions. The coat protein (CP) of Prunus necrotic ringspot virus is required for multiple functions in its replication cycle. In this study, the region involved in CP dimerization has been mapped by BiFC in both bacteria and plant tissue. Full-length and C-terminal deleted forms of the CP gene were fused in-frame to the N- and C-terminal fragments of the yellow fluorescent protein. The BiFC analysis showed that a domain located between residues 9 and 27 from the C-end plays a critical role in dimerization. The importance of this C-terminal region in dimer formation and the applicability of the BiFC technique to analyse viral protein interactions are discussed.

  14. Recognition of cis-acting sequences in RNA 3 of Prunus necrotic ringspot virus by the replicase of Alfalfa mosaic virus.

    Science.gov (United States)

    Aparicio, F; Sánchez-Navarro, J A; Olsthoorn, R C; Pallás, V; Bol, J F

    2001-04-01

    Alfalfa mosaic virus (AMV) and Prunus necrotic ringspot virus (PNRSV) belong to the genera ALFAMOVIRUS: and ILARVIRUS:, respectively, of the family BROMOVIRIDAE: Initiation of infection by AMV and PNRSV requires binding of a few molecules of coat protein (CP) to the 3' termini of the inoculum RNAs and the CPs of the two viruses are interchangeable in this early step of the replication cycle. CIS:-acting sequences in PNRSV RNA 3 that are recognized by the AMV replicase were studied in in vitro replicase assays and by inoculation of AMV-PNRSV RNA 3 chimeras to tobacco plants and protoplasts transformed with the AMV replicase genes (P12 plants). The results showed that the AMV replicase recognized the promoter for minus-strand RNA synthesis in PNRSV RNA 3 but not the promoter for plus-strand RNA synthesis. A chimeric RNA with PNRSV movement protein and CP genes accumulated in tobacco, which is a non-host for PNRSV.

  15. Molecular adaptation within the coat protein-encoding gene of Tunisian almond isolates of Prunus necrotic ringspot virus.

    Science.gov (United States)

    Boulila, Moncef; Ben Tiba, Sawssen; Jilani, Saoussen

    2013-04-01

    The sequence alignments of five Tunisian isolates of Prunus necrotic ringspot virus (PNRSV) were searched for evidence of recombination and diversifying selection. Since failing to account for recombination can elevate the false positive error rate in positive selection inference, a genetic algorithm (GARD) was used first and led to the detection of potential recombination events in the coat protein-encoding gene of that virus. The Recco algorithm confirmed these results by identifying, additionally, the potential recombinants. For neutrality testing and evaluation of nucleotide polymorphism in PNRSV CP gene, Tajima's D, and Fu and Li's D and F statistical tests were used. About selection inference, eight algorithms (SLAC, FEL, IFEL, REL, FUBAR, MEME, PARRIS, and GA branch) incorporated in HyPhy package were utilized to assess the selection pressure exerted on the expression of PNRSV capsid. Inferred phylogenies pointed out, in addition to the three classical groups (PE-5, PV-32, and PV-96), the delineation of a fourth cluster having the new proposed designation SW6, and a fifth clade comprising four Tunisian PNRSV isolates which underwent recombination and selective pressure and to which the name Tunisian outgroup was allocated.

  16. The Anti-Inflammatory Effect of Prunus yedoensis Bark Extract on Adipose Tissue in Diet-Induced Obese Mice

    Directory of Open Access Journals (Sweden)

    Hee Kang

    2015-01-01

    Full Text Available Chronic, low-grade inflammatory responses occur in obese adipose tissue and play a crucial role in the development of insulin resistance. Macrophages exposed to high glucose upregulate the expression of SRA, a macrophage-specific scavenger receptor. The present study investigated whether Prunus yedoensis (PY bark extract affects the inflammatory response and scavenger receptor gene expression observed in a diet-induced obesity model in vivo. Oral administration of PY extract significantly reduced fasting blood glucose levels without a change in body weight in mice fed a high fat diet for 17 weeks. PY extract significantly suppressed expression of inflammatory and macrophage genes such as tumor necrosis factor-α, interleukin-6, and F4/80 in epididymal adipose tissue. Among scavenger receptor genes, SRA expression was significantly reduced. The inhibitory responses of PY extract and its fractions were determined through evaluation of scavenger receptor expression in THP-1 cells. PY extract and its ethyl acetate fraction decreased the levels of SRA mRNA and phospho-ERK1/2 during monocyte differentiation. Our data indicate that the anti-inflammatory effects of PY extract and its downregulation of SRA seem to account for its hypoglycemic effects.

  17. MULTIPLICAÇÃO IN VITRO DE PORTA-ENXERTOS DO GÊNERO PRUNUS SOB DIFERENTES CONCENTRAÇÕES DE BAP EM DOIS MEIOS DE CULTURA IN VITRO MULTIPLICATION OF PRUNUS ROOTSTOCKS IN DIFFERENT BAP CONCENTRATIONS IN TWO CULTURE MEDIA

    Directory of Open Access Journals (Sweden)

    CARLOS AUGUSTO POSSER SILVEIRA

    2001-12-01

    Full Text Available Este trabalho teve como objetivo determinar a melhor concentração de BAP (6-benzilaminopurina e meio de cultura para a multiplicação in vitro de porta-enxertos de Prunus sp., recentemente introduzidos no Brasil. Os porta-enxertos G x N22, GF 677, Mr.S 2/5, Marianna e Mirabolano foram testados em dois meios de cultura, meio MS e meio MS ¾ (reduzido em 25% dos sais do meio inteiro, combinados com quatro concentrações da citocinina BAP: 0,1; 0,3; 0,5 e 0,7 mg.L-1. Observou-se que os genótipos apresentaram comportamentos diferentes entre si em relação às concentrações de BAP e aos meios. Concluiu-se que, para os porta-enxertos G x N22 e Mr.S 2/5, o melhor meio de multiplicação é o MS ¾ com BAP na concentração de 0,7 mg.L-1; para o porta-enxerto Marianna, o meio MS com BAP na concentração de 0,7 mg.L-1; para o porta-enxerto Mirabolano, o meio MS ¾ com BAP na concentração de 0,5 mg.L-1, sendo que, para este porta-enxerto, o BAP exerce efeito negativo sobre o tamanho das brotações, independentemente do tipo de meio. Já para o porta-enxerto G x N22, este efeito se fez notar apenas no meio MS. O porta-enxerto GF 677 não apresentou bons resultados na propagação in vitro.The purpose of this work was to determine the best BAP concentration and culture media for the in vitro multiplication of Prunus rootstocks starting from nodal segments. The rootstocks G x N22, GF 677, Mr.S 2/5, Marianna and Mirabolano were tested in two culture media (MS and MS ¾ combined with four BAP concentrations (0.1; 0.3; 0.5 and 0.7 mg.L-1. It was observed that the genotypes had different performance as the two media and BAP concentrations are concerned. BAP provided better results in the MS ¾ for the rootstocks G x N22 and Mr.S 2/5. For 'Marianna', the best results were found in the MS at 0.7 mg.L-1 BAP. 'Mirabolano', showed better results in the MS ¾ at 0.5 mg.L-1 BAP and in the two tested media, the shoot length decreased with the increase for

  18. The importance of bee pollination of the sour cherry (Prunus cerasus Cultivar ‘Stevnsbaer’ in Denmark

    Directory of Open Access Journals (Sweden)

    Lise Hansted

    2012-12-01

    Full Text Available Low fruit set, despite normally-developed flowers, is often a significant contributor to poor yield of the self-fertile sour cherry (Prunus cerasus cultivar ‘Stevnsbaer’ in Denmark. The aim of this study was to investigate the effect of insect, and particularly, bee pollination on the fruit set of this cultivar, in order to provide orchard management information for both Danish ‘Stevnsbaer’ growers and beekeepers. Visits to cherry flowers by honey bees (Apis mellifera, Bombus species and solitary bees, were recorded during the flowering of ‘Stevnsbaer’ in five separate Danish orchards. The results indicate that there is a significantly higher fruit set on open pollinated branches when compared to caged branches, where bees and other pollinating insects where excluded. The results were qualitatively consistent over three different seasons (2007, 2009 and 2010. A period of prolonged cold, humid weather before and during early flowering probably reduced fruit set significantly in 2010 compared to 2009. Regarding the apparent benefits of bee pollination on fruit set and subsequent implications for yield, we recommend placing honeybees in ‘Stevnsbaer’ orchards during flowering to sustain commercially viable production. Another valuable management strategy would be to improve foraging and nesting conditions to support both honey and wild bees in and around the orchards.

  19. SEP-class genes in Prunus mume and their likely role in floral organ development.

    Science.gov (United States)

    Zhou, Yuzhen; Xu, Zongda; Yong, Xue; Ahmad, Sagheer; Yang, Weiru; Cheng, Tangren; Wang, Jia; Zhang, Qixiang

    2017-01-13

    Flower phylogenetics and genetically controlled development have been revolutionised during the last two decades. However, some of these evolutionary aspects are still debatable. MADS-box genes are known to play essential role in specifying the floral organogenesis and differentiation in numerous model plants like Petunia hybrida, Arabidopsis thaliana and Antirrhinum majus. SEPALLATA (SEP) genes, belonging to the MADS-box gene family, are members of the ABCDE and quartet models of floral organ development and play a vital role in flower development. However, few studies of the genes in Prunus mume have yet been conducted. In this study, we cloned four PmSEPs and investigated their phylogenetic relationship with other species. Expression pattern analyses and yeast two-hybrid assays of these four genes indicated their involvement in the floral organogenesis with PmSEP4 specifically related to specification of the prolificated flowers in P. mume. It was observed that the flower meristem was specified by PmSEP1 and PmSEP4, the sepal by PmSEP1 and PmSEP4, petals by PmSEP2 and PmSEP3, stamens by PmSEP2 and PmSEP3 and pistils by PmSEP2 and PmSEP3. With the above in mind, flower development in P. mume might be due to an expression of SEP genes. Our findings can provide a foundation for further investigations of the transcriptional factors governing flower development, their molecular mechanisms and genetic basis.

  20. Dual role of imidazole as activator/inhibitor of sweet almond (Prunus dulcis β-glucosidase

    Directory of Open Access Journals (Sweden)

    Sara Caramia

    2017-07-01

    Full Text Available The activity of Prunus dulcis (sweet almond β-glucosidase at the expense of p-nitrophenyl-β-d-glucopyranoside at pH 6 was determined, both under steady-state and pre-steady-state conditions. Using crude enzyme preparations, competitive inhibition by 1–5 mM imidazole was observed under both kinetic conditions tested. However, when imidazole was added to reaction mixtures at 0.125–0.250 mM, we detected a significant enzyme activation. To further inspect this effect exerted by imidazole, β-glucosidase was purified to homogeneity. Two enzyme isoforms were isolated, i.e. a full-length monomer, and a dimer containing a full-length and a truncated subunit. Dimeric β-glucosidase was found to perform much better than the monomeric enzyme, independently of the kinetic conditions used to assay enzyme activity. In addition, the sensitivity towards imidazole was found to differ between the two isoforms. While monomeric enzyme was indeed found to be relatively insensitive to imidazole, dimeric β-glucosidase was observed to be significantly activated by 0.125–0.250 mM imidazole under pre-steady-state conditions. Further, steady-state assays revealed that the addition of 0.125 mM imidazole to reaction mixtures increases the Km of dimeric enzyme from 2.3 to 6.7 mM. The activation of β-glucosidase dimer by imidazole is proposed to be exerted via a conformational transition poising the enzyme towards proficient catalysis.

  1. Dual role of imidazole as activator/inhibitor of sweet almond (Prunus dulcis) β-glucosidase.

    Science.gov (United States)

    Caramia, Sara; Gatius, Angela Gala Morena; Dal Piaz, Fabrizio; Gaja, Denis; Hochkoeppler, Alejandro

    2017-07-01

    The activity of Prunus dulcis (sweet almond) β-glucosidase at the expense of p -nitrophenyl-β-d-glucopyranoside at pH 6 was determined, both under steady-state and pre-steady-state conditions. Using crude enzyme preparations, competitive inhibition by 1-5 mM imidazole was observed under both kinetic conditions tested. However, when imidazole was added to reaction mixtures at 0.125-0.250 mM, we detected a significant enzyme activation. To further inspect this effect exerted by imidazole, β-glucosidase was purified to homogeneity. Two enzyme isoforms were isolated, i.e. a full-length monomer, and a dimer containing a full-length and a truncated subunit. Dimeric β-glucosidase was found to perform much better than the monomeric enzyme, independently of the kinetic conditions used to assay enzyme activity. In addition, the sensitivity towards imidazole was found to differ between the two isoforms. While monomeric enzyme was indeed found to be relatively insensitive to imidazole, dimeric β-glucosidase was observed to be significantly activated by 0.125-0.250 mM imidazole under pre-steady-state conditions. Further, steady-state assays revealed that the addition of 0.125 mM imidazole to reaction mixtures increases the K m of dimeric enzyme from 2.3 to 6.7 mM. The activation of β-glucosidase dimer by imidazole is proposed to be exerted via a conformational transition poising the enzyme towards proficient catalysis.

  2. In vitro evidence for RNA binding properties of the coat protein of prunus necrotic ringspot ilarvirus and their comparison to related and unrelated viruses.

    Science.gov (United States)

    Pallás, V; Sánchez-Navarro, J A; Díez, J

    1999-01-01

    The RNA binding properties of the prunus necrotic ringspot virus (PNRSV) coat protein (CP) were demonstrated by northwestern and dot-blot analyses. The capability to bind PNRSV RNA 4 was compared with viruses representing three different interactions prevailing in the assembly and architecture of virions. The results showed that cucumber mosaic virus (CMV) and PNRSV CPs, which stabilise their virions mainly through RNA-protein interactions bound PNRSV RNA 4 even at very high salt concentrations. The CP of cherry leaf roll nepovirus, whose virions are predominantly stabilised by protein-protein interactions did not bind even at the lowest salt concentration tested. Finally the CP of carnation mottle carmovirus, that has an intermediate position in which both RNA-protein and protein-protein interactions are equally important showed a salt-dependent RNA binding.

  3. Ozone uptake (flux) as it relates to ozone-induced foliar symptoms of Prunus serotina and Populus maximowizii x trichocarpa

    International Nuclear Information System (INIS)

    Orendovici-Best, T.; Skelly, J.M.; Davis, D.D.; Ferdinand, J.A.; Savage, J.E.; Stevenson, R.E.

    2008-01-01

    Field studies were conducted during 2003 and 2004 from early June to the end of August, at 20 sites of lower or higher elevation within north-central Pennsylvania, using seedlings of black cherry (Prunus serotina, Ehrh.) and ramets of hybrid poplar (Populus maximowizii x trichocarpa). A linear model was developed to estimate the influence of local environmental conditions on stomatal conductance. The most significant factors explaining stomatal variance were tree species, air temperature, leaf vapor pressure deficit, elevation, and time of day. Overall, environmental factors explained less than 35% of the variation in stomatal conductance. Ozone did not affect gas exchange rates in either poplar or cherry. Ozone-induced foliar injury was positively correlated with cumulative ozone exposures, expressed as SUM40. Overall, the amount of foliar injury was better correlated to a flux-based approach rather than to an exposure-based approach. More severe foliar injuries were observed on plants growing at higher elevations. - Within heterogeneous environments, ozone flux does not completely explain the variation observed in ozone-induced visible injury

  4. Replication of alfalfa mosaic virus RNA 3 with movement and coat protein genes replaced by corresponding genes of Prunus necrotic ringspot ilarvirus.

    Science.gov (United States)

    Sánchez-Navarro, J A; Reusken, C B; Bol, J F; Pallás, V

    1997-12-01

    Alfalfa mosaic virus (AMV) and Prunus necrotic ringspot virus (PNRSV) are tripartite positive-strand RNA plant viruses that encode functionally similar translation products. Although the two viruses are phylogenetically closely related, they infect a very different range of natural hosts. The coat protein (CP) gene, the movement protein (MP) gene or both genes in AMV RNA 3 were replaced by the corresponding genes of PNRSV. The chimeric viruses were tested for heterologous encapsidation, replication in protoplasts from plants transformed with AMV replicase genes P1 and P2 (P12 plants) and for cell-to-cell transport in P12 plants. The chimeric viruses exhibited basic competence for encapsidation and replication in P12 protoplasts and for a low level of cell-to-cell movement in P12 plants. The potential involvement of the MP gene in determining host specificity in ilarviruses is discussed.

  5. Oxidative stress induction by Prunus necrotic ringspot virus infection in apricot seeds.

    Science.gov (United States)

    Amari, Khalid; Díaz-Vivancos, Pedro; Pallás, Vincente; Sánchez-Pina, María Amelia; Hernández, José Antonio

    2007-10-01

    Prunus necrotic ringspot rvirus (PNRSV) was able to invade the immature apricot seed including the embryo. The amount of virus was very high inside the embryo compared with that present in the cotyledons. PNRSV infection produced an oxidative stress in apricot seeds as indicated by the increase in lipid peroxidation, measured as thiobarbituric acid-reactive substances. This lipid peroxidation increase was parallelled with an imbalance in the seed antioxidant enzymes. A significant decrease in the ascorbate-GSH cycle enzymes as well as in peroxidase (POX) activity took place in infected seeds, suggesting a low capability to eliminate H2O2. No changes in superoxide dismutase (SOD) or catalase activity were observed. A significant decrease in polyphenoloxidase (PPO) activity was also observed. Native PAGE revealed the presence of three different SOD activity bands in apricot seeds: a Mn-containing SOD and two CuZn-containing SODs. Only an isozyme with catalase, glutathione reductase (GR) or PPO activity was detected in both healthy and infected apricot seeds. Regarding POX staining, three bands with POX activity were detected in native gels in both healthy and infected seeds. The gel results emphasise that the drop detected in POX, GR and PPO activities in PNRSV-infected apricot seeds by kinetic analyses was also evident from the results obtained by native PAGE. The oxidative stress and the imbalance in the antioxidant systems from PNRSV-infected apricot seeds resemble the hypersensitive response observed in some virus-host interactions. This defence mechanism would inactivate PNRSV during seed formation and/or the storage period or even during seed germination. Those results can explain the decrease in seed germination and the low transmission of PNRSV by seeds in apricot trees.

  6. Leaf age affects the responses of foliar injury and gas exchange to tropospheric ozone in Prunus serotina seedlings

    International Nuclear Information System (INIS)

    Zhang Jianwei; Schaub, Marcus; Ferdinand, Jonathan A.; Skelly, John M.; Steiner, Kim C.; Savage, James E.

    2010-01-01

    We investigated the effect of leaf age on the response of net photosynthesis (A), stomatal conductance (g wv ), foliar injury, and leaf nitrogen concentration (N L ) to tropospheric ozone (O 3 ) on Prunus serotina seedlings grown in open-plots (AA) and open-top chambers, supplied with either carbon-filtered or non-filtered air. We found significant variation in A, g wv , foliar injury, and N L (P 3 treatments. Seedlings in AA showed the highest A and g wv due to relatively low vapor pressure deficit (VPD). Older leaves showed significantly lower A, g wv , N L , and higher foliar injury (P wv , and foliar injury to O 3 . Both VPD and N L had a strong influence on leaf gas exchange. Foliar O 3 -induced injury appeared when cumulative O 3 uptake reached 8-12 mmol m -2 , depending on soil water availability. The mechanistic assessment of O 3 -induced injury is a valuable approach for a biologically relevant O 3 risk assessment for forest trees. - Ozone effects on symptom development and leaf gas exchange interacted with leaf age and N-content on black cherry seedlings.

  7. Chemical characterization and thermal properties of kernel oils from Tunisian peach and nectarine varieties of Prunus persica; Caracterización química y propiedades térmicas de los aceites de semillas de variedades tunecinas de melocotón y nectarina de Prunus pérsica

    Energy Technology Data Exchange (ETDEWEB)

    Chamli, D.; Bootello, M.A.; Bouali, I.; Jouhri, S.; Boukhchina, S.; Martínez-Force, S.

    2017-07-01

    A comparative study was conducted to determine the fatty acids, triacylglycerol compositions and thermal properties of Tunisian kernel oils from the Prunus persica varieties, peach and nectarine, grown in two areas of Tunisia, Gabes and Morneg. Qualitatively, the fatty acids composition and triacylglycerol species were identical for all samples. Oleic acid (67.7-75.0%) was the main fatty acid, followed by linoleic (15.7-22.1%) and palmitic (5.6-6.3%) acids. The major triacylglycerol species were triolein, OOO (38.4-50.5%), followed by OOL (18.2-23.2%), POO (8.3-9.7%) and OLL (6.3-10.1%). The thermal profiles were highly influenced by the high content of triolein due to the importance of oleic acid in these oils. Moreover, the fatty acids distribution in TAG external positions was determined as corresponding to an α asymmetry coefficient that was between 0.10 and 0.12, indicating a high asymmetry in the distribution of saturated fatty acids in the position sn-1 and sn-3 in the TAG species of all samples. [Spanish] Se ha realizado un estudio comparativo de aceites tunecinos obtenidos a partir de las semillas de variedades de Prunus persica, melocotón y nectarina, cultivadas en dos zonas de Túnez, Gabes y Morneg. Cualitativamente, la composición de ácidos grasos y de especies de triglicéridos fueron idénticas para todas las muestras. El ácido oleico (67,7-75,0%) fue el ácido graso principal, seguido del linoleico (15,7-22,1%) y el palmítico (5,6-6,3%). Las especies principales de triacilglicéridos fueron la trioleina, OOO (38,4-50,5%), seguida de OOL (18,2-23,2%), POO (8,3-9,7%) y OLL (6,3-10,1%). Los perfiles térmicos fueron muy influidos por el alto contenido de trioleina debido a la importancia del ácido oleico en estos aceites. Por otra parte, se determinó la distribución de ácidos grasos en las posiciones externas de los TAG correspondiendo a un coeficiente de asimetría α entre 0,10 y 0,12, lo que indica una alta asimetría en la distribuci

  8. Rooting and acclimatization of the Japanese plum tree, cv. América

    Directory of Open Access Journals (Sweden)

    Juliana de Magalhães Bandeira

    2012-06-01

    Full Text Available Rooting and acclimatization are limiting steps in plant micropropagation, especially in woody plant species. This study aimed to evaluate the IAA and IBA effect on the in vitro rooting and acclimatization of micropropagated shoots of Japanese plum (Prunus salicina Lindl. cv. América. Shoots from 3 to 4 cm long were inoculated in MS medium with half salt and vitamin concentrations (MS/2 added with IAA and IBA (0, 0.25, 0.5, 0.75 and 1 mg L-1. After a 20-day period in in vitro cultivation, the shoots were evaluated, and then transferred to a greenhouse, and evaluated after 30 days. At the end of the in vitro cultivation period, no significant interactions were observed for number of roots per shoot and rooting percentage, but a significant effect was recorded for auxin type only, for which shoots grown in media added with IBA showed high values - 0.87 and 41.95%, respectively. A linear increase response from 1.45 to 5.75 cm was verified for root length of shoots cultivated in IBA medium; however, no significant effect was observed, and a 0.86 cm average root length per shoot grown in medium added with IAA was found. After 30 days of acclimatization period, the largest survival percentage was obtained from shoots cultivated in medium with 1 mg L-1 of IBA and IAA (88% and 92%, respectively. Although, IBA provided the highest in vitro rooting, most of the surviving shoots were those originated in IAA-added medium, probably because IBA promoted longer fibrous roots, less appropriate for transplant and soil fixation, as they are easily damaged. It was concluded that in vitro rooting with the addition of the highest IAA concentration (1 mg L-1 provided the greatest plant survival during the acclimatization period of the Japanese plum cv. América.

  9. Post-storage cell wall metabolism in two sweet cherry (Prunus avium L.) cultivars displaying different postharvest performance.

    Science.gov (United States)

    Belge, Burcu; Comabella, Eva; Graell, Jordi; Lara, Isabel

    2015-09-01

    The biochemical processes underlying firmness loss of sweet cherry (Prunus avium L.) fruit are poorly understood. Studies on cell wall metabolism of sweet cherry have been generally undertaken during on-tree development or at harvest maturity, while published reports on postharvest changes are scarce and fragmentary. In this work, cell wall modifications after storage at 0 ℃ were studied in two cherry cultivars ('Celeste' and 'Somerset') displaying different postharvest potential. Firmness was largely determined by the yields of the Na2CO3- and KOH-soluble fractions, enriched in covalently-bound pectins and in matrix glycans, respectively, and correlated well with ascorbic acid contents. The yields of these two cell wall fractions were correlated inversely with pectinmethylesterase and endo-1,4-β-d-glucanase activities, indicating a relevant role of these two enzymes in postharvest firmness changes in sweet cherry. The amount of solubilised cell wall materials was closely associated to the contents of dehydroascorbic acid, suggesting the possible involvement of oxidative mechanisms in cell wall disassembly. These data may help understanding the evolution of fruit quality during the marketing period, and give hints for the design of suitable management strategies to preserve key attributes. © The Author(s) 2014.

  10. Preclinical renal chemo-protective potential of Prunus amygdalus Batsch seed coat via alteration of multiple molecular pathways.

    Science.gov (United States)

    Pandey, Preeti; Bhatt, Prakash Chandra; Rahman, Mahfoozur; Patel, Dinesh Kumar; Anwar, Firoz; Al-Abbasi, Fahad; Verma, Amita; Kumar, Vikas

    2018-02-01

    Prunus amygdalus Batsch (almond) is a classical nutritive traditional Indian medicine. Along with nutritive with anti-oxidant properties, it is, clinically, used in the treatment of various diseases with underlying anti-oxidant mechanism. This study is an effort to scrutinise the renal protective effect of P. amygdalus Batsch or green almond (GA) seed coat extract and its underlying mechanism in animal model of Ferric nitrilotriacetate (Fe-NTA) induced renal cell carcinoma (RCC). RCC was induced in Swiss Albino Wistar rats by intraperitoneal injection of Fe-NTA. The rats were then treated with ethanolic extract of GA (25, 50 and 100 mg/kg per oral) for 22 weeks. Efficacy of GA administration was evaluated by change in biochemical, renal, macroscopical and histopathological parameters and alterations. Additionally, interleukin-6 (IL-6), tumour necrosis factor-α (TNF-α), interleukin-1β (IL-1β) and inflammatory mediator including prostaglandin E2 (PGE 2 ), nuclear factor-kappa B (NF-κB) were also observed to explore the possible mechanisms. The oral administration of GA significantly (p Bowman capsules and inflammatory cells. Hence, it can be concluded that GA possesses observable chemo-protective action and effect on Fe-NTA induced RCC via dual inhibition mechanism one by inhibiting free radical generation and second by inhibiting inflammation.

  11. Factors affecting branch wound occlusion and associated decay following pruning – a case study with wild cherry (Prunus avium L.

    Directory of Open Access Journals (Sweden)

    Jonathan Sheppard

    2016-11-01

    Full Text Available Pruning wild cherry (Prunus avium L. is a common silvicultural practice carried out to produce valuable timber at a veneer wood quality. Sub-optimal pruning treatments can permit un-occluded pruning wounds to develop devaluing decay. The aim of this study is to determine relevant branch, tree and pruning characteristics affecting the occlusion process of pruning wounds. Important factors influencing occlusion time for an optimised pruning treatment for valuable timber production utilising wild cherry are derived. 85 artificially pruned branches originating from ten wild cherry trees were retrospectively analysed. Branch stub length, branch diameter and radial stem increment during occlusion were found to be significant predictors for occlusion time. From the results it could be concluded that for the long term success of artificial pruning of wild cherry it is crucial to (i keep branch stubs short (while avoiding damage to the branch collar, (ii to enable the tree to maintain significant radial growth after pruning, (iii to avoid large pruning wounds (>2.5 cm by removing steeply angled and fast growing branches at an early stage.

  12. The RNA 5 of Prunus necrotic ringspot virus is a biologically inactive copy of the 3'-UTR of the genomic RNA 3.

    Science.gov (United States)

    Di Terlizzi, B; Skrzeczkowski, L J; Mink, G I; Scott, S W; Zimmerman, M T

    2001-01-01

    In addition to the four RNAs known to be encapsidated by Prunus necrotic ringspot virus (PNRSV) and Apple mosaic virus (ApMV), an additional small RNA (RNA 5) was present in purified preparations of several isolates of both viruses. RNA 5 was always produced following infection of a susceptible host by an artificial mixture of RNAs 1, 2, 3, and 4 indicating that it was a product of viral replication. RNA 5 does not activate the infectivity of mixtures that contain the three genomic RNAs (RNA 1 + RNA 2 + RNA 3) nor does it appear to modify symptom expression. Results from hybridization studies suggested that RNA 5 had partial sequence homology with RNAs 1, 2, 3, and 4. Cloning and sequencing the RNA 5 of isolate CH 57/1-M of PNRSV, and the 3' termini of the RNA 1, RNA 2 and RNA 3 of this isolate indicated that it was a copy of the 3' untranslated terminal region (3'-UTR) of the genomic RNA 3.

  13. Ethylene regulation of carotenoid accumulation and carotenogenic gene expression in colour-contrasted apricot varieties (Prunus armeniaca).

    Science.gov (United States)

    Marty, I; Bureau, S; Sarkissian, G; Gouble, B; Audergon, J M; Albagnac, G

    2005-07-01

    In order to elucidate the regulation mechanisms of carotenoid biosynthesis in apricot fruit (Prunus armeniaca), carotenoid content and carotenogenic gene expression were analysed as a function of ethylene production in two colour-contrasted apricot varieties. Fruits from Goldrich (GO) were orange, while Moniqui (MO) fruits were white. Biochemical analysis showed that GO accumulated precursors of the uncoloured carotenoids, phytoene and phytofluene, and the coloured carotenoid, beta-carotene, while Moniqui (MO) fruits only accumulated phytoene and phytofluene but no beta-carotene. Physiological analysis showed that ethylene production was clearly weaker in GO than in MO. Carotenogenic gene expression (Psy-1, Pds, and Zds) and carotenoid accumulation were measured with respect to ethylene production which is initiated in mature green fruits at the onset of the climacteric stage or following exo-ethylene or ethylene-receptor inhibitor (1-MCP) treatments. Results showed (i) systematically stronger expression of carotenogenic genes in white than in orange fruits, even for the Zds gene involved in beta-carotene synthesis that is undetectable in MO fruits, (ii) ethylene-induction of Psy-1 and Pds gene expression and the corresponding product accumulation, (iii) Zds gene expression and beta-carotene production independent of ethylene. The different results obtained at physiological, biochemical, and molecular levels revealed the complex regulation of carotenoid biosynthesis in apricots and led to suggestions regarding some possible ways to regulate it.

  14. Exogenous application of ascorbic acid alleviates chilling injury in apricot (Prunus armeniaca L. cv. Shahroudi flowers

    Directory of Open Access Journals (Sweden)

    Hassan Bayat

    2013-08-01

    Full Text Available One of the most important limiting factors in spread of apricot in Iran is late spring frost, which damages flower bud and decrease total yield of crop. It has been found that ascorbic acid (AA plays a beneficial role during plant response to chilling and freezing stresses. To evaluate the effects of AA on alleviating of cold stress, the flower buds of Prunus armeniaca L. cv. Shahroudi were sprayed at pink cluster stage with AS at 4 levels (0, 100, 200 and 300 mg. L-1 and were then exposed to artificial cold stress (4 h at –4 °C or without cold stress (+ 25°C. Experimental attributes including electrolyte leakage (EL of flower buds and percentage of damage of pistil, anthers and petals to temperature treatments were determined. The results showed that at - 4°C the lowest and highest percentage of damage and EL of flower buds were observed in application of 200 and 0 mg. L-1 AA, respectively. The highest and lowest percentage of damage of flower organs and EL were obtained in application of 300 and 200 mg. L-1 AA, respectively at + 25 °C. Based on the results of this experiment, AA alleviates the negative effect of cold stress on EL and flower organ damages in apricot cv. Shahroudi, depending on the concentrations of AA used.

  15. Caracterización de cultivares de duraznero (Prunus persica (L. Batsch. por resistencia a heladas

    Directory of Open Access Journals (Sweden)

    Javier Emilio Chaar

    2015-07-01

    Full Text Available Las heladas primaverales son una de las principales limitantes de la producción de frutales de clima templado. Dentro de una misma especie existe variabilidad en resistencia frente al daño en órganos florales ocasionado por temperaturas bajo cero durante la salida del reposo invernal. En cinco cultivares de duraznero (Prunus persica (L. Batsch. y uno de nectarino se evaluó el daño ocasionado por heladas y se determinaron la fecha de plena floración y la densidad de floración. Adicionalmente se determinó la temperatura letal media (TL50 de las yemas florales en el estado de flor abierta, mediante descensos térmicos controlados en laboratorio. Los cultivares (cv de duraznero Maria Bianca y Summer Pearl presentaron las mayores densidades de flores sanas por cm de ramo, luego de la ocurrencia de temperaturas bajo cero en campo. La resistencia a heladas en campo se relacionó principalmente con la elevada densidad de floración, en combinación, en algunos casos, con floración tardía. La floración tardía por sí sola no resultó una característica de resistencia; por tanto, para la elección de cultivares de duraznero con menor riesgo de daño por temperaturas bajo cero es importante tener en cuenta más de una variable relacionada con los órganos reproductivos

  16. Effects of roasting temperature and duration on fatty acid composition, phenolic composition, Maillard reaction degree and antioxidant attribute of almond (Prunus dulcis) kernel.

    Science.gov (United States)

    Lin, Jau-Tien; Liu, Shih-Chun; Hu, Chao-Chin; Shyu, Yung-Shin; Hsu, Chia-Ying; Yang, Deng-Jye

    2016-01-01

    Roasting treatment increased levels of unsaturated fatty acids (linoleic, oleic and elaidic acids) as well as saturated fatty acids (palmitic and stearic acids) in almond (Prunus dulcis) kernel oils with temperature (150 or 180 °C) and duration (5, 10 or 20 min). Nonetheless, higher temperature (200 °C) and longer duration (10 or 20 min) roasting might result in breakdown of fatty acids especially for unsaturated fatty acids. Phenolic components (total phenols, flavonoids, condensed tannins and phenolic acids) of almond kernels substantially lost in the initial phase; afterward these components gradually increased with roasting temperature and duration. Similar results also observed for their antioxidant activities (scavenging DPPH and ABTS(+) radicals and ferric reducing power). The changes of phenolic acid and flavonoid compositions were also determined by HPLC. Maillard reaction products (estimated with non-enzymatic browning index) also increased with roasting temperature and duration; they might also contribute to enhancing the antioxidant attributes. Copyright © 2015 Elsevier Ltd. All rights reserved.

  17. Assessing the Crop-Water Status in Almond (Prunus dulcis Mill. Trees via Thermal Imaging Camera Connected to Smartphone

    Directory of Open Access Journals (Sweden)

    Iván Francisco García-Tejero

    2018-03-01

    Full Text Available Different tools are being implemented in order to improve the water management in agricultural irrigated areas of semiarid environments. Thermography has been progressively introduced as a promising technique for irrigation scheduling and the assessing of crop-water status, especially when deficit irrigation is being implemented. However, an important limitation is related to the cost of the actual cameras, this being a severe limitation to its practical usage by farmers and technicians. This work evaluates the potential and the robustness of a thermal imaging camera that is connected to smartphone (Flir One recently developed by Flir Systems Inc. as a first step to assess the crop water status. The trial was developed in mature almond (Prunus dulcis Mill. trees that are subjected to different irrigation treatments. Thermal information obtained by the Flir One camera was deal with the thermal information obtained with a conventional Thermal Camera (Flir SC660 with a high resolution, and subsequently, confronted with other related plant physiological parameters (leaf water potential, Ψleaf, and stomatal conductance, gs. Thermal imaging camera connected to smartphone provided useful information in estimating the crop-water status in almond trees, being a potential promising tool to accelerate the monitoring process and thereby enhance water-stress management of almond orchards.

  18. Assessing the Crop-Water Status in Almond (Prunus dulcis Mill.) Trees via Thermal Imaging Camera Connected to Smartphone.

    Science.gov (United States)

    García-Tejero, Iván Francisco; Ortega-Arévalo, Carlos José; Iglesias-Contreras, Manuel; Moreno, José Manuel; Souza, Luciene; Tavira, Simón Cuadros; Durán-Zuazo, Víctor Hugo

    2018-03-31

    Different tools are being implemented in order to improve the water management in agricultural irrigated areas of semiarid environments. Thermography has been progressively introduced as a promising technique for irrigation scheduling and the assessing of crop-water status, especially when deficit irrigation is being implemented. However, an important limitation is related to the cost of the actual cameras, this being a severe limitation to its practical usage by farmers and technicians. This work evaluates the potential and the robustness of a thermal imaging camera that is connected to smartphone (Flir One) recently developed by Flir Systems Inc. as a first step to assess the crop water status. The trial was developed in mature almond ( Prunus dulcis Mill.) trees that are subjected to different irrigation treatments. Thermal information obtained by the Flir One camera was deal with the thermal information obtained with a conventional Thermal Camera (Flir SC660) with a high resolution, and subsequently, confronted with other related plant physiological parameters (leaf water potential, Ψ leaf , and stomatal conductance, g s ). Thermal imaging camera connected to smartphone provided useful information in estimating the crop-water status in almond trees, being a potential promising tool to accelerate the monitoring process and thereby enhance water-stress management of almond orchards.

  19. DETERMINATION OF A MATHEMATICAL MODEL TO ESTIMATE THE AREA AND DRY WEIGHT OF THE LEAF LIMBO OF Prunus persica CV. Jarillo DETERMINACIÓN DE UN MODELO MATEMÁTICO PARA LA ESTIMACIÓN DEL ÁREA FOLIAR Y PESO SECO DEL LIMBO DE Prunus persica CV. Jarillo

    Directory of Open Access Journals (Sweden)

    Enrique Quevedo García

    2012-06-01

    Full Text Available Abstract. A study was conducted to determine the variables that estimated the leaf limbo area and the leaf limbo dry weight of peach Prunus persica (L. Batsch cv. Jarillo. Fifty leaves, aged 2.5 months, were selected and measured: leaf limbo length and width, petiole length, leaf length, petiole diameter, leaf limbo fresh weight, petiole fresh weight, leaf fresh weight, leaf limbo dry weight, petiole dry weight, leaf dry weight, length/width limbo, petiole length/limbo length and leaf limbo area. The results allowed to obtain regression equations for estimating the leaf area and the limbo dry weight. Using the lineal models LA = b1 + b2 (LLL x LLW and LA= b1+ b2LLL + b3LLW a leaf area equation was determined. Alternative models to calculate limbo dry weight were evaluated LLDW = -b1+ b2 LLFW and LLDW= - b1 + b2LLL + b3PL. The best equations found with an R2 of 0.99 were LA = 1.572 + 0.65169(LLL x LLW, LA=-23.106+2.8064LLW + 3.6761LLL and LLDW = -0.002+0.401(LLFW.Resumen. Se realizó un estudio para determinar las variables que estimaran el área del limbo foliar y el peso seco del limbo de durazno Prunus persica (L. Batsch cv. Jarillo. Se seleccionaron cincuenta hojas con 2,5 meses de edad, fueron medidos: ancho del limbo, longitud del limbo, longitud del peciolo, longitud hoja, diámetro peciolo, peso fresco del limbo, peso fresco del peciolo, peso fresco de la hoja, peso seco del limbo, peso seco peciolo, peso seco de la hoja, longitud /ancho limbo, longitud del peciolo/longitud del limbo, área foliar del limbo. Los resultados alcanzados permitieron obtener ecuaciones de regresión para estimar el área foliar del limbo y el peso seco del limbo. Se halló una ecuación para la determinación del área foliar del limbo con los modelos lineales LA = b1 + b2 (LLL x LLW y LA= b1 + b2LLL + b3LLW. También se evaluaron modelos alternativas para calcular el peso seco del limbo, LLDW = -b1+ b2LLFW y LLDW= - b1 + b2LLL + b3PL. Las mejores ecuaciones

  20. Response of nitrogen and potassium fertigation to "Waris" almond (Prunus dulcis) under northwestern Himalayan Region of India.

    Science.gov (United States)

    Kumar, Dinesh; Ahmed, N

    2014-01-01

    A field experiment was conducted on almond (Prunus dulcis) to study the effect of N&K fertigation on growth, yields and leaf nutrient status over two seasons (2011 and 2012) in Srinagar, Jammu and Kashmir, India. There were six treatments, namely, T1--100% recommended dose of fertilizers as soil application, T2--100% RDF through fertigations, T3--75% RDF through fertigation, T4--75% RDF through fertigation (split application), T5--50% RDF through fertigation and T6--50% RDF through fertigation (split application) with three replications under randomized block design. The results indicated that the maximum tree height (3.21 m and 3.56 m), nut weight (2.73 g and 1.94 g), nut yield (2.41 kg/tree and 5.98 kg/tree; 2.67 t/ha and 6.64 t/ha), and leaf nutrient content (2.34 and 2.38% N; 0.14 and 0.17% P; 1.37 and 1.41% K) were recorded in T4 treatment, whereas the highest TCSA of main trunk, primary, secondary, and tertiary branches (72.67 and 90.28 cm(2); 16.75 and 24.26 cm(2); 3.83 and 7.49 cm(2); 0.47 and 1.23 cm(2)), canopy volume (7.15 and 8.11 m(3)), and fruit number (990 and 3083/tree) were recorded in T2 in almond variety Waris.

  1. Chemical composition and functional properties of gum exudates from the trunk of the almond tree (Prunus dulcis).

    Science.gov (United States)

    Mahfoudhi, N; Chouaibi, M; Donsì, F; Ferrari, G; Hamdi, S

    2012-06-01

    The physicochemical components and functional properties of the gum exudates from the trunk of the almond tree (Prunus dulcis) have been investigated, along with the emulsification and foaming properties. The gum exudates are composed on dry weight basis by 2.45% of proteins, 0.85% of fats and 92.36% of carbohydrates. The latter consist of arabinose, xylitol, galactose and uronic acid (46.8 : 10.9 : 35.5 : 6.0 mass ratio) with traces of rhamnose, mannose and glucose. Moreover, gum exudates are rich in minerals, such as sodium, potassium, magnesium, calcium and iron. The emulsifying capacity was studied for a 20% w/w olive oil in water emulsion as a function of gum concentration (from 3% to 12% w/w in the aqueous phase) as well as pH levels (from 3.0 to 10.0). The most stable and homogeneous emulsion was prepared with an 8% w/w aqueous almond gum solution at a pH between 5.0 and 8.0. In particular, for the same formulation, the emulsion processed by high pressure homogenization (5 passes at 200 MPa) resulted to be extremely stable under accelerated ageing, exhibiting no significant change in droplet size distribution for 14 days at 55 °C. All the tested systems exhibited an extremely low foaming capacity.

  2. Minor lipid components of some Acacia species: potential dietary health benefits of the unexploited seeds

    Directory of Open Access Journals (Sweden)

    Nasri Nizar

    2012-05-01

    Full Text Available Abstract Background Oilseed samples from four Acacia species ( A. cyclops, A. ligulata, A. salicina and A. cyanophylla were analyzed in order to evaluate the potential nutritional value of their unexploited seeds. Methods Samples were collected from different Tunisian geographic locations. Seed oils were extracted and carotenoids, tocopherols and sterols were analyzed using chromatographic methods. Results The studied Acacia seeds seem to be quite rich in lipids (from 6% to 12%. All Acacia species contain mainly the xanthophylls zeaxanthin and lutein compounds: from ca. 38 mg.kg-1 of total lipids (A. cyclops to ca. 113 mg.kg-1 of total lipids (A. cyanophylla. Total tocopherols varied from ca. 221 mg.kg-1 of total lipids (A. cyclops to ca. 808 mg.kg-1 of total lipids (A. ligulata. Sterols are highly present and their contents ranged between ca. 7 g. kg-1 of total lipids (A. salicina and 11 g. kg-1 of total lipids (A. cyclops. Conclusion This study highlights that these unexploited seeds might have a potential nutritional value and encourages researchers to more explore and find developments for these plants for healthy purposes.

  3. Prunus africana (Hook.f.) Kalkman: the overexploitation of a medicinal plant species and its legal context.

    Science.gov (United States)

    Bodeker, Gerard; van 't Klooster, Charlotte; Weisbord, Emma

    2014-11-01

    The linkage between herbal medicines and the sustainability of medical plants from which they are manufactured is increasingly being understood and receiving attention through international accords and trade labeling systems. However, little attention is paid to the fair trade aspects of this sector, including the issue of benefit-sharing agreements with traditional societies whose knowledge and resources are being exploited for commercial herbal medicine development and production. This article examines the case of Prunus africana (Hook.f.) Kalkman, from equatorial Africa. While the conservation and cultivation dimension of the trade in P. africana has been much discussed in literature, no research appears to have focused on the traditional resource rights and related ethical dimensions of this trade in traditional medicine of Africa. Serving as a cautionary tale for the unbridled exploitation of medicinal plants, the history of P. africana extraction is considered here in the context of relevant treaties and agreements existing today. These include the Nagoya Protocol, a supplementary agreement to the Convention on Biological Diversity, the Trade-Related Aspects of Intellectual Property Rights agreement from the World Trade Organization, and two African regional frameworks: the Swakopmund Protocol and the Organisation Africaine de la Propriété Intellectuelle Initiative. In the context of strengthening medicinal plant research in Africa, a novel international capacity-building project on traditional medicines for better public health in Africa will be discussed, illustrating how access and benefit sharing principles might be incorporated in future projects on traditional medicines.

  4. RNA-binding properties and mapping of the RNA-binding domain from the movement protein of Prunus necrotic ringspot virus.

    Science.gov (United States)

    Herranz, M Carmen; Pallás, Vicente

    2004-03-01

    The movement protein (MP) of Prunus necrotic ringspot virus (PNRSV) is involved in intercellular virus transport. In this study, putative RNA-binding properties of the PNRSV MP were studied. The PNRSV MP was produced in Escherichia coli using an expression vector. Electrophoretic mobility shift assays (EMSAs) using DIG-labelled riboprobes demonstrated that PNRSV MP bound ssRNA cooperatively without sequence specificity. Two different ribonucleoprotein complexes were found to be formed depending on the molar MP : PNRSV RNA ratio. The different responses of the complexes to urea treatment strongly suggested that they have different structural properties. Deletion mutagenesis followed by Northwestern analysis allowed location of a nucleic acid binding domain to aa 56-88. This 33 aa RNA-binding motif is the smallest region delineated among members of the family Bromoviridae for which RNA-binding properties have been demonstrated. This domain is highly conserved within all phylogenetic subgroups previously described for PNRSV isolates. Interestingly, the RNA-binding domain described here and the one described for Alfamovirus are located at the N terminus of their corresponding MPs, whereas similar domains previously characterized in members of the genera Bromovirus and Cucumovirus are present at the C terminus, strongly reflecting their corresponding phylogenetic relationships. The evolutionary implications of this observation are discussed.

  5. Evolutionary relationships in the ilarviruses: nucleotide sequence of prunus necrotic ringspot virus RNA 3.

    Science.gov (United States)

    Sánchez-Navarro, J A; Pallás, V

    1997-01-01

    The complete nucleotide sequence of an isolate of prunus necrotic ringspot virus (PNRSV) RNA 3 has been determined. Elucidation of the amino acid sequence of the proteins encoded by the two large open reading frames (ORFs) allowed us to carry out comparative and phylogenetic studies on the movement (MP) and coat (CP) proteins in the ilarvirus group. Amino acid sequence comparison of the MP revealed a highly conserved basic sequence motif with an amphipathic alpha-helical structure preceding the conserved motif of the '30K superfamily' proposed by Mushegian and Koonin [26] for MP's. Within this '30K' motif a strictly conserved transmembrane domain is present in all ilarviruses sequenced so far. At the amino-terminal end, prune dwarf virus (PDV) has an extension not present in other ilarviruses but which is observed in all bromo- and cucumoviruses, suggesting a common ancestor or a recombinational event in the Bromoviridae family. Examination of the N-terminus of the CP's of all ilarviruses revealed a highly basic region, part of which resembles the Arg-rich motif that has been characterized in the RNA-binding protein family. This motif has also been found in the other members of the Bromoviridae family, suggesting its involvement in a structural function. Furthermore this region is required for infectivity in ilarviruses. The similarities found in this Arg-rich motif are discussed in terms of this process known as genome activation. Finally, phylogenetic analysis of both the MP and CP proteins revealed a higher relationship of A1MV to PNRSV, apple mosaic virus (ApMV) and PDV than any other member of the ilarvirus group. In that sense, A1MV should be considered as a true ilarvirus instead of forming a distinct group of viruses.

  6. Leaf age affects the responses of foliar injury and gas exchange to tropospheric ozone in Prunus serotina seedlings

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Jianwei, E-mail: jianweizhang@fs.fed.u [Environmental Resources Research Institute, Pennsylvania State University, University Park, PA 16802 (United States); School of Forest Resources, Pennsylvania State University, University Park, PA 16802 (United States); Schaub, Marcus; Ferdinand, Jonathan A. [Environmental Resources Research Institute, Pennsylvania State University, University Park, PA 16802 (United States); Skelly, John M. [Department of Plant Pathology, Pennsylvania State University, University Park, PA 16802 (United States); Steiner, Kim C. [School of Forest Resources, Pennsylvania State University, University Park, PA 16802 (United States); Savage, James E. [Department of Plant Pathology, Pennsylvania State University, University Park, PA 16802 (United States)

    2010-08-15

    We investigated the effect of leaf age on the response of net photosynthesis (A), stomatal conductance (g{sub wv}), foliar injury, and leaf nitrogen concentration (N{sub L}) to tropospheric ozone (O{sub 3}) on Prunus serotina seedlings grown in open-plots (AA) and open-top chambers, supplied with either carbon-filtered or non-filtered air. We found significant variation in A, g{sub wv}, foliar injury, and N{sub L} (P < 0.05) among O{sub 3} treatments. Seedlings in AA showed the highest A and g{sub wv} due to relatively low vapor pressure deficit (VPD). Older leaves showed significantly lower A, g{sub wv}, N{sub L}, and higher foliar injury (P < 0.001) than younger leaves. Leaf age affected the response of A, g{sub wv}, and foliar injury to O{sub 3}. Both VPD and N{sub L} had a strong influence on leaf gas exchange. Foliar O{sub 3}-induced injury appeared when cumulative O{sub 3} uptake reached 8-12 mmol m{sup -2}, depending on soil water availability. The mechanistic assessment of O{sub 3}-induced injury is a valuable approach for a biologically relevant O{sub 3} risk assessment for forest trees. - Ozone effects on symptom development and leaf gas exchange interacted with leaf age and N-content on black cherry seedlings.

  7. Prunus cerasifera Ehrh. fabricated ZnO nano falcates and its photocatalytic and dose dependent in vitro bio-activity

    Directory of Open Access Journals (Sweden)

    Jaffri Shaan Bibi

    2018-03-01

    Full Text Available Zinc oxide nano falcates of sickle shape have been synthesized from Prunus cerasifera pomological extract as a reducing cum stabilizing agent via novel, biomimetic and non-toxic route. Zinc oxide nano falcates were analyzed via ultraviolet spectroscopy, Fourier transform infrared analysis, X-ray powder diffraction, scanning electron microscopy and atomic force microscopy. Highly stable zinc oxide nano falcates synthesized at 200°C and 400°C calcination temperatures expressed intense UV-vis peak at 398 nm. Phenolic and amino groups were revealed by FTIR in pomological extract. Wurtzite crystalline structure of zinc oxide nano falcates was confirmed by XRD with average crystal size of 4.93 nm. SEM sizes ranged between 72.11-120 nm and 56.57-107.70 nm, respectively and shown higher polydispersity levels for two calcination temperatures. Augmented photocatalytic degradation of methyl red and bromophenol blue under direct solar irradiance shown pseudo first order kinetics (R2= 0.99 and 0.96. Furthermore, biomedical and agriculturally important pathogenic strains i.e., Xanthomanas axonopodis pv. citri and Pseudomonas syringae, Aspergillus niger, Aspergillus flavus, Aspergillus fumigatus, Aspergillus terreus, Penicillium chrysogenum, Fusarium solani and Lasiodiplodia theobromae were remarkably inhibited. Enhanced photocatalytic and antimicrobial activity reveals zinc oxide nano falcates promising prospects in nano bioremediation of polluted water and conversion into green nano pesticides.

  8. Implication of the C terminus of the Prunus necrotic ringspot virus movement protein in cell-to-cell transport and in its interaction with the coat protein.

    Science.gov (United States)

    Aparicio, Frederic; Pallás, Vicente; Sánchez-Navarro, Jesús

    2010-07-01

    The movement protein (MP) of Prunus necrotic ringspot virus (PNRSV) is required for viral transport. Previous analysis with MPs of other members of the family Bromoviridae has shown that the C-terminal part of these MPs plays a critical role in the interaction with the cognate coat protein (CP) and in cell-to-cell transport. Bimolecular fluorescence complementation and overlay analysis confirm an interaction between the C-terminal 38 aa of PNRSV MP and its cognate CP. Mutational analysis of the C-terminal region of the PNRSV MP revealed that its C-terminal 38 aa are dispensable for virus transport, however, the 4 aa preceding the dispensable C terminus are necessary to target the MP to the plasmodesmata and for the functionality of the protein. The capacity of the PNRSV MP to use either a CP-dependent or a CP-independent cell-to-cell transport is discussed.

  9. Studies on Parameters Influencing the Performance of Reverse Transcriptase Polymerase Chain Reaction (RT-PCR in Detecting Prunus Necrotic Ringpot Virus (PNRSV

    Directory of Open Access Journals (Sweden)

    M. Usta

    2005-08-01

    Full Text Available In order to have a more detailed understanding of the various factors influencing a reverse transcriptase polymerase chain reaction (RT-PCR, a number of important parameters such as Mg+2, primer, enzyme concentration and others were optimized for the detection of Prunus necrotic ringspot virus (PNRSV. Using a PNRSV isolate with a pair of primers, complementary DNA of viral genome as template, and an appropriate enzyme together with magnesium chloride, the following optimal conditions were identified: primer concentration between 0.2 and 0.0002 pmol µl-1 and 0.06–2 units µl-1 for Taq DNA polymerase enzyme for a 50 µl reaction volume when other parameters were optimum; magnesium chloride concentration less than 2.5 mM; dNTP concentration between 1 and 10 mM. The optimum cDNA amount should be ~360 ng for a 50 µl reaction mixture. When these optimized concentrations and/or values of the main PCR parameters were brought together for a new RT-PCR, a clear and a reliable PNRSV detection having no background was performed from both growth-chamber and field-grown PNRSV-infected plants.

  10. Low-cost and eco-friendly green synthesis of silver nanoparticles using Prunus japonica (Rosaceae) leaf extract and their antibacterial, antioxidant properties.

    Science.gov (United States)

    Saravanakumar, Arthanari; Peng, Mei Mei; Ganesh, Mani; Jayaprakash, Jayabalan; Mohankumar, Murugan; Jang, Hyun Tae

    2017-09-01

    Low cost and eco-friendly green synthesis of silver nanoparticles (AgNPs) from silver nitrate (AgNO 3 ) using Prunus japonica leaves extract as reducing agent by a simple method at room temperature. The biosynthesized nanoparticles (NPs) were characterized by UV-Vis, tunneling electron microscopy (HR-TEM), scanning electron microscopy (SEM) coupled with X-ray energy dispersive spectrophotometer (EDAX), X-ray diffraction (XRD) and Fourier transform infrared spectroscopy (FTIR). In UV-Vis spectroscopy results, the λ max was observed at 441 nm. The AgNPs synthesized were spherical, hexagonal, and irregular in shapes. The EDAX and XRD spectrum confirmed the presence of silver ions and crystalline nature of synthesized AgNPs. FTIR showed the functional groups such as C = O, N-H and C-N groups involved in the reduction of Ag +  to Ag. 2, 2-Diphenyl-1-picrylhydrazyl (DPPH) radical scavenging assay was performed and it showed the percentage inhibition in concentration-dependent manner. The synthesized AgNPs showed antibacterial activity against Escherichia coli, Proteus vulgaris, Staphylococcus aureus and Bacillus cereus to different extents and the higher activity was observed in Proteus vulgaris.

  11. Study of the volatile compounds from plum (Prunus domestica L. cv. Horvin and estimation of their contribution to the fruit aroma

    Directory of Open Access Journals (Sweden)

    Jorge Antonio Pino

    2012-03-01

    Full Text Available Simultaneous Distillation-Extraction (SDE and headspace-solid phase microextraction (HS-SPME combined with GC-FID and GC-MS were used to analyze volatile compounds from plum (Prunus domestica L. cv. Horvin and to estimate the most odor-active compounds by application of the Odor Activity Values (OAV. The analyses led to the identification of 148 components, including 58 esters, 23 terpenoids, 14 aldehydes, 11 alcohols, 10 ketones, 9 alkanes, 7 acids, 4 lactones, 3 phenols, and other 9 compounds of different structures. According to the results of SDE-GC-MS, SPME-GC-MS and OAV, ethyl 2-methylbutanoate, hexyl acetate, (E-2-nonenal, ethyl butanoate, (E-2-decenal, ethyl hexanoate, nonanal, decanal, (E-β-ionone, Γ-dodecalactone, (Z-3-hexenyl acetate, pentyl acetate, linalool, Γ-decalactone, butyl acetate, limonene, propyl acetate, Δ-decalactone, diethyl sulfide, (E-2-hexenyl acetate, ethyl heptanoate, (Z-3-hexenol, (Z-3-hexenyl hexanoate, eugenol, (E-2-hexenal, ethyl pentanoate, hexyl 2-methylbutanoate, isopentyl hexanoate, 1-hexanol, Γ-nonalactone, myrcene, octyl acetate, phenylacetaldehyde, 1-butanol, isobutyl acetate, (E-2-heptenal, octadecanal, and nerol are characteristic odor active compounds in fresh plums since they showed concentrations far above their odor thresholds.

  12. Gene Expression Analysis of Plum pox virus (Sharka) Susceptibility/Resistance in Apricot (Prunus armeniaca L.).

    Science.gov (United States)

    Rubio, Manuel; Ballester, Ana Rosa; Olivares, Pedro Manuel; Castro de Moura, Manuel; Dicenta, Federico; Martínez-Gómez, Pedro

    2015-01-01

    RNA-Seq has proven to be a very powerful tool in the analysis of the Plum pox virus (PPV, sharka disease)/Prunus interaction. This technique is an important complementary tool to other means of studying genomics. In this work an analysis of gene expression of resistance/susceptibility to PPV in apricot is performed. RNA-Seq has been applied to analyse the gene expression changes induced by PPV infection in leaves from two full-sib apricot genotypes, "Rojo Pasión" and "Z506-7", resistant and susceptible to PPV, respectively. Transcriptomic analyses revealed the existence of more than 2,000 genes related to the pathogen response and resistance to PPV in apricot. These results showed that the response to infection by the virus in the susceptible genotype is associated with an induction of genes involved in pathogen resistance such as the allene oxide synthase, S-adenosylmethionine synthetase 2 and the major MLP-like protein 423. Over-expression of the Dicer protein 2a may indicate the suppression of a gene silencing mechanism of the plant by PPV HCPro and P1 PPV proteins. On the other hand, there were 164 genes involved in resistance mechanisms that have been identified in apricot, 49 of which are located in the PPVres region (scaffold 1 positions from 8,050,804 to 8,244,925), which is responsible for PPV resistance in apricot. Among these genes in apricot there are several MATH domain-containing genes, although other genes inside (Pleiotropic drug resistance 9 gene) or outside (CAP, Cysteine-rich secretory proteins, Antigen 5 and Pathogenesis-related 1 protein; and LEA, Late embryogenesis abundant protein) PPVres region could also be involved in the resistance.

  13. Molecular cloning, identification, and chromosomal localization of two MADS box genes in peach (Prunus persica).

    Science.gov (United States)

    Zhang, Lin; Xu, Yong; Ma, Rongcai

    2008-06-01

    MADS box proteins play an important role in floral development. To find genes involved in the floral transition of Prunus species, cDNAs for two MADS box genes, PpMADS1 and PpMADS10, were cloned using degenerate primers and 5'- and 3'-RACE based on the sequence database of P. persica and P. dulcis. The full length of PpMADS1 cDNA is 1,071 bp containing an open reading frame (ORF) of 717 bp and coding for a polypeptide of 238 amino acid residues. The full length of PpMADS10 cDNA is 937 bp containing an ORF of 633 bp and coding for a polypeptide of 210 amino acid residues. Sequence comparison revealed that PpMADS1 and PpMADS10 were highly homologous to genes AP1 and PI in Arabidopsis, respectively. Phylogenetic analysis indicated that PpMADS1 belongs to the euAP1 clade of class A, and PpMADS10 is a member of GLO/PI clade of class B. RT-PCR analysis showed that PpMADS1 was expressed in sepal, petal, carpel, and fruit, which was slightly different from the expression pattern of AP1; PpMADS10 was expressed in petal and stamen, which shared the same expression pattern as PI. Using selective mapping strategy, PpMADS1 was assigned onto the Bin1:50 on the G1 linkage group between the markers MCO44 and TSA2, and PpMADS10 onto the Bin1:73 on the same linkage group between the markers Lap-1 and FGA8. Our results provided the basis for further dissection of the two MADS box gene function.

  14. Epicuticular wax on cherry laurel (Prunus laurocerasus) leaves does not constitute the cuticular transpiration barrier.

    Science.gov (United States)

    Zeisler, Viktoria; Schreiber, Lukas

    2016-01-01

    Epicuticular wax of cherry laurel does not contribute to the formation of the cuticular transpiration barrier, which must be established by intracuticular wax. Barrier properties of cuticles are established by cuticular wax deposited on the outer surface of the cuticle (epicuticular wax) and in the cutin polymer (intracuticular wax). It is still an open question to what extent epi- and/or intracuticular waxes contribute to the formation of the transpiration barrier. Epicuticular wax was mechanically removed from the surfaces of isolated cuticles and intact leaf disks of cherry laurel (Prunus laurocerasus L.) by stripping with different polymers (collodion, cellulose acetate and gum arabic). Scanning electron microscopy showed that two consecutive treatments with all three polymers were sufficient to completely remove epicuticular wax since wax platelets disappeared and cuticle surfaces appeared smooth. Waxes in consecutive polymer strips and wax remaining in the cuticle after treatment with the polymers were determined by gas chromatography. This confirmed that two treatments of the polymers were sufficient for selectively removing epicuticular wax. Water permeability of isolated cuticles and cuticles covering intact leaf disks was measured using (3)H-labelled water before and after selectively removing epicuticular wax. Cellulose acetate and its solvent acetone led to a significant increase of cuticular permeability, indicating that the organic solvent acetone affected the cuticular transpiration barrier. However, permeability did not change after two subsequent treatments with collodion and gum arabic or after treatment with the corresponding solvents (diethyl ether:ethanol or water). Thus, in the case of P. laurocerasus the epicuticular wax does not significantly contribute to the formation of the cuticular transpiration barrier, which evidently must be established by the intracuticular wax.

  15. Molecular characterization and intermolecular interaction of coat protein of Prunus necrotic ringspot virus: implications for virus assembly.

    Science.gov (United States)

    Kulshrestha, Saurabh; Hallan, Vipin; Sharma, Anshul; Seth, Chandrika Attri; Chauhan, Anjali; Zaidi, Aijaz Asghar

    2013-09-01

    Coat protein (CP) and RNA3 from Prunus necrotic ringspot virus (PNRSV-rose), the most prevalent virus infecting rose in India, were characterized and regions in the coat protein important for self-interaction, during dimer formation were identified. The sequence analysis of CP and partial RNA 3 revealed that the rose isolate of PNRSV in India belongs to PV-32 group of PNRSV isolates. Apart from the already established group specific features of PV-32 group member's additional group-specific and host specific features were also identified. Presence of methionine at position 90 in the amino acid sequence alignment of PNRSV CP gene (belonging to PV-32 group) was identified as the specific conserved feature for the rose isolates of PNRSV. As protein-protein interaction plays a vital role in the infection process, an attempt was made to identify the portions of PNRSV CP responsible for self-interaction using yeast two-hybrid system. It was found (after analysis of the deletion clones) that the C-terminal region of PNRSV CP (amino acids 153-226) plays a vital role in this interaction during dimer formation. N-terminal of PNRSV CP is previously known to be involved in CP-RNA interactions, but our results also suggested that N-terminal of PNRSV CP represented by amino acids 1-77 also interacts with C-terminal (amino acids 153-226) in yeast two-hybrid system, suggesting its probable involvement in the CP-CP interaction.

  16. cDNA Cloning, expression and characterization of an allergenic 60s ribosomal protein of almond (prunus dulcis).

    Science.gov (United States)

    Abolhassani, Mohsen; Roux, Kenneth H

    2009-06-01

    Tree nuts, including almond (prunus dulcis) are a source of food allergens often associated with life-threatening allergic reactions in susceptible individuals. Although the proteins in almonds have been biochemically characterized, relatively little has been reported regarding the identity of the allergens involved in almond sensitivity. The present study was undertaken to identify the allergens of the almond by cDNA library approach. cDNA library of almond seeds was constructed in Uni-Zap XR lamda vector and expressed in E. coli XL-1 blue. Plaques were immunoscreened with pooled sera of allergic patients. The cDNA clone reacting significantly with specific IgE antibodies was selected and subcloned and subsequently expressed in E. coli. The amino acids deducted from PCR product of clone showed homology to 60s acidic ribosomal protein of almond. The expressed protein was 11,450 Dalton without leader sequence. Immunoreactivity of the recombinant 60s ribosomal protein (r60sRP) was evaluated with dot blot analysis using pooled and individual sera of allergic patients. The data showed that r60sRP and almond extract (as positive control) possess the ability to bind the IgE antibodies. The results showed that expressed protein is an almond allergen.Whether this r60sRP represents a major allergen of almond needs to be further studied which requires a large number of sera from the almond atopic patients and also need to determine the IgE-reactive frequencies of each individual allergen.

  17. Whole genome comparisons of Fragaria, Prunus and Malus reveal different modes of evolution between Rosaceous subfamilies.

    Science.gov (United States)

    Jung, Sook; Cestaro, Alessandro; Troggio, Michela; Main, Dorrie; Zheng, Ping; Cho, Ilhyung; Folta, Kevin M; Sosinski, Bryon; Abbott, Albert; Celton, Jean-Marc; Arús, Pere; Shulaev, Vladimir; Verde, Ignazio; Morgante, Michele; Rokhsar, Daniel; Velasco, Riccardo; Sargent, Daniel James

    2012-04-04

    Rosaceae include numerous economically important and morphologically diverse species. Comparative mapping between the member species in Rosaceae have indicated some level of synteny. Recently the whole genome of three crop species, peach, apple and strawberry, which belong to different genera of the Rosaceae family, have been sequenced, allowing in-depth comparison of these genomes. Our analysis using the whole genome sequences of peach, apple and strawberry identified 1399 orthologous regions between the three genomes, with a mean length of around 100 kb. Each peach chromosome showed major orthology mostly to one strawberry chromosome, but to more than two apple chromosomes, suggesting that the apple genome went through more chromosomal fissions in addition to the whole genome duplication after the divergence of the three genera. However, the distribution of contiguous ancestral regions, identified using the multiple genome rearrangements and ancestors (MGRA) algorithm, suggested that the Fragaria genome went through a greater number of small scale rearrangements compared to the other genomes since they diverged from a common ancestor. Using the contiguous ancestral regions, we reconstructed a hypothetical ancestral genome for the Rosaceae 7 composed of nine chromosomes and propose the evolutionary steps from the ancestral genome to the extant Fragaria, Prunus and Malus genomes. Our analysis shows that different modes of evolution may have played major roles in different subfamilies of Rosaceae. The hypothetical ancestral genome of Rosaceae and the evolutionary steps that lead to three different lineages of Rosaceae will facilitate our understanding of plant genome evolution as well as have a practical impact on knowledge transfer among member species of Rosaceae.

  18. Genome-wide identification, characterisation and expression analysis of the MADS-box gene family in Prunus mume.

    Science.gov (United States)

    Xu, Zongda; Zhang, Qixiang; Sun, Lidan; Du, Dongliang; Cheng, Tangren; Pan, Huitang; Yang, Weiru; Wang, Jia

    2014-10-01

    MADS-box genes encode transcription factors that play crucial roles in plant development, especially in flower and fruit development. To gain insight into this gene family in Prunus mume, an important ornamental and fruit plant in East Asia, and to elucidate their roles in flower organ determination and fruit development, we performed a genome-wide identification, characterisation and expression analysis of MADS-box genes in this Rosaceae tree. In this study, 80 MADS-box genes were identified in P. mume and categorised into MIKC, Mα, Mβ, Mγ and Mδ groups based on gene structures and phylogenetic relationships. The MIKC group could be further classified into 12 subfamilies. The FLC subfamily was absent in P. mume and the six tandemly arranged DAM genes might experience a species-specific evolution process in P. mume. The MADS-box gene family might experience an evolution process from MIKC genes to Mδ genes to Mα, Mβ and Mγ genes. The expression analysis suggests that P. mume MADS-box genes have diverse functions in P. mume development and the functions of duplicated genes diverged after the duplication events. In addition to its involvement in the development of female gametophytes, type I genes also play roles in male gametophytes development. In conclusion, this study adds to our understanding of the roles that the MADS-box genes played in flower and fruit development and lays a foundation for selecting candidate genes for functional studies in P. mume and other species. Furthermore, this study also provides a basis to study the evolution of the MADS-box family.

  19. Promising sour cherry hybrids (Prunus cerasus L. developed at Fruit Research Institute Čačak

    Directory of Open Access Journals (Sweden)

    Radičević Sanja

    2010-01-01

    Full Text Available At Fruit Research Institute in Čačak, major objectives of the work on breeding new sour cherry (Prunus cerasus L. cultivars are high cropping, large, high-quality fruits and resistance to causal agents of diseases and pests. As a result of the planned hybridization, more than 10,000 hybrid seedlings have been developed from about 40 cultivars within more than 110 parental combinations, among which are 'Čačanski rubin' ('Shasse Morello' x 'Köröser Weichsel' and 'Šumadinka' ('Köröser Weichsel' x 'Heimanns Konserven Weichsel' which have been named and released. Ten-year study of 11 hybrids, selected from the population of about 3,000 hybrid seedlings, gave four hybrids which have been singled out as elite (III/23, III/31, II/40 i XII/57. These hybrids are currently under procedure of being released as new cultivars. The paper presents two-year results of the study of ripening time, pomological properties, biochemical composition of fruits, and field resistance to causal agents of diseases and pests attacking the above named genotypes which were compared to standard cultivar 'Heimanns Konserven Weichsel'. In the studied hybrids, fruit weight, soluble solids content and sugars content were higher than in standard cultivar. In addition, they exhibit substantial field resistance to causal agents of brown rot (Monilinia laxa /Ader et Ruhl./ Honey ex Whetz., cherry leaf spot (Blumeriella jaapii (Rehm. v. Arx., shot-hole (Clasterosporium carpophilum (Lév. Aderh. and cherry fruit fly (Rhagoletis cerasi L. attack.

  20. Investigation of the aroma of commercial peach (Prunus persica L. Batsch) types by Proton Transfer Reaction-Mass Spectrometry (PTR-MS) and sensory analysis.

    Science.gov (United States)

    Bianchi, Tiago; Weesepoel, Yannick; Koot, Alex; Iglesias, Ignasi; Eduardo, Iban; Gratacós-Cubarsí, Marta; Guerrero, Luis; Hortós, Maria; van Ruth, Saskia

    2017-09-01

    The aim of this study was to investigate the aroma and sensory profiles of various types of peaches (Prunus persica L. Batsch.). Forty-three commercial cultivars comprising peaches, flat peaches, nectarines, and canning peaches (pavías) were grown over two consecutive harvest years. Fruits were assessed for chemical aroma and sensory profiles. Chemical aroma profile was obtained by proton transfer reaction-mass spectrometry (PTR-MS) and spectral masses were tentatively identified with PTR-Time of Flight-MS (PTR-Tof-MS). Sensory analysis was performed at commercial maturity considering seven aroma/flavor attributes. The four types of peaches showed both distinct chemical aroma and sensory profiles. Flat peaches and canning peaches showed most distinct patterns according to discriminant analysis. The sensory data were related to the volatile compounds by partial least square regression. γ-Hexalactone, γ-octalactone, hotrienol, acetic acid and ethyl acetate correlated positively, and benzeneacetaldehyde, trimethylbenzene and acetaldehyde negatively to the intensities of aroma and ripe fruit sensory scores. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. 7 CFR 319.37-1 - Definitions.

    Science.gov (United States)

    2010-01-01

    ...: mechanical transmission of the pest to an indicator plant for Dianthus, Malus, Prunus, Rubus, and Syringa..., Rubus, and Syringa; serology for Dianthus, Malus, Prunus, Pyrus, Rubus, and Syringa; electron microscopy for Dianthus and Prunus, and nucleic acid probes for Chaenomeles, Cydonia, Malus, and Pyrus. Inspector...

  2. [Pharmacotherapy for preventing calcium containing stone formation].

    Science.gov (United States)

    Nagata, Masao; Takayama, Tatsuya; Mugiya, Souichi; Ohzono, Seiichiro

    2011-10-01

    Many urinary tract stones consist of calcium, and has high relapse rate. Accordingly, it is very important to prevent calcium-containing stone formation. This paper describes about effects and mechanisms for Xanthine oxidase inhibitor, citrate formulation, magnesium formulation, thiazides, vitamin B(6), extract of Quercus salicina Blume and chorei-to (medical herb) . Recent new drugs and the elucidation of new metabolic pathways may lead to the development of prevention of urolithiasis.

  3. Purification, crystallization and preliminary X-ray characterization of prunin-1, a major component of the almond (Prunus dulcis) allergen amandin.

    Science.gov (United States)

    Albillos, Silvia M; Jin, Tengchuan; Howard, Andrew; Zhang, Yuzhu; Kothary, Mahendra H; Fu, Tong-Jen

    2008-07-09

    The 11S globulins from plant seeds account for a number of major food allergens. Because of the interest in the structural basis underlying the allergenicity of food allergens, we sought to crystallize the main 11S seed storage protein from almond ( Prunus dulcis). Prunin-1 (Pru1) was purified from defatted almond flour by water extraction, cryoprecipitation, followed by sequential anion exchange, hydrophobic interaction, and size exclusion chromatography. Single crystals of Pru1 were obtained in a screening with a crystal screen kit, using the hanging-drop vapor diffusion method. Diffraction quality crystals were grown after optimization. The Pru1 crystals diffracted to at least 3.0 A and belong to the tetragonal space group P4(1)22, with unit cell parameters of a = b = 150.912 A, c = 165.248 A. Self-rotation functions and molecular replacement calculations showed that there are three molecules in the asymmetry unit with water content of 51.41%. The three Pru1 protomers are related by a noncrystallographic 3-fold axis and they form a doughnut-shaped trimer. Two prunin trimers form a homohexamer. Elucidation of prunin structure will allow further characterization of the allergenic features of the 11S protein allergens at the molecular level.

  4. Purification, Crystallization and Preliminary X-ray Characterization of Prunin-1, a Major Component of the Almond (Prunus dulcis) Allergen Amandin

    Energy Technology Data Exchange (ETDEWEB)

    Albillos, Silvia M.; Jin, Tengchuan; Howard, Andrew; Zhang, Yuzhu; Kothary, Mahendra H.; Fu, Tong-Jen (IIT); (US-FDA)

    2008-08-04

    The 11S globulins from plant seeds account for a number of major food allergens. Because of the interest in the structural basis underlying the allergenicity of food allergens, we sought to crystallize the main 11S seed storage protein from almond (Prunus dulcis). Prunin-1 (Pru1) was purified from defatted almond flour by water extraction, cryoprecipitation, followed by sequential anion exchange, hydrophobic interaction, and size exclusion chromatography. Single crystals of Pru1 were obtained in a screening with a crystal screen kit, using the hanging-drop vapor diffusion method. Diffraction quality crystals were grown after optimization. The Pru1 crystals diffracted to at least 3.0 {angstrom} and belong to the tetragonal space group P4{sub 1}22, with unit cell parameters of a = b = 150.912 {angstrom}, c = 165.248 {angstrom}. Self-rotation functions and molecular replacement calculations showed that there are three molecules in the asymmetry unit with water content of 51.41%. The three Pru1 protomers are related by a noncrystallographic 3-fold axis and they form a doughnut-shaped trimer. Two prunin trimers form a homohexamer. Elucidation of prunin structure will allow further characterization of the allergenic features of the 11S protein allergens at the molecular level.

  5. LA RELACIÓN HOJA: FRUTO AFECTA LA PRODUCCIÓN, EL CRECIMIENTO Y LA CALIDAD DEL FRUTO EN DURAZNERO (Prunus persica L. Batsch, cv. ‘Rubidoux’ LEAF TO FRUIT RATIO AFFECTS YIELD, FRUIT GROWTH AND FRUIT QUALITY OF PEACH (Prunus persica L. Batsch, cv. ‘Rubidoux’

    Directory of Open Access Journals (Sweden)

    Fánor Casierra-Posada

    2007-06-01

    Full Text Available El raleo de frutos es un práctica agrícola común en los árboles de melocotón con miras a una cosecha moderada a abundante. Sin embargo, a pesar de las muchas ventajas del raleo, demostradas a lo largo de años de experiencia en la zona templada, esta práctica es a menudo una de las operaciones conducidas de manera ineficiente en el cultivo del duraznero. Árboles de duraznero (Prunus persica L. Batsch cv. ‘Rubidoux’ se ralearon manualmente con el objeto de mejorar la calidad comercial del fruto. Se evaluaron los cambios en el crecimiento del fruto, los sólidos solubles totales, la relación pulpa: semilla, la producción, la calidad del fruto y el diámetro de la fruta, durante una temporada de crecimiento de los frutos según el efecto de la relación hoja: fruto (10; 20; 30; 40 y 50 hojas por fruto, en Guasca - Cundinamarca - Colombia. El raleo se realizó 85 días después de plena floración. Los árboles del tratamiento control no se ralearon. Se observaron diferencias en las curvas de crecimiento del fruto, en el promedio de fruto cosechado, en el peso fresco de los frutos y en su calidad comercial. El contenido de sólidos solubles totales en los frutos y la relación pulpa:semilla aumentaron con el raleo. Al momento de la cosecha, la producción se redujo en los árboles raleados, pero se mejoró la cantidad del fruto comercial. Los tratamientos con 40 y 50 hojas por fruto tuvieron la mayor proporción de frutos de mejor calidad en comparación con los árboles control.Fruit thinning is a standard practice on peach trees carrying a moderate to heavy crop. However, in spite of the many benefits from thinning demostrated through long years of experience in the temperate zone, fruit thinning is too often one of the most unefficiently conducted operations in peach growing. With a view to improve marketable yield and fruit quality, trees of peach (Prunus persica L. Batsch cv. ‘Rubidoux’ were subjected to hand thinning. Changes

  6. Evaluation of the chemical and nutritional characteristics of almonds (Prunus dulcis (Mill). D.A. Webb) as influenced by harvest time and cultivar.

    Science.gov (United States)

    Summo, Carmine; Palasciano, Marino; De Angelis, Davide; Paradiso, Vito M; Caponio, Francesco; Pasqualone, Antonella

    2018-04-30

    Several authors studied the effect of harvest time on chemical and nutritional composition of almonds, but the results are partly conflicting, probably due to differences in the cultivars considered and to different agronomic and climatic conditions in the growing areas. In this paper the influence of harvest time and cultivar on the chemical and nutritional composition of almonds (Prunus dulcis (Mill). D.A. Webb) was evaluated. Ten cultivars were considered, grown in the same orchard and subjected to the same agronomical regime. Almonds were collected at two different harvest times: i) when the fruits were unripe, but already edible, and showed green and moist hull, and ii) when the fruits were ripe, with dry brown hull. The analyses of proximate composition, fatty acid profile, total phenolic compounds and antioxidant activity were carried out. Lipid content increased (palmonds. Genotype strongly influenced fatty acid composition and total phenolic compounds. The changes of bioactive compounds and antioxidant activity suggest that the synthesis of antioxidants occur also in the last stage of ripening. Unripe almonds, a valuable niche product, showed interesting nutritional value. This article is protected by copyright. All rights reserved.

  7. The use of short and long PCR products for improved detection of prunus necrotic ringspot virus in woody plants.

    Science.gov (United States)

    Rosner, A; Maslenin, L; Spiegel, S

    1997-09-01

    The reverse transcriptase-polymerase chain reaction (RT-PCR) was used for detection of prunus necrotic ringspot virus (PNRSV) in dormant peach and almond trees by the application of two different pairs of primers yielding a short and a long product, respectively. The relative amount of the short (200 base pair, bp) product was higher than the longer (785 bp) product. PNRSV was detected better in plant tissues with a low virus concentration (e.g. dormant trees) by amplification of the short PCR product, whereas the long product was product was produced at higher virus titers. Simultaneous amplification of both short and long products was demonstrated using a three-primer mixture in a single reaction tube. In this assay, amplification of either PCR product indicated the presence of PNRSV-specific sequences in the plant tissue examined, thus covering a wide range of virus concentrations in a single test. Dilution of the RNA extracted from infected plant material resulted in a steep decline in the amplification of both short and long PCR products. In contrast, serial dilutions of the intermediate cDNA template differentially affected the amplification patterns: the relative amount of the short product increased whereas that of the long product decreased. These results may explain the preferential amplification of the short PCR product observed in samples containing low virus concentrations.

  8. Purification, structure and immunobiological activity of an arabinan-rich pectic polysaccharide from the cell walls of Prunus dulcis seeds.

    Science.gov (United States)

    Dourado, Fernando; Madureira, Pedro; Carvalho, Vera; Coelho, Ricardo; Coimbra, Manuel A; Vilanova, Manuel; Mota, Manuel; Gama, Francisco M

    2004-10-20

    The structure and bioactivity of a polysaccharide extracted and purified from a 4M KOH + H3BO3 solution from Prunus dulcis seed cell wall material was studied. Anion-exchange chromatography of the crude extract yielded two sugar-rich fractions: one neutral (A), the other acidic (E). These fractions contain a very similar monosaccharide composition: 5:2:1 for arabinose, uronic acids and xylose, respectively, rhamnose and galactose being present in smaller amounts. As estimated by size-exclusion chromatography, the acidic fraction had an apparent molecular mass of 762 kDa. Methylation analysis (from the crude and fractions A and E), suggests that the polysaccharide is an arabinan-rich pectin. In all cases, the polysaccharides bear the same type of structural Ara moieties with highly branched arabinan-rich pectic polysaccharides. The average relative proportions of the arabinosyl linkages is 3:2:1:1 for T-Araf:(1-->5)-Araf:(1-->3,5)-Araf:(1-->2,3,5)-Araf. The crude polysaccharide extract and fractions A and E induced a murine lymphocyte stimulatory effect, as evaluated by the in vitro and in vivo expression of lymphocyte activation markers and spleen mononuclear cells culture proliferation. The lymphocyte stimulatory effect was stronger on B- than on T-cells. No evidence of cytotoxic effects induced by the polysaccharide fractions was found.

  9. Mutational analysis of the RNA-binding domain of the Prunus necrotic ringspot virus (PNRSV) movement protein reveals its requirement for cell-to-cell movement.

    Science.gov (United States)

    Carmen Herranz, Ma; Sanchez-Navarro, Jesús-Angel; Saurí, Ana; Mingarro, Ismael; Pallás, Vicente

    2005-08-15

    The movement protein (MP) of Prunus necrotic ringspot virus (PNRSV) is required for cell-to-cell movement. MP subcellular localization studies using a GFP fusion protein revealed highly punctate structures between neighboring cells, believed to represent plasmodesmata. Deletion of the RNA-binding domain (RBD) of PNRSV MP abolishes the cell-to-cell movement. A mutational analysis on this RBD was performed in order to identify in vivo the features that govern viral transport. Loss of positive charges prevented the cell-to-cell movement even though all mutants showed a similar accumulation level in protoplasts to those observed with the wild-type (wt) MP. Synthetic peptides representing the mutants and wild-type RBDs were used to study RNA-binding affinities by EMSA assays being approximately 20-fold lower in the mutants. Circular dichroism analyses revealed that the secondary structure of the peptides was not significantly affected by mutations. The involvement of the affinity changes between the viral RNA and the MP in the viral cell-to-cell movement is discussed.

  10. Mutational analysis of the RNA-binding domain of the Prunus necrotic ringspot virus (PNRSV) movement protein reveals its requirement for cell-to-cell movement

    International Nuclear Information System (INIS)

    Carmen Herranz, Ma; Sanchez-Navarro, Jesus-Angel; Sauri, Ana; Mingarro, Ismael; Pallas, Vicente

    2005-01-01

    The movement protein (MP) of Prunus necrotic ringspot virus (PNRSV) is required for cell-to-cell movement. MP subcellular localization studies using a GFP fusion protein revealed highly punctate structures between neighboring cells, believed to represent plasmodesmata. Deletion of the RNA-binding domain (RBD) of PNRSV MP abolishes the cell-to-cell movement. A mutational analysis on this RBD was performed in order to identify in vivo the features that govern viral transport. Loss of positive charges prevented the cell-to-cell movement even though all mutants showed a similar accumulation level in protoplasts to those observed with the wild-type (wt) MP. Synthetic peptides representing the mutants and wild-type RBDs were used to study RNA-binding affinities by EMSA assays being approximately 20-fold lower in the mutants. Circular dichroism analyses revealed that the secondary structure of the peptides was not significantly affected by mutations. The involvement of the affinity changes between the viral RNA and the MP in the viral cell-to-cell movement is discussed

  11. Gene Expression Analysis of Plum pox virus (Sharka Susceptibility/Resistance in Apricot (Prunus armeniaca L..

    Directory of Open Access Journals (Sweden)

    Manuel Rubio

    Full Text Available RNA-Seq has proven to be a very powerful tool in the analysis of the Plum pox virus (PPV, sharka disease/Prunus interaction. This technique is an important complementary tool to other means of studying genomics. In this work an analysis of gene expression of resistance/susceptibility to PPV in apricot is performed. RNA-Seq has been applied to analyse the gene expression changes induced by PPV infection in leaves from two full-sib apricot genotypes, "Rojo Pasión" and "Z506-7", resistant and susceptible to PPV, respectively. Transcriptomic analyses revealed the existence of more than 2,000 genes related to the pathogen response and resistance to PPV in apricot. These results showed that the response to infection by the virus in the susceptible genotype is associated with an induction of genes involved in pathogen resistance such as the allene oxide synthase, S-adenosylmethionine synthetase 2 and the major MLP-like protein 423. Over-expression of the Dicer protein 2a may indicate the suppression of a gene silencing mechanism of the plant by PPV HCPro and P1 PPV proteins. On the other hand, there were 164 genes involved in resistance mechanisms that have been identified in apricot, 49 of which are located in the PPVres region (scaffold 1 positions from 8,050,804 to 8,244,925, which is responsible for PPV resistance in apricot. Among these genes in apricot there are several MATH domain-containing genes, although other genes inside (Pleiotropic drug resistance 9 gene or outside (CAP, Cysteine-rich secretory proteins, Antigen 5 and Pathogenesis-related 1 protein; and LEA, Late embryogenesis abundant protein PPVres region could also be involved in the resistance.

  12. The evaluation of the growth and nutrition conditions of the garden nursery material Prunus and Thuja according to the use of various cultivating substrates and systems of fertilization

    Directory of Open Access Journals (Sweden)

    Tomáš Meisl

    2006-01-01

    Full Text Available The influence of different peat-based cultivating substrates and the system of fertilization on the nutrition conditions and growth characteristics of garden nursery material Prunus kurilensis ‘Brillant’ and Thuja occidentalis ‘Smaragd’ were observed during a three-year experiment. Three kinds of substrates were tested: peat + pumice (pemza proportioned 8:2, fermented bark + peat + clay proportioned 4:4:2, fermented bark + peat + clay proportioned 4:4:2. Two fertilizers were used: granular controlled-release fertilizer – Osmocote, and watersoluble with irrigation – Kristalon.A higher content of macroelements was observed in the leaves of Prunus. The only exception was potassium, the quantity of which was demonstrably higher in the assimilative organs of Thuja. On the contrary, Thuja had a higher content of trace elements except for copper and iron. The highest contents of nitrogen, potassium, and iron were statistically proved in leaves of woods grown in the substrate of peat and pumice due to its higher sorption capability. A better nutrition conditions in almost all nutrients were observed at plants where the gradually effective Osmocote was applied. The exceptions were calcium, molybdenum and iron, the content of which was, on the contrary, higher where Kristalon with irrigation were used. Physical characteristics of the growing substrates that contained bark were significantly worse at the end of the experiment. This was even intensified by clay. The substrate containing peat and pumice were less stable. The best growth was observed in woods grown in the substrate of peat and pumice, ie where peat was not substituted by bark, and, at the same time, expanded clay was used instead of classic clay. Higher values of growth characteristics were demonstratively observed after the Osmocote fertilizer was applied.The results of the experiment reveal that pumice should be recommended, pemza with a high sorption capability and the

  13. Effect of Pulsed Electric Fields on the Flavour Profile of Red-Fleshed Sweet Cherries (Prunus avium var. Stella

    Directory of Open Access Journals (Sweden)

    Kristine Ann Gualberto Sotelo

    2015-03-01

    Full Text Available The aim of this research was to study the effect of pulsed electric fields (PEF on the flavour profile of red-fleshed sweet cherries (Prunus avium variety Stella. The cherry samples were treated at a constant pulse frequency of 100 Hz, a constant pulse width of 20 μs, different electric field strengths between 0.3 and 2.5 kV/cm and specific energy ranging from 31 to 55 kJ/kg. Volatile compounds of samples were analysed using an automated headspace solid phase microextraction (HS–SPME method coupled with gas chromatography-mass spectrometry (GC–MS. A total of 33 volatile compounds were identified with benzaldehyde, hexanal, (E-2-hexenal, (Z-2-hexen-1-ol, and benzyl alcohol being the predominant volatiles in different PEF-treated samples. Aldehydes namely butanal, octanal, 2-octenal, and nonanal, and (Z-2-hexen-1-ol increased significantly 24 h after PEF treatment at electric field strengths of more than 1.0 kV/cm. Samples incubated for 24 h after PEF treatment (S3 generated higher concentrations of volatiles than samples immediately after PEF treatments (S2. Quantitative results revealed that more flavour volatiles were released and associated with S3 samples after 24 h storage and S2 samples immediately after PEF both with the highest electric field intensities. Interestingly, this study found that the PEF treatments at the applied electric field strength and energy did not result in releasing/producing undesirable flavour compounds.

  14. Prunus domestica pathogenesis-related protein-5 activates the defense response pathway and enhances the resistance to fungal infection.

    Directory of Open Access Journals (Sweden)

    Ashraf El-kereamy

    Full Text Available Pathogenesis-related protein-5 (PR-5 has been implicated in plant disease resistance and its antifungal activity has been demonstrated in some fruit species. However, their roles, especially their interactions with the other defense responses in plant cells, are still not fully understood. In this study, we have cloned and characterized a new PR-5 cDNA named PdPR5-1 from the European plum (Prunus domestica. Expression of PdPR5-1 was studied in different cultivars varying in resistance to the brown rot disease caused by the necrotrophic fungus Monilinia fructicola. In addition transgenic Arabidopsis, ectopically expressing PdPR5-1 was used to study its role in other plant defense responses after fungal infection. We show that the resistant cultivars exhibited much higher levels of transcripts than the susceptible cultivars during fruit ripening. However, significant rise in the transcript levels after infection with M. fructicola was observed in the susceptible cultivars too. Transgenic Arabidopsis plants exhibited more resistance to Alternaria brassicicola. Further, there was a significant increase in the transcripts of genes involved in the phenylpropanoid biosynthesis pathway such as phenylalanine ammonia-lyase (PAL and phytoalexin (camalexin pathway leading to an increase in camalexin content after fungal infection. Our results show that PdPR5-1 gene, in addition to its anti-fungal properties, has a possible role in activating other defense pathways, including phytoalexin production.

  15. Prunus domestica, Prunus persica and Prunus avium extracts ...

    African Journals Online (AJOL)

    Background: Nowadays antioxidants from plants origin are considered as a promising source of biologically active substances; as synthetic agents are ... suitable for preparing new antioxidant emulsions loaded with pleasant fruity extracts which remain economical, effective and completely safe for human skin therefore, ...

  16. The complete nucleotide sequence of RNA 3 of a peach isolate of Prunus necrotic ringspot virus.

    Science.gov (United States)

    Hammond, R W; Crosslin, J M

    1995-04-01

    The complete nucleotide sequence of RNA 3 of the PE-5 peach isolate of Prunus necrotic ringspot ilarvirus (PNRSV) was obtained from cloned cDNA. The RNA sequence is 1941 nucleotides and contains two open reading frames (ORFs). ORF 1 consisted of 284 amino acids with a calculated molecular weight of 31,729 Da and ORF 2 contained 224 amino acids with a calculated molecular weight of 25,018 Da. ORF 2 corresponds to the coat protein gene. Expression of ORF 2 engineered into a pTrcHis vector in Escherichia coli results in a fusion polypeptide of approximately 28 kDa which cross-reacts with PNRSV polyclonal antiserum. Analysis of the coat protein amino acid sequence reveals a putative "zinc-finger" domain at the amino-terminal portion of the protein. Two tetranucleotide AUGC motifs occur in the 3'-UTR of the RNA and may function in coat protein binding and genome activation. ORF 1 homologies to other ilarviruses and alfalfa mosaic virus are confined to limited regions of conserved amino acids. The translated amino acid sequence of the coat protein gene shows 92% similarity to one isolate of apple mosaic virus, a closely related member of the ilarvirus group of plant viruses, but only 66% similarity to the amino acid sequence of the coat protein gene of a second isolate. These relationships are also reflected at the nucleotide sequence level. These results in one instance confirm the close similarities observed at the biophysical and serological levels between these two viruses, but on the other hand call into question the nomenclature used to describe these viruses.

  17. Whole genome comparisons of Fragaria, Prunus and Malus reveal different modes of evolution between Rosaceous subfamilies

    Directory of Open Access Journals (Sweden)

    Jung Sook

    2012-04-01

    Full Text Available Abstract Background Rosaceae include numerous economically important and morphologically diverse species. Comparative mapping between the member species in Rosaceae have indicated some level of synteny. Recently the whole genome of three crop species, peach, apple and strawberry, which belong to different genera of the Rosaceae family, have been sequenced, allowing in-depth comparison of these genomes. Results Our analysis using the whole genome sequences of peach, apple and strawberry identified 1399 orthologous regions between the three genomes, with a mean length of around 100 kb. Each peach chromosome showed major orthology mostly to one strawberry chromosome, but to more than two apple chromosomes, suggesting that the apple genome went through more chromosomal fissions in addition to the whole genome duplication after the divergence of the three genera. However, the distribution of contiguous ancestral regions, identified using the multiple genome rearrangements and ancestors (MGRA algorithm, suggested that the Fragaria genome went through a greater number of small scale rearrangements compared to the other genomes since they diverged from a common ancestor. Using the contiguous ancestral regions, we reconstructed a hypothetical ancestral genome for the Rosaceae 7 composed of nine chromosomes and propose the evolutionary steps from the ancestral genome to the extant Fragaria, Prunus and Malus genomes. Conclusion Our analysis shows that different modes of evolution may have played major roles in different subfamilies of Rosaceae. The hypothetical ancestral genome of Rosaceae and the evolutionary steps that lead to three different lineages of Rosaceae will facilitate our understanding of plant genome evolution as well as have a practical impact on knowledge transfer among member species of Rosaceae.

  18. AcEST: BP912159 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 9ROSA Photosystem Q(B) protein OS=Prunus spinul... 60 1e-16 tr|Q95B38|Q95B38_9ROSA Photosystem Q(B) protein OS=Prunus grayan...em Q(B) protein OS=Prunus grayana GN=psbA PE=3 SV=1 Length = 353 Score = 60.1 bit

  19. Status and Trend of Cottonwood Forests Along the Missouri River

    Science.gov (United States)

    2010-03-03

    Rhamnus davurica), green ash, chokecherry ( Prunus virginiana ), and some Russian olive (Figure 30a). Younger cottonwood (all sapling stands, and...argentea), common chokecherry ( Prunus virginiana ), service berry (Amelanchier spp.) and rarely, red-osier dogwood (Cornus stolonifera) (Figure 32). In...sagebrush (Artemisia cana), common chokecherry ( Prunus virginiana ), and rarely, red-osier dogwood (Cornus stolonifera) (Ross and Hunter 1976, Scott

  20. Physico-chemical characteristics of seed oils extracted from different apricot (Prunus armeniaca L. varieties from Pakistan

    Directory of Open Access Journals (Sweden)

    Alkharfy, K. M.

    2012-06-01

    Full Text Available The fruit seed oils from four varieties of apricot (Prunus armeniaca L., namely, Halmas, Nari, Travet and Charmagzi were analyzed for different physico-chemical characteristics. The oil yield from the apricot seeds (kernels ranged from 32.23-42.51%, while the protein, fiber and ash contents ranged from 13.21-20.90%, 5.13-9.81% and 2.11-3.89%, respectively. The extracted oils had an average iodine value (g of I/100 g of oil of 96.4-106.3; density at 24 °C, 0.87-0.93 mg/mL; refractive index (40 °C, 1.4655-1.4790; saponification value, 189.1-199.4 mg of KOH/g oil; unsaponifiable matter, 0.59-0.88%; free fatty acid (mg of KOH/g oil, 0.41-1.28; and color (1-inch cell, 1.31-2.96R 1 14.8-29.8Y. With regard to the oxidation state, the tested oils showed values for specific extinction at 232 and 268 nm, 2.30-3.42 and 0.82-1.04, respectively, while the peroxide value was 1.0-2.32 meq O2/kg and, p-anisidine was 1.22-1.90. The major fatty acid found in the oils was oleic acid (62.34-80.97% followed by linoleic (13.13-30.33%, palmitic (3.35-5.93%, linolenic (0.73-1.03% and stearic (1.10-1.68% acids. The contents of α-, γ-, and δ-, tocopherols in the oils ranged from 14.8-40.4, 330.8-520.8 and 28.5-60.2 mg/kg, respectively. The results of our present investigation revealed that apricot seed is a potential source of oil which can be used both for edible and oleochemical applications.Se han analizado las características físico-químicas de aceites de semillas de frutos de cuatro variedades diferentes de albaricoque, Halmas, Nari, Travet y Charmagzi (Prunus armeniaca L.. La producción de aceites de las semillas de albaricoque (hueso osciló entre 32,23-42,51%, mientras que las proteínas, fibra y cenizas dieron valores de 13,21-20,90%, 5,13-9,81% y 2,11-3,89%, respectivamente. Los aceites extraídos presentaron valores promedio de índice de yodo, de 96,4-106,3 (g de I/100 g de aceite; densidades a 24 °C de 0,87-0,93 mg/mL, índices de refracción (40

  1. Management of genetic resources in the nursery system of wild cherry (Prunus avium L.

    Directory of Open Access Journals (Sweden)

    Proietti R

    2006-01-01

    Full Text Available Knowledge of genetic and adaptive traits of reproductive materials used in the nursery system of wild cherry, could be an useful instrument to improve ecological and economic sustainability of plantation ecosystems. This work reports results from a research which the objectives were: 1 to study the genetic variation of a Prunus avium L. Population, used for seed harvesting, through its multi-locus genotypes detected by starch gel electrophoresis; 2 to analyze the level of genetic variation within and among different steps in a commercial nursery system (basic population and sub-populations, seedlings aged S1T1 and S1T2, plantation. Results showed low genetic variation levels of the basic population, similar to a reference system of other 12 wild cherry Italian populations and to other French and Caucasian materials. The genetic distances among Monte Baldo and some closer Lombardy provenances (Area Garda, Bosco Fontana, Valtellina were smaller than the Venice Region populations (Monti Lessini and Asiago. Number of alleles and percentage of polymorphic loci within the complex of Monte Baldo provenance and multiplication materials were similar, whilst a variable value of Fis was noted. Indeed, along with the nursery system until the plantation, heterozygosis initially (S1T1 increased, then decreased proceeding to the plantation. This fluctuation of FIS values could be determined by seed lots characterized initially by higher levels of variation, due to self-incompatibility. In the following steps, a possible selection pressure can affect randomly the genotypic structure of wild cherry by increasing the homozygosity. There is not among population a well defined geographic characterization, as suggested by genetic distances, therefore homogeneous seed harvest could be established an area larger than geographic and administrative borders. On this way we could have reproductive material with a wide genetic base and environmental adaptability. To

  2. Population genetic diversity and structure analysis of wild apricot (Prunus armeniaca L.) revealed by ssr markers in the Tien-Shan mountains of China

    International Nuclear Information System (INIS)

    Hu, X.; Ni, B.; Zheng, P.; Li, M.

    2018-01-01

    The simple sequence repeat markers were used to investigate the population genetic diversity and structure of 212 germplasm samples from 14 apricot (Prunus armeniaca) populations in the western of Tien-Shan Mountains, Sinkiang, China. The relatively high expected heterozygosity and Shannon's diversity index indicated the apricot populations maintained a high level of genetic diversity (He = 0.6109, I = 1.2208), with the population in Tuergen ditch of Xinyuan County having the highest genetic diversity index. A high level of intra-population genetic differentiation (91.51%) and a lower level of inter-population genetic differentiation were occurred, as well as a moderate but steady inter-population gene flow (Nm = 2.3735). The self-incompatible pattern, wide distribution, and long-distance pollen transmission via insects and gale are the main factors underlying the genetic variation structure. The UPGMA cluster analysis and genetic structure analysis showed that apricot germplasm could be divided into two or four groups, which was basically consistent with the geographic distribution pattern. The inter-population genetic distance and geographic distance showed a significant correlation (r = 0.2658, p<0.05). (author)

  3. Effects of different products of peach (Prunus persica L. Batsch) from a variety developed in southern Brazil on oxidative stress and inflammatory parameters in vitro and ex vivo

    Science.gov (United States)

    Gasparotto, Juciano; Somensi, Nauana; Bortolin, Rafael Calixto; Moresco, Karla Suzana; Girardi, Carolina Saibro; Klafke, Karina; Rabelo, Thallita Kelly; Morrone, Maurilio Da Silva; Vizzotto, Márcia; Raseira, Maria do Carmo Bassols; Moreira, José Claudio Fonseca; Gelain, Daniel Pens

    2014-01-01

    Antioxidant, anti-glycation and anti-inflammatory activities of fresh and conserved peach fruits (Prunus persica L. Batsch) were compared. Fresh peach pulps, peels, preserve peach pulps and the preserve syrup were prepared at equal concentrations. Rat liver, kidney and brain cortex tissue slices were pre-incubated with peach samples, subjected to oxidative stress with FeSO4 and hydrogen peroxide. Fresh peach pulps and peel conferred higher protection against cytotoxicity and oxidative stress than preserve peach pulps in most tissues. Release of tumor necrosis factor-α and interleukin-1β was also significantly decreased by Fresh peach pulps and peel, followed by preserve peach pulps. Total phenolic determination and HPLC analysis of carotenoids showed that the content of secondary metabolites in Fresh peach pulps and peel is significantly higher than in preserve peach pulps, while the syrup had only small or trace amounts of these compounds. Fresh peach pulps and Peel demonstrated high antioxidant and anti-inflammatory effects preventing against induced damage. PMID:25320458

  4. The coat protein of prunus necrotic ringspot virus specifically binds to and regulates the conformation of its genomic RNA.

    Science.gov (United States)

    Aparicio, Frederic; Vilar, Marçal; Perez-Payá, Enrique; Pallás, Vicente

    2003-08-15

    Binding of coat protein (CP) to the 3' nontranslated region (3'-NTR) of viral RNAs is a crucial requirement to establish the infection of Alfamo- and Ilarviruses. In vitro binding properties of the Prunus necrotic ringspot ilarvirus (PNRSV) CP to the 3'-NTR of its genomic RNA using purified E. coli- expressed CP and different synthetic peptides corresponding to a 26-residue sequence near the N-terminus were investigated by electrophoretic mobility shift assays. PNRSV CP bound to, at least, three different sites existing on the 3'-NTR. Moreover, the N-terminal region between amino acid residues 25 to 50 of the protein could function as an independent RNA-binding domain. Single exchange of some arginine residues by alanine eliminated the RNA-interaction capacity of the synthetic peptides, consistent with a crucial role for Arg residues common to many RNA-binding proteins possessing Arg-rich domains. Circular dichroism spectroscopy revealed that the RNA conformation is altered when amino-terminal CP peptides bind to the viral RNA. Finally, mutational analysis of the 3'-NTR suggested the presence of a pseudoknotted structure at this region on the PNRSV RNA that, when stabilized by the presence of Mg(2+), lost its capability to bind the coat protein. The existence of two mutually exclusive conformations for the 3'-NTR of PNRSV strongly suggests a similar regulatory mechanism at the 3'-NTR level in Alfamo- and Ilarvirus genera.

  5. Novel insights for permeant lead structures through in vitro skin diffusion assays of Prunus lusitanica L., the Portugal Laurel

    Science.gov (United States)

    Costa, Maria do Céu; Duarte, Patrícia; Neng, Nuno R.; Nogueira, José M. F.; Costa, Filomena; Rosado, Catarina

    2015-01-01

    As a contribution for the generation of libraries in which a natural product (NP) is used as the guiding structure, this work sought to investigate molecular features of triterpenes as deliver leads to cross the stratum corneum at a significant rate. Seeking a bioguided investigation of the dermocosmetic lead-like potential of triterpenes in Prunus lusitanica L., various extracts were obtained by two different methods (Soxhlet extractor and Accelerated Solvent Extraction-ASE) and analyzed by GC-MS and NMR. In vitro assays were conducted to quantify the friedelin 1 and crude plant extract permeation through a membrane of polydimethylsiloxane (PDMS), as well as their skin penetration enhancement capacity using two model molecules, caffeine 19 and ibuprofen 20. Friedelin 1 was identified as the major component (16-77%, GC) with isolated yield of 51% w/w (94%, GC) from Soxhlet residue (1.7% p/p) of the dried aerial parts of the plant harvested when in early flowering stage. Friedelin 1 promoted the penetration of the lipophilic molecule 20, however, it did not influence the permeation of the hydrophilic permeant 20. On the other hand, the crude extract acted as a retardant of the penetration of both substances. Molecular characteristics for the applicability of P. lusitanica L. in the development of dermocosmetics, as well as a new potential use for friedelin 1 in particular, are demonstrated. Probable mechanisms for chemical penetration enhancement using triterpenes as models for transdermal administration are herein discussed.

  6. The RNase PD2 gene of almond (Prunus dulcis) represents an evolutionarily distinct class of S-like RNase genes.

    Science.gov (United States)

    Ma, R C; Oliveira, M M

    2000-07-01

    A cDNA for an S-like RNase (RNase PD2) has been isolated from a pistil cDNA library of Prunus dulcis cv. Ferragnés. The cDNA encodes an acidic protein of 226 amino acid residues with a molecular weight of 25 kDa. A potential N-glycosylation site is present at the N-terminus in RNase PD2. A signal peptide of 23 amino acid residues and a transmembrane domain are predicted. The two active-site histidines present in enzymes of the T2/S RNase superfamily were detected in RNase PD2. Its amino acid sequence shows 71.2% similarity to RNSI of Arabidopsis and RNase T2 of chickpea, respectively. Northern blotting and RT-PCR analyses indicate that PD2 is expressed predominantly in petals, pistils of open flowers and leaves of the almond tree. Analyses of shoots cultured in vitro suggested that the expression of RNase PD2 is associated with phosphate starvation. Southern analysis detected two sequences related to RNase PD2 in the P. dulcis genome. RFLP analysis showed that S-like RNase genes are polymorphic in different almond cultivars. The PD2 gene sequence was amplified by PCR and two introns were shown to interrupt the coding region. Based on sequence analysis, we have defined three classes of S-like RNase genes, with the PD2 RNase gene representing a distinct class. The significance of the structural divergence of S-like RNase genes is further discussed.

  7. Purification and chemical characterisation of a cell wall-associated β-galactosidase from mature sweet cherry (Prunus avium L.) fruit.

    Science.gov (United States)

    Gerardi, Carmela; Blando, Federica; Santino, Angelo

    2012-12-01

    Using four different chromatographic steps, β-galactosidase was purified from the ripe fruit of sweet cherry to apparent electrophoretic homogeneity with approximately 131-fold purification. The Prunus avium β-galactosidase showed an apparent molecular mass of about 100 kDa and consisted of four different active polypeptides with pIs of about 7.9, 7.4, 6.9 and 6.4 as estimated by native IEF and β-galactosidase-activity staining. The active polypeptides were individually excised from the gel and subjected to SDS-PAGE. Each of the four native enzymes showing β-galactosidase activity was composed of two polypeptides with an estimated mass of 54 and 33 kDa. Both of these polypeptides were subjected to N-terminal amino acid sequence analysis. The 54 kDa polypeptide of sweet cherry β-galactosidase showed a 43% identity with the 44 kDa subunit of persimmon and apple β-galactosidases and the 48 kDa subunit of carambola galactosidase I. The sweet cherry β-galactosidase exhibited a strict specificity towards p-nitrophenyl β-D-galactopyranoside, a pH optimum of 4.0 and K(m) and V(max) values of 0.42 mM and 4.12 mmol min(-1) mg(-1) of protein respectively with this substrate. The enzyme was also active towards complex glycans. Taken together the results of this study prompted a role for this class of enzymes on sweet cherry fruit ripening and softening. Copyright © 2012 Elsevier Masson SAS. All rights reserved.

  8. The coat protein of prunus necrotic ringspot virus specifically binds to and regulates the conformation of its genomic RNA

    International Nuclear Information System (INIS)

    Aparicio, Frederic; Vilar, Marcal; Perez-Paya, Enrique; Pallas, Vicente

    2003-01-01

    Binding of coat protein (CP) to the 3' nontranslated region (3'-NTR) of viral RNAs is a crucial requirement to establish the infection of Alfamo- and Ilarviruses. In vitro binding properties of the Prunus necrotic ringspot ilarvirus (PNRSV) CP to the 3'-NTR of its genomic RNA using purified E. coli- expressed CP and different synthetic peptides corresponding to a 26-residue sequence near the N-terminus were investigated by electrophoretic mobility shift assays. PNRSV CP bound to, at least, three different sites existing on the 3'-NTR. Moreover, the N-terminal region between amino acid residues 25 to 50 of the protein could function as an independent RNA-binding domain. Single exchange of some arginine residues by alanine eliminated the RNA-interaction capacity of the synthetic peptides, consistent with a crucial role for Arg residues common to many RNA-binding proteins possessing Arg-rich domains. Circular dichroism spectroscopy revealed that the RNA conformation is altered when amino-terminal CP peptides bind to the viral RNA. Finally, mutational analysis of the 3'-NTR suggested the presence of a pseudoknotted structure at this region on the PNRSV RNA that, when stabilized by the presence of Mg 2+ , lost its capability to bind the coat protein. The existence of two mutually exclusive conformations for the 3'-NTR of PNRSV strongly suggests a similar regulatory mechanism at the 3'-NTR level in Alfamo- and Ilarvirus genera

  9. Genetic Diversity and Structure of the Apiosporina morbosa Populations on Prunus spp.

    Science.gov (United States)

    Zhang, Jinxiu; Fernando, W G Dilantha; Remphrey, William R

    2005-08-01

    ABSTRACT Populations of Apiosporina morbosa collected from 15 geographic locations in Canada and the United States and three host species, Prunus virginiana, P. pensylvanica, and P. padus, were evaluated using the sequence-related amplified polymorphism (SRAP) technique to determine their genetic diversity and population differentiation. Extensive diversity was detected in the A. morbosa populations, including 134 isolates from Canada and the United States, regardless of the origin of the population. The number of polymorphic loci varied from 6.9 to 82.8% in the geographic populations, and from 41.4 to 79.3% in the populations from four host genotypes based on 58 polymorphic fragments. In all, 44 to 100% of isolates in the geographic populations and 43.6 to 76.2% in populations from four host genotypes represented unique genotypes. Values of heterozygosity (H) varied from 2.8 to 28.3% in the geographic populations and 10.2 to 26.1% in the populations from four host genotypes. In general, the A. morbosa populations sampled from wild chokecherry showed a higher genetic diversity than those populations collected from other host species, whereas the populations isolated from cultivated chokecherry, P. virginiana 'Shubert Select', showed a reduction of genetic diversity compared with populations from wild P. virginiana. Significant population differentiation was found among both the geographic populations (P virginiana were closely clustered, and no population differentiation was detected except for the populations from Morris, Morden, and Winnipeg, Manitoba, Canada. Furthermore, the populations from P. virginiana in the same geographic locations had higher genetic identity and closer genetic distance to each other compared with those from different locations. Four populations from P. virginiana, P. pensylvanica, and P. padus, were significantly differentiated from each other (P P> = 0.334). Indirect estimation of gene flow showed that significant restricted gene flow

  10. Physico-chemical characteristics of seed oils extracted from different apricot (Prunus armeniaca L.) varieties from Pakistan

    Energy Technology Data Exchange (ETDEWEB)

    Manzoor, M.; Anwar, F.; Ashraf, M.; Alkharfy, K. M.

    2012-11-01

    The fruit seed oils from four varieties of apricot (Prunus armeniaca L.), namely, Halmas, Nari, Travet and Charmagzi were analyzed for different physico-chemical characteristics. The oil yield from the apricot seeds (kernels) ranged from 32.23-42.51%, while the protein, fiber and ash contents ranged from 13.21-20.90%, 5.13-9.81% and 2.11-3.89%, respectively. The extracted oils had an average iodine value (g of I/100 g of oil) of 96.4-106.3; density at 24 degree centigrade 0.87-0.93 mg/mL; refractive index (40 degree centigrade), 1.4655-1.4790; saponification value, 189.1-199.4 mg of KOH/g oil; unsaponifiable matter, 0.59-0.88%; free fatty acid (mg of KOH/g oil), 0.41-1.28; and color (1-inch cell), 1.31-2.96R 1 14.8-29.8Y. With regard to the oxidation state, the tested oils showed values for specific extinction at 232 and 268 nm, 2.30-3.42 and 0.82-1.04, respectively, while the peroxide value was 1.0-2.32 meq O{sub 2}/kg and, p-anisidine was 1.22-1.90. The major fatty acid found in the oils was oleic acid (62.34-80.97%) followed by linoleic (13.13-30.33%), palmitic (3.35-5.93%), linolenic (0.73-1.03%) and stearic (1.10-1.68%) acids. The contents of {alpha}-, {gamma}-, and {delta}-, tocopherols in the oils ranged from 14.8-40.4, 330.8-520.8 and 28.5-60.2 mg/kg, respectively. The results of our present investigation revealed that apricot seed is a potential source of oil which can be used both for edible and oleo chemical applications. (Author) 55 refs.

  11. The Small-RNA Profiles of Almond (Prunus dulcis Mill. Reproductive Tissues in Response to Cold Stress.

    Directory of Open Access Journals (Sweden)

    Marzieh Karimi

    Full Text Available Spring frost is an important environmental stress that threatens the production of Prunus trees. However, little information is available regarding molecular response of these plants to the frost stress. Using high throughput sequencing, this study was conducted to identify differentially expressed miRNAs, both the conserved and the non-conserved ones, in the reproductive tissues of almond tolerant H genotype under cold stress. Analysis of 50 to 58 million raw reads led to identification of 174 unique conserved and 59 novel microRNAs (miRNAs. Differential expression pattern analysis showed that 50 miRNA families were expressed differentially in one or both of almond reproductive tissues (anther and ovary. Out of these 50 miRNA families, 12 and 15 displayed up-regulation and down-regulation, respectively. The distribution of conserved miRNA families indicated that miR482f harbor the highest number of members. Confirmation of miRNAs expression patterns by quantitative real- time PCR (qPCR was performed in cold tolerant (H genotype alongside a sensitive variety (Sh12 genotype. Our analysis revealed differential expression for 9 miRNAs in anther and 3 miRNAs in ovary between these two varieties. Target prediction of miRNAs followed by differential expression analysis resulted in identification of 83 target genes, mostly transcription factors. This study comprehensively catalogued expressed miRNAs under different temperatures in two reproductive tissues (anther and ovary. Results of current study and the previous RNA-seq study, which was conducted in the same tissues by our group, provide a unique opportunity to understand the molecular basis of responses of almond to cold stress. The results can also enhance the possibility for gene manipulation to develop cold tolerant plants.

  12. The Small-RNA Profiles of Almond (Prunus dulcis Mill.) Reproductive Tissues in Response to Cold Stress.

    Science.gov (United States)

    Karimi, Marzieh; Ghazanfari, Farahnaz; Fadaei, Adeleh; Ahmadi, Laleh; Shiran, Behrouz; Rabei, Mohammad; Fallahi, Hossein

    2016-01-01

    Spring frost is an important environmental stress that threatens the production of Prunus trees. However, little information is available regarding molecular response of these plants to the frost stress. Using high throughput sequencing, this study was conducted to identify differentially expressed miRNAs, both the conserved and the non-conserved ones, in the reproductive tissues of almond tolerant H genotype under cold stress. Analysis of 50 to 58 million raw reads led to identification of 174 unique conserved and 59 novel microRNAs (miRNAs). Differential expression pattern analysis showed that 50 miRNA families were expressed differentially in one or both of almond reproductive tissues (anther and ovary). Out of these 50 miRNA families, 12 and 15 displayed up-regulation and down-regulation, respectively. The distribution of conserved miRNA families indicated that miR482f harbor the highest number of members. Confirmation of miRNAs expression patterns by quantitative real- time PCR (qPCR) was performed in cold tolerant (H genotype) alongside a sensitive variety (Sh12 genotype). Our analysis revealed differential expression for 9 miRNAs in anther and 3 miRNAs in ovary between these two varieties. Target prediction of miRNAs followed by differential expression analysis resulted in identification of 83 target genes, mostly transcription factors. This study comprehensively catalogued expressed miRNAs under different temperatures in two reproductive tissues (anther and ovary). Results of current study and the previous RNA-seq study, which was conducted in the same tissues by our group, provide a unique opportunity to understand the molecular basis of responses of almond to cold stress. The results can also enhance the possibility for gene manipulation to develop cold tolerant plants.

  13. Análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica

    Directory of Open Access Journals (Sweden)

    Yineth Ruiz

    2011-01-01

    Full Text Available El aroma de las frutas se debe a los constituyentes volátiles presentes que, aunque se encuentran en muy bajas concentraciones, contribuyen al aroma global en grados muy diversos. Se hace necesario usar técnicas de aislamiento y concentración que garanticen el análisis de una composición química semejante a la de la fruta. Este trabajo tuvo como objetivo el análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica por el método de evaporación del aroma asistida por solvente (SAFE. Este método utiliza un equipo de destilación conectado a una bomba de alto vacío que ofrece la posibilidad de aislar rápidamente compuestos volátiles sin daño térmico en diferentes matrices alimentarias. La separación e identificación de los compuestos volátiles se realizó por cromatografía de gases-espectrometría de masas (GC-MS. Se identificaron 47 compuestos (6,55 mg/kg de pulpa de fruta, entre ellos 14 alcoholes, 8 aldehídos, 7 ésteres, 5 cetonas, 4 ácidos carboxílicos, 4 hidrocarburos aromáticos, 3 lactonas, un compuesto azufrado y una hidroxicetona; 16 de ellos se informan por primera vez. El acetato de etilo (2,88 mg/kg, etanol (1 mg/kg y ácido octanoico (0,78 mg/kg fueron los constituyentes volátiles mayoritarios de esta variedad de ciruela.

  14. Análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp. domestica

    Directory of Open Access Journals (Sweden)

    Yineth Ruiz

    2011-06-01

    Full Text Available El aroma de las frutas se debe a los constituyentes volátiles presentes que, aunque se encuentran en muy bajas concentraciones, contribuyen al aroma global en grados muy diversos. Se hace necesario usar técnicas de aislamiento y concentración que garanticen el análisis de una composición química semejante a la de la fruta. Este trabajo tuvo como objetivo el análisis de los compuestos volátiles de la ciruela amarilla (Prunus domestica L. ssp.domestica por el método de evaporación del aroma asistida por solvente (SAFE. Este método utiliza un equipo de destilación conectado a una bomba de alto vacío que ofrece la posibilidad de aislar rápidamente compuestos volátiles sin daño térmico en diferentes matrices alimentarias. La separación e identificación de los compuestos volátiles se realizó por cromatografía de gases-espectrometría de masas (GC-MS. Se identificaron 47 compuestos (6,55 mg/kg de pulpa de fruta, entre ellos 14 alcoholes, 8 aldehídos, 7 ésteres, 5 cetonas, 4 ácidos carboxílicos, 4 hidrocarburos aromáticos, 3 lactonas, un compuesto azufrado y una hidroxicetona; 16 de ellos se informan por primera vez. El acetato de etilo (2,88 mg/kg, etanol (1 mg/kg y ácido octanoico (0,78 mg/kg fueron los constituyentes volátiles mayoritarios de esta variedad de ciruela.

  15. Rangewide determinants of population performance in Prunus lusitanica: Lessons for the contemporary conservation of a Tertiary relict tree

    Science.gov (United States)

    Pardo, Adara; Cáceres, Yonatan; Pulido, Fernando

    2018-01-01

    Relict species are an extremely important part of biodiversity and as such studies on the factors that allow their current persistence are required. The aim of this study was to assess the determinants of the distribution and range-wide population performance of the Tertiary relict tree Prunus lusitanica L. This threatened species is confined to Iberia, Northern Morocco and Macaronesia with a fragmented and scattered distribution. Using ecological niche modelling, we calculated the level of range filling across the range and tested its relationship with human impact. We then assessed the relative importance of climatic suitability as obtained through niche modelling, topographic factors and contemporary human impact on range-wide population performance. Results showed that the species occupies only 2.4% of the overall area predicted to be climatically suitable for its presence and the level of range filling varied across regions. A weak negative relationship among range filling and human impact was found. Overall climatic suitability was the strongest predictor of population performance. However, it showed high variability across regions: the effect was positive in Iberia whereas negative but not significant in Macaronesia and Morocco. Human impact showed a significant negative effect and finally topographic factors such as altitude had a minor negative effect. Our results highlight that both climate and human impact play a major role in the current limited range filling and performance of the species. Management plans to minimize anthropogenic disturbances together with reforestation measures are urgently needed in order to conserve this unique species.

  16. Evaluation of different doses of gamma radiation on physicochemical characteristics of peach Prunus persica (cv. Chimarrita) minimally processed

    International Nuclear Information System (INIS)

    Oliveira, Ana Claudia S.; Silva, Lucia C.A.S.; Perecin, Thalita Neme; Arthur, Valter; Harder, Marcia N.C.; Mansi, Debora N.; Canniatti-Brazaca, Solange G.

    2009-01-01

    The objective was to evaluate the effect of different doses of gamma radiation on the physico-chemical characteristics of peach Prunus persica (cv. Chimarrita) minimally processed, to increase the useful life of the fruit. The peaches were purchased at Ceasa of Campinas/SP and taken to the Laboratory of Radiobiology and Environment of CENA/USP (Piracicaba/SP), which were washed in tap water, peeled and cut into four pieces. The pieces of peach were dipped in sodium hypochlorite solution of 15 mL/L for 4 minutes and dry in a plastic support. Then it were placed in plastic containers (polypropylene). Subsequently, they were irradiated in a Cobalt-60 source, type Gammacell-220 (dose rate of 0,543 kGy/hour) with doses of: 0 (control), 1.0 and 2.0 kGy and stored at a temperature of 8 deg C. The experimental was developed entirely at random with 3 replicates for each treatment. For the statistic analysis was using the Tuckey test at 5% level of probability. Subsequently, analysis was carried out: color factors (l, a, b), pH, soluble solids (deg Brix), acidity and vitamin C. The tests were performed at 1, 3 and 6 days after irradiation. According to the results concluded that the analysis of color and acidity there was no significant difference between treatments, however, for the soluble solids (deg Brix), vitamin C and texture significant difference showing a decrease proportional to increasing doses of radiation and storage time. But the pH increased in relation to dose and during the analysis. (author)

  17. Response of Nitrogen and Potassium Fertigation to “Waris” Almond (Prunus dulcis) under Northwestern Himalayan Region of India

    Science.gov (United States)

    Ahmed, N.

    2014-01-01

    A field experiment was conducted on almond (Prunus dulcis) to study the effect of N&K fertigation on growth, yields and leaf nutrient status over two seasons (2011 and 2012) in Srinagar, Jammu and Kashmir, India. There were six treatments, namely, T1—100% recommended dose of fertilizers as soil application, T2—100% RDF through fertigations, T3—75% RDF through fertigation, T4—75% RDF through fertigation (split application), T5—50% RDF through fertigation and T6—50% RDF through fertigation (split application) with three replications under randomized block design. The results indicated that the maximum tree height (3.21 m and 3.56 m), nut weight (2.73 g and 1.94 g), nut yield (2.41 kg/tree and 5.98 kg/tree; 2.67 t/ha and 6.64 t/ha), and leaf nutrient content (2.34 and 2.38% N; 0.14 and 0.17% P; 1.37 and 1.41% K) were recorded in T4 treatment, whereas the highest TCSA of main trunk, primary, secondary, and tertiary branches (72.67 and 90.28 cm2; 16.75 and 24.26 cm2; 3.83 and 7.49 cm2; 0.47 and 1.23 cm2), canopy volume (7.15 and 8.11 m3), and fruit number (990 and 3083/tree) were recorded in T2 in almond variety Waris. PMID:24587708

  18. Response of Nitrogen and Potassium Fertigation to “Waris” Almond (Prunus dulcis under Northwestern Himalayan Region of India

    Directory of Open Access Journals (Sweden)

    Dinesh Kumar

    2014-01-01

    Full Text Available A field experiment was conducted on almond (Prunus dulcis to study the effect of N&K fertigation on growth, yields and leaf nutrient status over two seasons (2011 and 2012 in Srinagar, Jammu and Kashmir, India. There were six treatments, namely, T1—100% recommended dose of fertilizers as soil application, T2—100% RDF through fertigations, T3—75% RDF through fertigation, T4—75% RDF through fertigation (split application, T5—50% RDF through fertigation and T6—50% RDF through fertigation (split application with three replications under randomized block design. The results indicated that the maximum tree height (3.21 m and 3.56 m, nut weight (2.73 g and 1.94 g, nut yield (2.41 kg/tree and 5.98 kg/tree; 2.67 t/ha and 6.64 t/ha, and leaf nutrient content (2.34 and 2.38% N; 0.14 and 0.17% P; 1.37 and 1.41% K were recorded in T4 treatment, whereas the highest TCSA of main trunk, primary, secondary, and tertiary branches (72.67 and 90.28 cm2; 16.75 and 24.26 cm2; 3.83 and 7.49 cm2; 0.47 and 1.23 cm2, canopy volume (7.15 and 8.11 m3, and fruit number (990 and 3083/tree were recorded in T2 in almond variety Waris.

  19. A Review of the Potential of Phytochemicals from Prunus africana (Hook f. Kalkman Stem Bark for Chemoprevention and Chemotherapy of Prostate Cancer

    Directory of Open Access Journals (Sweden)

    Richard Komakech

    2017-01-01

    Full Text Available Prostate cancer remains one of the major causes of death worldwide. In view of the limited treatment options for patients with prostate cancer, preventive and treatment approaches based on natural compounds can play an integral role in tackling this disease. Recent evidence supports the beneficial effects of plant-derived phytochemicals as chemopreventive and chemotherapeutic agents for various cancers, including prostate cancer. Prunus africana has been used for generations in African traditional medicine to treat prostate cancer. This review examined the potential roles of the phytochemicals from P. africana, an endangered, sub-Saharan Africa plant in the chemoprevention and chemotherapy of prostate cancer. In vitro and in vivo studies have provided strong pharmacological evidence for antiprostate cancer activities of P. africana-derived phytochemicals. Through synergistic interactions between different effective phytochemicals, P. africana extracts have been shown to exhibit very strong antiandrogenic and antiangiogenic activities and have the ability to kill tumor cells via apoptotic pathways, prevent the proliferation of prostate cancer cells, and alter the signaling pathways required for the maintenance of prostate cancer cells. However, further preclinical and clinical studies ought to be done to advance and eventually use these promising phytochemicals for the prevention and chemotherapy of human prostate cancer.

  20. Effects of New Dietary Fiber from Japanese Apricot (Prunus mume Sieb. et Zucc. on Gut Function and Intestinal Microflora in Adult Mice

    Directory of Open Access Journals (Sweden)

    Nobuki Gato

    2011-03-01

    Full Text Available Much attention has been focused recently on functional foods. Ume, the Japanese name for the apricot of Prunus mume Sieb. et Zucc., is an example of a Japanese traditional functional food. There are, however, few reports on the effects of fiber from this fruit on bowel function. With this objective, we prepared ume fiber to test the hypothesis that it can change gut function and intestinal flora in mice. Mice were fed an ume fiber (UF or cellulose (CF diet (control for 40 days. The fecal weight, fecal lipids, plasma lipids and cecal composition of the microflora were analyzed. The amount of feces was significantly greater in the UF group than in the CF group (p < 0.01. The fecal lipids content (% DW of the feces sampled on the final days of the experiment were significantly greater in the UF group than in the CF group (p < 0.01. Plasma non-esterified fatty acids (NEFA concentrations tended to be lower in the UF compared to the CF group (p = 0.058. Occupation ratios of Bacteroides and Clostridium cluster IV were significantly greater in the cecal flora of the UF group. Our results suggest that ume fiber possesses the fecal lipid excretion effects and feces bulking effects.

  1. A review on the complexity of insect-plant interactions under varying levels of resources and host resistance: the case of Myzus persicae-Prunus persica

    Directory of Open Access Journals (Sweden)

    Verdugo, JA.

    2016-01-01

    Full Text Available Introduction. Insect-plant interactions are affected directly or indirectly by stress factors. The effect of environmental resource availability on insect-plant interactions is here reviewed. Subsequently, the analysis focuses on aphid-host plant interactions, particularly in the system composed by the green peach aphid Myzus persicae and its primary host plant Prunus persica. Literature. Plant defenses arise in two ways: resistance and tolerance, both are affected by abiotic factors. The information gathered from studies (n = 29 on plant-aphid interactions addressing the reduction in water availability on plant resistance, showed that in 41,4% of the studies, drought stress elicits lower resistance, while 34.5%, 20.1% and 3.4%, showed higher, no change and conditional effects on plant resistance, respectively. Conclusions. Water stress elicits mixed effects on plant resistance to aphids. However, the literature review also suggests that cultural practices play a role in the fate of the peach-aphid interactions, whereas the development of predictive models aimed to assist crop-pest management systems still requires more basic information. Aphid responses to plant defenses under stressed conditions are still largely unexplored.

  2. Genetic determinism of phenological traits highly affected by climate change in Prunus avium: flowering date dissected into chilling and heat requirements.

    Science.gov (United States)

    Castède, Sophie; Campoy, José Antonio; García, José Quero; Le Dantec, Loïck; Lafargue, Maria; Barreneche, Teresa; Wenden, Bénédicte; Dirlewanger, Elisabeth

    2014-04-01

    The present study investigated the genetic determinism of flowering date (FD), dissected into chilling (CR) and heat (HR) requirements. Elucidation of the genetic determinism of flowering traits is crucial to anticipate the increasing of ecological misalignment of adaptative traits with novel climate conditions in most temperate-fruit species. CR and HR were evaluated over 3 yr and FD over 5 yr in an intraspecific sweet cherry (Prunus avium) F1 progeny, and FD over 6 yr in a different F1 progeny. One quantitative trait locus (QTL) with major effect and high stability between years of evaluation was detected for CR and FD in the same region of linkage group (LG) 4. For HR, no stable QTL was detected. Candidate genes underlying the major QTL on LG4 were investigated and key genes were identified for CR and FD. Phenotypic dissection of FD and year repetitions allowed us to identify CR as the high heritable component of FD and a high genotype × environment interaction for HR. QTLs for CR reported in this study are the first described in this species. Our results provide a foundation for the identification of genes involved in CR and FD in sweet cherry which could be used to develop ideotypes adapted to future climatic conditions. © 2014 INRA. New Phytologist © 2014 New Phytologist Trust.

  3. Effect of Salicylic Acid on Alleviating of Electrolyte Leakage and Flower Organ Damage in Apricot (Prunus armeniaca L. cv. ‘Shahroudi’

    Directory of Open Access Journals (Sweden)

    Morteza ALIREZAIE NOGHONDAR

    2013-02-01

    Full Text Available One of the most important limiting factors in spread of apricot in Iran is late spring frost, which damages flower bud and decrease total yield of crop. It has been found that salicylic acid (SA plays a beneficial role during plant response to chilling and freezing stresses. To evaluate the effects of salicylic acid on alleviating of cold stress, the flower buds (FBs of Prunus armeniaca L. cv. ‘Shahroudi’ were sprayed at pink cluster stage with SA at 4 levels (0, 0.5, 1 and 2 mM and were then exposed to artificial cold stress (4 h at -4°C or without cold stress (+ 25. Experimental attributes including electrolyte leakage of FBs and percentage of damage (PD of pistil, anthers and petals to temperature treatments were determined. The results showed that at -4°C the lowest and highest PD and EL of FBs were observed in application of 0.5 and 0 mM SA, respectively. The highest and lowest PD of flower organ and EL were obtained in application of 0 and 2 mM SA, respectively at +25°C. Based on the results of this experiment, SA alleviates the negative effect of cold stress on electrolyte leakage and flower organ damages in apricot cv. ‘Shahroudi’, depending on the concentrations of SA used.

  4. Effects of planting density and bearing-branch composition on the yield of sweet cherry [Prunus avium] grown by hedge-row training

    International Nuclear Information System (INIS)

    Tomita, A.; Shinya, K.; Watanabe, K.; Inomata, M.

    2008-01-01

    To improve the yield of sweet cherries (Prunus avium L.) grown by hedge-row training, the following two methods were compared: increased numbers of spurs and bouquet spurs to improve the spur composition and narrowed row intervals to increase planting density. To develop spurs and bouquet spurs, 30 cm long branches were positioned at 30 cm intervals on lateral branches in addition to the conventional spur development from 5 cm current shoots. Although this measure decreased the number of bouquet spurs, it increased the total number of spurs including the conventional short spurs to improve the yield to 1,024 kg/10a from 557 kg/10a using conventional hedge-row training. However, this method decreased solar radiation in the tree crowns thereby lowering fruit quality. In contrast, increasing planting density from 3-m intervals to 2- or 1.5-m intervals did not affect fruit quality. Moreover, in contrast to a yield of 588 kg/10a when row intervals were 3 m, the row intervals narrowed to 2 m and 1.5 m improved the yield to 881 kg/10a and 1,101 kg/10a, respectively. The above results show that decreasing row intervals is an effective method for increasing the yield of sweet cherries grown by hedge-row training without lowering fruit quality

  5. The Crow Creek Site (39BF11) Massacre: A Preliminary Report,

    Science.gov (United States)

    1981-02-01

    samples investi- gated were collected from the fortification ditch. Choke-cherry ( Prunus virginiana L.) and what is believed to be wolfberry (Symphori...below Vegetable Material: Prunus virginiana L. Choke-cherry Ambrosia sp. Ragweed cf. Symphoricarpos occidentalis Hook. Wolfberry Chenopodium sp...1 Sample from Bone Bed B - Upper Level 7B: Prunus virginiana L. Choke-cherry - 10 pits, 5 half pits, and 10 fragments Ambrosia sp. Ragweed - 3 Rumex

  6. 7 CFR 301.92-2 - Restricted, regulated, and associated articles; lists of proven hosts and associated plant taxa.

    Science.gov (United States)

    2010-01-01

    ... virginiana Witch hazel *Heteromeles arbutifolia Toyon *Kalmia spp. Kalmia—includes all species, hybrids, and... tree Pittosporum undulatum Victorian box Prunus laurocerasus English laurel, cherry laurel Prunus...

  7. Improvement of physico-chemical properties and phenolic compounds bioavailability by concentrating dietary fiber of peach (Prunus persica) juice by-product.

    Science.gov (United States)

    Rodríguez-González, Sarahí; Pérez-Ramírez, Iza F; Castaño-Tostado, Eduardo; Amaya-Llano, Silvia; Rodríguez-García, Mario E; Reynoso-Camacho, Rosalía

    2018-06-01

    This study aimed to concentrate dietary fiber (DF) from peach (Prunus persica) juice by-product (PJBP), to improve its functional properties, and its polyphenols bioavailability. The dietary fiber concentrates (DFCs) were obtained from PJBP using water/ethanol treatments (100:0, 20:80, 50:50, 80:20, and 0:100, v/v) at 1:5 ratio (wet weight/solvent, w/v) for 5 and 20 min at 21 °C. All treatments concentrated condensed tannins, total and insoluble DF, with the highest content found with 100% H 2 O treatment. The major polyphenols of DFC were 4-O-caffeoylquinic, chlorogenic, and 1,5-di-O-caffeoylquinic acids. Water and oil retention capacity and maximum glucose diffusion rate were improved mainly with 100% H 2 O treatment. Healthy rats were fed with a standard diet supplemented with 8% of PJBP, DFC obtained with 100% H 2 O for 5 min, or DFC obtained with 20% EtOH for 5 min. Gastrointestinal digesta weight and viscosity were increased in animals supplemented with 100% H 2 O DFC. Moreover, the urinary excretion of polyphenol metabolites, mainly glucuronide and sulfate conjugates, was increased with this treatment, indicating a greater bioavailability of PJBP polyphenols, which was associated with an increased dietary fiber porosity. Water treatment could be used to potentiate PJBP functional properties and polyphenols bioavailability. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.

  8. Physiological and foliar injury responses of Prunus serotina, Fraxinus americana, and Acer rubrum seedlings to varying soil moisture and ozone

    International Nuclear Information System (INIS)

    Schaub, M.; Skelly, J.M.; Steiner, K.C.; Davis, D.D.; Pennypacker, S.P.; Zhang, J.; Ferdinand, J.A.; Savage, J.E.; Stevenson, R.E.

    2003-01-01

    High soil water availability favors ozone uptake, increases foliar injury, and exacerbates the negative ozone effect on gas exchange of seedlings of deciduous tree species. - Sixteen black cherry (Prunus serotina, Ehrh.), 10 white ash (Fraxinus americana, L.) and 10 red maple (Acer rubrum, L.) 1-year old seedlings were planted per plot in 1997 on a former nursery bed within 12 open-top chambers and six open plots. Seedlings were exposed to three different ozone scenarios (ambient air: 100% O 3 ; non-filtered air: 98% ambient O 3 ; charcoal-filtered air: 50% ambient O 3 ) within each of two different water regimes (nine plots irrigated, nine plots non-irrigated) during three growing seasons. During the 1998 and 1999 growing season, leaf gas exchange, plant water relations, and foliar injury were measured. Climatic data, ambient- and chamber-ozone-concentrations were monitored. We found that seedlings grown under irrigated conditions had similar (in 1998) but significantly higher gas exchange rates (in 1999) than seedlings grown within non-irrigated plots among similar ozone exposures. Cherry and ash had similar ozone uptake but cherry developed more ozone-induced injury (<34% affected leaf area, LAA) than ash (<5% LAA), while maple rarely showed foliar injury, indicating the species differed in ozone sensitivity. Significantly more severe injury on seedlings grown under irrigated conditions than seedlings grown under non-irrigated conditions demonstrated that soil moisture altered seedling responses to ambient ozone exposures

  9. Comparison of the genetic determinism of two key phenological traits, flowering and maturity dates, in three Prunus species: peach, apricot and sweet cherry.

    Science.gov (United States)

    Dirlewanger, E; Quero-García, J; Le Dantec, L; Lambert, P; Ruiz, D; Dondini, L; Illa, E; Quilot-Turion, B; Audergon, J-M; Tartarini, S; Letourmy, P; Arús, P

    2012-11-01

    The present study investigates the genetic determinism of flowering and maturity dates, two traits highly affected by global climate change. Flowering and maturity dates were evaluated on five progenies from three Prunus species, peach, apricot and sweet cherry, during 3-8 years. Quantitative trait locus (QTL) detection was performed separately for each year and also by integrating data from all years together. High heritability estimates were obtained for flowering and maturity dates. Several QTLs for flowering and maturity dates were highly stable, detected each year of evaluation, suggesting that they were not affected by climatic variations. For flowering date, major QTLs were detected on linkage groups (LG) 4 for apricot and sweet cherry and on LG6 for peach. QTLs were identified on LG2, LG3, LG4 and LG7 for the three species. For maturity date, a major QTL was detected on LG4 in the three species. Using the peach genome sequence data, candidate genes underlying the major QTLs on LG4 and LG6 were investigated and key genes were identified. Our results provide a basis for the identification of genes involved in flowering and maturity dates that could be used to develop cultivar ideotypes adapted to future climatic conditions.

  10. Free radical scavenging capacity and antioxidant activity of methanolic and ethanolic extracts of plum (Prunus domestica L. in both fresh and dried samples

    Directory of Open Access Journals (Sweden)

    Amin Morabbi Najafabad

    2014-09-01

    Full Text Available Objectives: Consumption of fruits, such as plums and prunes, is useful in treating blood circulation disorder, measles, digestive disorder, and prevention of cancer, diabetes, and obesity. The paper presents a description of antioxidant and antiradical capacity of plum (Prunus domestica L. in both fresh and dried samples. Materials and Methods: Samples were mixed with methanol and ethanol (as solvents and were extracted on magnetic shaker, separately. The experiments were carried out to measure the Total Phenolic Content (TPC, Total Flavonoid Content (TFC, Total Antioxidant Capacity (TAC, Reducing Power Assay (RPA, Chain Breaking Activity (CBA, and quantity of Malondialdehyde (MDA, 2,2-Diphenyl-1-Picrylhydrazyl (DPPH,Nitric Oxide (NO,Hydrogen peroxide (H2O2 and superoxide(O2- radicals inhibition. Results: The results showed that the highest values for the TPC, TFC,TAC, RPA, CBA, DPPH, and NO were related to ethanolic extractsof dried sample which showed statistically significant differences (p2O2 and O2-were related to ethanolic extracts of fresh sample. The correlations data were analyzed among all parameters and the TPC and TFC had a significant correlation (r2=0.977. Moreover, it was found that methanol was more successful in extraction procedure than ethanol (p

  11. Pectin of Prunus domestica L. alters sulfated structure of cell-surface heparan sulfate in differentiated Caco-2 cells through stimulation of heparan sulfate 6-O-endosulfatase-2.

    Science.gov (United States)

    Nishida, Mitsutaka; Murata, Kazuma; Kanamaru, Yoshihiro; Yabe, Tomio

    2014-01-01

    Although previous reports have suggested that pectin induces morphological changes of the small intestine in vivo, the molecular mechanisms have not been elucidated. As heparan sulfate plays important roles in development of the small intestine, to verify the involvement of heparan sulfate (HS) in the pectin-induced morphological changes of the small intestine, the effects of pectin from Prunus domestica L. on cell-surface HS were investigated using differentiated Caco-2 cells. Disaccharide compositional analysis revealed that sulfated structures of HS were markedly changed by pectin administration. Real-time RT-PCR showed that pectin upregulated human HS 6-O-endosulfatase-2 (HSulf-2) expression and markedly inhibited HSulf-1 expression. Furthermore, inhibition analysis suggested that pretreatment with fibronectin III1C fragment, RGD peptide, and ERK1/2 inhibitor suppressed pectin-induced HSulf-2 expression. These observations indicate that pectin induced the expression of HSulf-2 through the interaction with fibronectin, α5β1 integrin, and ERK1/2, thereby regulating the sulfated structure of HS on differentiated Caco-2 cells.

  12. Comprehensive Cloning of Prunus mume Dormancy Associated MADS-Box Genes and Their Response in Flower Bud Development and Dormancy

    Directory of Open Access Journals (Sweden)

    Kai Zhao

    2018-02-01

    Full Text Available Dormancy Associated MADS-box genes are SVP/MADs-box members and supposed to play crucial roles in plant dormancy of perennial species. In Prunus mume, PmDAM6 has been previously identified to induce plant dormancy. In the current study, six PmDAMs were cloned in P. mume and functionally analyzed in yeast and tobacco to detect the roles of the genes paralogous to PmDAM6. The expression patterns together with sequence similarities indicate that PmDAMs are divided into two sub-clades within SVP group. Moreover, PmDAMs are verified to take part in the development of different plant organs, specifically the flower buds, in some intricate patterns. Furthermore, the PmDAM proteins are found to have special functions by forming corresponding protein complex during the development of flower bud and induction of dormancy. In particular, when PmDAM1 dominating in flower bud in the warm months, the protein complexes are consisted of PmDAM1 itself or with PmDAM2. With the decrease temperatures in the following months, PmDAM6 was found to be highly expressed and gradually changed the complex structure to PmDAM6-protein complex due to strong binding tendencies with PmDAM1 and PmDAM3. Finally, the homodimers of PmDAM6 prevailed to induce the dormancy. The results obtained in the current study highlight the functions of PmDAMs in the tissue development and dormancy, which provide available suggestions for further explorations of protein-complex functions in association with bud growth and dormancy.

  13. Spatial and temporal assessment of pollen- and seed-mediated gene flow from genetically engineered plum Prunus domestica.

    Directory of Open Access Journals (Sweden)

    Ralph Scorza

    Full Text Available Pollen flow from a 0.46 ha plot of genetically engineered (GE Prunus domestica located in West Virginia, USA was evaluated from 2000-2010. Sentinel plum trees were planted at distances ranging from 132 to 854 m from the center of the GE orchard. Plots of mixed plum varieties and seedlings were located at 384, 484 and 998 m from the GE plot. Bee hives (Apis mellifera were dispersed between the GE plum plot and the pollen flow monitoring sites. Pollen-mediated gene flow from out of the GE plum plot to non-GE plums under the study conditions was low, only occurring at all in 4 of 11 years and then in only 0.31% of the 12,116 seeds analyzed. When it occurred, gene flow, calculated as the number of GUS positive embryos/total embryos sampled, ranged from 0.215% at 132 m from the center of the GE plum plot (28 m from the nearest GE plum tree to 0.033-0.017% at longer distances (384-998 m. Based on the percentage of GUS positive seeds per individual sampled tree the range was 0.4% to 12%. Within the GE field plot, gene flow ranged from 4.9 to 39%. Gene flow was related to distance and environmental conditions. A single year sample from a sentinel plot 132 m from the center of the GE plot accounted for 65% of the total 11-year gene flow. Spatial modeling indicated that gene flow dramatically decreased at distances over 400 m from the GE plot. Air temperature and rainfall were, respectively, positively and negatively correlated with gene flow, reflecting the effects of weather conditions on insect pollinator activity. Seed-mediated gene flow was not detected. These results support the feasibility of coexistence of GE and non-GE plum orchards.

  14. Simultaneous quantification by HPLC of the phenolic compounds for the crude drug of Prunus serotina subsp. capuli.

    Science.gov (United States)

    Rivero-Cruz, Blanca

    2014-08-01

    Prunus serotina Ehrenb. subsp. capuli (Cav.) McVaugh (Rosaceae), commonly known as "capulin", is a native North American tree, commercialized and used in folk medicine for the treatment of the hypertension, gastrointestinal illnesses, and cough. This work developed a suitable HPLC method for quantifying the major active constituents of the infusion of P. serotina, the most important preparation consumed by populations around the world. The analytical method was performed using a Fortis-RP column (150 mm × 4.6 mm; film thickness 5 µm). The mobile phase consisted of an isocratic acetate buffer solution (pH 2.7; A) and methanol (B) (65:35 v/v) at a flow rate of 1.0 mL min(-1). The proposed method was applied to the quantification of 1-3 in several samples of the leaves of P. serotina. The results indicated that amounts of 1-3 in the samples analyzed are uniform, and greater amounts of chlorogenic acid (2; 479.9 ± 33.6 µg g(-1), dry matter) along with hyperoside (1; 185.7 ± 55.3 µg g(-1), dry matter) were present. On the other hand, benzaldehyde (3; 118.2 ± 12.1 µg g(-1) dry matter) was found to be in lower concentration. A simple, sensitive, precise, and reproducible HPLC method for the simultaneous quantification of 1-3 in P. serotina was developed and validated. This is the first report on the quantification of 1-3 as active principles, and compound 1 was selected as a marker of P. serotina, which could be useful to guarantee the quality of the crude drug and herbal products.

  15. Mites fluctuation population on peach tree (Prunus persica (L. Batsch and in associated plants

    Directory of Open Access Journals (Sweden)

    Carla Rosana Eichelberger

    2011-09-01

    Full Text Available Despite the importance of peach (Prunus persica (L. Batsch in Rio Grande do Sul, little is known about mites fluctuation population considered important to this crop. The objective of this study was to know the population diversity and fluctuation of mite species associated with Premier and Eldorado varieties in Roca Sales and Venâncio Aires counties, Rio Grande do Sul. The study was conducted from July 2008 to June 2009 when 15 plants were randomly chosen in each area. The plants were divided in quadrants and from each one a branch was chosen from which three leaves were removed: one collected in the apical region, another in the medium and the other in the basal region, totalizing 180 leaves/area. Five of the most abundant associated plants were collected monthly in enough amounts for the screening under the stereoscopic microscope during an hour. A total of 1,124 mites were found belonging to 14 families and 28 species. Tetranychus ludeni Zacher, 1913, Panonychus ulmi (Koch, 1836 and Mononychellus planki (McGregor, 1950 were the most abundant phytophagous mites, whereas Typhlodromalus aripo Deleon, 1967 and Phytoseiulus macropilis (Banks, 1904 the most common predatory mites. The period of one hour under stereoscopic microscope was enough to get a representative sample. In both places evaluated the ecologic indices were low, but little higherin Premier (H' 0.56; EqJ: 0.43 when compared to Eldorado (H' 0.53; EqJ 0.40. In Premier constant species were not observed and accessory only Brevipalpus phoenicis (Geijskes, 1939, T. ludeni and T. aripo. Higher abundance was observed in December and January and bigger amount in April. Already in Eldorado, T. ludeni and P. ulmi were constants. Greater abundance was observed in November and December, whereas grater richness in December and January. In both orchards were not found mites in buds. Tetranychus ludeni is the most abundant phytophagous mites with outbreak population in November, December and

  16. In-vitro free radical scavenging activity of biosynthesized gold and silver nanoparticles using Prunus armeniaca (apricot) fruit extract

    Energy Technology Data Exchange (ETDEWEB)

    Dauthal, Preeti; Mukhopadhyay, Mausumi, E-mail: mausumi_mukhopadhyay@yahoo.com [S.V. National Institute of Technology, Department of Chemical Engineering (India)

    2013-01-15

    In-vitro free radical scavenging activity of biosynthesized gold (Au-NPs) and silver (Ag-NPs) nanoparticles was investigated in the present study. Natural precursor Prunus armeniaca (apricot) fruit extract was used as a reducing agent for the nanoparticle synthesis. The free radical scavenging activity of the nanoparticles were observed by modified 1,1 Prime -diphynyl-2-picrylhydrazyl, DPPH and 2,2 Prime -azinobis (3-ethylbenzothiazoline-6-sulfonic acid), ABTS assay. The synthesized nanoparticles were characterized by UV-Visible spectroscopy, dynamic light scattering, transmission electron microscopy (TEM), X-ray diffraction (XRD), energy dispersive spectroscopy, and fourier transform infrared spectroscopy (FTIR). Appearance of optical absorption peak at 537 nm (2.20 keV) and 435 nm (3 keV) within 0.08 and 0.5 h of reaction time was confirmed the presence of metallic Au and Ag nanoclusters, respectively. Nearly spherical nanoparticles with majority of particle below 20 nm (TEM) for both Au-NPs and Ag-NPs were synthesized. XRD pattern confirmed the existence of pure nanocrystalline Au-NPs while few additional peaks in the vicinity of fcc silver-speculated crystallization of metalloproteins of fruit extract on the surface of the Ag-NPs and vice versa. FTIR spectra was supported the role of amino acids of protein/enzymes of fruit extract for synthesis and stabilization of nanoparticles. Dose-dependent scavenging activity was observed for Au-NPs and Ag-NPs in both DPPH and ABTS in-vitro assay. 50 % scavenging activity for DPPH were 11.27 and 16.18 mg and for ABTS 3.40 and 7.12 mg with Au-NPs and Ag-NPs, respectively.

  17. Effect of Tree Species on Enzyme Secretion by the Shiitake Medicinal Mushroom, Lentinus edodes (Agaricomycetes).

    Science.gov (United States)

    Plotnikov, Evgeny V; Glukhova, Lubov B; Sokolyanskaya, Ludmila O; Karnachuk, Olga V; Solioz, Marc

    2016-01-01

    We compared cold and hot wood extracts of 3 endemic Siberian trees-namely, Prunus padus (bird cherry), Populus tremula (aspen), and Betula sp. (birch)-on biomass production and laccase and peroxidase secretion in submerged cultures by the medicinal mushroom Lentinus edodes. Of the conditions tested, only hot Prunus extracts stimulated biomass production, whereas all extracts stimulated laccase and peroxidase secretion, albeit to different extents. A large, differential stimulation of manganese peroxidase was observed by hot Prunus extracts. The results highlight important differences between tree species in the stimulation of biomass and enzyme production by L. edodes and point to potentially interesting stimulatory factors present in hot Prunus extracts. These findings are of relevance in the use of L. edodes for medicinal or biotechnological applications.

  18. Application of reflectance colorimeter measurements and infrared spectroscopy methods to rapid and nondestructive evaluation of carotenoids content in apricot (Prunus armeniaca L.).

    Science.gov (United States)

    Ruiz, David; Reich, Maryse; Bureau, Sylvie; Renard, Catherine M G C; Audergon, Jean-Marc

    2008-07-09

    The importance of carotenoid content in apricot (Prunus armeniaca L.) is recognized not only because of the color that they impart but also because of their protective activity against human diseases. Current methods to assess carotenoid content are time-consuming, expensive, and destructive. In this work, the application of rapid and nondestructive methods such as colorimeter measurements and infrared spectroscopy has been evaluated for carotenoid determination in apricot. Forty apricot genotypes covering a wide range of peel and flesh colors have been analyzed. Color measurements on the skin and flesh ( L*, a*, b*, hue, chroma, and a*/ b* ratio) as well as Fourier transform near-infrared spectroscopy (FT-NIR) on intact fruits and Fourier transform mid-infrared spectroscopy (FT-MIR) on ground flesh were correlated with the carotenoid content measured by high-performance liquid chromatography. A high variability in color values and carotenoid content was observed. Partial least squares regression analyses between beta-carotene content and provitamin A activity and color measurements showed a high fit in peel, flesh, and edible apricot portion (R(2) ranged from 0.81 to 0.91) and low prediction error. Regression equations were developed for predicting carotenoid content by using color values, which appeared as a simple, rapid, reliable, and nondestructive method. However, FT-NIR and FT-MIR models showed very low R(2) values and very high prediction errors for carotenoid content.

  19. CRESCIMENTO DE MUDAS DE Prunus brasiliensis (Cham. & Schltdl. D. Dietr. EM SUBSTRATOS À BASE DE LODO DE ESGOTO COMPOSTADO E FERTILIZANTE MINERAL

    Directory of Open Access Journals (Sweden)

    Maurício Bergamini Scheer

    2012-01-01

    Full Text Available The increasing amount of solid waste generates the need for its use. An opportunity is the use of sewage sludge to attend the demand for alternative inputs in the agricultural and forestry practices. The aim of thisstudy was to evaluate the performance of Prunus brasiliensis (Cham. & Schltdl. D. Dietr. (pessegueiro - bravo grown on substrates prepared from aerobic sewage sludge composted with ground tree pruningand with different levels of a granulated fertilizer, and to compare its performance with those grown on commercial substrate, which is widely used in forest nurseries. The experiment was conducted in a shadehouse (from July/08 to Oct/08 and in an outdoor growing area (from Nov/08 to Feb/09 at Water and Sanitation Company of Paraná, located in Araucária, southern Brazil. Three different substrates were used: commercial substrate, consisting of composted pine bark and vermiculite, and 3:1 (v:v and 2:1 (v:v composted substrate based on crushed tree pruning and sewage sludge. The following variables were measured: seedling height, diameter and dry biomass of leaves and branches. The results showed higher growth rates of seedlings grown on substrates containing sewage sludge than on those grown on commercial substrate. Both composts with sewage sludge, using the two levels of fertilization (2.7 and 4 g dm-3, present similar results for the majority of the variables tested.

  20. Virus Diseases Infecting Almond Germplasm in Lebanon

    OpenAIRE

    Adeeb Saad; Yusuf Abou-Jawdah; Zahi Kanaan-Atallah

    2000-01-01

    Cultivated and wild almond species were surveyed for virus diseases. Four viruses infected cultivated almonds (Prunus dulcis): Prunus necrotic ringspot virus (PNRSV), Prune dwarf virus (PDV), Apple chlorotic leaf spot virus (ACLSV) and Apple mosaic virus (ApMV). Only ACLSV and ApMV were detected on wild almonds, (Prunus orientalis and P. korschinskii). The occurence of PNRSV or PDV on seeds used for the production of rootstocks, on seedlings in nurseries, and on mother plants reve...

  1. Mites fluctuation population on peach tree (Prunus persica (L. Batsch and in associated plants Flutuação populacional de ácaros na cultura do pessegueiro (Prunus persica (L. Batsch e em plantas associadas

    Directory of Open Access Journals (Sweden)

    Carla Rosana Eichelberger

    2011-09-01

    Full Text Available Despite the importance of peach (Prunus persica (L. Batsch in Rio Grande do Sul, little is known about mites fluctuation population considered important to this crop. The objective of this study was to know the population diversity and fluctuation of mite species associated with Premier and Eldorado varieties in Roca Sales and Venâncio Aires counties, Rio Grande do Sul. The study was conducted from July 2008 to June 2009 when 15 plants were randomly chosen in each area. The plants were divided in quadrants and from each one a branch was chosen from which three leaves were removed: one collected in the apical region, another in the medium and the other in the basal region, totalizing 180 leaves/area. Five of the most abundant associated plants were collected monthly in enough amounts for the screening under the stereoscopic microscope during an hour. A total of 1,124 mites were found belonging to 14 families and 28 species. Tetranychus ludeni Zacher, 1913, Panonychus ulmi (Koch, 1836 and Mononychellus planki (McGregor, 1950 were the most abundant phytophagous mites, whereas Typhlodromalus aripo Deleon, 1967 and Phytoseiulus macropilis (Banks, 1904 the most common predatory mites. The period of one hour under stereoscopic microscope was enough to get a representative sample. In both places evaluated the ecologic indices were low, but little higherin Premier (H' 0.56; EqJ: 0.43 when compared to Eldorado (H' 0.53; EqJ 0.40. In Premier constant species were not observed and accessory only Brevipalpus phoenicis (Geijskes, 1939, T. ludeni and T. aripo. Higher abundance was observed in December and January and bigger amount in April. Already in Eldorado, T. ludeni and P. ulmi were constants. Greater abundance was observed in November and December, whereas grater richness in December and January. In both orchards were not found mites in buds. Tetranychus ludeni is the most abundant phytophagous mites with outbreak population in November, December and

  2. Power, policy and the Prunus africana bark trade, 1972-2015.

    Science.gov (United States)

    Cunningham, A; Anoncho, V F; Sunderland, T

    2016-02-03

    After almost 50 years of international trade in wild harvested medicinal bark from Africa and Madagascar, the example of Prunus africana holds several lessons for both policy and practice in the fields of forestry, conservation and rural development. Due to recent CITES restrictions on P. africana exports from Burundi, Kenya and Madagascar, coupled with the lifting of the 2007 European Union (EU) ban in 2011, Cameroon's share of the global P. africana bark trade has risen from an average of 38% between 1995 and 2004, to 72.6% (658.6 metric tons) in 2012. Cameroon is therefore at the center of this international policy arena. This paper draws upon several approaches, combining knowledge in working with P. africana over a 30-year period with a thorough literature review and updated trade data with "ground-truthing" in the field in 2013 and 2014. This enabled the construction of a good perspective on trade volumes (1991-2012), bark prices (and value-chain data) and the gaps between research reports and practice. Two approaches provided excellent lenses for a deeper understanding of policy failure and the "knowing-doing gap" in the P. africana case. A similar approach to Médard's (1992) analyses of power, politics and African development was taken and secondly, studies of commodity chains that assess the power relations that coalesce around different commodities (Ribot, 1998; Ribot and Peluso, 2003). Despite the need to conserve genetically and chemically diverse P. africana, wild populations are vulnerable, even in several "protected areas" in Burundi, Cameroon, the Democratic Republic of Congo and in the forest reserves of Madagascar. Secondly, hopes of decentralized governance of this forest product are misplaced due to elite capture, market monopolies and subsidized management regimes. At the current European price, for P. africana bark (US$6 per kg) for example, the 2012 bark quota (658.675t) from Cameroon alone was worth over US$3.9 million, with the majority of

  3. Evaluation of the glycoside hydrolase activity of a Brettanomyces strain on glycosides from sour cherry (Prunus cerasus L.) used in the production of special fruit beers.

    Science.gov (United States)

    Daenen, Luk; Sterckx, Femke; Delvaux, Freddy R; Verachtert, Hubert; Derdelinckx, Guy

    2008-11-01

    The glycoside hydrolase activity of Saccharomyces cerevisiae and Brettanomyces custersii was examined on sour cherry (Prunus cerasus L.) glycosides with bound volatile compounds. Refermentations by the beta-glucosidase-negative S. cerevisiae strains LD25 and LD40 of sour cherry juice-supplemented beer demonstrated only a moderate increase of volatiles. In contrast, the beta-glucosidase-positive B. custersii strain LD72 showed a more pronounced activity towards glycosides with aliphatic alcohols, aromatic compounds and terpenoid alcohols. Important contributors to sour cherry aroma such as benzaldehyde, linalool and eugenol were released during refermentation as shown by analytical tools. A gradually increasing release was observed during refermentations by B. custersii when whole sour cherries, sour cherry pulp or juice were supplemented in the beer. Refermentations with whole sour cherries and with sour cherry stones demonstrated an increased formation of benzyl compounds. Thus, amygdalin was partially hydrolysed, and a large part of the benzaldehyde formed was mainly reduced to benzyl alcohol and some further esterified to benzyl acetate. These findings demonstrate the importance and interesting role of certain Brettanomyces species in the production of fruit lambic beers such as 'Kriek'.

  4. [CO2 response process and its simulation of Prunus sibirica photosynthesis under different soil moisture conditions].

    Science.gov (United States)

    Wu, Qin; Zhang, Guang-Can; Pei, Bin; Xu, Zhi-Qiang; Zhao, Yu; Fang, Li-Dong

    2013-06-01

    Taking the two-year old potted Prunus sibirica seedlings as test materials, and using CIRAS-2 photosynthetic system, this paper studied the CO2 response process of P. sibirica photosynthesis in semi-arid loess hilly region under eight soil moisture conditions. The CO2 response data of P. sibirica were fitted and analyzed by rectangular hyperbola model, exponential equation, and modified rectangular hyperbola model. Meanwhile, the quantitative relationships between the photosynthesis and the soil moisture were discussed. The results showed that the CO2 response process of P. sibirica photosynthesis had obvious response characteristics to the soil moisture threshold. The relative soil water content (RWC) required to maintain the higher photosynthetic rate (P(n)) and carboxylation efficiency (CE) of P. sibirica was in the range of 46.3%-81.9%. In this RWC range, the photosynthesis did not appear obvious CO2 saturated inhibition phenomenon. When the RWC exceeded this range, the photosynthetic capacity (P(n max)), CE, and CO2 saturation point (CSP) decreased evidently. Under different soil moisture conditions, there existed obvious differences among the three models in simulating the CO2 response data of P. sibirica. When the RWC was in the range of 46.3%-81.9%, the CO2 response process and the characteristic parameters such as CE, CO2 compensation point (see symbol), and photorespiration rate (R(p)) could be well fitted by the three models, and the accuracy was in the order of modified rectangular hyperbola model > exponential equation > rectangular hyperbola model. When the RWC was too high or too low, namely, the RWC was > 81.9% or CO2 response process and the characteristic parameters. It was suggested that when the RWC was from 46.3% to 81.9%, the photosynthetic efficiency of P. sibirica was higher, and, as compared with rectangular hyperbola model and exponential equation, modified rectangular hyperbola model had more applicability to fit the CO2 response data of

  5. Prunus necrotic ringspot ilarvirus: nucleotide sequence of RNA3 and the relationship to other ilarviruses based on coat protein comparison.

    Science.gov (United States)

    Guo, D; Maiss, E; Adam, G; Casper, R

    1995-05-01

    The RNA3 of prunus necrotic ringspot ilarvirus (PNRSV) has been cloned and its entire sequence determined. The RNA3 consists of 1943 nucleotides (nt) and possesses two large open reading frames (ORFs) separated by an intergenic region of 74 nt. The 5' proximal ORF is 855 nt in length and codes for a protein of molecular mass 31.4 kDa which has homologies with the putative movement protein of other members of the Bromoviridae. The 3' proximal ORF of 675 nt is the cistron for the coat protein (CP) and has a predicted molecular mass of 24.9 kDa. The sequence of the 3' non-coding region (NCR) of PNRSV RNA3 showed a high degree of similarity with those of tobacco streak virus (TSV), prune dwarf virus (PDV), apple mosaic virus (ApMV) and also alfalfa mosaic virus (AIMV). In addition it contained potential stem-loop structures with interspersed AUGC motifs characteristic for ilar- and alfamoviruses. This conserved primary and secondary structure in all 3' NCRs may be responsible for the interaction with homologous and heterologous CPs and subsequent activation of genome replication. The CP gene of an ApMV isolate (ApMV-G) of 657 nt has also been cloned and sequenced. Although ApMV and PNRSV have a distant serological relationship, the deduced amino acid sequences of their CPs have an identity of only 51.8%. The N termini of PNRSV and ApMV CPs have in common a zinc-finger motif and the potential to form an amphipathic helix.

  6. PaCYP78A9, a Cytochrome P450, Regulates Fruit Size in Sweet Cherry (Prunus avium L.

    Directory of Open Access Journals (Sweden)

    Xiliang Qi

    2017-12-01

    Full Text Available Sweet cherry (Prunus avium L. is an important fruit crop in which fruit size is strongly associated with commercial value; few genes associated with fruit size have, however, been identified in sweet cherry. Members of the CYP78A subfamily, a group of important cytochrome P450s, have been found to be involved in controlling seed size and development in Arabidopsis thaliana, rice, soybean, and tomato. However, the influence of CYP78A members in controlling organ size and the underlying molecular mechanisms in sweet cherry and other fruit trees remains unclear. Here, we characterized a P. avium CYP78A gene PaCYP78A9 that is thought to be involved in the regulation of fruit size and organ development using overexpression and silencing approaches. PaCYP78A9 was significantly expressed in the flowers and fruit of sweet cherry. RNAi silencing of PaCYP78A9 produced small cherry fruits and PaCYP78A9 was found to affect fruit size by mediating mesocarp cell proliferation and expansion during fruit growth and development. Overexpression of PaCYP78A9 in Arabidopsis resulted in increased silique and seed size and PaCYP78A9 was found to be highly expressed in the inflorescences and siliques of transgenic plants. Genes related to cell cycling and proliferation were downregulated in fruit from sweet cherry TRV::PaCYP78A9-silencing lines, suggesting that PaCYP78A9 is likely to be an important upstream regulator of cell cycle processes. Together, our findings indicate that PaCYP78A9 plays an essential role in the regulation of cherry fruit size and provide insights into the molecular basis of the mechanisms regulating traits such as fruit size in P. avium.

  7. Development of an integrated pretreatment fractionation process for fermentable sugars and lignin: Application to almond (Prunus dulcis) shell

    International Nuclear Information System (INIS)

    Gong, Dachun; Holtman, Kevin M.; Franqui-Espiet, Diana; Orts, William J.; Zhao, Ruming

    2011-01-01

    An environmentally friendly pretreatment process was developed to fractionate cellulose, hemicellulose and lignin from almond (Prunus dulcis) shells, consisting of hot water pretreatment (HWP) coupled with organic solvent (organosolv) pretreatment of water/ethanol (OWEP). This integrated pretreatment process proved more effective on the basis of yield of fermentable sugar and lignin separation compared with HWP alone, dilute acid pretreatment (DAP), ammonia pretreatment (AP), lime pretreatment LP, organosolv water/ethanol pretreatment (OWEP), and organosolv water/acetone pretreatment (OWAP). In the coupled hot water-organosolv process, hemicellulose sugars were recovered in the first residual liquid while varying amounts of cellulose was retained in the residual solid. The lignin fraction was obtained by simply adjusting the pH from the second liquid. The optimal two-stage process consisted of first HWP stage at 195 o C for 30 min, resulting in w glucose = 95.4% glucose recovery yield and w xylose = 92.2% xylose removal. The second organosolv OWEP stage was operated at 195 o C for 20 min, in ethanol in water mixtures of ethanol = 50% and resulted in nearly w glucose = 100% glucose recovery yield, w xylose = 90% xylose and w lignin = 61% lignin removal. After enzymatic hydrolysis, glucose yield was up to w glucose = 95%, compared to 61% yield from untreated almond. Images obtained via scanning electron microscopy (SEM) highlighted the differences in almond structure from the varying pretreatment methods during biomass fractionation. -- Highlights: → Almond shells are an under-utilized agriculture byproduct available in the world. → Almond shells are particularly attractive as bioenergy feedstock. → We have developed a new fractionation process for the almond shell. → The new process combined the HWP with OWEP. → The fractionation process has potential in the utilization of almond shell.

  8. Residual determination and risk assessment of buprofezin in plum (Prunus domestica) grown in open-field conditions following the application of three different formulations.

    Science.gov (United States)

    Kabir, Md Humayun; Abd El-Aty, A M; Kim, Sung-Woo; Lee, Han Sol; Rahman, Md Musfiqur; Lee, Young-Jun; Chung, Hyung Suk; Lieu, Truong; Choi, Jeong-Heui; Shin, Ho-Chul; Im, Geon-Jae; Hong, Su Myeong; Shim, Jae-Han

    2016-11-01

    This study was conducted to characterize the residual level and perform a risk assessment on buprofezin formulated as an emulsifiable concentrate, wettable powder, and suspension concentrate over various treatment schedules in plum (Prunus domestica). The samples were extracted with an AOAC quick, easy, cheap, effective, rugged, and safe, 'QuEChERS', method after major modifications. As intrinsic interferences were observed in blank plum samples following dispersive-solid phase extraction (consisting of primary secondary amine and C 18 sorbents), amino cartridges were used for solid-phase extraction. Analysis was carried out using liquid chromatography with diode array detection and confirmed by liquid chromatography-tandem mass spectrometry. The method showed excellent linearity with determination coefficient (R 2  = 1) and satisfactory recoveries (at two spiking levels, 0.5 and 2.5 mg/kg) between 90.98 and 94.74% with relative standard deviation (RSD) ≤8%. The limit of quantification (0.05 mg/kg) was considerably lower than the maximum residue limit (2 mg/kg) set by the Codex Alimentarius. Absolute residue levels for emulsifiable concentrates were highest, perhaps owing to the dilution rate and adjuvant. Notably, all formulation residues were lower than the maximum residue limit, and safety data proved that the fruits are safe for consumers. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  9. Transcriptional Responses in root and leaf of Prunus persica Under Drought Stress Using RNA Sequencing

    Directory of Open Access Journals (Sweden)

    Najla Ksouri

    2016-11-01

    Full Text Available Prunus persica L. Batch, or peach, is one of the most important crops and it is widely established in irrigated arid and semi-arid regions. However, due to variations in the climate and the increased aridity, drought has become a major constraint, causing crop losses worldwide. The use of drought-tolerant rootstocks in modern fruit production appears to be a useful method of alleviating water deficit problems. However, the transcriptomic variation and the major molecular mechanisms that underlie the adaptation of drought-tolerant rootstocks to water shortage remain unclear. Hence, in this study, high-throughput sequencing (RNA-seq was performed to assess the transcriptomic changes and the key genes involved in the response to drought in root tissues (GF677 rootstock and leaf tissues (graft, var. Catherina subjected to 16 days of drought stress. In total, 12 RNA libraries were constructed and sequenced. This generated a total of 315M raw reads from both tissues, which allowed the assembly of 22,079 and 17,854 genes associated with the root and leaf tissues, respectively. Subsets of 500 differentially expressed genes (DEGs in roots and 236 in leaves were identified and functionally annotated with 56 gene ontology (GO terms and 99 metabolic pathways, which were mostly associated with aminobenzoate degradation and phenylpropanoid biosynthesis. The GO analysis highlighted the biological functions that were exclusive to the root tissue, such as locomotion, hormone metabolic process, and detection of stimulus, indicating the stress-buffering role of the GF677 rootstock. Furthermore, the complex regulatory network involved in the drought response was revealed, involving proteins that are associated with signaling transduction, transcription and hormone regulation, redox homeostasis, and frontline barriers. We identified two poorly characterized genes in P. persica: growth-regulating factor 5 (GRF5, which may be involved in cellular expansion, and AtHB12

  10. Polyphenolic Characterization and Antioxidant Activity of Malus domestica and Prunus domestica Cultivars from Costa Rica.

    Science.gov (United States)

    Navarro, Mirtha; Moreira, Ileana; Arnaez, Elizabeth; Quesada, Silvia; Azofeifa, Gabriela; Vargas, Felipe; Alvarado, Diego; Chen, Pei

    2018-01-30

    The phenolic composition of skin and flesh from Malus domestica apples (Anna cultivar) and Prunus domestica plums (satsuma cultivar) commercial cultivars in Costa Rica, was studied using Ultra Performance Liquid Chromatography coupled with High Resolution Mass Spectrometry (UPLC-DAD-ESI-MS) on enriched-phenolic extracts, with particular emphasis in proanthocyanidin and flavonoids characterization. A total of 52 compounds were identified, including 21 proanthocyanidins ([(+)-catechin and (-)-epicatechin]) flavan-3-ols monomers, five procyanidin B-type dimers and two procyanidin A-type dimers, five procyanidin B-type trimers and two procyanidin A-type trimers, as well as one procyanidin B-type tetramer, two procyanidin B-type pentamers, and two flavan-3-ol gallates); 15 flavonoids (kaempferol, quercetin and naringenin derivatives); nine phenolic acids (protochatechuic, caffeoylquinic, and hydroxycinnamic acid derivatives); five hydroxychalcones (phloretin and 3-hydroxyphloretin derivatives); and two isoprenoid glycosides (vomifoliol derivatives). These findings constitute the first report of such a high number and diversity of compounds in skins of one single plum cultivar and of the presence of proanthocyanidin pentamers in apple skins. Also, it is the first time that such a large number of glycosylated flavonoids and proanthocyanidins are reported in skins and flesh of a single plum cultivar. In addition, total phenolic content (TPC) was measured with high values observed for all samples, especially for fruits skins with a TPC of 619.6 and 640.3 mg gallic acid equivalents/g extract respectively for apple and plum. Antioxidant potential using 2,2-diphenyl-1-picrylhidrazyl (DPPH) and oxygen radical absorbance capacity (ORAC) methods were evaluated, with results showing also high values for all samples, especially again for fruit skins with IC 50 of 4.54 and 5.19 µg/mL (DPPH) and 16.8 and 14.6 mmol TE/g (ORAC) respectively for apple and plum, indicating the potential

  11. Gene flow among wild and domesticated almond species: insights from chloroplast and nuclear markers

    Science.gov (United States)

    Delplancke, Malou; Alvarez, Nadir; Espíndola, Anahí; Joly, Hélène; Benoit, Laure; Brouck, Elise; Arrigo, Nils

    2012-01-01

    Hybridization has played a central role in the evolutionary history of domesticated plants. Notably, several breeding programs relying on gene introgression from the wild compartment have been performed in fruit tree species within the genus Prunus but few studies investigated spontaneous gene flow among wild and domesticated Prunus species. Consequently, a comprehensive understanding of genetic relationships and levels of gene flow between domesticated and wild Prunus species is needed. Combining nuclear and chloroplastic microsatellites, we investigated the gene flow and hybridization among two key almond tree species, the cultivated Prunus dulcis and one of the most widespread wild relative Prunus orientalis in the Fertile Crescent. We detected high genetic diversity levels in both species along with substantial and symmetric gene flow between the domesticated P. dulcis and the wild P. orientalis. These results were discussed in light of the cultivated species diversity, by outlining the frequent spontaneous genetic contributions of wild species to the domesticated compartment. In addition, crop-to-wild gene flow suggests that ad hoc transgene containment strategies would be required if genetically modified cultivars were introduced in the northwestern Mediterranean. PMID:25568053

  12. Host suitability analysis of the bark beetle Scolytus amygdali (Coleoptera: Curculionidae: Scolytinae).

    Science.gov (United States)

    Zeiri, A; Ahmed, M Z; Braham, M; Qiu, B-L

    2015-08-01

    Scolytus amygdali is a polyphagous insect pest that feeds on fruit trees and forest trees. Our study assessed the host preference and reproductive potential of S. amygdali on four tree species: almond (Prunus dulcis), apricot (Prunus armeniaca), peach (Prunus persica), and plum (Prunus domestica). Females of S. amygdali produced maternal galleries that were longer on peach than the other three trees, and female fecundity was highest on peach. Females with longer maternal galleries produced more eggs, indicating a positive correlation between maternal gallery length and female fertility. The under-bark development time of S. amygdali is significantly shorter on plum (45 days) and almond (56 days) than on apricot (65 days) and peach (64 days). Despite this longer development time on peach, our results still suggest that, of the four types of tree tested, peach is the most preferred host for S. amygdali.

  13. Informe del proyecto "Prospección, conservación, caracterización y documentación del Banco de Germoplasma de Frutales del CITA" (RF2011-00020-C02-01)

    OpenAIRE

    Alonso Segura, José Manuel; Centro de Investigación y Tecnología Agroalimentaria de Aragón - CITA

    2015-01-01

    En Zaragoza se encuentran las mayores colecciones de germoplasma de frutales de hueso y pepita de España, creadas a partir de prospecciones realizadas en los años 50 y 60. El material autóctono siempre ha tenido un papel relevante en estas colecciones. Con la creación de las autonomías, el Gobierno de Aragón se responsabilizó de las colecciones de referencia nacional de almendro (Prunus amygdalus), melocotonero (Prunus pérsica), peral (Pyrus communis) y patrones del Género Prunus. Estas colec...

  14. Epigenetic Variance, Performing Cooperative Structure with Genetics, Is Associated with Leaf Shape Traits in Widely Distributed Populations of Ornamental Tree Prunus mume

    Directory of Open Access Journals (Sweden)

    Kaifeng Ma

    2018-01-01

    Full Text Available Increasing evidence shows that epigenetics plays an important role in phenotypic variance. However, little is known about epigenetic variation in the important ornamental tree Prunus mume. We used amplified fragment length polymorphism (AFLP and methylation-sensitive amplified polymorphism (MSAP techniques, and association analysis and sequencing to investigate epigenetic variation and its relationships with genetic variance, environment factors, and traits. By performing leaf sampling, the relative total methylation level (29.80% was detected in 96 accessions of P. mume. And the relative hemi-methylation level (15.77% was higher than the relative full methylation level (14.03%. The epigenetic diversity (I∗ = 0.575, h∗ = 0.393 was higher than the genetic diversity (I = 0.484, h = 0.319. The cultivated population displayed greater epigenetic diversity than the wild populations in both southwest and southeast China. We found that epigenetic variance and genetic variance, and environmental factors performed cooperative structures, respectively. In particular, leaf length, width and area were positively correlated with relative full methylation level and total methylation level, indicating that the DNA methylation level played a role in trait variation. In total, 203 AFLP and 423 MSAP associated markers were detected and 68 of them were sequenced. Homologous analysis and functional prediction suggested that the candidate marker-linked genes were essential for leaf morphology development and metabolism, implying that these markers play critical roles in the establishment of leaf length, width, area, and ratio of length to width.

  15. Epigenetic Variance, Performing Cooperative Structure with Genetics, Is Associated with Leaf Shape Traits in Widely Distributed Populations of Ornamental Tree Prunus mume.

    Science.gov (United States)

    Ma, Kaifeng; Sun, Lidan; Cheng, Tangren; Pan, Huitang; Wang, Jia; Zhang, Qixiang

    2018-01-01

    Increasing evidence shows that epigenetics plays an important role in phenotypic variance. However, little is known about epigenetic variation in the important ornamental tree Prunus mume . We used amplified fragment length polymorphism (AFLP) and methylation-sensitive amplified polymorphism (MSAP) techniques, and association analysis and sequencing to investigate epigenetic variation and its relationships with genetic variance, environment factors, and traits. By performing leaf sampling, the relative total methylation level (29.80%) was detected in 96 accessions of P . mume . And the relative hemi-methylation level (15.77%) was higher than the relative full methylation level (14.03%). The epigenetic diversity ( I ∗ = 0.575, h ∗ = 0.393) was higher than the genetic diversity ( I = 0.484, h = 0.319). The cultivated population displayed greater epigenetic diversity than the wild populations in both southwest and southeast China. We found that epigenetic variance and genetic variance, and environmental factors performed cooperative structures, respectively. In particular, leaf length, width and area were positively correlated with relative full methylation level and total methylation level, indicating that the DNA methylation level played a role in trait variation. In total, 203 AFLP and 423 MSAP associated markers were detected and 68 of them were sequenced. Homologous analysis and functional prediction suggested that the candidate marker-linked genes were essential for leaf morphology development and metabolism, implying that these markers play critical roles in the establishment of leaf length, width, area, and ratio of length to width.

  16. Download this PDF file

    African Journals Online (AJOL)

    cadewumi

    Materials and Methods: Three fruit extracts Prunus domestica (plum), Prunus persica ... Distilled water was prepared in the Laboratory of Natural Products and ... 80% methanol and water in a ratio of 80:20 respectively; with 0.5ml HCl (5%); for ...

  17. Carotenoids, Tocopherols and Antioxidant Activity of Lipophilic Extracts from Sea Buckthorn Berries (Hippophae rhamnoides, Apricot Pulp and Apricot Kernel (Prunus armeniaca

    Directory of Open Access Journals (Sweden)

    Elena Andreea Pop

    2015-11-01

    Full Text Available A healthy human diet requires the daily consumption of fruits and vegetables rich in bioactive compounds. Sea buckthorn berries (Hippophae rhamnoides L. and apricot fruits (Prunus armeniaca L. are cultivated and appreciated in Romania both as fresh fruits and as derived products. Characterized by a complex chemical composition, sea buckthorn is rich in unsaturated lipids, carotenoids and tocopherols. Except for β-carotene content, less is known about other lipophilic compounds in apricot fruits. The aim of this paper was to separate and quantify the individual carotenoids, tocopherols and tocotrienols in sea buckthorn, apricot pulp and kernels and also to determine the antioxidant activity of the lipophilic extracts using the TEAC  method.  Chemical characterization of lipophilic extract was performed by HPLC with PDA and fluorescence detection. The total carotenoid content was 17.19±1.4 mg/100g F.W. in sea buckthorn; 3.51±0.25 mg/100g F.W. in apricot fruits and 0.58±0.04 mg/100 g F.W. in apricot kernels. The major carotenoids in sea buckthorn were β-carotene, zeaxanthin and β-cryptoxanthin esters. Apricots fruits are rich in β-carotene and its geometric isomers while in kernels we could properly identified only lycopene. The α-tocopherol concentration was higher in sea buckthorn (46 mg/kg than in apricot fruits (1.09 mg/kg while apricot kernel contain large amounts of γ-tocopherol (111 mg/kg. Sea buckthorn fruits showed the highest antioxidant capacity, correlated with a high content of both tocopherols and carotenoids.

  18. Comparative effect of Prunus persica L. BATSCH-water extract and tacrine (9-amino-1,2,3,4-tetrahydroacridine hydrochloride) on concentration of extracellular acetylcholine in the rat hippocampus.

    Science.gov (United States)

    Kim, Yeon-Kye; Koo, Byung-Soo; Gong, Dae-Jong; Lee, Young-Choon; Ko, Jeong-Heon; Kim, Cheorl-Ho

    2003-08-01

    Prunus persica L. BATSCH seed-water extract (PPE) has been used in the treatment of the degenerative disorders, such as hypermenorrhea and dysmenorrhea, in Taiwan, China, Japan and Korea. In this study, the effects of oral administration of PPE on the extracellular acetylcholine concentration in the hippocampus of rats were evaluated, and compared to that of tacrine (9-amino-1,2,3,4-tetrahydroacridine hydrochloride), a well-known and centrally acting acetylcholinesterase (AChE) inhibitor, which had been developed for the treatment of Alzheimer's disease. We measured the inhibition of brain AChE. PPE at 2.5g/kg and tacrine at 5mg/kg showed significant effects for more than 6h. At these doses, the maximum increases were observed at about 1.5h after administration of PPE, and at about 2h with tacrine, and were 454 and 412% of the pre-level, respectively. The results suggest that oral administration of PPE and tacrine increases acetylcholine concentration in the synaptic cleft of the hippocampus mostly through AChE inhibition, and that PPE has a potent and long-lasting effect on the central cholinergic system.

  19. Genetic diversity and population structure of Prunus mira (Koehne from the Tibet plateau in China and recommended conservation strategies.

    Directory of Open Access Journals (Sweden)

    Wenquan Bao

    Full Text Available Prunus mira Koehne, an important economic fruit crop with high breeding and medicinal values, and an ancestral species of many cultivated peach species, has recently been declared an endangered species. However, basic information about genetic diversity, population structure, and morphological variation is still limited for this species. In this study, we sampled 420 P. mira individuals from 21 wild populations in the Tibet plateau to conduct a comprehensive analysis of genetic and morphological characteristics. The results of molecular analyses based on simple sequence repeat (SSR markers indicated moderate genetic diversity and inbreeding (A = 3.8, Ae = 2.5, He = 0.52, Ho = 0.44, I = 0.95, FIS = 0.17 within P. mira populations. STRUCTURE, GENELAND, and phylogenetic analyses assigned the 21 populations to three genetic clusters that were moderately correlated with geographic altitudes, and this may have resulted from significantly different climatic and environmental factors at different altitudinal ranges. Significant isolation-by-distance was detected across the entire distribution of P. mira populations, but geographic altitude might have more significant effects on genetic structure than geographic distance in partial small-scale areas. Furthermore, clear genetic structure, high genetic differentiation, and restricted gene flow were detected between pairwise populations from different geographic groups, indicating that geographic barriers and genetic drift have significant effects on P. mira populations. Analyses of molecular variance based on the SSR markers indicated high variation (83.7% and 81.7%, whereas morphological analyses revealed low variation (1.30%-36.17% within the populations. Large and heavy fruits were better adapted than light fruits and nutlets to poor climate and environmental conditions at high altitudes. Based on the results of molecular and morphological analyses, we classified the area into three conservation units

  20. Difference in photosynthetic performance among three peach ...

    African Journals Online (AJOL)

    The effects of low photosynthetic photon flux density (PPFD) on greenhouse grown peach trees ('Qingfeng': Prunus persica L. Batsch, 'NJN76': Prunus persica L. Batsch and 'Maixiang': P. persica var. nectarine) were investigated. Difference in photosynthesis rate (Pn) and stoma morphology among cultivars were studied.

  1. Multiplicação in vitro de porta-enxertos do gênero Prunus sob baixas concentrações e diferentes tipos de auxinas

    Directory of Open Access Journals (Sweden)

    Silveira Carlos Augusto Posser

    2002-01-01

    Full Text Available Experimentos testando o tipo de auxina (AIB, AIA e ANA e concentração (0; 0,01; 0,1 e 1,0 mM foram realizados para cada um dos quatro porta-enxertos utilizados (G x N22, Mr.S 2/5, Marianna e Mirabolano. Cada porta-enxerto constituiu-se num experimento, uma vez que, apesar de ser o mesmo meio básico, MS fraction three-quarters, com exceção de Marianna, onde o meio foi o MS, as concentrações da citocinina BAP foram diferentes. A cada meio, foram adicionados os tipos e as concentrações das auxinas a serem testadas. Os porta-enxertos apresentaram comportamentos distintos quanto ao tipo e concentração das auxinas. O AIB e o AIA foram superiores ao ANA nas variáveis analisadas. Na fase de multiplicação, o 'Mirabolano' não respondeu a concentrações de auxinas de até 1,0 mM. O 'G x N22' apresentou as melhores respostas na concentração de 0,01 miM de AIB ou AIA. O porta-enxerto Marianna respondeu positivamente a concentrações de auxinas entre 0,01 e 1,0 miM. O ANA não proporciona bons resultados na multiplicação in vitro de porta-enxertos do gênero Prunus, sendo muitas vezes superado pela testemunha.

  2. Determination of pollen viability, germination ratios and morphology ...

    African Journals Online (AJOL)

    STORAGESEVER

    2008-12-03

    Dec 3, 2008 ... Key words: Flower biology, malatya, Prunus armeniaca, scanning electron microscope .... *Different letters indicate significant differences based on LSD .... Table 4. Pollen number for apricot (Prunus armeniaca) genotypes. .... Acta. Hort. 701: 64-69. Pırlak L (2002). The effects of temperature on pollen germi ...

  3. Phenology of native fruit trees in National Botanical Garden of Iran

    Directory of Open Access Journals (Sweden)

    P. Panahi

    2013-10-01

    Full Text Available Phenology, as one of the most important subjects of ecology, is the study of periodic plant life cycle events and how these are influenced by variations in climate and ecological conditions. In this research, phonological observations of 5 species (Prunus dulcis, Prunus avium, Prunus armeniaca, Pyrus communis, Prunus domestica were studied in Iranian orchard of National Botanical Garden of Iran during the years 2004-2008. Ten trees were selected for each species and leaf, flower and fruit phenology were recorded from second decade of February to end decade of November. Occurrence time of phenomena was converted to its interval from first day of the year. Statistical analysis of occurrence time of phenomena showed that there are significant differences between the studied species. Soonest and latest occurrence time of phenomena and their sustainability were observed in P. duclis and P. avium, respectively. Based on study of correlation between climate factors (temperature and precipitation and occurrence time of phenomena, significant correlations were found in some species.

  4. Wild food plants used by the Tibetans of Gongba Valley (Zhouqu county, Gansu, China)

    Science.gov (United States)

    2014-01-01

    Background The ethnobotany of Tibetans is a seriously under-studied topic. The aim of the study was to investigate knowledge and use of wild food plants in a valley inhabited by Tibetans in the Gannan Tibetan Autonomous Region. Methods The field research was carried out in a wooded mountain valley in 9 neighbouring villages the Zhouqu (Brugchu) county, and comprised 17 interviews with single informants and 14 group interviews, involving 122 people altogether. Results We recorded the use of 81 species of vascular plants from 41 families. Fruits formed the largest category, with 42 species, larger than the wild greens category, with 36 species. We also recorded the culinary use of 5 species of edible flowers, 7 species with underground edible organs and 5 taxa of fungi. On average, 16.2 edible taxa were listed per interview (median – 16). Green vegetables formed the largest category of wild foods (mean – 8.7 species, median – 9 species), but fruits were listed nearly as frequently (mean – 6.9, median – 6). Other categories were rarely mentioned: flowers (mean – 0.2, median – 0), underground edible parts (mean – 0.3, median – 0) and mushrooms (mean – 1.5, – median 1). Wild vegetables are usually boiled and/or fried and served as side-dishes (cai). They are often lacto-fermented. Wild fruits are mainly collected by children and eaten raw, they are not stored for further use. The most widely used wild vegetables are: Eleuterococcus spp., Pteridium aquilinum, Helwingia japonica, Aralia chinensis, Allium victorialis, Pteridium aquilinum, Ixeris chinensis, Thlaspi arvense and Chenopodium album. The culinary use of Caltha palustris as a green vegetable is very interesting. In its raw state, marsh marigold is a toxic plant, due to the presence of protoanemonin. In this area it is dried or lactofermented before use. The most commonly eaten fruits are: Pyrus xerophila, Prunus salicina, Berchemia sinica, Rubus spp. and Eleagnus umbellata. Conclusions The

  5. Elaboración de néctar de durazno (Prunus persica L., endulzado con sucralosa como aprovechamiento de pérdidas poscosecha

    Directory of Open Access Journals (Sweden)

    Darío Alberto Pinto Medina

    2015-12-01

    Full Text Available En el durazno (Prunus persica L, así como en la mayoría de los frutos climatéricos, la calidad y el tiempo de vida útil comercial son afectados por los inadecuados manejos durante la cosecha, transporte y empaque, evidenciados por una serie de daños y defectos que el consumidor rechaza a la hora de adquirir el producto en fresco y que representan cuantiosas pérdidas al final del proceso de mercadeo, esta investigación se basó principalmente en el aprovechamiento de las pérdidas en durazno en el eslabón de la poscosecha, agroindustrializando la materia prima; se realizaron pruebas sensoriales para determinar la variedad más aceptada de tres probadas: Rubidoux, Dorado y Rubidoux-Dorado, no se evidenciaron diferencias significativas entre las muestras. Para darle valor agregado al producto, se fabricó néctar de la variedad Rubidoux endulzado con sucralosa, se realizaron análisis fisicoquímicos, microbiológicos y bromatológicos siguiendo la normatividad vigente. Se encontró que la sucralosa contribuyó a disminuir considerablemente el aporte calórico en el néctar elaborado, pasando de 48 Kcal/100g a 38,69 Kcal/100g. Se concluye que el costo de producción unitario para envase de 350ml ($ 1.054 resulta favorable, puesto que la rentabilidad puede superar el 40%, para un precio de venta de $1.476, generando un producto competitivo en el mercado, dada la calidad y el valor agregado como alimento funcional

  6. First Report of Cherry virus A in Sweet Cherry Trees in China

    Science.gov (United States)

    Plants in the genus Prunus of the family Rosaceae are important ornamental and fruit trees in China (1). In June 2007, sweet cherry (Prunus avium) trees with mottling and mosaic symptoms were observed in a private garden near Kunming, Yunnan Province. Twenty-four samples were then collected from swe...

  7. Krymsk®1 (VVA-1), A dwarfing rootstock suitable for high density plum orchards in the Netherlands

    NARCIS (Netherlands)

    Maas, F.M.; Balkhoven-Baart, J.M.T.; Heijerman-Peppelman, G.; Steeg, van der P.A.H.

    2011-01-01

    Krymsk®:1 (Prunus tomentosa × Prunus cerasifera) was selected by Gennady Eremin at the Krymsk Breeding Station in Russia in 1966. Since 1994, it has been tested as a rootstock for several plum cultivars in The Netherlands. Graft compatibility was good for scion cultivars ‘Avalon’, ‘Excalibur’,

  8. Dormancy in Peach (Prunus persica L.) Flower Buds : I. Floral Morphogenesis and Endogenous Gibberellins at the End of the Dormancy Period.

    Science.gov (United States)

    Luna, V; Lorenzo, E; Reinoso, H; Tordable, M C; Abdala, G; Pharis, R P; Bottini, R

    1990-05-01

    Flower buds of peach (Prunus persica L.) trees, cv Novedad de Cordoba (Argentina), were collected near the end of the dormant period and immediately before anthesis. After removal of scale leaves, morphological observations of representative buds, made on transverse and longitudinal microtome sections, showed that all verticils making up the flower are present in an undifferentiated form during the dormant period (June). Flower buds collected at the end of dormant period (August) showed additional growth and differentiation, at which time formation of two ovules was beginning in the unicarpelar gynoecium. Dehiscence of anthers had not yet occurred 10 days before full bloom, and the ovules were still developing. Free endogenous gibberellin (GA)-like substances were quantified by bioassay (Tan-ginbozu dwarf rice microdrop) after SiO(2) partition column chromatography, reversed phase C18-high performance liquid chromatography, and finally Nucleosil [N(CH(3))(2)]high performance liquid chromatography. Bioactive fractions were then subjected to capillary gas chromatography-mass spectrometry-selected ion monitoring (GC-MS-SIM). Gibberellins A(1), A(3), and A(8) were tentatively identified in peach flower buds using GC-SIM and Kovat's retention indices, and relative amounts approximated by GC-SIM (2:8:6 for GA(1), GA(3), and GA(8), respectively). The highest concentration (330 nanograms per gram dry weight) of free GA(1)/GA(3) was found in dormant buds (June) and diminished thereafter. The concentration free of GA(1)/GA(3) did not increase immediately prior to bud break. However, high GA(1)/GA(3) concentrations occurred during stages where rate of growth and cellular differentiation of (mainly fertile) verticils can be influenced.

  9. Crosslinked enzyme aggregates of hydroxynitrile lyase partially purified from Prunus dulcis seeds and its application for the synthesis of enantiopure cyanohydrins.

    Science.gov (United States)

    Yildirim, Deniz; Tükel, S Seyhan; Alagöz, Dilek

    2014-01-01

    Hydroxynitrile lyases are powerful catalysts in the synthesis of enantiopure cyanohydrins which are key synthons in the preparations of a variety of important chemicals. The response surface methodology including three-factor and three-level Box-Behnken design was applied to optimize immobilization of hydroxynitrile lyase purified partially from Prunus dulcis seeds as crosslinked enzyme aggregates (PdHNL-CLEAs). The quadratic model was developed for predicting the response and its adequacy was validated with the analysis of variance test. The optimized immobilization parameters were initial glutaraldehyde concentration, ammonium sulfate saturation concentration, and crosslinking time, and the response was relative activity of PdHNL-CLEA. The optimal conditions were determined as initial glutaraldehyde concentration of 25% w/v, ammonium sulfate saturation concentration of 43% w/v, and crosslinking time of 18 h. The preparations of PdHNL-CLEA were examined for the synthesis of (R)-mandelonitrile, (R)-2-chloromandelonitrile, (R)-3,4-dihydroxymandelonitrile, (R)-2-hydroxy-4-phenyl butyronitrile, (R)-4-bromomandelonitrile, (R)-4-fluoromandelonitrile, and (R)-4-nitromandelonitrile from their corresponding aldehydes and hydrocyanic acid. After 96-h reaction time, the yield-enantiomeric excess values (%) were 100-99, 100-21, 100-99, 83-91, 100-99, 100-72, and 100-14%, respectively, for (R)-mandelonitrile, (R)-2-chloromandelonitrile, (R)-3,4-dihydroxymandelonitrile, (R)-2-hydroxy-4-phenyl butyronitrile, (R)-4-bromomandelonitrile, (R)-4-fluoromandelonitrile, and (R)-4-nitromandelonitrile. The results show that PdHNL-CLEA offers a promising potential for the preparation of enantiopure (R)-mandelonitrile, (R)-3,4-dihydroxymandelonitrile, (R)-2-hydroxy-4-phenyl butyronitrile, and (R)-4-bromomandelonitrile with a high yield and enantiopurity. © 2014 American Institute of Chemical Engineers.

  10. Antimicrobial activity and probable mechanisms of action of medicinal plants of Kenya: Withania somnifera, Warbugia ugandensis, Prunus africana and Plectrunthus barbatus.

    Directory of Open Access Journals (Sweden)

    Peter G Mwitari

    Full Text Available Withania somnifera, Warbugia ugandensis, Prunus africana and Plectrunthus barbatus are used traditionally in Kenya for treatment of microbial infections and cancer. Information on their use is available, but scientific data on their bioactivity, safety and mechanisms of action is still scanty. A study was conducted on the effect of organic extracts of these plants on both bacterial and fungal strains, and their mechanisms of action. Extracts were evaluated through the disc diffusion assay. Bacteria and yeast test strains were cultured on Mueller-Hinton agar and on Sabouraud dextrose agar for the filamentous fungi. A 0.5 McFarland standard suspension was prepared. Sterile paper discs 6 mm in diameter impregnated with 10 µl of the test extract (100 mg/ml were aseptically placed onto the surface of the inoculated media. Chloramphenicol (30 µg and fluconazole (25 µg were used as standards. Discs impregnated with dissolution medium were used as controls. Activity of the extracts was expressed according to zone of inhibition diameter. MIC was determined at 0.78-100 mg/ml. Safety studies were carried using Cell Counting Kit 8 cell proliferation assay protocol. To evaluate extracts mechanisms of action, IEC-6 cells and RT-PCR technique was employed in vitro to evaluate Interleukin 7 cytokine. Investigated plants extracts have both bactericidal and fungicidal activity. W. ugandensis is cytotoxic at IC50200 µg/ml. Fractions from W. ugandensis and W. somnifera too demonstrated antimicrobial activity. Mechanisms of action can largely be attributed to cytotoxicity, Gene silencing and immunopotentiation. Use of medicinal plants in traditional medicine has been justified and possible mechanisms of action demonstrated. Studies to isolate and characterize the bioactive constituents continue.

  11. Antioxidant capacities of ten edible North American plants.

    Science.gov (United States)

    Acuña, Ulyana Muñoz; Atha, Daniel E; Ma, Jun; Nee, Michael H; Kennelly, Edward J

    2002-02-01

    The EtOAc extract obtained from ten edible North American plants, Acorus calamus, Clintonia borealis, Gaultheria shallon, Juniperus osteosperma, Opuntia polyacantha, Prunus americana, Prunus virginiana, Sambucus cerulea, Sorbus americana and Vaccinium parvifolium, were tested in the 1,1-diphenyl-2-picrylhydrazyl (DPPH) free radical assay. High antioxidant activity was obtained from the extracts of three fruits, Gaultheria shallon, Sambucus cerulea and Prunus americana and one extracted rhizome, Acorus calamus. Catechin and epicatechin, potent polyphenolic antioxidants, were identified in the EtOAc extracts of Gaultheria shallon and Sambucus cerulea by reversed-phase thin-layer chromatography (TLC) and reversed-phase high-performance liquid chromatography (HPLC). Copyright 2002 John Wiley & Sons, Ltd.

  12. Differences in proleptic and epicormic shoot structures in relation to water deficit and growth rate in almond trees (Prunus dulcis).

    Science.gov (United States)

    Negrón, Claudia; Contador, Loreto; Lampinen, Bruce D; Metcalf, Samuel G; Guédon, Yann; Costes, Evelyne; DeJong, Theodore M

    2014-02-01

    Shoot characteristics differ depending on the meristem tissue that they originate from and environmental conditions during their development. This study focused on the effects of plant water status on axillary meristem fate and flowering patterns along proleptic and epicormic shoots, as well as on shoot growth rates on 'Nonpareil' almond trees (Prunus dulcis). The aims were (1) to characterize the structural differences between proleptic and epicormic shoots, (2) to determine whether water deficits modify shoot structures differently depending on shoot type, and (3) to determine whether shoot structures are related to shoot growth rates. A hidden semi-Markov model of the axillary meristem fate and number of flower buds per node was built for two shoot types growing on trees exposed to three plant water status treatments. The models segmented observed shoots into successive homogeneous zones, which were compared between treatments. Shoot growth rates were calculated from shoot extension measurements made during the growing season. Proleptic shoots had seven successive homogeneous zones while epicormic shoots had five zones. Shoot structures were associated with changes in growth rate over the season. Water deficit (1) affected the occurrence and lengths of the first zones of proleptic shoots, but only the occurrence of the third zone was reduced in epicormic shoots; (2) had a minor effect on zone flowering patterns and did not modify shoot or zone composition of axillary meristem fates; and (3) reduced growth rates, although patterns over the season were similar among treatments. Two meristem types, with different latency durations, produced shoots with different growth rates and distinct structures. Differences between shoot type structure responses to water deficit appeared to reflect their ontogenetic characteristics and/or resource availability for their development. Tree water deficit appeared to stimulate a more rapid progression through ontogenetic states.

  13. Enzyme-Linked Immunosorbent Assay Testing of Shoots Grown In Vitro and the Use of Immunocapture-Reverse Transcription-Polymerase Chain Reaction Improve the Detection of Prunus necrotic ringspot virus in Rose.

    Science.gov (United States)

    Moury, B; Cardin, L; Onesto, J P; Candresse, T; Poupet, A

    2000-05-01

    We developed and evaluated two different methods to improve the detection of the most prevalent virus of rose in Europe, Prunus necrotic ring-spot virus (PNRSV). Immunocapture-reverse transcription-polymerase chain reaction was estimated to be about 100 times more sensitive than double-antibody sandwich-enzyme-linked immunosorbent assay (DAS-ELISA) and showed an equivalent specificity. Based on the observation that PNRSV multiplies actively in young growing tissues (axillary shoots and cuttings), an in vitro culture method allowing rapid (about 15 days) and homogeneous development of dormant axillary buds with high virus titers was standardized. ELISA tests of these young shoots showed, in some cases, a 10(4) to 10(5) increase in sensitivity in comparison to adjacent leaf tissues from the rose mother plants. Between 21 and 98% (depending on the season) more samples were identified as positive by using ELISA on samples from shoot tips grown in vitro rather than on leaves collected directly from the PNRSV-infected mother plants. This simple method of growing shoot tips in vitro improved the confidence in the detection of PNRSV and eliminated problems in sampling appropriate tissues.

  14. The diversity of polyprenol pattern in leaves of fruit trees belonging to Rosaceae and Cornaceae.

    Science.gov (United States)

    Wanke, M; Chojnacki, T; Swiezewska, E

    1998-01-01

    The polyprenol pattern in leaves of fruit trees belonging to the Rosaceae (genera: Prunus, Malus) and Cornaceae (genus: Cornus) families is presented. The content of polyprenyl acetates varied within plant species between 10-50 mg per gram of dry weight. In genus Prunus, Cornus and in representatives of species Malus domestica, a mixture of polyprenols composed of 18, 19, 20, 21 isoprene units was found. In six species of genus Prunus (sour-cherry): P. serrulata-spontanea, P. yedoensis, P. fruticosa. P. kurilensis, P. subhirtella and P. incisa the presence of a second polyprenol family, i.e. the group of prenologues consisting of prenol -35, -36, -37, etc. up to -42 was detected.

  15. Validating the Operational Draft Regional Guidebook for the Functional Assessment of High-Gradient Ephemeral and Intermittent Headwater Streams in Western West Virginia and Eastern Kentucky

    Science.gov (United States)

    2014-04-01

    blackgum, wild black cherry (Prunus serotina), sweet cherry (Prunus avium), slippery elm (Ulmus rubra), sourwood (Oxydendrum arboreum), red maple, and...virginiana), American hornbeam (Carpinus caroliniana), and slippery elm . Buffalo nut (Pyrularia pubera), wild hydrangea (Hydrangea arborescens...Pinus strobus), wild black cherry, boxelder (Acer negundo), sycamore, black locust (Robinia pseudo-acacia), slippery elm , and white ash. The shrub

  16. Efficient synthesis of highly fluorescent nitrogen-doped carbon dots for cell imaging using unripe fruit extract of Prunus mume

    International Nuclear Information System (INIS)

    Atchudan, Raji; Edison, Thomas Nesakumar Jebakumar Immanuel; Sethuraman, Mathur Gopalakrishnan; Lee, Yong Rok

    2016-01-01

    Graphical abstract: The green synthesis of highly fluorescent N-CDs was achieved using the extract of unripe P. mume fruit as a carbon precursor by a one-pot simple hydrothermal-carbonization method. The resulting N-CDs were used as a staining agent for the fluorescence imaging of MDA-MB-231 cells. Display Omitted - Highlights: • The green synthesis of highly fluorescent N-CDs using the extract of unripe P. mume. • The N-CDs were synthesized by one-pot hydrothermal-carbonization method. • This method of synthesis is a simple, cost effective and eco-friendly route. • N-CDs will be a good alternative for fluorescent dyes and SQDs for bio-applications. - Abstract: Highly fluorescent nitrogen-doped carbon dots (N-CDs) were synthesized using the extract of unripe Prunus mume (P. mume) fruit by a simple one step hydrothermal-carbonization method. The N-CDs were synthesized at different pH ranges, 2.3, 5, 7, and 9. The pH of the P. mume extract was adjusted using an aqueous ammonia solution (25%). The optical properties of N-CDs were examined by UV–vis and fluorescence spectroscopy. The N-CDs synthesized at pH 9 emitted high fluorescence intensity compared to other obtained N-CDs. The N-CDs synthesized at pH 9 was further characterized by high resolution transmission electron microscopy (HR-TEM), X-ray diffraction (XRD), Raman spectroscopy, X-ray photoelectron spectroscopy (XPS), and Fourier transform-infra red (FT-IR) spectroscopy. HR-TEM showed that the average size of the synthesized N-CDs was approximately 9 nm and the interlayer distance was 0.21 nm, which was validated by XRD. The graphitic nature of the synthesized N-CDs were confirmed by Raman spectroscopy. XPS and FT-IR spectroscopy confirmed the doping of the nitrogen moiety over the synthesized CDs. The synthesized nitrogen doped CDs (N-CDs) were low toxicity and were used as a staining probe for fluorescence cell imaging.

  17. Efficient synthesis of highly fluorescent nitrogen-doped carbon dots for cell imaging using unripe fruit extract of Prunus mume

    Energy Technology Data Exchange (ETDEWEB)

    Atchudan, Raji; Edison, Thomas Nesakumar Jebakumar Immanuel [School of Chemical Engineering, Yeungnam University, Gyeongsan 38541 (Korea, Republic of); Sethuraman, Mathur Gopalakrishnan, E-mail: mgsethu@gmail.com [Department of Chemistry, Gandhigram Rural Institute-Deemed University, Gandhigram 624 302, Tamilnadu (India); Lee, Yong Rok, E-mail: yrlee@yu.ac.kr [School of Chemical Engineering, Yeungnam University, Gyeongsan 38541 (Korea, Republic of)

    2016-10-30

    Graphical abstract: The green synthesis of highly fluorescent N-CDs was achieved using the extract of unripe P. mume fruit as a carbon precursor by a one-pot simple hydrothermal-carbonization method. The resulting N-CDs were used as a staining agent for the fluorescence imaging of MDA-MB-231 cells. Display Omitted - Highlights: • The green synthesis of highly fluorescent N-CDs using the extract of unripe P. mume. • The N-CDs were synthesized by one-pot hydrothermal-carbonization method. • This method of synthesis is a simple, cost effective and eco-friendly route. • N-CDs will be a good alternative for fluorescent dyes and SQDs for bio-applications. - Abstract: Highly fluorescent nitrogen-doped carbon dots (N-CDs) were synthesized using the extract of unripe Prunus mume (P. mume) fruit by a simple one step hydrothermal-carbonization method. The N-CDs were synthesized at different pH ranges, 2.3, 5, 7, and 9. The pH of the P. mume extract was adjusted using an aqueous ammonia solution (25%). The optical properties of N-CDs were examined by UV–vis and fluorescence spectroscopy. The N-CDs synthesized at pH 9 emitted high fluorescence intensity compared to other obtained N-CDs. The N-CDs synthesized at pH 9 was further characterized by high resolution transmission electron microscopy (HR-TEM), X-ray diffraction (XRD), Raman spectroscopy, X-ray photoelectron spectroscopy (XPS), and Fourier transform-infra red (FT-IR) spectroscopy. HR-TEM showed that the average size of the synthesized N-CDs was approximately 9 nm and the interlayer distance was 0.21 nm, which was validated by XRD. The graphitic nature of the synthesized N-CDs were confirmed by Raman spectroscopy. XPS and FT-IR spectroscopy confirmed the doping of the nitrogen moiety over the synthesized CDs. The synthesized nitrogen doped CDs (N-CDs) were low toxicity and were used as a staining probe for fluorescence cell imaging.

  18. Single amino acid changes in the 6K1-CI region can promote the alternative adaptation of Prunus- and Nicotiana-propagated Plum pox virus C isolates to either host.

    Science.gov (United States)

    Calvo, María; Malinowski, Tadeusz; García, Juan Antonio

    2014-02-01

    Plum pox virus (PPV) C is one of the less common PPV strains and specifically infects cherry trees in nature. Making use of two PPV-C isolates that display different pathogenicity features, i.e., SwCMp, which had been adapted to Nicotiana species, and BY101, which had been isolated from cherry rootstock L2 (Prunus lannesiana) and propagated only in cherry species, we have generated two infective full-length cDNA clones in order to determine which viral factors are involved in the adaptation to each host. According to our results, the C-P3(PIPO)/6K1/N-CI (cylindrical inclusion) region contains overlapping but not coincident viral determinants involved in symptoms development, local viral amplification, and systemic movement capacity. Amino acid changes in this region promoting the adaptation to N. benthamiana or P. avium have trade-off effects in the alternative host. In both cases, adaptation can be achieved through single amino acid changes in the NIapro protease recognition motif between 6K1 and CI or in nearby sequences. Thus, we hypothesize that the potyvirus polyprotein processing could depend on specific host factors and the adaptation of PPV-C isolates to particular hosts relies on a fine regulation of the proteolytic cleavage of the 6K1-CI junction.

  19. Light energy partitioning, photosynthetic efficiency and biomass allocation in invasive Prunus serotina and native Quercus petraea in relation to light environment, competition and allelopathy.

    Science.gov (United States)

    Robakowski, Piotr; Bielinis, Ernest; Sendall, Kerrie

    2018-05-01

    This study addressed whether competition under different light environments was reflected by changes in leaf absorbed light energy partitioning, photosynthetic efficiency, relative growth rate and biomass allocation in invasive and native competitors. Additionally, a potential allelopathic effect of mulching with invasive Prunus serotina leaves on native Quercus petraea growth and photosynthesis was tested. The effect of light environment on leaf absorbed light energy partitioning and photosynthetic characteristics was more pronounced than the effects of interspecific competition and allelopathy. The quantum yield of PSII of invasive P. serotina increased in the presence of a competitor, indicating a higher plasticity in energy partitioning for the invasive over the native Q. petraea, giving it a competitive advantage. The most striking difference between the two study species was the higher crown-level net CO 2 assimilation rates (A crown ) of P. serotina compared with Q. petraea. At the juvenile life stage, higher relative growth rate and higher biomass allocation to foliage allowed P. serotina to absorb and use light energy for photosynthesis more efficiently than Q. petraea. Species-specific strategies of growth, biomass allocation, light energy partitioning and photosynthetic efficiency varied with the light environment and gave an advantage to the invader over its native competitor in competition for light. However, higher biomass allocation to roots in Q. petraea allows for greater belowground competition for water and nutrients as compared to P. serotina. This niche differentiation may compensate for the lower aboveground competitiveness of the native species and explain its ability to co-occur with the invasive competitor in natural forest settings.

  20. DETERMINACIÓN DE COMPUESTOS CIANOGÉNICOS AMIGDALINA Y PRUNASINA EN SEMILLAS DE ALMENDRAS (PRUNUS DULCIS L UTILIZANDO CROMATOGRAFÍA LIQUIDA DE ALTA RESOLUCIÓN

    Directory of Open Access Journals (Sweden)

    Guillermo Arrázola

    2013-11-01

    Full Text Available El objetivo del presente trabajo fue aplicar un técnica para determinar y cuantificar por separado los compuestos cianogénicos que pueden estar presentes en la semilla de almendra madura (Prunus dulcis. Entre los métodos encontrados, se seleccionó la cromatografía de líquidos de alta resolución (HPLC, que permite la cuantificación de los glucósidos cianogénicos amigdalina y prunasina por separado, adecuando diferentes procedimientos de extracción como el tamaño de partículas que influye en el proceso de liofilización, donde a menor superficie mayor área de contacto para la sublimación. Se ensayaron  muestras sin grasa y con grasa, utilizando los resultados con muestras con grasa, dados los resultados obtenidos. Se utilizó metanol 100% como extractante de los glucósidos cianogénicos, resultando una concentración de amigdalina máxima a partir un tiempo de extracción de 12 h y como fase móvil acetonitrilo/agua (20:80, se obtiene amigdalina, con una concentración de 9,8 mg/100g de muestra seca. Los cromatogramas obtenidos presentan tiempos de retención (Tr, Amigdalina: 3,4 min y Prunasina, 5,7 min, dos picos con excelente resolución, por lo tanto las condiciones anteriores se pueden utilizar para la identificación y  cuantificación de amigdalina y prunasina.

  1. Terrestrial Biological Inventory, Hillview Drainage and Levee District, Greene and Scott Counties, Illinois.

    Science.gov (United States)

    1982-01-01

    Timothy) Setaria faberi ’derrm. (Giant Foxtail) Setaria u-tescens (Weigel) Hubb. (Yellow Foxtail) Setaria viridis (L.) Beauv. (Green Foxtail) Spartina...Potamore toa nodosus Poir. (Long-leaved Poadveed) PRIMU]L&CEAE Lysimachia nummalaria L.. (Moneywort) &OSACEAE *Crataegus viridis L. (Southern Thorn... Fragaria vi-riniana Duchesne. (Cultivated Strawberry) Potentilla simplex 1uichx. (Common Cinquef oil) *Prunus americans Marsh. (Wild Plum) *Prunus

  2. Eriophyoid mites (Acari: Trombidiformes: Eriophyoidea) of Rosales trees in Iran: two new species and three new records.

    Science.gov (United States)

    Lotfollahi, Parisa; Irani-Nejad, Karim Haddad; De Lillo, Enrico

    2014-09-11

    This paper describes two new species of Eriophyoidea associated with trees belonging to the order Rosales in the south-western portion of East Azerbaijan province, Iran, collected during a survey in 2011: Aceria lobolinguae n. sp. on Elaeagnus angustifolia L. (Elaeagnaceae) and Rhinophytoptus nemalobos n. sp. on Prunus domestica L. (Rosaceae). Additionally, Phyllocoptes abaenus Keifer on Prunus armeniaca L. (Rosaceae), Aculus fockeui (Nalepa & Trouessart) on Prunus amygdalus Stokes and Malus domestica Borkh. (Rosaceae), and Aceria mori (Keifer) on Morus alba L. (Moraceae) were collected and are new records for the mite fauna of Iran. New locality records and host plant data are provided for Eriophyes similis (Nalepa), Eriophyes pyri (Pagenstecher) and Calepitrimerus baileyi (Keifer) which are eriophyoid species previously known from Iran. 

  3. Recent advances in the cryopreservation of shoot-derived germplasm of economically important fruit trees of Actinidia, Diospyros, Malus, Olea, Prunus, Pyrus and Vitis.

    Science.gov (United States)

    Benelli, Carla; De Carlo, Anna; Engelmann, Florent

    2013-01-01

    This paper presents the advances made over the last decade in cryopreservation of economically important vegetatively propagated fruit trees. Cryopreservation protocols have been established using both dormant buds sampled on field-grown plants and shoot tips sampled on in vitro plantlets. In the case of dormant buds, scions are partially dehydrated by storage at -5 °C, and then cooled slowly to -30 °C using low cooling rates (c.a. 1 °C/h) before immersion in liquid nitrogen. After slow rewarming and rehydration of samples, regrowth takes place either through grafting of buds on rootstocks or excision of apices and inoculation in vitro. In the case of shoot tips of in vitro plantlets, the cryopreservation techniques employed are the following: controlled rate cooling procedures involving slow prefreezing followed by immersion in liquid nitrogen or vitrification-based procedures including encapsulation-dehydration, vitrification, encapsulation-vitrification and droplet-vitrification. The current status of cryopreservation for a series of fruit tree species including Actinidia, Diospyros, Malus, Olea, Prunus, Pyrus and Vitis is presented. Routine application of cryopreservation for long-term germplasm storage in genebanks is currently limited to apple and pear, for which large cryopreserved collections have been established at NCGRP, Fort Collins (USA), using dormant buds and in vitro shoot tips, respectively. However, there are a growing number of examples of pilot scale testing experiments under way for different species in various countries. Progress in the further development and application of cryopreservation techniques will be made through a better understanding of the mechanisms involved in the induction of tolerance to dehydration and cryopreservation in frozen explants. Copyright © 2012 Elsevier Inc. All rights reserved.

  4. Evaluation of ozone injury on foliage of black cherry (Prunus serotina) and tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park.

    Science.gov (United States)

    Chappelka, A; Renfro, J; Somers, G; Nash, B

    1997-01-01

    The incidence and severity of visible foliar ozone injury on black cherry (Prunus serotina) seedlings and saplings and tall milkweed (Asclepias exaltata) plants in Great Smoky Mountains National Park (GRSM) were determined by surveys along selected trails conducted during late summer 1992. The incidence (% injured plants) of ozone injury on black cherry was 47% and the percent injured leaves/injured plant and average leaf area injured were 43 and 6%, respectively. Maximum severity (avg. leaf area of the most severely injured leaf) was 12%. Black cherry seedlings and saplings exhibiting ozone injury were taller than non-injured plants. When insect feeding was present, it occurred 96% of the time on plants with ozone injury. Significantly more injury (p=0.007) on black cherry (% injured leaves/injured black cherry) occurred in the NW section of GRSM compared with the other Park sections. Regression analyses showed no relationships in ozone injury with respect to aspect, slope or elevation. Tall milkweed was evaluated twice during August for ozone injury. The incidence (% injured plants) of ozone injury was 74 and 79% for the first and second survey, respectively. The percentage of injured leaves per plant from the first to second survey was 63 to 79%, respectively. Tall milkweeds showing ozone injury were taller than the non-injured plants. The percentage of insect-damaged plants was 50% among plants without ozone injury and 60% among ozone-injured plants. Non-injured tall milkweed had fewer flowers and/or pods than the injured plants. Mean leaf area injured increased over time, and mean maximum leaf area injured increased from 8 to 11% during the same period. Regression analyses showed no differences in ozone injury regarding aspect, slope or elevation. Our findings indicate that ozone injury is widespread throughout the Park on sensitive vegetation.

  5. Central Radar System, Over-the-Horizon Backscatter

    Science.gov (United States)

    1990-03-09

    Magnolia virginiana Switchgrass Panicum virgatum FAC+ Tall mannagrass Glyceria grandis OBL Water fern Salvinia spp. and Marsilea vestita OBL Water...boxelder, (Acer negundo), oaks (Quercus spp.), willows (Salix spp.), chokecherry (Prunus virginiana ), plum (Prunus spp.), and russian olive (Elaeagnus...maintenance of the power lines may be required to trim or prune trees which may interfere with the lines. With the exception of the pole sites, the only

  6. Physiological and foliar symptom response in the crowns of Prunus serotina, Fraxinus americana and Acer rubrum canopy trees to ambient ozone under forest conditions

    International Nuclear Information System (INIS)

    Schaub, M.; Skelly, J.M.; Zhang, J.W.; Ferdinand, J.A.; Savage, J.E.; Stevenson, R.E.; Davis, D.D.; Steiner, K.C.

    2005-01-01

    The crowns of five canopy dominant black cherry (Prunus serotina Ehrh.), five white ash (Fraxinus americana L.), and six red maple (Acer rubrum L.) trees on naturally differing environmental conditions were accessed with scaffold towers within a mixed hardwood forest stand in central Pennsylvania. Ambient ozone concentrations, meteorological parameters, leaf gas exchange and leaf water potential were measured at the sites during the growing seasons of 1998 and 1999. Visible ozone-induced foliar injury was assessed on leaves within the upper and lower crown branches of each tree. Ambient ozone exposures were sufficient to induce typical symptoms on cherry (0-5% total affected leaf area, LAA), whereas foliar injury was not observed on ash or maple. There was a positive correlation between increasing cumulative ozone uptake (U) and increasing percent of LAA for cherry grown under drier site conditions. The lower crown leaves of cherry showed more severe foliar injury than the upper crown leaves. No significant differences in predawn leaf water potential (ψ L ) were detected for all three species indicating no differing soil moisture conditions across the sites. Significant variation in stomatal conductance for water vapor (g wv ) was found among species, soil moisture, time of day and sample date. When comparing cumulative ozone uptake and decreased photosynthetic activity (P n ), red maple was the only species to show higher gas exchange under mesic vs. drier soil conditions (P wv and P n demonstrate the strong influence of heterogeneous environmental conditions within forest canopies. - Within the heterogeneous environment of a mature forest, many factors in addition to soil moisture play a significant role in determining exposure/response relationships to ozone

  7. Pollen limitation and reduced reproductive success are associated with local genetic effects in Prunus virginiana, a widely distributed self-incompatible shrub.

    Science.gov (United States)

    Suarez-Gonzalez, Adriana; Good, Sara V

    2014-03-01

    A vast quantity of empirical evidence suggests that insufficient quantity or quality of pollen may lead to a reduction in fruit set, in particular for self-incompatible species. This study uses an integrative approach that combines field research with marker gene analysis to understand the factors affecting reproductive success in a widely distributed self-incompatible species, Prunus virginiana (Rosaceae). Twelve patches of P. virginiana distributed within three populations that differed in degree of disturbance were examined. Two of the sites were small (7-35 km(2)) remnants of forest in an intensively used agricultural landscape, while the third was continuous (350 km(2)) and less disturbed. Field studies (natural and hand cross-pollinations) were combined with marker gene analyses (microsatellites and S-locus) in order to explore potential factors affecting pollen delivery and consequently reproductive success at landscape (between populations) and fine scales (within populations). Reductions in reproductive output were found in the two fragments compared with the continuous population, and suggest that pollen is an important factor limiting fruit production. Genetic analyses carried out in one of the fragments and in the continuous site suggest that even though S-allele diversity is high in both populations, the fragment exhibits an increase in biparental inbreeding and correlated paternity. The increase in biparental inbreeding in the fragment is potentially attributable to variation in the density of individuals and/or the spatial distribution of genotypes among populations, both of which could alter mating dynamics. By using a novel integrative approach, this study shows that even though P. virginiana is a widespread species, fragmented populations can experience significant reductions in fruit set and pollen limitation in the field. Deatiled examination of one fragmented population suggests that these linitations may be explained by an increase in

  8. Comparative analysis of rosaceous genomes and the reconstruction of a putative ancestral genome for the family.

    Science.gov (United States)

    Illa, Eudald; Sargent, Daniel J; Lopez Girona, Elena; Bushakra, Jill; Cestaro, Alessandro; Crowhurst, Ross; Pindo, Massimo; Cabrera, Antonio; van der Knaap, Esther; Iezzoni, Amy; Gardiner, Susan; Velasco, Riccardo; Arús, Pere; Chagné, David; Troggio, Michela

    2011-01-12

    Comparative genome mapping studies in Rosaceae have been conducted until now by aligning genetic maps within the same genus, or closely related genera and using a limited number of common markers. The growing body of genomics resources and sequence data for both Prunus and Fragaria permits detailed comparisons between these genera and the recently released Malus × domestica genome sequence. We generated a comparative analysis using 806 molecular markers that are anchored genetically to the Prunus and/or Fragaria reference maps, and physically to the Malus genome sequence. Markers in common for Malus and Prunus, and Malus and Fragaria, respectively were 784 and 148. The correspondence between marker positions was high and conserved syntenic blocks were identified among the three genera in the Rosaceae. We reconstructed a proposed ancestral genome for the Rosaceae. A genome containing nine chromosomes is the most likely candidate for the ancestral Rosaceae progenitor. The number of chromosomal translocations observed between the three genera investigated was low. However, the number of inversions identified among Malus and Prunus was much higher than any reported genome comparisons in plants, suggesting that small inversions have played an important role in the evolution of these two genera or of the Rosaceae.

  9. Comparative analysis of rosaceous genomes and the reconstruction of a putative ancestral genome for the family

    Directory of Open Access Journals (Sweden)

    Velasco Riccardo

    2011-01-01

    Full Text Available Abstract Background Comparative genome mapping studies in Rosaceae have been conducted until now by aligning genetic maps within the same genus, or closely related genera and using a limited number of common markers. The growing body of genomics resources and sequence data for both Prunus and Fragaria permits detailed comparisons between these genera and the recently released Malus × domestica genome sequence. Results We generated a comparative analysis using 806 molecular markers that are anchored genetically to the Prunus and/or Fragaria reference maps, and physically to the Malus genome sequence. Markers in common for Malus and Prunus, and Malus and Fragaria, respectively were 784 and 148. The correspondence between marker positions was high and conserved syntenic blocks were identified among the three genera in the Rosaceae. We reconstructed a proposed ancestral genome for the Rosaceae. Conclusions A genome containing nine chromosomes is the most likely candidate for the ancestral Rosaceae progenitor. The number of chromosomal translocations observed between the three genera investigated was low. However, the number of inversions identified among Malus and Prunus was much higher than any reported genome comparisons in plants, suggesting that small inversions have played an important role in the evolution of these two genera or of the Rosaceae.

  10. Differentiation of mycoplasmalike organisms (MLOs) in European fruit trees by PCR using specific primers derived from the sequence of a chromosomal fragment of the apple proliferation MLO.

    Science.gov (United States)

    Jarausch, W; Saillard, C; Dosba, F; Bové, J M

    1994-01-01

    A 1.8-kb chromosomal DNA fragment of the mycoplasmalike organism (MLO) associated with apple proliferation was sequenced. Three putative open reading frames were observed on this fragment. The protein encoded by open reading frame 2 shows significant homologies with bacterial nitroreductases. From the nucleotide sequence four primer pairs for PCR were chosen to specifically amplify DNA from MLOs associated with European diseases of fruit trees. Primer pairs specific for (i) Malus-affecting MLOs, (ii) Malus- and Prunus-affecting MLOs, and (iii) Malus-, Prunus-, and Pyrus-affecting MLOs were obtained. Restriction enzyme analysis of the amplification products revealed restriction fragment length polymorphisms between Malus-, Prunus, and Pyrus-affecting MLOs as well as between different isolates of the apple proliferation MLO. No amplification with either primer pair could be obtained with DNA from 12 different MLOs experimentally maintained in periwinkle. Images PMID:7916180

  11. Cultural Resources Survey and Testing Along Ditch 19 and Extensive Testing of 23DU289, Dunklin and Stoddard Counties, Missouri.

    Science.gov (United States)

    1988-06-30

    Carya illinoensis ) 1 1 Persimmon (Diospyros virginiana) T 2 2 Pl.um (Prunus sp.) T Red Haw (Crataegus sp.) T 1 11 Red Mulberry (Morus rubra) T...2 Cherry (Prunus sp.) T Cottonwood (Populus sp.) 1 3 Dogwood (Cornus sp.) 1 Hackberry (Celtus occidentalis) 12 9 Hickory, ( Carya sp.) 5 4 Shellhark... Carya laciniosa) T Hornbeam (Ostrya virginiana) 2 Kentucky Coffee Tree( Gymnoeladus dioica)T Locust, T Black (Robinia pseudo-acacia) T Honey

  12. Protein (Viridiplantae): 975424 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available Prunus mume MARSSAVVLVIMAALLVASTRALSPASSPSKSHAASPSSTPPSAAPSPSSHPPKAASSASPSSSPTAASSASPSSSPKAASSASPSS...SPPSLSPVSTPPSSSPSSTPPTATTSPSSTTPTTSPSPSSTSPEAAPSSKPAANSPPSPPSSSPVASPEISPSSSGDAPAPAPSGAISNRLAVAGSLASGVFAGVLVM

  13. Impact of utilization of alternative wood products of less conventional species (cherry and acacia) on the phenolic composition and sensory profile evolution of a red wine

    OpenAIRE

    Tavares, Mariana Ferreira Filipe

    2015-01-01

    Mestrado em Viticultura e Enologia - Instituto Superior de Agronomia / Faculdade de Ciências. Universidade do Porto The aim of this study was to evaluate the time-dependent changes, in the course of 90 days, in the phenolic and volatile composition and sensory properties in one red wine matured in contact with Portuguese (Quercus pyrenaica Willd.) and French (Quercus petraea L.) oak, acacia (Robina pseudoacacia) and cherry (Prunus Avium) wood chips and a cherry (Prunus avium) wood powder. ...

  14. Fort Leonard Wood Cantonment Landscape Context, Inventory, and Management

    Science.gov (United States)

    2007-09-01

    Characteristics Ostrya virginiana Hop Hornbeam Height 30-50’ oval to rounded attractive habit Platanus occiden- talis American Planetree Height 80...langeana olia -white flowers in spring Saucer Magn Height 20-30’ rounded showy pink Prunus maakii Amur Chokecherry s in May Height 30-40’ pyramidal white...mound’’ Pine Spread 3-5 dense, dark green foliage Prunus glandulosa Dwarf Flowering Almond and leggy Height 3-5’, Spread 3-4’ broad rounded pink or

  15. Prunasin hydrolases localization during fruit development in sweet and bitter almonds

    DEFF Research Database (Denmark)

    Sánchez Pérez, Raquel; Belmonte, Fara Sáez; Borch-Jensen, Jonas

    2012-01-01

    Amygdalin is a cyanogenic diglucoside and constitutes the bitter component in bitter almond (Prunus dulcis). Amygdalin concentration increases in the course of fruit formation. The monoglucoside prunasin is the precursor of amygdalin. Prunasin may be degraded to hydrogen cyanide, glucose, and ben......Amygdalin is a cyanogenic diglucoside and constitutes the bitter component in bitter almond (Prunus dulcis). Amygdalin concentration increases in the course of fruit formation. The monoglucoside prunasin is the precursor of amygdalin. Prunasin may be degraded to hydrogen cyanide, glucose...

  16. The contribution of stored malate and citrate to the substrate requirements of metabolism of ripening peach (Prunus persica L. Batsch) flesh is negligible. Implications for the occurrence of phosphoenolpyruvate carboxykinase and gluconeogenesis.

    Science.gov (United States)

    Famiani, Franco; Farinelli, Daniela; Moscatello, Stefano; Battistelli, Alberto; Leegood, Richard C; Walker, Robert P

    2016-04-01

    The first aim of this study was to determine the contribution of stored malate and citrate to the substrate requirements of metabolism in the ripening flesh of the peach (Prunus persica L. Batsch) cultivar Adriatica. In the flesh, stored malate accumulated before ripening could contribute little or nothing to the net substrate requirements of metabolism. This was because there was synthesis and not dissimilation of malate throughout ripening. Stored citrate could potentially contribute a very small amount (about 5.8%) of the substrate required by metabolism when the whole ripening period was considered, and a maximum of about 7.5% over the latter part of ripening. The second aim of this study was to investigate why phosphoenolpyruvate carboxykinase (PEPCK) an enzyme utilised in gluconeogenesis from malate and citrate is present in peach flesh. The occurrence and localisation of enzymes utilised in the metabolism of malate, citrate and amino acids were determined in peach flesh throughout its development. Phosphoenolpyruvate carboxylase (essential for the synthesis of malate and citrate) was present in the same cells and at the same time as PEPCK and NADP-malic enzyme (both utilised in the dissimilation of malate and citrate). A hypothesis is presented to explain the presence of these enzymes and to account for the likely occurrence of gluconeogenesis. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  17. Protein (Viridiplantae): 51963 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available 3323771 isoform X2 Prunus mume MMWVRARSSAGVNIRKLSTAVQRRIEDEGDWSYASEWWGTESEGHTVLRS...TSDKGNGVVSVVAYPSSKPSELHWASTERWLQKRYEEIHGCHEQNDRFRVLGYQWRALRFNDDTRQSTVKVLAAYRQSEPGVFAVMQQPHCLAVPYLKSMISAGLAAI

  18. Espécies de cigarrinhas em cultivo de café no Município de Santa Teresa, Espírito Santo, Brasil (Hemiptera, Cicadellidae, Cicadellinae

    Directory of Open Access Journals (Sweden)

    Rachel A. Carvalho

    2015-01-01

    Full Text Available As cigarrinhas da subfamília Cicadellinae são importantes vetores de patógenos de plantas cultivadas, dentre eles, a bactéria Xylella fastidiosa, que, no Brasil, ataca cultivos de citros, café e também de ameixa. Pouca informação é conhecida sobre a ocorrência, distribuição e biologia de cicadelíneos em plantações de café. Este trabalho apresenta uma lista de 141 espécimes, coletados em meses alternados, no período entre junho de 2009 e abril de 2010, em plantação de café no Município de Santa Teresa no Estado do Espírito Santo, Brasil. Esses espécimes estão distribuídos em 16 gêneros e 21 espécies pertencentes às duas tribos de Cicadellinae: Cicadellini e Proconiini. Dentre os Cicadellini listados, o gênero Graphocephala é, pela primeira vez, registrado para o Brasil.

  19. Evaluación productiva, económica y social del agua de riego de durazno (Prunus persica L. Batsch en Zacatecas (México

    Directory of Open Access Journals (Sweden)

    José Luis Ríos-Flores

    2015-01-01

    Full Text Available La escasez de agua limita la agricultura, por lo que su uso debe ser más eficiente en la producción de alimentos. El objetivo de este trabajo fue determinar la productividad económica, física y social del agua del cultivo de durazno (Prunus persica L. Batsch, en la región del Distrito de Desarrollo Rural 183 —correspondiente a Fresnillo, Zacatecas— para el ciclo 2012; se desarrollaron modelos matemáticos para estimar la productividad y eficiencia del agua. En Zacatecas se cosecharon 817 ha de durazno; mismas que produjeron 3,954.1 t; con un valor de $32.79 millones de pesos, utilizando un total de 8.17 Mm3 en todo el estado; mientras que en el DDR183-Fresnillo (compuesto por los municipios Fresnillo y Valparaíso se emplearon 3.39 Mm3. La determinación de la huella hídrica azul mostró que, por cada kg de durazno se emplearon 2,066 L en Zacatecas, 2,000 L en Fresnillo, y 1,851 L en Valparaíso. En cuanto al ingreso por metro cúbico, se determinó que en Zacatecas se obtuvo un ingreso de $4.01 m-3, $4.38 m-3 en Fresnillo y $4.83 m-3 en Valparaíso. Mientras, la productividad laboral en Zacatecas fue 97.53 h t-1, en Fresnillo 94.40 h t-1, y en Valparaíso 87.35 h t-1. El trabajador adscrito a la producción de durazno en Zacatecas generó $97.53 h-1, en Fresnillo $94.40 h-1, y $87.35 h-1 en Valparaíso. La producción de durazno en Valparaíso resultó altamente eficiente y productiva, lo que se tradujo en una menor huella hídrica; ello promueve la sustentabilidad del recurso agua en esa región.

  20. Decontamination effects of bark washing with a high-pressure washer on Peach [Prunus persica (L.) Batsch] and Japanese Persimmon (Diospyros kaki Thunb.) contaminated with radiocaesium during dormancy

    International Nuclear Information System (INIS)

    Sato, Mamoru; Abe, Kazuhiro; Kikunaga, Hidetoshi; Ohtsuki, Tsutomu; Takata, Daisuke; Tanoi, Keitaro; Muramatsu, Yasuyuki

    2015-01-01

    The effect of bark washing with a high-pressure washer on deciduous trees contaminated during dormancy by radiocaesium fallout derived from the Fukushima Daiichi Nuclear Power Plant accident was examined using peach [Prunus persica (L.) Batsch] and Japanese persimmon (Diospyros kaki Thunb.). Eighteen-year-old peach trees ('Akatsuki') were bark-washed twice with a high-pressure washer on July 5 and 27, 2011. Seven-year-old peach trees ('Kawanakajima Hakuto') were bark-washed on January 24, 2012, and thirty-year-old Japanese persimmon trees ('Hachiya') were bark-washed on December 21, 2011. For the peach trees, most of the bark was not removed by washing with a high-pressure washer. In contrast, the rough bark of Japanese persimmon was removed completely. No significant differences in the 137 Cs concentration of 'Akatsuki' fruit were found between the treatments conducted in the summer of 2011. Upon the bark washing of peach 'Akatsuki' trees in summer, the possibility of secondary contamination of leaves via the leachate containing 137 Cs was likely. The 137 Cs concentrations in fruits and leaves of peach 'Kawanakajima Hakuto' collected in summer 2012 were decreased significantly by washing treatment conducted in winter 2011–2012. In the year after treatment, the 137 Cs concentrations in fruits and leaves of Japanese persimmon were significantly decreased by the treatment. The effect of the bark washing on decreasing 137 Cs contents in fruits and leaves was greater in Japanese persimmon than in peach. The results for 'Kawanakajima Hakuto' and 'Hachiya' demonstrated the possibility of additive contamination. (author)

  1. Remarkable, overlooked and new microfungi in North Rhine-Westphalia, Germany.

    Science.gov (United States)

    Ale-Agha, N; Feige, G B; Linke, K

    2001-01-01

    During our investigations of the micro flora in NRW in the years of 1999 and 2000 we were able to collect and identify some new and rare species of micro fungi as parasites and saprophytes on wild and ornamental plants. Some of them are new for Germany: Podosphaera xanthii on Coreopsis verticillata; Cercospora traversiana on Trigonella foenum-graecum; Passalora dubia on Atriplex hortensis; Ophiobolus cirsii on Carduus spec.; Periconia britannica on Polemonium coeruleum; Ascochyta leptospora on Agropyron repens; Apomelasmia urticae on Urtica dioica; Cryptodiaporthe salicina on Salix caprea; Dasyscyphus nidulus on Anemone hupehensis; Rhopographus filicinus on Pteridium aquilinum; Sillia ferruginea on Corylus avellana; Sirococcus spiraeae on Spiraea spec. and Forsythia x intermedia. Examples of these findings are in the Herbarium ESS (Mycotheca Parva, Slg. Feige/Ale-Agha).

  2. Phytochemical uptake following human consumption of Montmorency tart cherry (L. Prunus cerasus) and influence of phenolic acids on vascular smooth muscle cells in vitro.

    Science.gov (United States)

    Keane, Karen M; Bell, Phillip G; Lodge, John K; Constantinou, Costas L; Jenkinson, Sarah E; Bass, Rosemary; Howatson, Glyn

    2016-06-01

    To investigate the phytochemical uptake following human consumption of Montmorency tart cherry (L. Prunus cerasus) and influence of selected phenolic acids on vascular smooth muscle cells in vitro. In a randomised, double-blinded, crossover design, 12 healthy males consumed either 30 or 60 mL of Montmorency tart cherry concentrate. Following analysis of the juice composition, venous blood samples were taken before and 1, 2, 3, 5 and 8 h post-consumption of the beverage. In addition to examining some aspects of the concentrate contents, plasma concentrations of protocatechuic acid (PCA), vanillic acid (VA) and chlorogenic (CHL) acid were analysed by reversed-phase high-performance liquid chromatography (HPLC) with diode array for quantitation and mass spectrometry detection (LCMS) for qualitative purposes. Vascular smooth muscle cell migration and proliferation were also assessed in vitro. Both the 30 and 60 mL doses of Montmorency cherry concentrate contained high amounts of total phenolics (71.37 ± 0.11; 142.73 ± 0.22 mg/L) and total anthocyanins (62.47 ± 0.31; 31.24 ± 0.16 mg/L), as well as large quantities of CHL (0.205 ± 0.24; 0.410 ± 0.48 mg/L) and VA (0.253 ± 0.84; 0.506 ± 1.68 mg/L). HPLC/LCMS identified two dihydroxybenzoic acids (PCA and VA) in plasma following MC concentrate consumption. Both compounds were most abundant 1-2 h post-initial ingestion with traces detectable at 8 h post-ingestion. Cell migration was significantly influenced by the combination of PCA and VA, but not in isolation. There was no effect of the compounds on cell proliferation. These data show new information that phenolic compounds thought to exert vasoactive properties are bioavailable in vivo following MC consumption and subsequently can influence cell behaviour. These data may be useful for the design and interpretation of intervention studies investigating the health effects of Montmorency cherries.

  3. Above-ground woody biomass allocation and within tree carbon and nutrient distribution of wild cherry (Prunus avium L. – a case study

    Directory of Open Access Journals (Sweden)

    Christopher Morhart

    2016-02-01

    Full Text Available Background: The global search for new ways to sequester carbon has already reached agricultural lands. Such land constitutes a major potential carbon sink. The production of high value timber within agroforestry systems can facilitate an in-situ carbon storage function. This is followed by a potential long term ex- situ carbon sinkwithin long lasting products such as veneer and furniture. For this purpose wild cherry (Prunus avium L. is an interesting option for middle Europe, yielding high prices on the timber market. Methods: A total number of 39 wild cherry were sampled in 2012 and 2013 to assess the leafless above ground biomass. The complete trees including stem and branches were separated into 1 cm diameter classes. Wood and bark from sub-samples were analysed separately and nutrient content was derived. Models for biomass estimation were constructed for all tree compartments. Results: The smallest diameter classes possess the highest proportion of bark due to smaller cross sectional area. Tree boles with a greater amount of stem wood above 10 cm in diameter will have a more constant bark proportion. Total branch bark proportion also remains relatively constant above d1.3m measurements of 8 cm. A balance is evident between the production of new branches with a low diameter and high bark proportion offset by the thickening and a relative reduction in bark proportion in larger branches. The results show that a single tree with an age of 17 and 18 years can store up to 85 kg of carbon within the aboveground biomass portion, an amount that will increase as the tree matures. Branches display greater nutrient content than stem sections per volume unit which can be attributed to a greater bark proportion. Conclusions: Using the derived models the carbon and the nutrient content of above-ground woody biomass of whole trees can be calculated. Suggested values for carbon with other major and minor nutrients held within relatively immature trees

  4. ANTIOXIDANT AND ANTIFUNGAL ACTIVITY OF SELECTED MEDICINAL PLANT EXTRACTS AGAINST PHYTOPATHOGENIC FUNGI.

    Science.gov (United States)

    Mahlo, Salome Mamokone; Chauke, Hasani Richard; McGaw, Lyndy; Eloff, Jacobus

    2016-01-01

    Medicinal plants are used by many ethnic groups as a source of medicine for the treatment of various ailments in both humans and domestic animals. These plants produce secondary metabolites that have antimicrobial properties, thus screening of medicinal plants provide another alternative for producing chemical fungicides that are relatively non-toxic and cost-effective. Leaf extracts of selected South African plant species ( Bucida buceras, Breonadia salicina, Harpephyllum caffrum, Olinia ventosa, Vangueria infausta and Xylotheca kraussiana ) were investigated for activity against selected phytopathogenic fungi ( Aspergillus niger, Aspergillus parasiticus, Colletotricum gloeosporioides, Penicillium janthinellum, P. expansum, Trichoderma harzianum and Fusarium oxysporum ). These plant fungal pathogens causes major economic losses in fruit industry such as blue rot on nectaries and postharvest disease in citrus. Plant species were selected from 600 evaluated inter alia, against two animal fungal pathogens ( Candida albicans and Cryptococcus neoformans ). Antioxidant activity of the selected plant extracts were investigated using a qualitative assay (2, 2-diphenyl-1-picrylhydrazyl (DPPH)). Bioautography assay was used to determine the number of antifungal compounds in plant extracts. All plant extracts were active against the selected plant phytopathogenic fungi. Moreover, Bucida buceras had the best antifungal activity against four of the fungi, with minimum inhibitory concentration (MIC) values as low as 0.02 mg/ml and 0.08 mg/ml against P. expansum, P. janthinellum, T. harzianum and F. oxysporum . The plant extracts of five plant species did not possess strong antioxidant activity. However, methanol extract of X. kraussiana was the most active radical scavenger in the DPPH assay amongst the six medicinal plants screened. No antifungal compounds were observed in some of the plant extracts with good antifungal activity as shown in the microdilution assay, indicating

  5. Anthelmintic efficacy of five tropical native Australian plants against Haemonchus contortus and Trichostrongylus colubriformis in experimentally infected goats (Capra hircus).

    Science.gov (United States)

    Moreno, F C; Gordon, I J; Knox, M R; Summer, P M; Skerrat, L F; Benvenutti, M A; Saumell, C A

    2012-06-08

    The study of the anthelmintic properties of plants rich in plant secondary metabolites can provide ecologically sound methods for the treatment of parasites on grazing animals. The purpose of the present study was to evaluate the anthelmintic effect of five tropical native Australian plant species rich in plant secondary metabolites on adult Haemonchus contortus and Trichostrongylus colubriformis in experimentally infected goats. Thirty young, nematode-free goats were infected with 2500 H. contortus and 5000 T. colubriformis infective larvae thrice weekly for a week (day 1-7 of the experiment). On day 27 after first infection, the goats were allocated into six groups of five animals per group. From day 28 to day 35, fresh leaves from Acacia salicina, Acacia nilotica, Eucalyptus corymbia, Casuarina cunninghamiana and Eucalyptus drepanophylla were included in the goats diet. Five groups were offered leaves from one of these plant species and one group, the untreated control, received only the basal diet formulated with 20% Medicago sativa and 80% Avena sativa. Following plant material administration, the goats were monitored daily until day 40 and then slaughtered on day 41. Total faecal worm egg output, total production of larvae recovered from faecal cultures, total post-mortem worm burdens and the per capita fecundity of female worms were estimated. The toxicity of the plant species for the goats was measured by histopathological analyses of liver and kidney samples. Results showed that goats feeding on the plant material rich in plant secondary metabolites had significantly lower egg output compared to the control goats (P0.05), the per capita fecundity was significantly reduced by E. corymbia, A. nilotica and A. salicina (Pgoats can benefit from the short-term ingestion of plant secondary metabolites, which reduce the total faecal egg output and thus decrease the potential for re-infection from the pasture. Crown Copyright © 2012. Published by Elsevier B.V. All

  6. Variance, genetic control and spatial phenotypic plasticity of morphological and phenological traits in Prunus spinosa and its large fruited forms (P. x fruticans

    Directory of Open Access Journals (Sweden)

    Kristine Vander Mijnsbrugge

    2016-11-01

    Full Text Available Prunus spinosa is a highly esteemed shrub in forest and landscape plantings. Shrubs with larger organs occur often and are considered either as large fruited forms of P. spinosa or as P. x fruticans, involving a hybridization process with the ancient cultivated P. insititia (crop-to-wild gene flow. As climate change may augment hybridization processes in the future, a hybrid origin is important to detect. In addition, studying crop-to-wild gene flow can give insights in putative consequences for the wild populations. We studied the P. spinosa – P. x fruticans group, focusing on morphology and phenology in three experimental plantations. Two plantings harbored cuttings of P. spinosa (clone plantations. A third plantation comprised of a half-sib offspring from a population with both P. spinosa and P. x fruticans (family plantation. Several results point to a hybridization process as the origin of P. x fruticans. The clone plantation revealed endocarp traits to be more genetically controlled than fruit size, while this was the opposite in the family plantation, suggesting the control of fruit size being derived from the putative P. insititia parent. Bud burst, flower opening and leaf fall were genetically controlled in the clone plantation, whereas in the family plantation intrafamily variability was remarkably large for the bud burst and leaf fall, but not for the flower opening. This suggests there is a reduced genetic control for the first two phenophases, possibly caused by historic hybridization events. Pubescence on the long shoot leaves in the family plantation deviated from the short shoot leaves on the same plants and from long and short shoot leaves in the clone plantation, suggesting again a P. insititia origin. Finally, we quantified spatial phenotypic plasticity, indicating how P. spinosa may react in a changing environment. In contrast to the bud burst and leaf fall, flower opening did not demonstrate plasticity. The fruit size was

  7. Cyanogenic Glucosides and Derivatives in Almond and Sweet Cherry Flower Buds from Dormancy to Flowering

    Directory of Open Access Journals (Sweden)

    Jorge Del Cueto

    2017-05-01

    Full Text Available Almond and sweet cherry are two economically important species of the Prunus genus. They both produce the cyanogenic glucosides prunasin and amygdalin. As part of a two-component defense system, prunasin and amygdalin release toxic hydrogen cyanide upon cell disruption. In this study, we investigated the potential role within prunasin and amygdalin and some of its derivatives in endodormancy release of these two Prunus species. The content of prunasin and of endogenous prunasin turnover products in the course of flower development was examined in five almond cultivars – differing from very early to extra-late in flowering time – and in one sweet early cherry cultivar. In all cultivars, prunasin began to accumulate in the flower buds shortly after dormancy release and the levels dropped again just before flowering time. In almond and sweet cherry, the turnover of prunasin coincided with increased levels of prunasin amide whereas prunasin anitrile pentoside and β-D-glucose-1-benzoate were abundant in almond and cherry flower buds at certain developmental stages. These findings indicate a role for the turnover of cyanogenic glucosides in controlling flower development in Prunus species.

  8. In vitro establishment of the hybrid rootstock ‘Garfi x Nemared’ (Garnem for peach

    Directory of Open Access Journals (Sweden)

    Limberg Guevara Salguero

    2016-04-01

    Full Text Available The interspecific hybrid between almond and peach, ‘Garfield x Nemared’ (Prunus dulcis (Mill D.A.Webb x Prunus persica (L. Batsch. has become very important as rootstocks for peach in Bolivia, but propagation by traditional methods of this hybrid has been very difficult. In the present study the aim was to in vitro establishment of this hybrid. As initial explants, nodal segments from mother plants, growing under controlled culture conditions, were used. For disinfection two concentrations of sodium hypochlorite (0.5 and 0.75% and time (10 and 12 min were tested. The greatest percentage of establishment was achieved using 0.75% NaClO for 12 min in an MS culture medium free of growth regulators. A 100% control of the phenols oxidation was achieved with the combination of mother plants growing under 50% shade, young buds, use of 150 mg l-1 citric acid at the end of the disinfection process and into the culture medium and then place the test tubes with the nodal segments one week in the dark.   Keywords: interspecific hybrid, Prunus, tissue culture

  9. Mutational epitope analysis of Pru av 1 and Api g 1, the major allergens of cherry (Prunus avium) and celery (Apium graveolens): correlating IgE reactivity with three-dimensional structure.

    Science.gov (United States)

    Neudecker, Philipp; Lehmann, Katrin; Nerkamp, Jörg; Haase, Tanja; Wangorsch, Andrea; Fötisch, Kay; Hoffmann, Silke; Rösch, Paul; Vieths, Stefan; Scheurer, Stephan

    2003-01-01

    Birch pollinosis is often accompanied by adverse reactions to food due to pollen-allergen specific IgE cross-reacting with homologous food allergens. The tertiary structure of Pru av 1, the major cherry (Prunus avium) allergen, for example, is nearly identical with Bet v 1, the major birch (Betula verrucosa) pollen allergen. In order to define cross-reactive IgE epitopes, we generated and analysed mutants of Pru av 1 and Api g 1.0101, the major celery (Apium graveolens) allergen, by immunoblotting, EAST (enzyme allergosorbent test), CD and NMR spectroscopy. The mutation of Glu45 to Trp45 in the P-loop region, a known IgE epitope of Bet v 1, significantly reduced IgE binding to Pru av 1 in a subgroup of cherry-allergic patients. The backbone conformation of Pru av 1 wild-type is conserved in the three-dimensional structure of Pru av 1 Trp45, demonstrating that the side chain of Glu45 is involved in a cross-reactive IgE epitope. Accordingly, for a subgroup of celery-allergic patients, IgE binding to the homologous celery allergen Api g 1.0101 was enhanced by the mutation of Lys44 to Glu. The almost complete loss of IgE reactivity to the Pru av 1 Pro112 mutant is due to disruption of its tertiary structure. Neither the mutation Ala112 nor deletion of the C-terminal residues 155-159 influenced IgE binding to Pru av 1. In conclusion, the structure of the P-loop partially explains the cross-reactivity pattern, and modulation of IgE-binding by site-directed mutagenesis is a promising approach to develop hypo-allergenic variants for patient-tailored specific immunotherapy. PMID:12943529

  10. Unraveling the Host Plant Alternation of Cacopsylla pruni – Adults but Not Nymphs Can Survive on Conifers Due to Phloem/Xylem Composition

    Science.gov (United States)

    Gallinger, Jannicke; Gross, Jürgen

    2018-01-01

    Plant sap feeding insects like psyllids are known to be vectors of phloem dwelling bacteria (‘Candidatus Phytoplasma’ and ‘Ca. Liberibacter’), plant pathogens which cause severe diseases and economically important crop damage. Some univoltine psyllid species have a particular life cycle, within one generation they alternate two times between different host plant species. The plum psyllid Cacopsylla pruni, the vector of European Stone Fruit Yellows (ESFY), one of the most serious pests in European fruit production, migrates to stone fruit orchards (Prunus spp.) for mating and oviposition in early spring. The young adults of the new generation leave the Prunus trees in summer and emigrate to their overwintering hosts like spruce and other conifers. Very little is known about the factors responsible for the regulation of migration, reasons for host alternation, and the behavior of psyllids during their phase of life on conifers. Because insect feeding behavior and host acceptance is driven by different biotic factors, such as olfactory and gustatory cues as well as mechanical barriers, we carried out electrical penetration graph (EPG) recordings and survival bioassays with C. pruni on different conifer species as potential overwintering hosts and analyzed the chemical composition of the respective plant saps. We are the first to show that migrating psyllids do feed on overwintering hosts and that nymphs are able to ingest phloem and xylem sap of coniferous trees, but cannot develop on conifer diet. Analyses of plant saps reveal qualitative differences in the chemical composition between coniferous trees and Prunus as well as within conifer species. These differences are discussed with regard to nutritional needs of psyllid nymphs for proper development, overwintering needs of adults and restriction of ‘Ca. P. prunorum’ to Prunus phloem. PMID:29706983

  11. Physical mapping of a pollen modifier locus controlling self-incompatibility in apricot and synteny analysis within the Rosaceae.

    Science.gov (United States)

    Zuriaga, Elena; Molina, Laura; Badenes, María Luisa; Romero, Carlos

    2012-06-01

    S-locus products (S-RNase and F-box proteins) are essential for the gametophytic self-incompatibility (GSI) specific recognition in Prunus. However, accumulated genetic evidence suggests that other S-locus unlinked factors are also required for GSI. For instance, GSI breakdown was associated with a pollen-part mutation unlinked to the S-locus in the apricot (Prunus armeniaca L.) cv. 'Canino'. Fine-mapping of this mutated modifier gene (M-locus) and the synteny analysis of the M-locus within the Rosaceae are here reported. A segregation distortion loci mapping strategy, based on a selectively genotyped population, was used to map the M-locus. In addition, a bacterial artificial chromosome (BAC) contig was constructed for this region using overlapping oligonucleotides probes, and BAC-end sequences (BES) were blasted against Rosaceae genomes to perform micro-synteny analysis. The M-locus was mapped to the distal part of chr.3 flanked by two SSR markers within an interval of 1.8 cM corresponding to ~364 Kb in the peach (Prunus persica L. Batsch) genome. In the integrated genetic-physical map of this region, BES were mapped against the peach scaffold_3 and BACs were anchored to the apricot map. Micro-syntenic blocks were detected in apple (Malus × domestica Borkh.) LG17/9 and strawberry (Fragaria vesca L.) FG6 chromosomes. The M-locus fine-scale mapping provides a solid basis for self-compatibility marker-assisted selection and for positional cloning of the underlying gene, a necessary goal to elucidate the pollen rejection mechanism in Prunus. In a wider context, the syntenic regions identified in peach, apple and strawberry might be useful to interpret GSI evolution in Rosaceae.

  12. Cloning, Expression, and Characterization of Sorbitol Transporters from Developing Sour Cherry Fruit and Leaf Sink Tissues1

    Science.gov (United States)

    Gao, Zhifang; Maurousset, Laurence; Lemoine, Remi; Yoo, Sang-Dong; van Nocker, Steven; Loescher, Wayne

    2003-01-01

    The acyclic polyol sorbitol is a primary photosynthetic product and the principal photosynthetic transport substance in many economically important members of the family Rosaceace (e.g. almond [Prunus dulcis (P. Mill.) D.A. Webber], apple [Malus pumila P. Mill.], cherry [Prunus spp.], peach [Prunus persica L. Batsch], and pear [Pyrus communis]). To understand key steps in long-distance transport and particularly partitioning and accumulation of sorbitol in sink tissues, we have cloned two sorbitol transporter genes (PcSOT1 and PcSOT2) from sour cherry (Prunus cerasus) fruit tissues that accumulate large quantities of sorbitol. Sorbitol uptake activities and other characteristics were measured by heterologous expression of PcSOT1 and PcSOT2 in yeast (Saccharomyces cerevisiae). Both genes encode proton-dependent, sorbitol-specific transporters with similar affinities (Km sorbitol of 0.81 mm for PcSOT1 and 0.64 mm for PcSOT2). Analyses of gene expression of these transporters, however, suggest different roles during leaf and fruit development. PcSOT1 is expressed throughout fruit development, but especially when growth and sorbitol accumulation rates are highest. In leaves, PcSOT1 expression is highest in young, expanding tissues, but substantially less in mature leaves. In contrast, PcSOT2 is mainly expressed only early in fruit development and not in leaves. Compositional analyses suggest that transport mediated by PcSOT1 and PcSOT2 plays a major role in sorbitol and dry matter accumulation in sour cherry fruits. Presence of these transporters and the high fruit sorbitol concentrations suggest that there is an apoplastic step during phloem unloading and accumulation in these sink tissues. Expression of PcSOT1 in young leaves before completion of the transition from sink to source is further evidence for a role in determining sink activity. PMID:12692316

  13. Characterization of Pseudomonas pathovars isolated from rosaceous fruit trees in East Algeria.

    Science.gov (United States)

    Harzallah, D; Sadallah, S; Larous, L

    2004-01-01

    A survey of bacterial diseases due to Pseudomonas on rosaceous fruit trees was conducted. In forty two orchards located in the Constantine region ( East Algeria). Pseudomonas isolates were identified on the bases of their cultural and biochemical characteristics . A total of fifty nine phytopathogenic bacteria were isolated from diseased pome and stone fruit trees. Thirty one strains comparable to Pseudomonas syringae pv. syringae were isolated from cherry (Prunus avium L.), plum (P. domestica L.), apricot (P. armeniaca L.), almond (P. dulcis L.) and pear trees (Pirus communis L.); sixteen strains comparable to Pseudomonas syringae pv. morsprunorum were obtained from samples of cherry and plum. Twelve strains of Pseudomonas viridiflava were isolated from cherry, apricot and peach (Prunus persica L.).

  14. Diverse amino acid changes at specific positions in the N-terminal region of the coat protein allow Plum pox virus to adapt to new hosts.

    Science.gov (United States)

    Carbonell, Alberto; Maliogka, Varvara I; Pérez, José de Jesús; Salvador, Beatriz; León, David San; García, Juan Antonio; Simón-Mateo, Carmen

    2013-10-01

    Plum pox virus (PPV)-D and PPV-R are two isolates from strain D of PPV that differ in host specificity. Previous analyses of chimeras originating from PPV-R and PPV-D suggested that the N terminus of the coat protein (CP) includes host-specific pathogenicity determinants. Here, these determinants were mapped precisely by analyzing the infectivity in herbaceous and woody species of chimeras containing a fragment of the 3' region of PPV-D (including the region coding for the CP) in a PPV-R backbone. These chimeras were not infectious in Prunus persica, but systemically infected Nicotiana clevelandii and N. benthamiana when specific amino acids were modified or deleted in a short 30-amino-acid region of the N terminus of the CP. Most of these mutations did not reduce PPV fitness in Prunus spp. although others impaired systemic infection in this host. We propose a model in which the N terminus of the CP, highly relevant for virus systemic movement, is targeted by a host defense mechanism in Nicotiana spp. Mutations in this short region allow PPV to overcome the defense response in this host but can compromise the efficiency of PPV systemic movement in other hosts such as Prunus spp.

  15. Dicty_cDB: Contig-U15146-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available us BAC clone RP24-129G21 from chromosom... 38 1.7 4 ( FG066604 ) dlbw0_003512 cDNA library... of cambium of Betula pl... 40 2.6 2 ( FG065202 ) dlbw0_000186 cDNA library of cambium of Betul...0 2 ( FG065344 ) dlbw0_000454 cDNA library of cambium of Betula pl... 40 3.1 2 ( FG067998 ) dlbw0_005638 cDNA library...vus cDNA 3', mRNA ... 34 3.7 2 ( BU836156 ) T083C10 Populus apical shoot cDNA library Popul... 1 ( BU572652 ) PA__Ea0001H21f Almond developing seed Prunus dulc... 48 0.25 1 ( BQ641167 ) EST290 almond cDNA library Prunus dul

  16. (Prunus armeniaca L.) genotypes

    African Journals Online (AJOL)

    STORAGESEVER

    2009-03-20

    Mar 20, 2009 ... increase in growth would probably be a more successful strategy under the ... Academic Press, London, pp. 307-327. Lakso AN (1994). Apple. ... Inc., p. 344. Sahin T, Soylu A (1991). A study on leaf and stomatal properties of.

  17. Promotion of adventitious root formation of difficult-to-root hardwood tree species

    Science.gov (United States)

    Paula M. Pijut; Keith E. Woeste; Charles H. Michler

    2011-01-01

    North American hardwood tree species, such as alder (Alnus spp.), ash (Fraxinus spp.), basswood (Tilia spp.), beech (Fagus spp.), birch (Betula spp.), black cherry (Prunus seratina), black walnut (Juglans nigra), black willow (...

  18. 7 CFR 301.74-2 - Regulated articles.

    Science.gov (United States)

    2010-01-01

    ... following are regulated articles: (a) All plant material and plant parts of Prunus (stone fruit) species.... serotina, P. serrula, P. serrulata, P. subhirtella, P. yedoensis, and P. virginiana, except for seeds and...

  19. Department of Zoological Sciences, Addis Ababa Univer

    African Journals Online (AJOL)

    USER

    2016-12-02

    Dec 2, 2016 ... unprecedented negative effects thereby exasperating natural disasters which ultimately will cause a negative .... such farms there is substantial activity in animal husbandry. .... capensis, Prunus africana, Cordia africana, and ...

  20. Candidate gene database and transcript map for peach, a model species for fruit trees.

    Science.gov (United States)

    Horn, Renate; Lecouls, Anne-Claire; Callahan, Ann; Dandekar, Abhaya; Garay, Lilibeth; McCord, Per; Howad, Werner; Chan, Helen; Verde, Ignazio; Main, Doreen; Jung, Sook; Georgi, Laura; Forrest, Sam; Mook, Jennifer; Zhebentyayeva, Tatyana; Yu, Yeisoo; Kim, Hye Ran; Jesudurai, Christopher; Sosinski, Bryon; Arús, Pere; Baird, Vance; Parfitt, Dan; Reighard, Gregory; Scorza, Ralph; Tomkins, Jeffrey; Wing, Rod; Abbott, Albert Glenn

    2005-05-01

    Peach (Prunus persica) is a model species for the Rosaceae, which includes a number of economically important fruit tree species. To develop an extensive Prunus expressed sequence tag (EST) database for identifying and cloning the genes important to fruit and tree development, we generated 9,984 high-quality ESTs from a peach cDNA library of developing fruit mesocarp. After assembly and annotation, a putative peach unigene set consisting of 3,842 ESTs was defined. Gene ontology (GO) classification was assigned based on the annotation of the single "best hit" match against the Swiss-Prot database. No significant homology could be found in the GenBank nr databases for 24.3% of the sequences. Using core markers from the general Prunus genetic map, we anchored bacterial artificial chromosome (BAC) clones on the genetic map, thereby providing a framework for the construction of a physical and transcript map. A transcript map was developed by hybridizing 1,236 ESTs from the putative peach unigene set and an additional 68 peach cDNA clones against the peach BAC library. Hybridizing ESTs to genetically anchored BACs immediately localized 11.2% of the ESTs on the genetic map. ESTs showed a clustering of expressed genes in defined regions of the linkage groups. [The data were built into a regularly updated Genome Database for Rosaceae (GDR), available at (http://www.genome.clemson.edu/gdr/).].

  1. Evolutionary origin of Rosaceae-specific active non-autonomous hAT elements and their contribution to gene regulation and genomic structural variation.

    Science.gov (United States)

    Wang, Lu; Peng, Qian; Zhao, Jianbo; Ren, Fei; Zhou, Hui; Wang, Wei; Liao, Liao; Owiti, Albert; Jiang, Quan; Han, Yuepeng

    2016-05-01

    Transposable elements account for approximately 30 % of the Prunus genome; however, their evolutionary origin and functionality remain largely unclear. In this study, we identified a hAT transposon family, termed Moshan, in Prunus. The Moshan elements consist of three types, aMoshan, tMoshan, and mMoshan. The aMoshan and tMoshan types contain intact or truncated transposase genes, respectively, while the mMoshan type is miniature inverted-repeat transposable element (MITE). The Moshan transposons are unique to Rosaceae, and the copy numbers of different Moshan types are significantly correlated. Sequence homology analysis reveals that the mMoshan MITEs are direct deletion derivatives of the tMoshan progenitors, and one kind of mMoshan containing a MuDR-derived fragment were amplified predominately in the peach genome. The mMoshan sequences contain cis-regulatory elements that can enhance gene expression up to 100-fold. The mMoshan MITEs can serve as potential sources of micro and long noncoding RNAs. Whole-genome re-sequencing analysis indicates that mMoshan elements are highly active, and an insertion into S-haplotype-specific F-box gene was reported to cause the breakdown of self-incompatibility in sour cherry. Taken together, all these results suggest that the mMoshan elements play important roles in regulating gene expression and driving genomic structural variation in Prunus.

  2. Development and bin mapping of a Rosaceae Conserved Ortholog Set (COS of markers

    Directory of Open Access Journals (Sweden)

    Kozik Alex

    2009-01-01

    Full Text Available Abstract Background Detailed comparative genome analyses within the economically important Rosaceae family have not been conducted. This is largely due to the lack of conserved gene-based molecular markers that are transferable among the important crop genera within the family [e.g. Malus (apple, Fragaria (strawberry, and Prunus (peach, cherry, apricot and almond]. The lack of molecular markers and comparative whole genome sequence analysis for this family severely hampers crop improvement efforts as well as QTL confirmation and validation studies. Results We identified a set of 3,818 rosaceaous unigenes comprised of two or more ESTs that correspond to single copy Arabidopsis genes. From this Rosaceae Conserved Orthologous Set (RosCOS, 1039 were selected from which 857 were used for the development of intron-flanking primers and allele amplification. This led to successful amplification and subsequent mapping of 613 RosCOS onto the Prunus TxE reference map resulting in a genome-wide coverage of 0.67 to 1.06 gene-based markers per cM per linkage group. Furthermore, the RosCOS primers showed amplification success rates from 23 to 100% across the family indicating that a substantial part of the RosCOS primers can be directly employed in other less studied rosaceaous crops. Comparisons of the genetic map positions of the RosCOS with the physical locations of the orthologs in the Populus trichocarpa genome identified regions of colinearity between the genomes of Prunus-Rosaceae and Populus-Salicaceae. Conclusion Conserved orthologous genes are extremely useful for the analysis of genome evolution among closely and distantly related species. The results presented in this study demonstrate the considerable potential of the mapped Prunus RosCOS for genome-wide marker employment and comparative whole genome studies within the Rosaceae family. Moreover, these markers will also function as useful anchor points for the genome sequencing efforts currently

  3. Development and bin mapping of a Rosaceae Conserved Ortholog Set (COS) of markers.

    Science.gov (United States)

    Cabrera, Antonio; Kozik, Alex; Howad, Werner; Arus, Pere; Iezzoni, Amy F; van der Knaap, Esther

    2009-11-29

    Detailed comparative genome analyses within the economically important Rosaceae family have not been conducted. This is largely due to the lack of conserved gene-based molecular markers that are transferable among the important crop genera within the family [e.g. Malus (apple), Fragaria (strawberry), and Prunus (peach, cherry, apricot and almond)]. The lack of molecular markers and comparative whole genome sequence analysis for this family severely hampers crop improvement efforts as well as QTL confirmation and validation studies. We identified a set of 3,818 rosaceaous unigenes comprised of two or more ESTs that correspond to single copy Arabidopsis genes. From this Rosaceae Conserved Orthologous Set (RosCOS), 1039 were selected from which 857 were used for the development of intron-flanking primers and allele amplification. This led to successful amplification and subsequent mapping of 613 RosCOS onto the Prunus TxE reference map resulting in a genome-wide coverage of 0.67 to 1.06 gene-based markers per cM per linkage group. Furthermore, the RosCOS primers showed amplification success rates from 23 to 100% across the family indicating that a substantial part of the RosCOS primers can be directly employed in other less studied rosaceaous crops. Comparisons of the genetic map positions of the RosCOS with the physical locations of the orthologs in the Populus trichocarpa genome identified regions of colinearity between the genomes of Prunus-Rosaceae and Populus-Salicaceae. Conserved orthologous genes are extremely useful for the analysis of genome evolution among closely and distantly related species. The results presented in this study demonstrate the considerable potential of the mapped Prunus RosCOS for genome-wide marker employment and comparative whole genome studies within the Rosaceae family. Moreover, these markers will also function as useful anchor points for the genome sequencing efforts currently ongoing in this family as well as for comparative QTL

  4. Biochemical profile of cuttings used for in vitro organogenesis of ...

    African Journals Online (AJOL)

    Biochemical profile of cuttings used for in vitro organogenesis of Prunus africana: An endangered species in Cameroon. JG Nzweundji, N Niemenak, O Oumar, JJ Tsafack, K Konan, L Nyochembeng, C Noumi, DT Nehemie, DO Ndoumou ...

  5. Final Remedial Investigation Report Area of Contamination (AOC) 57. Volume I. Text Sections 1 Through 10, Figures and Tables

    Science.gov (United States)

    2000-06-01

    choke cherry ( Prunus virginiana ), maleberry (Lyonia ligustrina), and paper birch (Betula papyrifera). Herbaceous species observed in this habitat...portion of this habitat include sheep laurel, witch hazel (Hamamelis virginiana ), nannyberry, choke cherry, clubmoss (Lycopodium carolinianum), and ferns

  6. Ocorrência precoce da mosca das frutas em ameixas Incidence of the southamerican fruit fly on plums

    Directory of Open Access Journals (Sweden)

    Luiz Antonio Salles

    1999-06-01

    Full Text Available O objetivo deste estudo foi verificar qual o estágio fenológico mais precoce da fruta de ameixeira em que ocorreria o ataque de mosca das frutas Anastrepha fraterculus. Os estudos foram conduzidos em plantas adultas de ameixeira, expondo-se fêmeas grávidas da mosca das frutas, confinadas em gaiolas com frutos protegidos do ataque natural. Cinco cultivares de ameixeira foram estudados (Amarelinha, Pluma 7, Reubennel, Santa Rosa e Wade. Essa praga ataca frutos de qualquer um dos cultivares logo nos primeiros estádios do desenvolvimento, quando os mesmos têm somente cerca de 2 a 3cm de diâmetro.The incidence of the southamerican fruit fly, Anastrepha fraterculus, on plum cultivars is reported. The objective of this study was to know the earliest fruit phase that fly attack could occur. Fertilized females were confined with fruits in plum trees in an orchard. Five plums cultivars were studied: Amarelinha; Pluma 7; Reubennel; Santa Rosa and Wade. This pest attack fruits during first stages of their development, mainly they have only from 2 to 3 centimeters of diameter.

  7. Construction of an almond linkage map in an Australian population Nonpareil × Lauranne

    Science.gov (United States)

    2010-01-01

    Background Despite a high genetic similarity to peach, almonds (Prunus dulcis) have a fleshless fruit and edible kernel, produced as a crop for human consumption. While the release of peach genome v1.0 provides an excellent opportunity for almond genetic and genomic studies, well-assessed segregating populations and the respective saturated genetic linkage maps lay the foundation for such studies to be completed in almond. Results Using an almond intraspecific cross between 'Nonpareil' and 'Lauranne' (N × L), we constructed a moderately saturated map with SSRs, SNPs, ISSRs and RAPDs. The N × L map covered 591.4 cM of the genome with 157 loci. The average marker distance of the map was 4.0 cM. The map displayed high synteny and colinearity with the Prunus T × E reference map in all eight linkage groups (G1-G8). The positions of 14 mapped gene-anchored SNPs corresponded approximately with the positions of homologous sequences in the peach genome v1.0. Analysis of Mendelian segregation ratios showed that 17.9% of markers had significantly skewed genotype ratios at the level of P almond map, which is highly syntenic and collinear with the Prunus reference map and peach genome V1.0. Therefore, the well-assessed almond population reported here can be used to investigate the traits of interest under Australian growing conditions, and provides more information on the almond genome for the international community. PMID:20932335

  8. The Cloning and Functional Characterization of Peach CONSTANS and FLOWERING LOCUS T Homologous Genes PpCO and PpFT.

    Directory of Open Access Journals (Sweden)

    Xiang Zhang

    Full Text Available Flowering is an essential stage of plant growth and development. The successful transition to flowering not only ensures the completion of plant life cycles, it also serves as the basis for the production of economically important seeds and fruits. CONSTANS (CO and FLOWERING LOCUS T (FT are two genes playing critical roles in flowering time control in Arabidopsis. Through homology-based cloning and rapid-amplifications of cDNA ends (RACE, we obtained full-lengths cDNA sequences of Prunus persica CO (PpCO and Prunus persica FT (PpFT from peach (Prunus persica (L. Batsch and investigated their functions in flowering time regulation. PpCO and PpFT showed high homologies to Arabidopsis CO and FT at DNA, mRNA and protein levels. We showed that PpCO and PpFT were nucleus-localized and both showed transcriptional activation activities in yeast cells, consistent with their potential roles as transcription activators. Moreover, we established that the over-expression of PpCO could restore the late flowering phenotype of the Arabidopsis co-2 mutant, and the late flowering defect of the Arabidopsis ft-1 mutant can be rescued by the over-expression of PpFT, suggesting functional conservations of CO and FT genes in peach and Arabidopsis. Our results suggest that PpCO and PpFT are homologous genes of CO and FT in peach and they may function in regulating plant flowering time.

  9. Upland hardwood habitat types in southwestern North Dakota

    Science.gov (United States)

    Michele M. Girard; Harold Goetz; Ardell J. Bjugstad

    1985-01-01

    The Daubenmire habitat type method was used to classify the upland hardwood draws of southwestern North Dakota. Preliminary data analysis indicates there are four upland habitat types: Fraxinus pennsylvanica/Prunus virginiana; F. pnnseanica-Ulmus americana/P. virginiana; Populus...

  10. An Integrated Strategy to Identify Key Genes in Almond Adventitious Shoot Regeneration

    Science.gov (United States)

    Plant genetic transformation usually depends on efficient adventitious regeneration systems. In almond (Prunus dulcis Mill.), regeneration of transgenic adventitious shoots was achieved but with low efficiency. Histological studies identified two main stages of organogenesis in almond explants that ...

  11. Sensitive and specific detection of potentially allergenic almond (Prunus dulcis) in complex food matrices by Taqman real-time polymerase chain reaction in comparison to commercially available protein-based enzyme-linked immunosorbent assay

    International Nuclear Information System (INIS)

    Roeder, Martin; Vieths, Stefan; Holzhauser, Thomas

    2011-01-01

    Currently, causative immunotherapies are lacking in food allergy. The only option to prevent allergic reactions in susceptible individuals is to strictly avoid the offending food. Thus, reliable labelling of allergenic constituents is of major importance, but can only be achieved if appropriate specific and sensitive detection techniques for foods with allergenic potential are available. Almond is an allergenic food that requires mandatory labelling on prepackaged foods and belongs to the genus Prunus. Species of this genus are phylogenetically closely related. We observed commercially available almond specific ELISA being highly cross-reactive with other foods of the Prunoideae family, resulting in a false-positive detection of up to 500,000 mg kg -1 almond. Previously published PCR methods were reported to be cross-reactive with false positive results >1200 mg kg -1 . We describe the development of a novel almond specific real-time PCR, based on mutated mismatch primers and sequence specific Taqman probe detection, in comparison with two quantitative commercially available ELISA. PCR sensitivity was investigated with chocolate, chocolate coating and cookies spiked between 5 and 100,000 mg kg -1 almond. In all matrices almond was reproducibly detected by real-time PCR at the lowest spike level of 5 mg kg -1 . Further, between 100 and 100,000 mg kg -1 spiked almond, the method featured good correlation between quantified copy numbers and the amount of spiked almond. Within this range a similar relation between detectable signal and amount of almond was observed for both PCR and ELISA. In contrast to ELISA the Taqman real-time PCR method was highly specific in 59 food items with negligible cross-reactivity for a very limited number of Prunoideae foods. The real-time PCR analysis of 24 retail samples was in concordance with ELISA results: 21% (n = 5) contained undeclared almond. This is the first completely disclosed real-time PCR method for a specific and

  12. Archaeological Investigations in the Upper Tombigbee Valley, Mississippi: Phase I. Volume 4.

    Science.gov (United States)

    1983-01-01

    marshelder (sumpweed) (7va) maygrass (Phalaris carol iniana) maypop (Passi flora Incarnata) milkweed (Asclepiodora viridis ) neftles (Urt ica) Ohio...plum (Prunus) wild potato vine (Tpomoea pandurata) wild rice (Zizania aquatica) wild strawberries ( Fragaria ) DATE, FILMED 15, 8 3 DTIC

  13. Some physico-chemical properties and mineral contents of sweet ...

    African Journals Online (AJOL)

    STORAGESEVER

    2009-06-17

    Jun 17, 2009 ... contents of sweet cherry (Prunus avium L.) type grown in Konya .... Working conditions of ICP-AES. Instrument: ICP-AES ... The volume of fruit (V) and fruit density (Pt), were determined using the liquid ... These differences can.

  14. Optimization of growth regulators in organogenesis of Bletia purpurea

    African Journals Online (AJOL)

    glopez

    2012-07-17

    Jul 17, 2012 ... alternative propagation techniques vital to reversing decreases in wild populations ... plants such as Prunus dulcis (Martins, 2004); to study genetic diversity in grape and orchid cultivars (Narváez et al., 2000; Taniguchi et al., ...

  15. Estudio bacteriológico de la Pasteurella pestis

    Directory of Open Access Journals (Sweden)

    Héctor Colichón

    1942-10-01

    Full Text Available Un considerable número de cepas de P. pestis aisladas en el Perú han sido estudiadas bacteriológicamente y los resultados obtenidos pueden ser resumidos en la forma siguiente: 2 cepas entre 148 estudiadas en caldo produjeron franco enturbiamiento del medio. La liquefación de la gelatina, la producción de indol y acetil metilcarbinol fueron negativos para todas las cepas estudiadas. En las condiciones ordinarias puede haber débil producción de SH2 por muy pocas cepas; en cambio, en el agar-Martín-infusión-extracto hepático la producción de SH2 ocurre en el mayor número de cepas, y en un considerable número de ellas en forma notablemente intensa. La temperatura de incubación es decisiva en la producción de hidrógeno sulfurado. Salvo una excepción la reducción del azul de metileno fue negativa para las cepas estudiadas, en esta misma forma la reducción de nitratos a nitritos, la producción de ácido nitroso y reacción del rojo de metilo fueron positivas para las cepas de P. pestis probadas. Todas las cepas estudiadas dieron reacción de catalasas positiva y no desarrollaron en ácido úrico, ni en medio de Koser. La acción de la P. pestis sobre los carbohidratos fue dividida en los siguientes grupos: Carbohidratos atacados constantemente con producción de ácido, no gas; ellos son: glucosa, maltosa, manita, xilosa, salicina y leche tornasolada. Carbohidratos constantemente no atacados, como son: sacarosa, rafinosa, dulcita, inosita, glicerina y dextrina. Carbohidratos, inconstantemente atacados y son: rhamnosa, trehalosa, lactosa, sorbita y arabinosa. En condiciones adecuadas de cultivo, muchas cepas pueden desarrollar en papa, entre las que desarrollaron se observaron algunas que producen pigmentación amarillo-cepia o amarillo dorado. Las pruebas, del ácido nitroso, de la reducción del azul de metileno y de la rahmnosa tienen valor relativo para el Diagnóstico de la Peste, en cambio la glicerina, el indol, la sacarosa

  16. Lipolytic activity and chilling requirement for germination of some ...

    African Journals Online (AJOL)

    Prunus amygdalus Mill.) seeds germination. In this study, the effect of cold stratification in two almonds varieties: ''Achaak'' a Tunisian cultivar and ''Tuono'' an Italian cultivar was tested. The study revealed, for the first time, that only the Tunisian ...

  17. Boomkwekerij op veen : bedrijfseconomische resultaten biologische boomkwekerij

    NARCIS (Netherlands)

    Snoek, B.; Schuring, W.; Leijden, van J.P.H.

    2003-01-01

    Resultaten van een onderzoek op PPO-locatie Boskoop naar de bedrijfseconomische mogelijkheden van biologische boomteelt. Zes gewassen uit de gewasgroep siergewassen (Acer, Buxus, Magnolia, Mahonia, Prunus en Syringa) werden in twee jaar opgekweekt van plantgoed naar leverbaar materiaal. In tabellen

  18. Relationship between endogenous hormonal content and somatic organogenesis in callus of peach (Prunus persica L. Batsch) cultivars and Prunus persica×Prunus dulcis rootstocks.

    Science.gov (United States)

    Pérez-Jiménez, Margarita; Cantero-Navarro, Elena; Pérez-Alfocea, Francisco; Le-Disquet, Isabel; Guivarc'h, Anne; Cos-Terrer, José

    2014-05-01

    The relationship between endogenous hormones content and the induction of somatic peach plant was studied. To induce multiple shoots from callus derived from the base of stem explants of the scion cultivars 'UFO-3', 'Flariba' and 'Alice Bigi', and the peach×almond rootstocks 'Garnem' and 'GF677', propagated plants were cultured on Murashige and Skoog salts augmented with 0.1mgL(-1) of indolebutyric acid, 1mgL(-1) of 6-benzylaminopurine and 3% sucrose. The highest regeneration rate was obtained with the peach×almond rootstocks. Endogenous levels of abscisic acid (ABA), indole-3-acetic acid (IAA), zeatin (Z), zeatin riboside (ZR), ethylene precursor 1-aminocyclopropane-1-carboxylic acid (ACC), salicylic acid (SA), and jasmonic acid (JA) were analyzed in the organogenic callus. Lower levels of several hormones, namely Z, ZR, ABA, and ACC were found in the peach×almond rootstock compared to peach cultivars, while IAA and SA presented inconclusive returns. These results suggest that the difference in somatic organogenesis capacity observed in peach and peach×almond hybrids is markedly affected by the endogenous hormonal content of the studied genotypes. Copyright © 2014 Elsevier GmbH. All rights reserved.

  19. The effects of foliar fertilization with iron sulfate in chlorotic leaves are limited to the treated area. A study with peach trees (Prunus persica L. Batsch grown in the field and sugar beet (Beta vulgaris L. grown in hydroponics

    Directory of Open Access Journals (Sweden)

    Hamdi eEl-Jendoubi

    2014-01-01

    Full Text Available Crop Fe deficiency is a worldwide problem. The aim of this study was to assess the effects of foliar Fe applications in two species grown in different environments: peach (Prunus persica L. Batsch trees grown in the field and sugar beet (Beta vulgaris L. cv. ‘Orbis’ grown in hydroponics. The distal half of Fe-deficient, chlorotic leaves was treated with Fe sulfate by dipping and using a brush in peach trees and sugar beet plants, respectively. The re-greening of the distal (Fe-treated and basal (untreated leaf areas was monitored, and the nutrient and photosynthetic pigment composition of the two areas were also determined. Leaves were also studied using chlorophyll fluorescence imaging, low temperature-scanning electron microscopy microanalysis, scanning transmission ion microscopy-particle induced X-ray emission and Perls Fe staining. The distal, Fe-treated leaf parts of both species showed a significant increase in Fe concentrations (across the whole leaf volume and marked re-greening, with significant increases in the concentrations of all photosynthetic pigments, as well as decreases in de-epoxidation of xanthophyll cycle carotenoids and increases in photochemical efficiency. In the basal, untreated leaf parts, Fe concentrations increased slightly, but little re-greening occurred. No changes in the concentrations of other nutrients were found. Foliar Fe fertilization was effective in re-greening treated leaf areas both in peach trees and sugar beet plants. Results indicate that the effects of foliar Fe-sulfate fertilization in Fe-deficient, chlorotic leaves were minor outside the leaf surface treated, indicating that Fe mobility within the leaf is a major constraint for full fertilizer effectiveness in crops where Fe-deficiency is established and leaf chlorosis occurs.

  20. The effects of foliar fertilization with iron sulfate in chlorotic leaves are limited to the treated area. A study with peach trees (Prunus persica L. Batsch) grown in the field and sugar beet (Beta vulgaris L.) grown in hydroponics.

    Science.gov (United States)

    El-Jendoubi, Hamdi; Vázquez, Saúl; Calatayud, Angeles; Vavpetič, Primož; Vogel-Mikuš, Katarina; Pelicon, Primož; Abadía, Javier; Abadía, Anunciación; Morales, Fermín

    2014-01-01

    Crop Fe deficiency is a worldwide problem. The aim of this study was to assess the effects of foliar Fe applications in two species grown in different environments: peach (Prunus persica L. Batsch) trees grown in the field and sugar beet (Beta vulgaris L. cv. "Orbis") grown in hydroponics. The distal half of Fe-deficient, chlorotic leaves was treated with Fe sulfate by dipping and using a brush in peach trees and sugar beet plants, respectively. The re-greening of the distal (Fe-treated) and basal (untreated) leaf areas was monitored, and the nutrient and photosynthetic pigment composition of the two areas were also determined. Leaves were also studied using chlorophyll fluorescence imaging, low temperature-scanning electron microscopy microanalysis, scanning transmission ion microscopy-particle induced X-ray emission and Perls Fe staining. The distal, Fe-treated leaf parts of both species showed a significant increase in Fe concentrations (across the whole leaf volume) and marked re-greening, with significant increases in the concentrations of all photosynthetic pigments, as well as decreases in de-epoxidation of xanthophyll cycle carotenoids and increases in photochemical efficiency. In the basal, untreated leaf parts, Fe concentrations increased slightly, but little re-greening occurred. No changes in the concentrations of other nutrients were found. Foliar Fe fertilization was effective in re-greening treated leaf areas both in peach trees and sugar beet plants. Results indicate that the effects of foliar Fe-sulfate fertilization in Fe-deficient, chlorotic leaves were minor outside the leaf surface treated, indicating that Fe mobility within the leaf is a major constraint for full fertilizer effectiveness in crops where Fe-deficiency is established and leaf chlorosis occurs.

  1. Traditional alcoholic beverages and their value in the local culture of the Alta Valle del Reno, a mountain borderland between Tuscany and Emilia-Romagna (Italy).

    Science.gov (United States)

    Egea, Teresa; Signorini, Maria Adele; Ongaro, Luca; Rivera, Diego; Obón de Castro, Concepción; Bruschi, Piero

    2016-06-22

    Traditional alcoholic beverages (TABs) have only received marginal attention from researchers and ethnobotanists so far, especially in Italy. This work is focused on plant-based TABs in the Alta Valle del Reno, a mountainous area on the border between Tuscany and Emilia-Romagna regions. The aims of our study were to document local knowledge about TABs and to analyze and discuss the distribution of related knowledge within the investigated communities. Field data were collected through semi-structured interviews. The relative importance of each plant species used to prepare TABs was assessed by calculating a general Use Value Index (UV general), a current UV (UV current) and a past UV (UV past). We also assessed personal experience of use by calculating effective and potential UV (UV effective, UV potential). A multivariate analysis was performed to compare ingredients in recipes recorded in the Alta Valle del Reno with those reported for neighboring areas. Forty-six plant species, belonging to 20 families, were recorded. Rosaceae was the most significant family (98 citations, 19 species), followed by Rutaceae (15, 3) and Lamiaceae (12, 4). The most important species was Prunus cerasus L. (UV general = 0.44), followed by Juglans regia L. (0.38), Rubus idaeus L. (0.27) and Prunus spinosa L. (0.22). Species with the highest UV current were Juglans regia (0.254), Prunus cerasus (0.238) and Citrus limon L. (0.159). The highest UV effective values were obtained by Prunus cerasus (0.413), Juglans regia (0.254), Rubus idaeus (0.222) and Citrus limon (0.206). We also discuss the results of the multivariate analysis. TABs proved to occupy an important place in the traditional culture and social life of the studied communities. Moreover, data highlight the local specificity and richness of this kind of tradition in the Alta Valle del Reno, compared to other Italian areas. Some plant ingredients used for TABs have potential nutraceutical and even therapeutic properties

  2. In vitro seed germination and rootstock establishing for micrografting of Theobroma cacao L

    Science.gov (United States)

    Micrografting has been successfully implemented in several plant species of Acacia, Citrus, Eucalyptus, Havea, Malus, Olea, Opuntia, Prunus and other genera. This technique is employed for plant rejuvenation, true-to-type propagation, genetic improvement, recovery of virus-free plants, testing of po...

  3. The occurrence of PPV in cherry trees in the Czech Republic

    Czech Academy of Sciences Publication Activity Database

    Navrátil, M.; Šafářová, D.; Fanigliulo, A.; Comes, S.; Petrzik, Karel; Karešová, R.

    2004-01-01

    Roč. 657, - (2004), 237-244 ISSN 0567-7572 R&D Projects: GA MZe(CZ) NAZV QD1407 Institutional research plan: CEZ:AV0Z5051902 Keywords : Plum pox virus * Prunus avium * sweet cherry cultivars * ELISA * RT-PCR Subject RIV: EE - Microbiology, Virology

  4. Genetic linkage maps of Japanese and European pears aligned to the apple consensus map

    NARCIS (Netherlands)

    Yamamoto, T.; Kimura, T.; Saito, T.; Kotobuki, K.; Matsuta, N.; Liebhard, R.; Gessler, C.; Weg, van de W.E.; Hayashi, T.

    2004-01-01

    Genetic linkage maps of the Japanese pear (Pyrus pyrifolia Nakai) cultivar `Housui¿ and the European pear (Pyrus communis L.) cultivar `Bartlett¿ were constructed based on Amplified Fragment Length Polymorphism markers (AFLPs), Simple Sequence Repeat markers (SSRs) (from pear, apple and Prunus),

  5. National Wetland Plant List Indicator Rating Definitions

    Science.gov (United States)

    2012-07-01

    glaucus (blue rye grass), Eragrostis pilosa (Indian love grass), Oenothera biennis (king’s-cureall), Ostrya virginiana (eastern hop-hornbeam...profile with a low wa- ter-holding capacity. ERDC/CRREL TN-12-1 6 Prunus serotina (black cherry), Phleum pretense (common timothy), Sarcobatus

  6. Environmental Assessment: Tailwater West Trail and Frisbee Golf Course at Coralville Reservoir, Johnson County, Iowa.

    Science.gov (United States)

    1986-08-01

    Cirsium sp.), goldenrod (Sol4dago sp.), and blackberry (Rubus sp.). Immature honey locust (Gleditsia triacanthos), red cedar (Juniperus virginiana ...cherry ( Prunus sp.), elm, silver maple, and box elder are widely scattered throughout the meadow. V. ENVIRONMENTAL CONSEQUENCES OF THE PREFERRED ACTION

  7. Population structure of Xylella fastidiosa associated with almond leaf scorch disease in the San Joaquin Valley of California

    Science.gov (United States)

    Xylella fastidiosa (Xf) causes disease in many commercial crops including almond leaf scorch (ALS) disease in susceptible almond (Prunus dulcis). In this study, genetic diversity and population structure of Xf associated with ALS disease were evaluated. Strains isolated from two almond production si...

  8. Ecological anachronisms in the recruitment of temperate light-demanding tree species in wooded pastures

    NARCIS (Netherlands)

    Bakker, ES; Olff, H; Vandenberghe, C; De Maeyer, K; Smit, R; Gleichman, JM; Vera, FWM

    1. Light-demanding trees and thorny shrubs in temperate plant communities may reflect adaptations to now-extinct large grazers, such as aurochs and tarpans, rendering these adaptations ecological anachronisms. 2. We explored the ecological functions of plant traits of Quercus robur and Prunus

  9. Bioactivity of sour cherry cultivars grown in Denmark

    DEFF Research Database (Denmark)

    Khoo, Gaik Ming; Clausen, Morten Rahr; Pedersen, Bjarne Hjelmsted

    2012-01-01

    Thirty four varieties of sour cherries (Prunus cerasus) were investigated for their total antioxidant activity, Caco-2 cancer cell proliferation inhibitory activity and effect on prostaglandin E2 (PGE2) production. Total phenolic content, oxygen radical absorbance capacity (ORAC) and cancer cell ...

  10. Maryam Moslemi, Sharghi, Mehdi Zahravi, Gholamreza Bakhshi ...

    African Journals Online (AJOL)

    01

    2013-08-21

    Aug 21, 2013 ... Briefly, Young leaves (100 mg) were ground to a fine powder in liquid nitrogen and ..... Yuan Z, Chen X, He T, Feng J, Feng T, Zhang C (2007b). Population genetic structure in apricot (Prunus armeniaca L.) cultivars revealed.

  11. Incorporation of an invasive plant into a native insect herbivore food web

    NARCIS (Netherlands)

    Schilthuizen, Menno; Santos Pimenta, Lúcia P; Lammers, Youri; Steenbergen, Peter J; Flohil, Marco; Beveridge, Nils G P; van Duijn, Pieter T; Meulblok, Marjolein M; Sosef, Nils; van de Ven, Robin; Werring, Ralf; Beentjes, Kevin K; Meijer, Kim; Vos, Rutger A; Vrieling, Klaas; Gravendeel, Barbara; Choi, Young; Verpoorte, Robert; Smit, Chris; Beukeboom, Leo W

    2016-01-01

    The integration of invasive species into native food webs represent multifarious dynamics of ecological and evolutionary processes. We document incorporation of Prunus serotina (black cherry) into native insect food webs. We find that P. serotina harbours a herbivore community less dense but more

  12. Antioxidant and Antimicrobial Activity of Polyphenol Extracts from ...

    African Journals Online (AJOL)

    Purpose: To assess the antioxidant and antimicrobial activities of polyphenolic extracts of three wild red wild berry fruit species from Southeast Serbia, viz, European cornel (Cornus mas), blackthorn (Prunus spinosa L.) and wild blackberry (Rubus fruticosus). Methods: Polyphenol content was determined using ...

  13. The Clinical and Experimental Studies of ChanLe Chongji for Reducing Bleeding after Abortion

    Institute of Scientific and Technical Information of China (English)

    赵荣胜; 丁元珍; 胡燕尔

    1999-01-01

    ChanLe Chongji (ChanLe dissolvable granule preparation) is a mixed Chinese traditional medicine composed of Prunus persica Batsch, Carthamus tinctorius, Angelica sinensis Diets, Typha angustifotia Borv. et Chaub. , Prunus mume Sieb. et Zucc.,etc. which could clear fever and remove blood stasis. The bleeding days in vagina after abortion by drug and the complete abortion rate were observed, 100cases were selected randomly from the treated group and the control group respectively. The results showed that the mean bleeding period in the treated group was 8. 4 days, while 13.3 days in the control. Although the mean complete abortion rate had no distinct difference between these two groups, the absolute level was higher in the treated group. The resuits of animal experiments showed that ChanLe Chongji could increase the contraction of uterus, stop bleeding, resist bacteria and diminish inflammation, thus providing its potentiality for clinical application.

  14. Content of the cyanogenic glucoside amygdalin in almond seeds related to the bitterness genotype

    Directory of Open Access Journals (Sweden)

    Guillermo Arrázola

    2012-08-01

    Full Text Available Almond kernels can be sweet, slightly bitter or bitter. Bitterness in almond (Prunus dulcis Mill. and other Prunus species is related to the content of the cyanogenic diglucoside amygdalin. When an almond containing amygdalin is chopped, glucose, benzaldehyde (bitter flavor and hydrogen cyanide (which is toxic are released. This two-year-study with 29 different almond cultivars for bitterness was carried out in order to relate the concentration of amygdalin in the kernel with the phenotype (sweet, slightly bitter or bitter and the genotype (homozygous: sweet or bitter or heterozygous: sweet or slightly bitter with an easy analytical test. Results showed that there was a clear difference in the amount of amygdalin between bitter and non-bitter cultivars. However, the content of amygdalin did not differentiate the other genotypes, since similar amounts of amygdalin can be found in the two different genotypes with the same phenotype

  15. Host Plants of Xylosandrus mutilatus in Mississippi

    International Nuclear Information System (INIS)

    Stone, W.D.; Nebeker, T.E.; Gerard, P.D.

    2007-01-01

    Host range of Xylosandrus mutilatus (Blandford) in North America is reported here for the first time. Descriptive data such as number of attacks per host, size of stems at point of attacks, and height of attacks above ground are presented. Hosts observed in Mississippi were Acer rubrum L., Acer saccharum Marsh., Acer palmatum Thunb., Ostrya virginiana (Mill.) K. Koch., Cornus florida L., Fagus grandifolia Ehrh., Liquidamber styraciflua L., Carya spp., Liriodendron tulipifera L., Melia azedarach L., Pinus taeda L., Prunus serotina Ehrh., Prunus americana Marsh., Ulmus alata Michaux, and Vitus rotundifolia Michaux. Liquidamber styraciflua had significantly more successful attacks, significantly higher probability of attacks, and significantly higher number of adult beetles per host tree than did Carya spp., A. rubrum, and L. tulipifera. This information is relevant in determining the impact this exotic beetle may have in nurseries, urban areas, and other forestry systems where this beetle becomes established. (author) [es

  16. Genetic evidence that two independent S-loci control RNase-based self-incompatibility in diploid strawberry.

    Science.gov (United States)

    Bosković, Radovan I; Sargent, Daniel J; Tobutt, Kenneth R

    2010-03-01

    The self-incompatibility mechanism that reduces inbreeding in many plants of the Rosaceae is attributed to a multi-allelic S locus which, in the Prunoideae and Maloideae subfamilies, comprises two complementary genes, a stylar-expressed S-RNase and a pollen-expressed SFB. To elucidate incompatibility in the subfamily Rosoideae, stylar-specific RNases and self-(in)compatibility status were analysed in various diploid strawberries, especially Fragaria nubicola and F. viridis, both self-incompatible, and F. vesca, self-compatible, and in various progenies derived from them. Unexpectedly, two unlinked RNase loci, S and T, were found, encoding peptides distinct from Prunoideae and Maloideae S-RNases; the presence of a single active allele at either is sufficient to confer self-incompatibility. By contrast, in diploid Maloideae and Prunoideae a single locus encodes S-RNases that share several conserved regions and two active alleles are required for self-incompatibility. Our evidence implicates the S locus in unilateral inter-specific incompatibility and shows that S and T RNases can, remarkably, confer not only allele-specific rejection of cognate pollen but also unspecific rejection of Sn Tn pollen, where n indicates a null allele, consistent with the the presence of the pollen component, SFB, activating the cognitive function of these RNases. Comparison of relevant linkage groups between Fragaria and Prunus suggests that Prunus S-RNases, unique in having two introns, may have resulted from gene conversion in an ancestor of Prunus. In addition, it is shown that there is a non-S locus that is essential for self-incompatibility in diploid Fragaria.

  17. Local predators attack exotic aphid Brachycaudus divaricatae in Lithuania

    Czech Academy of Sciences Publication Activity Database

    Danilov, J.; Rakauskas, R.; Havelka, Jan; Starý, Petr

    2016-01-01

    Roč. 69, č. 2 (2016), s. 263-269 ISSN 1721-8861 Institutional support: RVO:60077344 Keywords : Prunus * Aphids * Brachycaudus divaricatae Subject RIV: EH - Ecology, Behaviour Impact factor: 1.051, year: 2016 http://www.bulletinofinsectology.org/pdfarticles/vol69-2016-263-269danilov.pdf

  18. Novel Paraconiothyrium species on stone fruit trees and other woody hosts

    NARCIS (Netherlands)

    Damm, U; Verkley, G J M; Crous, P W; Fourie, P H; Haegi, A; Riccioni, L

    Coniothyrium-like fungi are common wood and soil inhabitants and hyperparasites on other fungi. They belong to different fungal genera within the Pleosporales. Several isolates were obtained on wood of different Prunus species (plum, peach and nectarine) from South Africa, on Actinidia species from

  19. Host selection and adaptation are major driving forces shaping ALS Xylella fastidiosa population structure in the San Joaquin Valley of California

    Science.gov (United States)

    Xylella fastidiosa (Xf) causes disease in many commercial crops including almond leaf scorch (ALS) disease in susceptible almond (Prunus dulcis). In this study, genetic diversity and population structure of Xf associated with ALS disease were evaluated. Strains from two almond production sites in th...

  20. Assessing the extent and effects of herbicide drift into Danish hedgerows

    DEFF Research Database (Denmark)

    Bruus, M.; Strandberg, M. T.; Andersen, H. V.

    Very low dosages of herbicides are known to cause effects on bird cherry (Prunus avium) and hawthorn (Crataegus monogyna). With the purpose of studying whether this is a general phenomenon two other common hedgerow species, Sambucus nigra (elder) and Sorbus intermedia (Swedish whitebeam), were...

  1. Use of cryotherapy to eradicate pathogens from horticultural crops

    Science.gov (United States)

    Cryotherapy is a method by which pathogens are eliminated from infected plant materials through the process of exposing the shoot tips to cryogenic temperatures and then recovering them. It has been successfully implemented in potato, sweet potato, grapevine, raspberry, Prunus, and other fruit crops...

  2. Carbohydrate metabolism of vegetative and reproductive sinks in the late-maturing peach cultivar 'Encore'

    Science.gov (United States)

    Riccardo Lo Bianco; Mark Rieger; Shi-Jean S. Sung

    1999-01-01

    Activities of NAD+-dependent sorbitol dehydrogenase (SDH), sorbitol oxidase (SOX), sucrose synthase (SS), acid invertase (AI), and neutral invertase (NI) in ?Encore? peach (Prunus persica L.) fruits and developing shoot tips were assayed during the growing season to determine whether carbohydrate metabolizing enzymes could...

  3. Phytotherapy for children's nocturnal enuresis | Ahmadipour ...

    African Journals Online (AJOL)

    Results have shown that Zingiber officinale, Valeriana officinalis, Alcea rosea, Elettaria cardamomum, Cinnamomum verum, Ribes uva-crispa, Cornus mas, Juglans regia, Vitis vinifera, Sinapis spp., Olea europaea, and Prunus cerasus are a number of important plants that are effective on nocturnal enuresis in traditional ...

  4. Influence of species composition of biocorridors on the abundance of aphids in cereal fields

    Czech Academy of Sciences Publication Activity Database

    Ameixa, Olga; Dvořáková, R.; Šipoš, Jan; Kindlmann, Pavel

    2014-01-01

    Roč. 4, č. 1 (2014), s. 47-52 ISSN 1805-0174 R&D Projects: GA MŠk(CZ) ED1.1.00/02.0073 Institutional support: RVO:67179843 Keywords : biocorridors * Prunus padus * Rhopalosiphum padi * pest refuge * spatial distribution Subject RIV: EH - Ecology, Behaviour

  5. Fruit size QTL analysis of an F1 population derived from a cross between a domesticated sweet cherry cultivar and a wild forest sweet cherry

    NARCIS (Netherlands)

    Zhang, G.; Sebolt, A.M.; Sooriyapathirana, S.S.; Wang, D.; Bink, M.C.A.M.; Olmstead, J.W.; Iezzoni, A.F.

    2010-01-01

    Maximizing fruit size is critical for profitable sweet cherry (Prunus avium L.) production. Yet, despite its importance, little is known about the genetic control of fruit size. The objective of this study was to identify quantitative trait loci (QTLs) for fruit size and two essential components of

  6. Susceptibility of sweet and sour cherry cultivars/genotypes to feeding damage caused by Bryobia rubrioculus (Acari: Tetranychidae)

    Czech Academy of Sciences Publication Activity Database

    Honarparvar, N.; Khanjani, M.; Zemek, Rostislav; Bouzari, N.

    2018-01-01

    Roč. 23, č. 1 (2018), s. 78-90 ISSN 1362-1971 Institutional support: RVO:60077344 Keywords : Prunus * brown mite * fee ding damage Subject RIV: GF - Plant Pathology, Vermin, Weed, Plant Protection OBOR OECD: Agronomy, plant breeding and plant protection Impact factor: 1.467, year: 2016

  7. African Journal of Biotechnology - Vol 11, No 83 (2012)

    African Journals Online (AJOL)

    Genetic diversity among selected genotypes of almond Prunus dulcis Miller D.A. Webb assessed by random amplified polymorphic DNA (RAPD) markers · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. Deepka Sharma, Rajinder Kaur, Krishan Kumar, SatyaVrat ...

  8. Archeological Survey of Undeveloped Portions of Eaker Air Force Base, Mississippi County, Arkansas

    Science.gov (United States)

    1991-01-25

    Swamp (Quercus bicolor) T I White (Quercus alba)11 Pecan ( Carya illinoensis ) Persimmon (Diospyros virginiana) T 2 2 Plum (Prunus sp.) T Red Haw...Celtus occidentalis) 12 9 Hickory, ( Carya sp.) 5 4 Sheilbark ( Carya laciniosa) T Hornbeamn (Ostrya virginiana) 2 Kentucky Coffee Tree(Gymnocladus dioica

  9. Toward sustainable harvesting of Africa's largest medicinal plant ...

    African Journals Online (AJOL)

    Global demand for treating prostate disorders with Prunus africana bark extract has made P. africana Africa's largest medicinal plant export. Unsustainable harvesting practices can lead to local extirpations of this multipurpose tree. Survey research targeting P. africana harvesters in a Tanzania forest reserve revealed that ...

  10. Breeding in peach, cherry and plum: from a tissue culture, genetic, transcriptomic and genomic perspective

    Directory of Open Access Journals (Sweden)

    Basilio Carrasco

    2013-01-01

    Full Text Available This review is an overview of traditional and modern breeding methodologies being used to develop new Prunus cultivars (stone fruits with major emphasis on peach, sweet cherry and Japanese plum. To this end, common breeding tools used to produce seedlings, including in vitro culture tools, are discussed. Additionally, the mechanisms of inheritance of many important agronomical traits are described. Recent advances in stone fruit transcriptomics and genomic resources are providing an understanding of the molecular basis of phenotypic variability as well as the identification of allelic variants and molecular markers. These have potential applications for understanding the genetic diversity of the Prunus species, molecular marker-assisted selection and transgenesis. Simple Sequence Repeat (SSR and Single Nucleotide Polymorphism (SNPs molecular markers are described as useful tools to describe genetic diversity in peach, sweet cherry and Japanese plum. Additionally, the recently sequenced peach genome and the public release of the sweet cherry genome are discussed in terms of their applicability to breeding programs

  11. Methylation of the S f locus in almond is associated with S-RNase loss of function.

    Science.gov (United States)

    Fernández i Martí, Angel; Gradziel, Thomas M; Socias i Company, Rafel

    2014-12-01

    Self-compatibility in almond (Prunus dulcis) is attributed to the presence of the S f haplotype, allelic to and dominant over the series of S-alleles controlling self-incompatibility. Some forms of the S f haplotype, however, are phenotypically self-incompatible even though their nucleotide sequences are identical. DNA from leaves and styles from genetically diverse almond samples was cloned and sequenced and then analyzed for changes affecting S f -RNase variants. Epigenetic changes in several cytosine residues were detected in a fragment of 4,700 bp of the 5' upstream region of all self-compatible samples of the S f -RNases, differentiating them from all self-incompatible samples of S f -RNases analyzed. This is the first report of DNA methylation in a Rosaceae species and appears to be strongly associated with inactivation of the S f allele. Results facilitate an understanding of the evolution of self-compatibility/self-incompatibility in almond and other Prunus species, and suggest novel approaches for future crop improvement.

  12. A Cherry Seed-Derived Spice, Mahleb, is Recognized by Anti-Almond Antibodies Including Almond-Allergic Patient IgE.

    Science.gov (United States)

    Noble, Kyle A; Liu, Changqi; Sathe, Shridhar K; Roux, Kenneth H

    2017-08-01

    There are a number of examples of immunologic cross-reactivity elicited by pollens, fruits, seeds, and nuts of closely related plant species. Such cross-reactivity is of particular concern for patients with food allergies. In this report, we investigated a spice (mahleb) that is prepared from the kernel of the St. Lucie cherry, Prunus mahaleb, for cross-reactivity with almond (Prunus dulcis), using enzyme-linked immunosorbent assay (ELISA) and Western blot. Almond and mahleb are members of the same genus. Cross-reactivity between the mahleb and almond was demonstrated by reaction of cherry and almond kernel protein extracts with antibodies raised against almond proteins. Almond-specific murine monoclonal IgG, rabbit polyclonal IgG, and almond-allergic serum IgE each exhibited cross-reactivity with cherry kernel protein. Because of the demonstrated cross-reactivity between almond and mahleb, these findings should be of special concern to almond-allergic patients and attending medical personnel. © 2017 Institute of Food Technologists®.

  13. Sensitive and specific detection of potentially allergenic almond (Prunus dulcis) in complex food matrices by Taqman real-time polymerase chain reaction in comparison to commercially available protein-based enzyme-linked immunosorbent assay

    Energy Technology Data Exchange (ETDEWEB)

    Roeder, Martin; Vieths, Stefan [Division of Allergology, Paul-Ehrlich-Institut, Paul-Ehrlich-Strasse 51-59, 63225 Langen (Germany); Holzhauser, Thomas, E-mail: holth@pei.de [Division of Allergology, Paul-Ehrlich-Institut, Paul-Ehrlich-Strasse 51-59, 63225 Langen (Germany)

    2011-01-24

    Currently, causative immunotherapies are lacking in food allergy. The only option to prevent allergic reactions in susceptible individuals is to strictly avoid the offending food. Thus, reliable labelling of allergenic constituents is of major importance, but can only be achieved if appropriate specific and sensitive detection techniques for foods with allergenic potential are available. Almond is an allergenic food that requires mandatory labelling on prepackaged foods and belongs to the genus Prunus. Species of this genus are phylogenetically closely related. We observed commercially available almond specific ELISA being highly cross-reactive with other foods of the Prunoideae family, resulting in a false-positive detection of up to 500,000 mg kg{sup -1} almond. Previously published PCR methods were reported to be cross-reactive with false positive results >1200 mg kg{sup -1}. We describe the development of a novel almond specific real-time PCR, based on mutated mismatch primers and sequence specific Taqman probe detection, in comparison with two quantitative commercially available ELISA. PCR sensitivity was investigated with chocolate, chocolate coating and cookies spiked between 5 and 100,000 mg kg{sup -1} almond. In all matrices almond was reproducibly detected by real-time PCR at the lowest spike level of 5 mg kg{sup -1}. Further, between 100 and 100,000 mg kg{sup -1} spiked almond, the method featured good correlation between quantified copy numbers and the amount of spiked almond. Within this range a similar relation between detectable signal and amount of almond was observed for both PCR and ELISA. In contrast to ELISA the Taqman real-time PCR method was highly specific in 59 food items with negligible cross-reactivity for a very limited number of Prunoideae foods. The real-time PCR analysis of 24 retail samples was in concordance with ELISA results: 21% (n = 5) contained undeclared almond. This is the first completely disclosed real-time PCR method for a

  14. Detection of selected plant viruses by microarrays

    OpenAIRE

    HRABÁKOVÁ, Lenka

    2013-01-01

    The main aim of this master thesis was the simultaneous detection of four selected plant viruses ? Apple mosaic virus, Plum pox virus, Prunus necrotic ringspot virus and Prune harf virus, by microarrays. The intermediate step in the process of the detection was optimizing of multiplex polymerase chain reaction (PCR).

  15. Beschrijving en rangschikking van in Nederland voorkomende kersen-vormen

    NARCIS (Netherlands)

    Rietsema, I.

    1928-01-01

    The history of the systematics of the subsection Eucerasus was reviewed. Since Linnaeus the number of species increased until Roemer, whose startling results caused a reaction. At that time botanists only recognized 3 or 4 species. Rietsema proposed only Prunus avium L. and P. cerasus L. as species.

  16. Apple mosaic virus

    Science.gov (United States)

    Apple mosaic virus (ApMV), a member of the ilarvirus group, naturally infects Betula, Aesculus, Humulus, and several crop genera in the family Rosaceae (Malus, Prunus, Rosa and Rubus). ApMV was first reported in Rubus in several blackberry and raspberry cultivars in the United States and subsequentl...

  17. Efficacy of brown sugar flotation and hot water methods for detecting Rhagoletis indifferens (Dipt., Tephritidae) larvae

    Science.gov (United States)

    The brown sugar flotation and hot water methods are accepted procedures for detecting larval western cherry fruit fly, Rhagoletis indifferens Curran, in sweet cherry [Prunus avium (L.) L.] and could be included in a systems approach for showing the absence of larvae in fruit. The methods require cr...

  18. An endangered species in Cameroon

    African Journals Online (AJOL)

    Justine Nzweundji

    2015-08-19

    Aug 19, 2015 ... 2002) and one of the main sources of supply to satisfy this demand consists of Cameroon natural populations. (Nsawir and Ingram, 2007). Unfortunately, much of this exploitation has been ..... Prunus africana: Money growing on trees? A plant that can boost rural economies in the Cameroon Highlands.

  19. Leaching behavior of water-soluble carbohydrates from almond hulls

    Science.gov (United States)

    Over 58% of the dry matter content of the hulls from the commercial almond (Prunus dulcis (Miller) D.A. Webb) is soluble in warm water (50-70°C) extraction. The water-soluble extractables include useful amounts of fermentable sugars (glucose, fructose, sucrose), sugar alcohols (inositol and sorbito...

  20. Strain of Fusarium oxysporum Isolated From Almond Hulls Produces Styrene and 7-Methyl-1,3,5-Cyclooctatriene as the Principal Volatile Components

    Science.gov (United States)

    An isolated strain of Fusarium oxysporum from the hulls of Prunus dulcis (sweet almond) was found to produce relatively large quantities of the hydrocarbons styrene and three isomers of 7-methyl-1,3,5-cyclooctatriene (MCOT). Production of styrene and MCOT was reproduced on small scale using potato d...