WorldWideScience

Sample records for amblyomma variegatum acari

  1. Phylogeography and Demographic History of Amblyomma variegatum (Fabricius) (Acari: Ixodidae), the Tropical Bont Tick

    OpenAIRE

    Beati, Lorenza; Patel, Jaymin; Lucas-Williams, Helene; Adakal, Hassane; Kanduma, Esther G.; Tembo-Mwase, Enala; Krecek, Rosina; Mertins, James W.; Alfred, Jeffery T.; Kelly, Susyn; Kelly, Patrick

    2012-01-01

    The genetic diversity of Amblyomma variegatum (Fabricius) from four Caribbean islands and five African countries was compared by analyzing the sequences of three gene fragments, two mitochondrial (12SrDNA and D-Loop-DL), and one nuclear (intergenic transcribed spacer 2 [ITS2]). Genetic variability of the ITS2 DNA fragment consisted of only uninformative single nucleotide mutations, and therefore this gene was excluded from further analyses. Mitochondrial gene divergences among African populat...

  2. Phylogeography and demographic history of Amblyomma variegatum (Fabricius) (Acari: Ixodidae), the tropical bont tick.

    Science.gov (United States)

    Beati, Lorenza; Patel, Jaymin; Lucas-Williams, Helene; Adakal, Hassane; Kanduma, Esther G; Tembo-Mwase, Enala; Krecek, Rosina; Mertins, James W; Alfred, Jeffery T; Kelly, Susyn; Kelly, Patrick

    2012-06-01

    The genetic diversity of Amblyomma variegatum (Fabricius) from four Caribbean islands and five African countries was compared by analyzing the sequences of three gene fragments, two mitochondrial (12SrDNA and D-Loop-DL), and one nuclear (intergenic transcribed spacer 2 [ITS2]). Genetic variability of the ITS2 DNA fragment consisted of only uninformative single nucleotide mutations, and therefore this gene was excluded from further analyses. Mitochondrial gene divergences among African populations and between Caribbean and African populations were very low. Nevertheless, the data suggest that A. variegatum is divided into distinct East and West African groups, the western group including all Caribbean samples. Phylogenetic analyses of the 12SrDNA and DL gene sequences showed that the West African A. variegatum clustered in a well-supported monophyletic clade, distinct from eastern paraphyletic lineages. Sequences of A. variegatum from the Caribbean were embedded in the West African clade, which supports the known West African historical origin for these ticks.

  3. Detection of Babesia caballi in Amblyomma variegatum ticks (Acari: Ixodidae) collected from cattle in the Republic of Guinea.

    Science.gov (United States)

    Tomassone, L; Pagani, P; De Meneghi, D

    2005-06-01

    A reverse line blot hybridisation (RLB) assay was applied to screen Amblyomma variegatum adult ticks (n = 504) collected from N'Dama cattle in the Republic of Guinea. In a PCR, the V1 hypervariable region of the 16S ribosomal RNA (rRNA) gene was amplified with a set of primers unique for species of the genera Anaplasma and Ehrlichia, and the V4 hypervariable region of the 18S rRNA gene was amplified with primers specific for members of the genera Theileria and Babesia. Amplified PCR products from A. variegatum ticks were hybridised onto a membrane, to which oligonucleotide probes species-specific for Ehrlichia/Anaplasma and Theileria/Babesia parasites were covalently linked. No pathogens belonging to Ehrlichia/Anaplasma species were found, while 10 DNA samples resulted positive for Babesia caballi and 5 samples for Theileria velifera. This is the first report of B. caballi in A. variegatum ticks. One of the B. caballi positive samples was sequenced. This new strain (BcabGuinea) showed a 97% similarity to the Z15104 B. caballi GenBank sequence.

  4. Cuticular hydrocarbon composition, phenotypic variability, and geographic relationships in allopatric populations of Amblyomma variegatum (Acari: Ixodidae) from Africa and the Caribbean.

    Science.gov (United States)

    Estrada-Peña, A; Castellá, J; Morel, P C

    1994-07-01

    Gas chromatography of cuticular hydrocarbons is used to determine the degree of genetic similarity and heterozygosity among 20 populations of Amblyomma variegatum (F.) collected from Africa and the Caribbean. Twenty-one compounds were detected in at least 90% of the specimens studied; another 57 hydrocarbons were detected in a variable number of specimens, ranging from 50 to 90% of all ticks extracted. Visual inspection of chromatograms revealed prominent differences in the relative abundance of hydrocarbons among the populations. Average heterozygosity was unexpectedly high (41.61%), whereas the average genetic identity among all populations was 0.8397. Principal components analysis for the relative amounts of several compounds did not provide adequate separation of populations according to geographical origin. Our data suggested that A. variegatum ticks are rapidly evolving and, while using several separate pathways, are sharing an undifferentiated genetic pool and retaining features that are typical for each population cluster.

  5. Amblyomma variegatum ticks and heartwater on three Caribbean Islands.

    Science.gov (United States)

    Vachiéry, Nathalie; Jeffery, Helena; Pegram, Rupert; Aprelon, Rosalie; Pinarello, Valérie; Kandassamy, Ranleen Lloyd Yane; Raliniaina, Modestine; Molia, Sophie; Savage, Hazel; Alexander, Randolph; Frebling, Mathieu; Martinez, Dominique; Lefrançois, Thierry

    2008-12-01

    Amblyomma variegatum tick infestation, tick infection by Ehrlichia ruminantium (ER), and ER genetic diversity were studied in the Caribbean Islands of Guadeloupe, Marie-Galante, and Antigua between 2003 and 2005. Nested PCR for pCS20 was used to detect ER, while ER strains were characterized by sequencing or by restriction fragment length polymorphism (RFLP) profiles of map-1 PCR products. In 2003 in Guadeloupe, the prevalence of tick-infested herds was 35.6%. In Marie-Galante 79.1% of herds in 2003 and 73.8% in 2005 were infested, while only an average of 2.2% of the herds were infected in Antigua between this same period. In Marie-Galante, 19.1% of ticks were ER positive, and ER-infected ticks were found in 33.3% of the herds. In Antigua only 5.8% of the ticks were ER positive. High ER tick infection rate combined with a very high level of tick infestation highlight the risk of heartwater in Marie-Galante and Guadeloupe more than in Antigua. The three islands still represent a reservoir for tick and heartwater in the Caribbean. Nine different African and Caribbean map-1 ER genotypes were identified. This diversity was observed even in restricted areas, and identical map-1 genotypes were observed on all three islands. This high genetic diversity of ER strains suggests that there was a simultaneous introduction of several strains from African countries into the Caribbean region.

  6. An Immunosuppressant Peptide from the Hard Tick Amblyomma variegatum

    Directory of Open Access Journals (Sweden)

    Yufeng Tian

    2016-05-01

    Full Text Available Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1–2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts’ immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA. In rat splenocytes, amregulin exerts significant anti-inflammatory effects by inhibiting the secretion of inflammatory factors in vitro, such as tumor necrosis factor-alpha (TNF-α, interleukin-1 (IL-1, interleukin-8 (IL-8 and interferon-gamma (IFN-γ. In rat splenocytes, treated with amregulin, compared to lipopolysaccharide (LPS alone, the inhibition of the above inflammatory factors was significant at all tested concentrations (2, 4 and 8 µg/mL. Amregulin shows strong free radical scavenging and antioxidant activities (5, 10 and 20 µg/mL in vitro. Amregulin also significantly inhibits adjuvant-induced paw inflammation in mouse models in vivo. This peptide may facilitate the ticks’ successful blood feeding and may lead to host immunotolerance of the tick. These findings have important implications for the understanding of tick-host interactions and the co-evolution between ticks and the viruses that they bear.

  7. Genetic diversity of Ehrlichia ruminantium in Amblyomma variegatum ticks and small ruminants in The Gambia determined by restriction fragment profile analysis

    OpenAIRE

    2007-01-01

    Genetic diversity of Ehrlichia ruminantium in Amblyomma variegatum ticks and small ruminants in The Gambia determined by restriction fragment profile analysis NETHERLANDS (Faburay, Bonto) NETHERLANDS Received: 2007-03-24 Revised: 2007-05-29 Accepted: 2007-06-14

  8. Factors of variation of Amblyomma variegatum infestation on Creole cattle in Guadeloupe.

    Science.gov (United States)

    Naves, M; Barré, N; Fargetton, M; Aprelon, R; Sheikboudou, C

    1996-07-23

    The level of infestation of "Creole" beef cattle of Guadeloupe by the tick Amblyomma variegatum was recorded during a long-term survey in an experimental farm: 61 steers and 83 cows were distributed in different lots according to sex and management. They grazed continuously either on irrigated Digitaria decumbens pastures or on dry native savannahs. Tick numbers as well as animal weights were registered monthly. Climatic data were also recorded. Different acaricide treatments were tested during the survey. But in order to minimize their effect in the data analysis, only tick counts over an average of 5 adult ticks per cattle were taken into account. The level of infestation is analyzed with respect to environmental factors (season, management) and individual factors (sex, weight, physiological stage, genetic effect). The effects of these factors are discussed with regard to alternative tick-control methods, such as the selection of resistant hosts.

  9. Rickettsia africae in Amblyomma variegatum and domestic ruminants on eight Caribbean islands.

    Science.gov (United States)

    Kelly, Patrick; Lucas, Helene; Beati, Lorenza; Yowell, Charles; Mahan, Suman; Dame, John

    2010-12-01

    We used PCRs with omp A primers to determine if spotted fever group rickettsiae occurred in Amblyomma variegatum from 6 Caribbean islands. Positive amplicons were obtained from ticks from the U.S. Virgin Islands (9/18; 50%), Dominica (39/171; 30%), Montserrat (2/5; 40%), Nevis (17/34; 50%), St. Kitts (46/227; 20%), and St. Lucia (1/14; 7%). Sequences for a convenience sample of reaction products obtained from A. variegatum on St. Kitts (7), American Virgin Islands (4), Montserrat (2), and St. Lucia (1) were 100% homologous with that of Rickettsia africae , the agent of African tick-bite fever. To determine if transmission of R. africae occurred, we used Rickettsia rickettsii antigen in IFA tests and found positive titers (≥ 1/80) with sera from cattle, goats, and sheep from Dominica (24/95 [25%], 2/136 [2%], 0/58 [0%]), Nevis (12/45 [27%], 5/157 [3%], 0/90 [0%]), St. Kitts (2/43 [5%], 1/25 [4%), 1/35 [3%]), and St. Lucia (6/184 [3%] cattle), respectively. No seropositive animals were found in Grenada (0/4, 0/98/, 0/86), Montserrat (0/12, 0/26, 0/52), or Puerto Rico (0/80 cattle). Our study indicates that R. africae and African tick-bite fever are widespread in the Caribbean.

  10. Ecology of Amblyomma neumanni (Acari: Ixodidae).

    Science.gov (United States)

    Nava, Santiago; Estrada-Peña, Agustín; Mangold, Atilio J; Guglielmone, Alberto A

    2009-09-01

    The life cycle of Amblyomma neumanni was described studying the seasonal distribution of free-living stages and parasitic phases during two consecutive years. Development periods of engorged ticks under different photoperiod conditions were recorded. Larvae of A. neumanni have the peak of abundance in autumn. Nymphs reach the peak in winter. Females were collected on cattle from autumn to late spring. The seasonal distribution pattern of females showed a bimodal curve, with a peak in autumn and other during early and middle spring. The engorged females exposed at shortest photoperiod regimen (10 h light-14 h dark) under both laboratory and field conditions undergo morphogenetic diapause, expressed as a delay in the oviposition. It is concluded that females of A. neumanni that feed and copulate in autumn undergo morphogenetic diapause, and they will lay eggs in spring, simultaneously with the females that feed and copulate in this season. Climate niche analysis shows that adequate suitability for A. neumanni depends mainly from temperature (mean, absolute maximum and minimum, and mean temperature in wettest and driest quarters) as well as from rainfall in warmest and coldest quarters. Sequences of 16S rDNA gene belonging to different populations of A. neumanni, showed no intraspecific genetic differentiation.

  11. A survey for spotted fever group rickettsiae and ehrlichiae in Amblyomma variegatum from St. Kitts and Nevis.

    Science.gov (United States)

    Kelly, Patrick J; Fournier, Pierre-Edouard; Parola, Philippe; Raoult, Didier

    2003-07-01

    Eighty-nine Amblyomma variegatum ticks were collected from the islands of St. Kitts and Nevis in the Caribbean and preserved in 70% ethanol or local rum. After being washed in sterile water, their DNA was extracted and analyzed by a polymerase chain reaction (PCR) for DNA of spotted fever group rickettsiae and ehrlichiae. None of the tested ticks was positive in a PCR assay using the primers 16S EHRD and 16S EHRR for the 16S rRNA gene of Ehrlichia spp.. Forty-one percent of the A. variegatum (36 of 89 of which 34 [47%] of 72 were adult males, 2 (13%) of 16 were adult females, and 0 (0%) of 1 were nymphs) were positive in a PCR assay using the primer pair 190-70 and 190-701 for the outer membrane protein A (ompA) gene of spotted fever group rickettsiae. All PCR amplification products obtained had 100% sequence homology with Rickettsia africae, the agent of African tick-bite fever.

  12. Differential transcription of the major antigenic protein 1 multigene family of Ehrlichia ruminantium in Amblyomma variegatum ticks.

    Science.gov (United States)

    Postigo, M; Taoufik, A; Bell-Sakyi, L; de Vries, E; Morrison, W I; Jongejan, F

    2007-06-21

    The rickettsial pathogen Ehrlichia ruminantium causes heartwater in ruminants and is transmitted by ticks of the genus Amblyomma. The map1 gene, encoding the major surface protein MAP1, is a member of a multigene family containing 16 paralogs. In order to investigate differential transcription of genes of the map1 multigene family in vivo in unfed and feeding ticks, RNA was extracted from midguts and salivary glands of E. ruminantium-infected adult female Amblyomma variegatum ticks and analysed by RT-PCR using MAP1 paralog-specific primers. In unfed ticks, only transcripts from the map1-1 gene were observed in midguts and no transcripts were detected in salivary glands. In feeding ticks, map1-1 transcripts were more abundant in midguts whereas high levels of map1 transcripts were observed in salivary glands. Our results show that differential transcription of genes of the E. ruminantium map1 cluster occurs in vivo in different tissues of infected ticks before and during transmission feeding, indicating that this multigene family may be involved in functions of biological relevance in different stages of the life cycle of E. ruminantium.

  13. Multi-locus sequence typing of Ehrlichia ruminantium strains from geographically diverse origins and collected in Amblyomma variegatum from Uganda

    Directory of Open Access Journals (Sweden)

    Jongejan Frans

    2011-07-01

    Full Text Available Abstract Background The rickettsial bacterium Ehrlichia ruminantium is the causative agent of heartwater in ruminants. A better understanding of the population genetics of its different strains is, however, needed for the development of novel diagnostic tools, therapeutics and prevention strategies. Specifically, the development of effective vaccination policies relies on the proper genotyping and characterisation of field isolates. Although multi-locus sequence typing (MLST has been recently developed, only strains from geographically restricted collections have been analysed so far. The expansion of the MLST database to include global strains with different geographic origins is therefore essential. In this study, we used a panel of reference strains from geographically diverse origins and field samples of E. ruminantium detected from its vector, Amblyomma variegatum, in heartwater-endemic areas in Uganda. Results A total of 31 novel alleles (six, four, six, three, two, five, three, and two for gltA, groEL, lepA, lipA, lipB, secY, sodB, and sucA loci, respectively and 19 novel sequence types (STs were identified. Both neighbour-joining and minimum spanning tree analyses indicated a high degree of genetic heterogeneity among these strains. No association was observed between genotypes and geographic origins, except for four STs from West African countries. When we performed six different tests for recombination (GeneConv, Bootscan, MaxChi, Chimaera, SiScan, and 3Seq on concatenated sequences, four possible recombination events were identified in six different STs. All the recombination breakpoints were located near gene borders, indicating the occurrence of intergenic recombination. All four STs that localized to a distinct group in clustering analysis showed evidence of identical recombination events, suggesting that recombination may play a significant role in the diversification of E. ruminantium. Conclusions The compilation of MLST data set

  14. High prevalence of spotted fever group rickettsiae in Amblyomma variegatum from Uganda and their identification using sizes of intergenic spacers.

    Science.gov (United States)

    Nakao, Ryo; Qiu, Yongjin; Igarashi, Manabu; Magona, Joseph W; Zhou, Lijia; Ito, Kimihito; Sugimoto, Chihiro

    2013-12-01

    The spotted fever group (SFG) rickettsiae are obligate intracellular bacteria transmitted by ticks that cause several tick-borne rickettsioses in humans worldwide. This study was intended to determine the prevalence of SFG rickettsiae in Amblyomma variegatum from 7 districts across Uganda. In addition to sequencing of gltA and ompA genes, identification of Rickettsia species based on the sizes of highly variable intergenic spacers, namely, dksA-xerC, mppA-purC, and rpmE-tRNA(fMet) was carried out. Application of multiplex PCR for simultaneous amplification of 3 spacers combined with capillary electrophoresis separation allowed simple, accurate, and high-throughput fragment sizing with considerable time and cost savings. Rickettsia genus-specific real-time PCR detected 136 positives out of 140 samples, giving an overall prevalence of 97.1%. Most samples (n=113) had a size combination of 225, 195, and 341 bp for dksA-xerC, mppA-purC, and rpmE-tRNA(fMet), respectively, which was identical to that of R. africae, a causative agent of African tick bite fever. In addition, several samples had size variants in either dksA-xerC or rpmE-tRNA(fMet). Nonetheless, the partial sequences of gltA and ompA genes of samples of all size combinations showed the greatest similarity to R. africae (99.3-100% for gltA and 98.1-100% for ompA). Given these results, it is highly possible that the tested ticks were infected with R. africae or closely related species. This is a first report on molecular genetic detection of R. africae and its high endemicity in Uganda. Clinicians in this country should be aware of this pathogen as a cause of non-malarial febrile illness. This study provided a starting point for the development of Rickettsia species identification based on the sizes of intergenic spacers. The procedure is simple, rapid, and cost-effective to perform; hence it might be particularly well suited for preliminary species identification in epidemiological investigations. The results

  15. High detection rate of Rickettsia africae in Amblyomma variegatum but low prevalence of anti-rickettsial antibodies in healthy pregnant women in Madagascar.

    Science.gov (United States)

    Keller, Christian; Krüger, Andreas; Schwarz, Norbert Georg; Rakotozandrindrainy, Raphael; Rakotondrainiarivelo, Jean Philibert; Razafindrabe, Tsiry; Derschum, Henri; Silaghi, Cornelia; Pothmann, Daniela; Veit, Alexandra; Hogan, Benedikt; May, Jürgen; Girmann, Mirko; Kramme, Stefanie; Fleischer, Bernhard; Poppert, Sven

    2016-02-01

    Tick-borne spotted fever group (SFG) rickettsioses are emerging infectious diseases in Sub-Saharan Africa. In Madagascar, the endemicity of tick-borne rickettsiae and their vectors has been incompletely studied. The first part of the present study was conducted in 2011 and 2012 to identify potential anthropophilic tick vectors for SFG rickettsiae on cattle from seven Malagasy regions, and to detect and characterize rickettsiae in these ticks. Amblyomma variegatum was the only anthropophilic tick species found on 262 cattle. Using a novel ompB-specific qPCR, screening for rickettsial DNA was performed on 111 A. variegatum ticks. Rickettsial DNA was detected in 96 of 111 ticks studied (86.5%). Rickettsia africae was identified as the only infecting rickettsia using phylogenetic analysis of ompA and ompB gene sequences and three variable intergenic spacers from 11 ticks. The second part of the study was a cross-sectional survey for antibodies against SFG rickettsiae in plasma samples taken from healthy, pregnant women at six locations in Madagascar, two at sea level and four between 450 and 1300m altitude. An indirect fluorescent antibody test with Rickettsia conorii as surrogate SFG rickettsial antigen was used. We found R. conorii-seropositives at all altitudes with prevalences between 0.5% and 3.1%. Our results suggest that A. variegatum ticks highly infected with R. africae are the most prevalent cattle-associated tick vectors for SFG rickettsiosis in Madagascar. Transmission of SFG rickettsiosis to humans occurs at different altitudes in Madagascar and should be considered as a relevant cause of febrile diseases.

  16. High prevalence of Rickettsia africae variants in Amblyomma variegatum ticks from domestic mammals in rural western Kenya: implications for human health.

    Science.gov (United States)

    Maina, Alice N; Jiang, Ju; Omulo, Sylvia A; Cutler, Sally J; Ade, Fredrick; Ogola, Eric; Feikin, Daniel R; Njenga, M Kariuki; Cleaveland, Sarah; Mpoke, Solomon; Ng'ang'a, Zipporah; Breiman, Robert F; Knobel, Darryn L; Richards, Allen L

    2014-10-01

    Tick-borne spotted fever group (SFG) rickettsioses are emerging human diseases caused by obligate intracellular Gram-negative bacteria of the genus Rickettsia. Despite being important causes of systemic febrile illnesses in travelers returning from sub-Saharan Africa, little is known about the reservoir hosts of these pathogens. We conducted surveys for rickettsiae in domestic animals and ticks in a rural setting in western Kenya. Of the 100 serum specimens tested from each species of domestic ruminant 43% of goats, 23% of sheep, and 1% of cattle had immunoglobulin G (IgG) antibodies to the SFG rickettsiae. None of these sera were positive for IgG against typhus group rickettsiae. We detected Rickettsia africae-genotype DNA in 92.6% of adult Amblyomma variegatum ticks collected from domestic ruminants, but found no evidence of the pathogen in blood specimens from cattle, goats, or sheep. Sequencing of a subset of 21 rickettsia-positive ticks revealed R. africae variants in 95.2% (20/21) of ticks tested. Our findings show a high prevalence of R. africae variants in A. variegatum ticks in western Kenya, which may represent a low disease risk for humans. This may provide a possible explanation for the lack of African tick-bite fever cases among febrile patients in Kenya.

  17. An attempt to correlate cattle breed origins and diseases associated with or transmitted by the tick Amblyomma variegatum in the French West Indies.

    Science.gov (United States)

    Maillard, J C; Kemp, S J; Naves, M; Palin, C; Demangel, C; Accipe, A; Maillard, N; Bensaid, A

    1993-01-01

    By using biological data and historical research, we have tried to explain the difference between resistance and susceptibility to the diseases transmitted (cowdriosis) or associated (dermatophilosis) with the tick Amblyomma variegatum, in two cattle breeds of the French West Indies: the Creole crossbred cattle of Guadeloupe and the Brahman zebu cattle of Martinique. Have been studied the polymorphisms of 5 independent genetic systems (erythrocytic haemoglobin, serum albumin and transferrin, the class I region of the BoLA complex and the gamma S crystallin gene) in different breeds comprising Bos taurus cattle of Europe and Africa, Bos indicus of West and East Africa, as well as the Brahman of Martinique and the Creole crossbred of Guadeloupe. By comparing the different allele frequencies of these 5 non related polymorphic loci and by using the two different mathematical matrices of NEI and of CAVALLI-SFORZA, have been established the genetic distances between these breeds. It appears clearly that the Creole cattle of Guadeloupe are in an intermediate position between the Bos taurus N'Dama breed of West Africa and two Bos indicus zebu breeds, namely the West African Sudan zebu and the Brahman. Thanks to studies of different archieves in the Caribbean and in Europe, historical evidence have been accumulated on the geographical origins and on the chronology of the establishment of Creole and Brahman cattle in the French West Indies. The high resistance of the Creole cattle of Guadeloupe to diseases associated with or transmitted by the "Senegalese" tick Amblyomma variegatum seems to be due to the inheritance of a pool of genes from West African cattle and more particularly from the N'Dama breed.(ABSTRACT TRUNCATED AT 250 WORDS)

  18. [Amblyomma triste and Amblyomma tigrinum (Acari: Ixodidae) in sympatry in Santa Fe Province, Argentina].

    Science.gov (United States)

    Colombo, Valeria C; Antoniazzi, Leandro R; Fasano, Agustín A; Beldomenico, Pablo M; Nava, Santiago

    2016-01-01

    The aim of this communication is to report, for the first time, the occurrence of Amblyomma triste in Santa Fe province, Argentina, and to add a new isolation place for Amblyomma tigrinum. Both species of ticks are vectors of Rickettsia parkeri, a spotted fever group rickettsia. Ticks were recovered from tourists in August 2014 and December 2015 at the Federico Wildermuth Foundation (31° 59'S, 61° 24'O), San Martin Department, Santa Fe province. Five adult ticks were morphologically identified as A. tigrinum (3 females and 1 male) and A. triste (1 female). This is the first finding including both Amblyomma maculatum group species, A. triste and A. tigrinum, together in the same locality in Argentina. This finding suggests that this site might have favorable features for the development of both species of R. parkeri vector. Further studies including sampling of a larger number of ticks and detection of R. parkeri DNA are needed to better document the epidemiology of this rickettsia in Santa Fe.

  19. Simultaneous detection of Anaplasma and Ehrlichia species in ruminants and detection of Ehrlichia ruminantium in Amblyomma variegatum ticks by reverse line blot hybridization.

    Science.gov (United States)

    Bekker, Cornelis P J; de Vos, Sander; Taoufik, Amar; Sparagano, Olivier A E; Jongejan, Frans

    2002-10-22

    The detection of Anaplasma and Ehrlichia species is usually based on species-specific PCR assays, since no assay is yet available which can detect and identify these species simultaneously. To this end, we developed a reverse line blot (RLB) assay for simultaneous detection and identification of Anaplasma and Ehrlichia species in domestic ruminants and ticks. In a PCR the hypervariable V1 region of the 16S ribosomal RNA (rRNA) gene was amplified with a set of primers unique for members of the genera Anaplasma and Ehrlichia [Int. J. Syst. Evol. Microbiol. 51 (2001) 2145]. Amplified PCR products from blood of domestic ruminants or Amblyomma variegatum tick samples were hybridized onto a membrane to which eight species-specific oligonucleotide probes and one Ehrlichia and Anaplasma catch-all oligonucleotide probe were covalently linked. No DNA was amplified from uninfected blood, nor from other hemoparasites such as Theileria annulata, or Babesia bigemina. The species-specific probes did not cross-react with DNA amplified from other species. E. ruminantium, A. ovis and another Ehrlichia were identified by RLB in blood samples collected from small ruminants in Mozambique. Finally, A. variegatum ticks were tested after feeding on E. ruminantium infected sheep. E. ruminantium could be detected in adult ticks even if feeding of nymphs was carried out 3.5 years post-infection. In conclusion, the developed species-specific oligonucleotide probes used in an RLB assay can simultaneously detect and identify several Ehrlichia and Anaplasma species. However, as no quantitative data for the detection limit are available yet, only positive results are interpretable at this stage.

  20. Brazilian distribution of Amblyomma varium Koch, 1844 (Acari: Ixodidae, a common parasite of sloths (Mammalia: Xenarthra

    Directory of Open Access Journals (Sweden)

    Marques Sandro

    2002-01-01

    Full Text Available Amblyomma varium, commonly known in Brazil as the "carrapato-gigante-da-preguiça" (sloth's giant tick is found from southern Central America to Argentina. The present study adds information on the geographical distribution of A. varium, as well as on their hosts, based on material deposited in the main Brazilian collections and on the available literature. Eighty-two vials, containing 191 adult specimens, deposited in five Acari collections between 1930 and 2001, were examined. These vials included data on the host and collection localities. The biology of A. varium is unknown. However it is known that, during the adult stage, the tick presents a high host specificity and is found almost exclusively on the sloths Bradypus tridactylus, B. variegatus, B.torquatus (Bradypodidae, Choloepus hoffmanni and C. didactylus (Megalonychidae. Based on the material examined, the states of Rondônia, Amazonas, Bahia and Alagoas are newly assigned to geographic distribution of A. varium in Brazil.

  1. Brazilian distribution of Amblyomma varium Koch, 1844 (Acari: Ixodidae), a common parasite of sloths (Mammalia: Xenarthra).

    Science.gov (United States)

    Marques, Sandro; Barros-Battesti, Darci Moraes; Faccini, João Luiz Horacio; Onofrio, Valeria Castilho

    2002-12-01

    Amblyomma varium, commonly known in Brazil as the "carrapato-gigante-da-pregui a" (sloth's giant tick) is found from southern Central America to Argentina. The present study adds information on the geographical distribution of A. varium, as well as on their hosts, based on material deposited in the main Brazilian collections and on the available literature. Eighty-two vials, containing 191 adult specimens, deposited in five Acari collections between 1930 and 2001, were examined. These vials included data on the host and collection localities. The biology of A. varium is unknown. However it is known that, during the adult stage, the tick presents a high host specificity and is found almost exclusively on the sloths Bradypus tridactylus, B. variegatus, B.torquatus (Bradypodidae), Choloepus hoffmanni and C. didactylus (Megalonychidae). Based on the material examined, the states of Rond nia, Amazonas, Bahia and Alagoas are newly assigned to geographic distribution of A. varium in Brazil.

  2. Genetic diversity of Ehrlichia ruminantium in Amblyomma variegatum ticks and small ruminants in The Gambia determined by restriction fragment profile analysis.

    Science.gov (United States)

    Faburay, Bonto; Jongejan, Frans; Taoufik, Amar; Ceesay, Ansumana; Geysen, Dirk

    2008-01-01

    Understanding genetic diversity of Ehrlichia ruminantium in host and vector populations is an important prerequisite to controlling heartwater by vaccination in traditional livestock systems in sub-Saharan Africa. We carried out a study in two phases: (i) evaluating the usefulness of the PCR-RFLP assay based on the map1 coding sequence of E. ruminantium as a discriminatory tool to characterise genetic diversity, (ii) applying the technique to field samples from Amblyomma variegatum ticks and small ruminants to characterise genotypic diversity of the organism in three main agroecological zones of The Gambia, Sudano-Guinean (SG), Western Sudano-Sahelian (WSS) and Eastern Sudano-Sahelian (ESS). Restriction fragment length polymorphisms were observed among different strains of E. ruminantium supporting the usefulness of the PCR-RFLP technique for studying genetic diversity of the organism. Restriction enzyme map1 profile analysis indicated the presence in The Gambia of multiple genotypes (at least 11) of E. ruminantium with sites in the WSS and SG zones showing comparatively high number of diverse genotypes. Profiles similar to the Kerr Seringe genotype (DQ333230) showed the highest distribution frequency, being present at sites in all three agroecological zones, thereby making the strain a suitable candidate for further characterisation in cross-protection studies. An additional three genotypes showed relatively high distribution frequency and were present in all three zones making them equally important for isolation and subsequent characterisation. The study demonstrated the occurrence of mixed infections with E. ruminantium genotypes in ruminants and ticks.

  3. Prevalence and genetic characterization of Anaplasma marginale in zebu cattle (Bos indicus) and their ticks (Amblyomma variegatum, Rhipicephalus microplus) from Madagascar.

    Science.gov (United States)

    Pothmann, Daniela; Poppert, Sven; Rakotozandrindrainy, Raphael; Hogan, Benedikt; Mastropaolo, Mariano; Thiel, Claudia; Silaghi, Cornelia

    2016-10-01

    Tick-borne bovine anaplasmosis, caused by the obligate intracellular pathogen Anaplasma marginale (Rickettsiales: Anaplasmataceae), is a major constraint to cattle production in tropical and subtropical regions. From Madagascar, clinical cases were published but data based on molecular methods regarding the prevalence and genetic diversity of this pathogen on the island are lacking. The aims of this study were to investigate (1) the prevalence of A. marginale in Malagasy zebu cattle (Bos indicus) and their ticks with a species-specific real-time PCR, (2) the genetic diversity of A. marginale based on tandem repeats and microsatellites of the msp1α gene, and (3) the phylogenetic relationship between A. marginale isolates from Madagascar and strains found worldwide. Two hundred fourteen blood samples and 1822 ticks from 214 zebu cattle were collected. Rhipicephalus (R) microplus (40.2%) and Amblyomma (A) variegatum (59.8%) were identified on the cattle. A. marginale DNA was found in 89.7% of the examined zebu cattle and in 62.3% of the examined ticks. The tandem repeat and microsatellite analyses of the mspa1 gene showed high genetic diversity among the isolates between and within the different regions and high infection potential. Eighteen of the 25 tandem repeats identified have not been described before. Phylogenetic analysis revealed clustering of A. marginale strains from Madagascar with South Africa, America and Israel. A common ancestor may originate from South Africa and may have evolved due to phylogeographic characteristics or by a history of cattle movement. Its high prevalence in cattle and ticks, together with a low number of clinical manifestations and a high genetic heterogeneity among the investigated strains, confirms endemic stability of A. marginale in cattle from Madagascar.

  4. Oviposition capacity and egg mass to fecundity weight ratios in laboratory cultured amblyoma variegatum fabricius, 1794 (Acari: Ixodida

    Directory of Open Access Journals (Sweden)

    E. Nkegbe

    2014-02-01

    Full Text Available We studied the reproductive characteristics of femaleAmblyoma variegatum in the laboratory. These included variations in engorgedweight, percentage body mass due to eggs, and quantity of eggs an engorgedfemale could lay. The results showed that different volumes of blood mealswould be consumed by the same progeny of Am. variegatum female ticks leading todifferent engorged weights. The study revealed that in Am. variegatum egg masscould account for as high as 51% of the engorged body weight. The female tickcould also oviposit as high as 31,487 eggs and also as low as 2421 eggs in samestudy cohorts. The study also showed that the actual engorged weight might notreflect the actual ovipositing capacity of the tick. Only the weight of the eggmass laid determined the actual quantity of eggs.

  5. Bacterial diversity in Amblyomma americanum (Acari: Ixodidae) with a focus on members of the genus Rickettsia.

    Science.gov (United States)

    Heise, Stephanie R; Elshahed, M S; Little, S E

    2010-03-01

    The lone star tick, Amblyomma americanum (Acari: Ixodidae), is commonly reported from people and animals throughout the eastern U.S. and is associated with transmission of a number of emerging diseases. To better define the microbial communities within lone star ticks, 16S rRNA gene based analysis using bacteria-wide primers, followed by sequencing of individual clones (n = 449) was used to identify the most common bacterial operational taxonomic units (OTUs) present within colony-reared and wild A. americanum. The colony-reared ticks contained primarily sequence affiliated with members of the genus Coxiella (89%; 81/91), common endosymbionts of ticks, and Brevibacterium (11%; 10/91). Similarly, analysis of clones from unfed wild lone star ticks revealed that 96.7% (89/92) of all the OTUs identified were affiliated with Coxiella-like endosymbionts, as compared with only 5.1-11.7% (5/98-9/77) of those identified from wild lone star ticks after feeding. In contrast, the proportion of OTUs identified as Rickettsia sp. in wild-caught ticks increased from 2.2% (2/92) before feeding to as high as 46.8% (36/77) after feeding, and all Rickettsia spp. sequences recovered were most similar to those described from the spotted fever group Rickettsia, specifically R. amblyommii and R. massiliae. Additional characterization of the Rickettsiales tick community by polymerase chain reaction, cloning, and sequencing of 17 kDa and gltA genes confirmed these initial findings and suggested that novel Rickettsia spp. are likely present in these ticks. These data provide insight into the overall, as well as the rickettsial community of wild lone star ticks and may ultimately aid in identification of novel pathogens transmitted by A. americanum.

  6. Comparative analysis of germ cells and DNA of the genus Amblyomma: adding new data on Amblyomma maculatum and Amblyomma ovale species (Acari: Ixodidae).

    Science.gov (United States)

    Rivera-Páez, Fredy Arvey; Sampieri, Bruno Rodrigues; Labruna, Marcelo Bahia; da Silva Matos, Renata; Martins, Thiago Fernandes; Camargo-Mathias, Maria Izabel

    2017-08-18

    Among tick species, members of the subfamily Amblyomminae have received special attention, since they serve as vectors for pathogens such as Rickettsia spp. and display cryptic species complexes that make their taxonomical classification challenging. Amblyomma ovale, Amblyomma maculatum, and other species of the genus Amblyomma have shown a long history of taxonomic controversies. Spermiotaxonomy has proved to be a valuable tool in the solution of systematic conflicts in Metazoa that can aid molecular and external morphological analyses in ticks and, overall, provide more robust analyses and results. With this in mind, this study included histological analyses of the reproductive system of the species A. ovale and A. maculatum, as well as the description of morphohistological characters of the male reproductive system of ticks of the genus Amblyomma, in order to evaluate these characters within the current clustering proposals. In addition, 16S rDNA and COI (mitochondrial) molecular markers were used to study the genetic relationships of the species. The results show that the tick male reproductive system and its germ cells contain useful candidate characters for taxonomical analyses of Ixodida.

  7. Rickettsia parkeri Transmission to Amblyomma americanum by Cofeeding with Amblyomma maculatum (Acari: Ixodidae) and Potential for Spillover.

    Science.gov (United States)

    Wright, Chelsea L; Sonenshine, Daniel E; Gaff, Holly D; Hynes, Wayne L

    2015-09-01

    Amblyomma americanum (L.) is a human-biting ixodid tick distributed throughout much of the southeastern United States. Rickettsia parkeri is a member of the spotted fever group rickettsiae and causes a febrile illness in humans commonly referred to as "Tidewater spotted fever" or "R. parkeri rickettsiosis." Although the Gulf Coast tick, Amblyomma maculatum Koch, is the primary vector of R. parkeri, a small proportion of A. americanum have also been shown to harbor R. parkeri. The purpose of this investigation was to determine whether R. parkeri is spilling over into A. americanum in eastern Virginia and also to determine through laboratory experiments, whether A. americanum can acquire R. parkeri by cofeeding alongside infected ticks. Of 317 wild-caught, flat adult A. americanum tested from 29 counties and independent cities in coastal Virginia, a single female A. americanum was positive for R. parkeri, suggesting that R. parkeri is spilling over into this species, but at very low rates (Rickettsia amblyommii, however, were less likely to acquire R. parkeri, suggesting that infection with R. amblyommii may prevent R. parkeri from establishing infection in A. americanum.

  8. Nymphs of the genus Amblyomma (Acari: Ixodidae) of Brazil: descriptions, redescriptions, and identification key.

    Science.gov (United States)

    Martins, Thiago F; Onofrio, Valeria C; Barros-Battesti, Darci M; Labruna, Marcelo B

    2010-06-01

    Together with the larval stage, the nymphal stage of ticks of the genus Amblyomma are the most aggressive ticks for humans entering areas inhabited by wildlife and some domestic animals in Brazil. However, due to the absence of morphological descriptions of the nymphal stage of most Brazilian Amblyomma species, plus the lack of an identification key, little or nothing is known about the life history of Amblyomma spp. nymphs in the country. In the present study, morphological description of the nymphal stage, illustrating important external characters through scanning electron microscopy, is provided for nymphs of 15 Amblyomma species that occur in Brazil, for which the nymphal stage had never been described: A. aureolatum, A. auricularium, A. calcaratum, A. coelebs, A. fuscum, A. humerale, A. incisum, A. latepunctatum, A. naponense, A. nodosum, A. ovale, A. pacae, A. pseudoconcolor, A. scalpturatum, A. varium. In addition, the nymphal stage of 12 Amblyomma species, which had been previously described, are redescribed: A. brasiliense, A. cajennense, A. dissimile, A. dubitatum, A. longirostre, A. oblongoguttatum, A. parkeri, A. parvum, A. romitii, A. rotundatum, A. tigrinum, A. triste. The descriptions and redescriptions totalized 27 species. Only 2 species (A. geayi, A. goeldii) out of the 29 Amblyomma species established in Brazil are not included in the present study. A dichotomous identification key is included to support taxonomic identification of the nymphal stage of 27 Amblyomma species established in Brazil.

  9. Amblyomma cajennense (Fabricius, 1787) (Acari: Ixodidae), the Cayenne tick: phylogeography and evidence for allopatric speciation

    National Research Council Canada - National Science Library

    Beati, Lorenza; Nava, Santiago; Burkman, Erica J; Barros-Battesti, Darci M; Labruna, Marcelo B; Guglielmone, Alberto A; Caceres, Abraham G; Guzman-Cornejo, Carmen M; Leon, Renato; Durden, Lance A; Faccini, Joao LH

    2013-01-01

    Background: Amblyomma cajennense F. is one of the best known and studied ticks in the New World because of its very wide distribution, its economical importance as pest of domestic ungulates, and its association with a variety...

  10. Amblyomma aureolatum (Pallas, 1772) and Amblyomma ovale Koch, 1844 (Acari: Ixodidae): hosts, distribution and 16S rDNA sequences.

    Science.gov (United States)

    Guglielmone, A A; Estrada-Peña, A; Mangold, A J; Barros-Battesti, D M; Labruna, M B; Martins, J R; Venzal, J M; Arzua, M; Keirans, J E

    2003-05-01

    DNA sequences of Amblyomma aureolatum (Pallas, 1772) and Amblyomma ovale Koch, 1844 were obtained to determine genetic differences between these tick species. Collections of these species are discussed in relation to distribution and hosts. Seven ticks collections (four from Brazil, one from Argentina, one from Uruguay and one from USA) house a total of 1272 A. aureolatum (224 males, 251 females, 223 nymphs and 574 larvae) and 1164 A. ovale (535 males, 556 females, 66 nymphs and 7 larvae). The length of the sequenced mitochondrial 16S rRNA gene fragment for A. aureolatum was 370bp and for A. ovale was 373bp. The DNA sequence analysis showed a 13.1% difference between the two species. Apart from one male A. ovale found on a toad, all adult ticks were found on mammals. The majority of adult specimens of both tick species were removed from Carnivora (96.1 and 84.3% of A. aureolatum and A. ovale, respectively), especially from dogs (53.1% of A. aureolatum, and 46.4% of A. ovale). Collections on wild Canidae were higher for A. aureolatum (23.3%) than for A. ovale (7.1%). On the other hand, collections of A. ovale adults on wild Felidae were higher (18.3%) than findings of A. aureolatum (9.2%). The contribution of other mammalian orders as hosts for adults of A. aureolatum and A. ovale was irrelevant, with the exception of Perissodactyla because Tapiridae contributed with 13.0% of the total number of A. ovale adults. Adults of both tick species have been found occasionally on domestic hosts (apart of the dog) and humans. Most immature stages of A. aureolatum were found on Passeriformes birds, while rodents and carnivores were the most common hosts for nymphs and larvae of A. ovale. A. aureolatum has been found restricted to the Neotropical region, covering the eastern area of South America from Uruguay to Surinam, including northeastern Argentina, eastern Paraguay, southeastern Brazil and French Guiana. A. ovale showed a distribution that covers the Neotropical region

  11. Amblyomma mixtum Koch, 1844 (Acari: Ixodidae): First record confirmation in Colombia using morphological and molecular analyses.

    Science.gov (United States)

    Rivera-Páez, Fredy A; Labruna, Marcelo B; Martins, Thiago F; Sampieri, Bruno Rodrigues; Camargo-Mathias, Maria I

    2016-07-01

    Up to some years ago, the taxon Amblyomma cajennense represented a single tick species in the New World, from southern United States to northern Argentina. Recent studies, based on genetic, reproductive and morphological data reorganized this taxon into a complex of the following 6 valid species: A. cajennense sensu stricto, Amblyomma mixtum, Amblyomma sculptum, Amblyomma interandinum, Amblyomma tonelliae, and Amblyomma patinoi. According to this classification, the A. cajennense complex is currently represented in Colombia by only one species, A. patinoi. Because the Colombian land is surrounded by confirmed records of A. mixtum in Panama and Ecuador, and by A. cajennense s.s. in Venezuela and the Brazilian Amazon, it is possible that these two species could also occur in Colombia. This study aimed to determine the occurrence of ticks of the A. cajennense complex in the Orinoquía region of Colombia. A total of 246 adult ticks of the Amblyomma genus were collected in three sampled regions: 71 females and 110 males in Arauca (Arauca Department), 27 females and 20 males in Nunchía (Casanare Department), and 10 females and 8 males in Yopal (Casanare Department). Based on morphological and molecular analyses, these ticks were identified as A. mixtum. Molecular analyses consisted of DNA sequences of two molecular markers, the nuclear second internal transcribed spacer (ITS2) and the mitochondrial cytochrome c oxidase subunit I gene (COI). The presence of A. mixtum in Colombia is of medical relevance, since this species is incriminated as a vector of Rickettsia rickettsii in Central America. Copyright © 2016. Published by Elsevier GmbH.

  12. Development of multiple-locus variable-number tandem-repeat analysis for rapid genotyping of Ehrlichia ruminantium and its application to infected Amblyomma variegatum collected in heartwater endemic areas in Uganda.

    Science.gov (United States)

    Nakao, Ryo; Morrison, Liam J; Zhou, Lijia; Magona, Joseph W; Jongejan, Frans; Sugimoto, Chihiro

    2012-01-01

    The rickettsial bacterium Ehrlichia ruminantium is the causative agent of heartwater, a serious tick-borne disease in ruminants. The genetic diversity of organisms in the field will have implications for cross-protective capacities of any vaccine developed, and for an effective vaccine design strategy proper genotyping and understanding of existing genetic diversity in the field is necessary. We searched for variable-number tandem-repeat (VNTR) loci for use in a multi-locus VNTR analysis (MLVA). Sequencing analysis of 30 potential VNTRs using a panel of 17 reference strains from geographically diverse origins identified 12 VNTRs with allelic profiles differing between strains. Application of MLVA to 38 E. ruminantium-infected Amblyomma variegatum collected from indigenous cattle in 6 different districts of Uganda identified 21 MLVA types. The discriminatory power of MLVA was greater than that of map1 PCR-restriction fragment length polymorphism analysis, with which only 6 genotypes were obtained. The high discriminatory power as well as cost- effective performance of MLVA provide the potential for this technique to be applied in the future with respect to optimizing vaccine trials by identifying local strain diversity, and also raise the possibility of exploring the association between E. ruminantium genotypes and phenotypes such as pathological outcome in the ruminant host.

  13. Distribution, hosts, 16S rDNA sequences and phylogenetic position of the Neotropical tick Amblyomma parvum (Acari: Ixodidae).

    Science.gov (United States)

    Nava, S; Szabó, M P J; Mangold, A J; Guglielmone, A A

    2008-07-01

    The hosts, distribution, intraspecific genetic variation and phylogenetic position of Amblyomma parvum (Acari: Ixodidae) have recently been re-assessed. Data on this tick's hosts and distribution were obtained not only from existing literature but also from unpublished records. Sequences of the ticks' mitochondrial 16S ribosomal DNA (rDNA) were used to evaluate genetic variation among specimens of A. parvum from different localities in Argentina and Brazil, and to explore the phylogenetic relationships between this tick and other Amblyomma species. Although several species of domestic and wild mammal act as hosts for adult A. parvum, most collected adults of this species have come from cattle and goats. Caviid rodents of the subfamily Caviinae appear to be the hosts for the immature stages. So far, A. parvum has been detected in 12 Neotropical biogeographical provinces (Chaco, Cerrado, Eastern Central America, Venezuelan Coast, Pantanal, Parana Forest, Caatinga, Chiapas, Venezuelan Llanos, Monte, Western Panamanian Isthmus, and Roraima) but the Chaco province has provided significantly more specimens than any other (P<0.0001). The 16S rDNA sequences showed just 0.0%-1.1% divergence among the Argentinean A. parvum investigated and no more than 0.2% divergence among the Brazilian specimens. The observed divergence between the Argentinean and Brazilian specimens was, however, greater (3.0%-3.7%). Although there is now molecular and morphological evidence to indicate that A. parvum, A. pseudoparvum, A. auricularium and A. pseudoconcolor are members of a natural group, previous subgeneric classifications do not reflect this grouping. The subgeneric status of these tick species therefore needs to be re-evaluated. The 16S-rDNA-based evaluation of divergence indicates that the gene flow between Argentinean and Brazilian 'A. parvum' is very limited and that the Argentinean 'A. parvum' may be a different species to the Brazilian.

  14. Isolation and characterization of microsatellite loci from the tick Amblyomma aureolatum (Acari: Ixodidae).

    Science.gov (United States)

    Ogrzewalska, M; Bajay, M M; Schwarcz, K; Bajay, S K; Telles, M P C; Pinheiro, J B; Zucchi, M I; Pinter, A; Labruna, M B

    2014-11-14

    Amblyomma aureolatum (Pallas) is the main vector of the bacterium Rickettsia rickettsii, the etiological agent of Brazilian spotted fever. This disease is the most lethal human spotted fever rickettsiosis in the world. Microsatellite loci were isolated from a dinucleotide-enriched library produced from A. aureolatum sampled in Southeastern Brazil. Eight polymorphic microsatellites were further characterized among 38 individuals sampled from São Paulo metropolitan region. The number of observed alleles ranged from 2 to 9, observed heterozygosity was 0.184-0.647, and expected heterozygosity was 0.251-0.747. Cross-species amplifications suggested that these loci will be useful for other Amblyomma species.

  15. Detection of two Bartonella tamiae-like sequences in Amblyomma americanum (Acari: Ixodidae) using 16S-23S intergenic spacer region-specific primers.

    Science.gov (United States)

    Billeter, Sarah A; Miller, Melissa K; Breitschwerdt, Edward B; Levy, Michael G

    2008-01-01

    Four hundred and sixty-six questing Amblyomma americanum (L.) (Acari: Ixodidae) from Carolina County, VA, and 98 questing A. americanum from Chatham County, NC, were screened by polymerase chain reaction (PCR) for the Bartonella 16S-23S intergenic spacer region. Two amplicons, approximately 270-280 bp, were detected in two ticks from Virginia. Based upon PCR and sequencing, an adult male and adult female tick harbored DNA sequences closely related to Bartonella tamiae (DQ395180). Bartonella DNA was not detected in A. americanum from North Carolina. Potential transmission of Bartonella spp. by A. americanum should be the focus of future experimental studies.

  16. [The first report of Amblyomma fuscum Neumann, 1907 (Acari Ixodidae) on the lizard Tupinambis teguixin (L.) at the Municipality of Glorinha, State of Rio Grande do Sul, Brazil].

    Science.gov (United States)

    Martins, João R; Monticelli, Elida C; Onofrio, Valéria C; Barros-Battesti, Darcy M; Doyle, Rovaina L

    2007-01-01

    Amblyomma fuscum known only from Brazil has been described as a rare tick species with few reports of its occurrence in South and Southeast region. This is a new records this tick species (9 females) parasitizing lizard (Tupinambis teguixin) at the Municipality of Glorinha, State of Rio Grande do Sul. The females were deposited in the tick collection of Veterinary Research Institute Desiderio Finamor (7 specimens), Eldorado do Sul, RS and in the Acari collection from Instituto Butantan, São Paulo, State of São Paulo (2 specimens). The finding confirms establishment de A. fuscum in the South of Brazil.

  17. Efficacy of granular deltamethrin against Ixodes scapularis and Amblyomma americanum (Acari: Ixodidade) nymphs.

    Science.gov (United States)

    Schulze, T L; Jordan, R A; Hung, R W; Taylor, R C; Markowski, D; Chomsky, M S

    2001-03-01

    A single barrier application of granular deltamethrin to the woodland edges of a forested residential community in late spring significantly reduced the abundance of Ixodes scapularis Say nymphs. The application also suppressed the population of Amblyomma americanum (L.) nymphs, which recently became established in the study area. The efficacy of deltamethrin is compared with other commonly used acaricides.

  18. Amblyomma cajennense (Fabricius, 1787) (Acari: Ixodidae), the Cayenne tick: phylogeography and evidence for allopatric speciation

    OpenAIRE

    Beati, Lorenza; Nava, Santiago; Burkman, Erica J; Barros-Battesti,Darci M; Labruna, Marcelo B.; Guglielmone, Alberto A; Cáceres, Abraham G; Guzmán-Cornejo, Carmen M; León, Renato; Durden, Lance A; Faccini, João L

    2013-01-01

    Abstract Background Amblyomma cajennense F. is one of the best known and studied ticks in the New World because of its very wide distribution, its economical importance as pest of domestic ungulates, and its association with a variety of animal and human pathogens. Recent observations, however, have challenged the taxonomic status of this tick and indicated that intraspecific cryptic speciation might be occurring. I...

  19. Molecular and morphological identification of a human biting tick, Amblyomma testudinarium (Acari: Ixodidae), in Taiwan.

    Science.gov (United States)

    Chao, Li-Lian; Lu, Chun-Wei; Lin, Ying-Fang; Shih, Chien-Ming

    2017-04-01

    Genetic identity and morphological features of a human biting tick, Amblyomma testudinarium, were determined for the first time in Taiwan. Morphological features of adult male and female ticks of Am. testudinarium were observed and photographed by a stereo- microscope. The genetic identity was analyzed by comparing the sequences of mitochondrial 16S ribosomal DNA gene obtained from 18 strains of ticks representing 10 species of Amblyomma, and four outgroup species of Dermacentor and Rhipicephalus ticks. Nine major clades could be easily distinguished by neighbour-joining analysis and were congruent by maximum-parsimony method. All these Am. testudinarium ticks collected from Taiwan and Japan were genetically affiliated to a monophyletic group with highly homogeneous sequence (99.8-100% similarity), and can be discriminated from other species of Amblyomma and other genera of ticks (Dermacentor and Rhipicephalus) with a sequence divergence ranging from 6.9 to 23.9%. Moreover, intra- and inter-species analysis based on the genetic distance (GD) values indicated a lower level (GD  0.108) of Amblyomma ticks, as well as outgroup (GD > 0.172) species. Our results provide the first distinguished features of adult Am. testudinarium ticks and the first genetic identification of Am. testudinarium ticks collected from humans in Taiwan. Seasonal prevalence, host range, and vectorial capacity of this tick species in Taiwan need to be further clarified.

  20. A novel spotted fever group Rickettsia infecting Amblyomma parvitarsum (Acari: Ixodidae) in highlands of Argentina and Chile.

    Science.gov (United States)

    Ogrzewalska, Maria; Nieri-Bastos, Fernanda A; Marcili, Arlei; Nava, Santiago; González-Acuña, Daniel; Muñoz-Leal, Sebastián; Ruiz-Arrondo, Ignacio; Venzal, José M; Mangold, Atilio; Labruna, Marcelo B

    2016-04-01

    The tick Amblyomma parvitarsum (Acari: Ixodidae) has established populations in Andean and Patagonic environments of South America. For the present study, adults of A. parvitarsum were collected in highland areas (elevation >3500 m) of Argentina and Chile during 2009-2013, and tested by PCR for rickettsial infection in the laboratory, and isolation of rickettsiae in Vero cell culture by the shell vial technique. Overall, 51 (62.2%) out of 82 A. parvitarsum adult ticks were infected by spotted fever group (SFG) rickettsiae, which generated DNA sequences 100% identical to each other, and when submitted to BLAST analysis, they were 99.3% identical to corresponding sequence of the ompA gene of Rickettsia sp. strain Atlantic rainforest. Rickettsiae were successfully isolated in Vero cell culture from two ticks, one from Argentina and one from Chile. DNA extracted from the third passage of the isolates of Argentina and Chile were processed by PCR, resulting in partial sequences for three rickettsial genes (gltA, ompB, ompA). These sequences were concatenated and aligned with rickettsial corresponding sequences available in GenBank. Phylogenetic analysis revealed that the A. pavitarsum rickettsial agent grouped under high bootstrap support in a clade composed by the SFG pathogens R. sibirica, R. africae, R. parkeri, Rickettsia sp. strain Atlantic rainforest, and two unnamed SFG agents of unknown pathogenicty, Rickettsia sp. strain NOD, and Rickettsia sp. strain ApPR. The pathogenic role of this A. parvitarsum rickettsia cannot be discarded, since several species of tick-borne rickettsiae that were considered nonpathogenic for decades are now associated with human infections.

  1. Hosts, distribution and genetic divergence (16S rDNA) of Amblyomma dubitatum (Acari: Ixodidae).

    Science.gov (United States)

    Nava, Santiago; Venzal, José M; Labruna, Marcelo B; Mastropaolo, Mariano; González, Enrique M; Mangold, Atilio J; Guglielmone, Alberto A

    2010-08-01

    We supply information about hosts and distribution of Amblyomma dubitatum. In addition, we carry out an analysis of genetic divergence among specimens of A. dubitatum from different localities and with respect to other Neotropical Amblyomma species, using sequences of 16S rDNA gene. Although specimens of A. dubitatum were collected on several mammal species as cattle horse, Tapirus terrestris, Mazama gouazoubira, Tayassu pecari, Sus scrofa, Cerdocyon thous, Myocastor coypus, Allouata caraya, Glossophaga soricina and man, most records of immature and adult stages of A. dubitatum were made on Hydrochoerus hydrochaeris, making this rodent the principal host for all parasitic stages of this ticks. Cricetidae rodents (Lundomys molitor, Scapteromys tumidus), opossums (Didelphis albiventris) and vizcacha (Lagostomus maximus) also were recorded as hosts for immature stages. All findings of A. dubitatum correspond to localities of Argentina, Brazil, Paraguay and Uruguay, and they were concentrated in the Biogeographical provinces of Pampa, Chaco, Cerrado, Brazilian Atlantic Forest, Parana Forest and Araucaria angustifolia Forest. The distribution of A. dubitatum is narrower than that of its principal host, therefore environmental variables rather than hosts determine the distributional ranges of this tick. The intraspecific genetic divergence among 16S rDNA sequences of A. dubitatum ticks collected in different localities from Argentina, Brazil and Uruguay was in all cases lower than 0.8%, whereas the differences with the remaining Amblyomma species included in the analysis were always bigger than 6.8%. Thus, the taxonomic status of A. dubitatum along its distribution appears to be certain at the specific level.

  2. First report of the male of Amblyomma rotundatum (Acari: Ixodidae) from a field-collected host.

    Science.gov (United States)

    Labruna, Marcelo B; Terrassini, Flávio A; Camargo, Luís Marcelo A

    2005-11-01

    An adult male of the tick Amblyomma rotundatum Koch was collected on a naturally infested lizard, Tropidurus sp. (Squamata: Tropiduridae), at Monte Negro, State of Rondonia, Brazil. The tick's identity was confirmed morphologically and by analysis of the second internal transcribed spacer of the ribosomal DNA. This is the third known male specimen of A. rotundatum, a species that has been shown to reproduce exclusively by parthenogenesis. The two previously reported male specimens seemed to be partially teratological or gynandromorphic, whereas the present specimen shows no visible genetic or developmental anomaly.

  3. Wild birds as hosts of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Rosario Rojas

    1999-05-01

    Full Text Available We evaluated the prevalence, mean intensity and relative density of ticks in 467 wild birds of 67 species (12 families from forest and cerrado habitats at two protected areas of Minas Gerais, between March and September 1997. Ticks collected (n=177 were identified as larvae and nymphs of Amblyomma cajennense and four other species of Amblyomma. We report for the first time 28 bird species as hosts of the immature stages of A. cajennense, demonstrating the lack of host specificity of the larvae and nymphs. A. cajennense had 15% prevalence on birds, with a mean infestation intensity of 0.37 ticks per host sampled, and 2.5 ticks per infested bird. Prevalence varied in relation to host species, diet and between birds from forests at two successional stages. There were no differences in relation to host forest dependence, participation in mixed flocks of birds, and nest type constructed. A. cajennense is a species of medical and veterinary importance, occurring on domestic animals but is known little of its occurrence on wildlife.

  4. Detection of Alpha and Gamma-Proteobacteria in Amblyomma triste (Acari: Ixodidae) from Uruguay.

    Science.gov (United States)

    Venzal, José Manuel; Estrada-Peña, Agustín; Portillo, Aránzazu; Mangold, Atilio J; Castro, Oscar; de Souza, Carlos G; Félix, María L; Pérez-Martínez, Laura; Santibánez, Sonia; Oteo, José A

    2008-01-01

    Amblyomma triste is the most prevalent tick species reported in human tick bites in Uruguay and has been found to be infected with Rickettsia parkeri, but no other microorganisms have been reported from this tick. A sample of 254 adults of A. triste was collected by flagging on vegetation in suburban areas in southern Uruguay. Pools of five ticks were assembled and a screening for the DNA from the resulting 51 pools was realized by PCR assays using primers for amplifying a fragment of 16S rRNA gene for members of Anaplasmataceae. Seventeen pools were positive (33%) and the sequenciation of the gene fragment amplified revealed the presence of a putative new Alpha-Proteobacterium (denominated Atri-uru). The phylogenetic analysis showed that this microorganism is closely related to the symbiont of I. ricinus denominated 'Candidatus Midichloria mitochondrii' and other associated organisms. This rickettsial symbiont of ticks is included in a recent new clade proposed for the Alpha subclass of the Proteobacteria. The discovery of this bacterium in A. triste is the first evidence of this group of Rickettsiales detected in the Genus Amblyomma, and the first record in South America. Also, in two of 17 positive samples a Gamma-Proteobacterium related to Francisella-like organisms was detected.

  5. Experimental infestation with the immatures of Amblyomma dissimile Koch, 1844 (Acari: Ixodidae on Tropidurus torquatus (Lacertilia: Iguanidae and Oryctolagus cuniculus Infestação experimental com as fases imaturas de Amblyomma dissimile Koch, 1844 (Acari: Ixodidae em Tropidurus torquatus (Lacertilia: Iguanidae e Oryctolagus cuniculus

    Directory of Open Access Journals (Sweden)

    L.H.T. Freitas

    2004-02-01

    Full Text Available Larvas provenientes de duas fêmeas de Amblyomma dissimile Koch, 1844 (Acari: Ixodidae, naturalmente ingurgitadas em uma iguana (Iguana iguana e provenientes do Estado do Mato Grosso, foram utilizadas na infestação experimental de lagartos da espécie Tropidurus torquatus e coelhos domésticos. As larvas alimentadas em ambos os hospedeiros realizaram ecdise para ninfas. As ninfas apenas ingurgitaram no lagarto e mudaram para machos e fêmeas. Este é o primeiro registro do parasitismo de larvas e ninfas de A. dissimile em T. torquatus e de larvas em coelhos.

  6. Detection of Borrelia lonestari in Amblyomma americanum (Acari: Ixodidae) from Tennessee.

    Science.gov (United States)

    Stegall-Faulk, T; Clark, D C; Wright, S M

    2003-01-01

    Genetic sequences characteristic of Borrelia lonestari (Barbour et al. 1996) were detected in two pools of adult Amblyomma americanum (L.) from Tennessee, corresponding to an estimated minimum field infection rate of 8.4 infected ticks/1000 adults. DNA amplification was conducted using primers derived from the B. lonestari flagellin gene that would also amplify Borrelia burgdorferi (Johnson, Schmid, Hyde, Steigerwalt, and Brenner). Species-specific, internal probes were then used to differentiate between genetic sequences of the spirochetes. Subsequent nucleotide sequencing confirmed the presence of B. lonestari in A. americanum; B. burgdorferi was not detected. This represents the first report of B. lonestari from Tennessee, and suggests that Lyme-like illness may occur in Tennessee.

  7. Infestations of the bont tick Amblyomma hebraeum (Acari: Ixodidae) on different breeds of cattle in Zimbabwe.

    Science.gov (United States)

    Norval, R A; Sutherst, R W; Kerr, J D

    1996-10-01

    Infestations of adults and nymphs of Amblyomma hebraeum were counted on Brahman (Br), Brahman x Simmental (BS), Sanga (Sa) and Hereford (He) steers exposed to infested pastures at Mbizi in southern Zimbabwe in 1986-1987. Herefords were always the most heavily infested, while the Sanga tended to carry the fewest ticks with the Brahman and Brahman x Simmental groups being in between. The ratios of the engorged females on the four breeds were 2.3:1.4:1.4:1.0 for He:Br:BS:Sa. The ratios of the standard nymphs were 2.2:1.4:1.7:1.0 for He:Br:BS:Sa. The results confirm earlier observations in Africa and support the view that there are genetic differences between breeds in the expression of resistance to this tick species.

  8. Characterization of Genetic Variability and Population Structure of the Tick Amblyomma aureolatum (Acari: Ixodidae).

    Science.gov (United States)

    Ogrzewalska, Maria; Schwarcz, Kaiser; Bajay, Miklos M; Bajay, Stephanie K; Pinheiro, José B; Zucchi, Maria I; Pinter, Adriano; Labruna, Marcelo B

    2016-07-01

    The hard tick Amblyomma aureolatum (Pallas) is a vector of the bacterium Rickettsia rickettsii, the etiologic agent of Brazilian spotted fever (BSF) in parts of Brazil. Despite its wide distribution in southeastern South America and its public health importance, there is no information about genetic variation of this species that might help to understand the epidemiology of BSF. Using data from eight microsatellite markers and ticks from six localities, we used a population genetics approach to test the hypothesis that tick populations from areas with the presence of R. rickettsii are genetically different from ticks from areas without R. rickettsii Contrary to expectations, we found low genetic structure between studied regions. Thus, the presence of R. rickettsii in the specific area is more likely correlated with ecological and the environmental conditions or due to unknown gene coding regions of A. aureolatum genome that would be related to R. rickettsii infection resistance.

  9. Amblyomma dissimile (Acari: Ixodidae PARÁSITO DE Boa constrictor EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Ana Torres M

    2009-08-01

    Full Text Available Objetivo. Describir algunas garrapatas encontradas en dos ejemplares de Boa constrictor, llevados al Centro de Atención y Valoración de Fauna Silvestre en Montería, Córdoba, Colombia. Materiales y métodos. Se recolectaron 37 garrapatas provenientes de dos individuos adultos de Boa constrictor, los parásitos fueron conservados en alcohol al 70% y posteriormente identificados mediante diversas claves taxonómicas. Resultados. Todas las garrapatas fueron identificadas como Amblyomma dissimile, de las cuales, 9 fueron hembras, 24 machos y 4 ninfas. Conclusiones. La identificación de ectoparásitos en especies de Boa c. constrictor contribuye a mantener adecuadamente esta especie en cautiverio y provee datos para establecer medidas profilácticas y tratamiento, igualmente, ayuda en el conocimiento de los agentes parasitarios de la fauna silvestre.

  10. Analyses of hemolymph from Amblyomma cajennense (Acari: ixodidae) using neutron activation analysis (NAA)

    Energy Technology Data Exchange (ETDEWEB)

    Simons, Simone M.; Oliveira, Daniella G.L.; Chudzinski-Tavassi, Ana M., E-mail: daniellaoliveira@butantan.gov.b, E-mail: amchudzinki@butantan.gov.b [Instituto Butantan, Sao Paulo, SP (Brazil); Zamboni, Cibele B., E-mail: czamboni@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Instrumental neutron activation analysis technique (INAA) was applied to determine the elemental composition of hemolymph from Amblyomma cajennense tick. This biological material came from Butantan Institute (Sao Paulo city, Brazil) and it was investigated using the IEA-R1 nuclear reactor (4MW, pool type) at IPEN/CNEN-SP - Brazil. The concentration values for: Br (0.0032 {+-} 0.0005gL{sup -1}), Ca (0.104 {+-} 0.029gL{sup -1}), Cl (4.41 {+-} 0.25gL{sup -1}), I (76 {+-} 27{mu}gL{sup -1}), K (0.38 {+-} 0.09gL{sup -1}), Mg (0.038 {+-} 0.011gL{sup -1}), Na (4.30 {+-} 0.26gL{sup -1}) and S (1.35 {+-} 0.37gL{sup -1}) were determined for the first time. These data were compared with the concentration values established for Americanum and Anatolicum Excavatum tick species to clarify the ion balance in this biological material (hemolymph). This comparison suggests that Na concentration, majority in these species, has a similar behavior. These data also contribute to the understanding of hemolymph composition complementing its characterization as well as for the understanding of several physiological processes, especially those related to salivary secretion. (author)

  11. Repellent activity of plant-derived compounds against Amblyomma cajennense (Acari: Ixodidae) nymphs.

    Science.gov (United States)

    Soares, Sara Fernandes; Borges, Lígia Miranda Ferreira; de Sousa Braga, Raquel; Ferreira, Lorena Lopes; Louly, Carla Cristina Braz; Tresvenzol, Leonice Manrique Faustino; de Paula, José Realino; Ferri, Pedro Henrique

    2010-01-20

    Repellence responses of Amblyomma cajennense nymphs to callicarpenal, intermedeol, Hyptis suaveolens essential oil, extract of Melia azedarach, Cymbopogon nardus, Spiranthera odoratissima, Chenopodium ambrosioides, Ageratum conyzoides, Mentha pulegium, Ruta graveolens, and Memora nodosa were studied. Among these the extract of C. nardus stood out because of the long-lasting repellence, maintaining, in the highest concentration, 35h of protection against 90% of the nymphs. The essential oil of H. suaveolens and the extracts of C. ambrosioides and A. conyzoides showed good repellence index (66%) when applied in high concentrations. However, greater protection could be obtained at higher concentrations but with a shorter repellence time. Callicarpenal, intermedeol, extract of M. Pulegium, and M. nodosa leaves showed moderate repellence in high concentrations. Extracts from M. azedarach, R. graveolens, S. odoratissima, and M. nodosa roots showed little or no repellent effect. These results show that some plant extracts may represent a promising alternative in the control of infestations by A. cajennense. Copyright 2009 Elsevier B.V. All rights reserved.

  12. Amblyomma auricularium (Acari: Ixodidae: underwater survival of the non-parasitic phase of feeding females

    Directory of Open Access Journals (Sweden)

    Iwine Joyce Barbosa de Sá-Hungaro

    Full Text Available To determine the effects of immersion in water on the biological parameters of engorged females of the tick species Amblyomma auricularium, 60 females were distributed in six groups, each comprising 10 individuals. The control group – G1 (not immersed was fixed dorsally in a Petri dish and incubated at 27 ± 1°C and 80% RH. The other groups were subjected to immersion periods of 24, 48, 72 and 96 hours, and the sixth group to continuous immersion. After the immersion period, the females were placed in Petri dishes to begin laying. Eggs were collected every 72 hours and kept in biological chambers. All the groups showed significant differences (p <0.05 during the pre-oviposition period. The laying period and the average weight of overall posture did not change. The egg incubation period also did not differ significantly, but the hatching rate in the group immersed for 96h showed a significant difference. Thus, immersion for up to 96 hours does not impair the survival of A. auricularium females, although it may delay egg laying and reduce the number of offspring.

  13. Ehrlichia chaffeensis (Rickettsiales: Ehrlichieae) infection in Amblyomma americanum (Acari: Ixodidae) at Aberdeen Proving Ground, Maryland.

    Science.gov (United States)

    Stromdahl, E Y; Randolph, M P; O'Brien, J J; Gutierrez, A G

    2000-05-01

    Human monocytic ehrlichiosis (HME) is a sometimes fatal, emerging tick-borne disease caused by the bacterium Ehrlichia chaffeensis. It is frequently misdiagnosed because its symptoms mimic those of the flu. Current evidence indicates that Amblyomma americanum (L.), the lone star tick, is the major vector of HME. To determine if E. chaffeensis is present in ticks at Aberdeen Proving Ground, MD, questing A. americanum ticks were collected from 33 sites. Nucleic acid was extracted from 34 adult and 81 nymphal pools. Sequences diagnostic for E. chaffeensis from three different loci (16S rRNA, 120-kDa protein, and a variable-length polymerase chain reaction [PCR] target, or VLPT) were targeted for amplification by the PCR. Fifty-two percent of the collection sites yielded pools infected with E. chaffeensis, confirming the presence and widespread distribution of E. chaffeensis at Aberdeen Proving Ground. Analysis with the both the 120-kDa protein primers and the VLPT primers showed that genetic variance exists. A novel combination of variance for the two loci was detected in two tick pools. The pathogenic implications of genetic variation in E. chaffeensis are as yet unknown.

  14. Electrophoretically detectable protein variation in natural populations of the lone star tick, Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Hilburn, L R; Sattler, P W

    1986-08-01

    Nine populations of Amblyomma americanum (L.) were examined electrophoretically for variation of 21 enzymes. Only three enzymes were not polymorphic and the average heterozygosity per individual (h) for the species was 0.085 with a range of 0.077 to 0.110, comparing well with values in other arthropods. The average Nei identity value for pairwise comparisons among the nine populations was high, 0.994 +/- 0.004 (I +/- SD). These high identity values and the absence of geographic structuring of the protein variation suggest that this species is genetically homogeneous. Normal levels of genic variability within and a lack of divergence between populations were not predicted by models developed to describe these genetic characteristics on the basis of the heterogeneities encountered by parasites in their environment. An analysis of data from several different species of ticks suggests host mobility and abundance, as well as tick abundance and selectivity in choosing a host, are important parameters in determining genetic variation in these ectoparasites.

  15. Patterns of cuticular hydrocarbon variation and genetic similarity between natural populations of Amblyomma cajennense (Acari: Ixodidae).

    Science.gov (United States)

    Estrada-Peña, A; Guglielmone, A A; Mangold, A J; Castellá, J

    1993-10-01

    Gas chromatography has been used to analyze the variation in cuticular hydrocarbon patterns between several populations of Amblyomma cajennense. 88 compounds were detected and these could be divided into 17 groups of hydrocarbons. Heterozygosis in the populations ranges from 0% to 25.84%. Isomers for pentacosane, heptacosane and nonatriacontane are the most variable, with 13, 10 and 11 variants, respectively. Nei's genetic identity and genetic distance show that populations may be considered as regional variants of only one species: the results do not indicate the presence of sibling species. However, a relatively high genetic distance has been observed between several Cuban and continental populations, suggesting a long reproductive isolation. Gas chromatography of cuticular hydrocarbons is a good alternative to isozyme analysis for population studies, when collecting conditions do not allow the use of live ticks and only alcohol-preserved collections are available. The high number of compounds available for genetic studies will provide excellent markers for evaluating the extent of gene flow and migration of tick species.

  16. Distribution and genetic variation of Amblyomma triste (Acari: Ixodidae) in Argentina.

    Science.gov (United States)

    Guglielmone, Alberto A; Nava, Santiago; Mastropaolo, Mariano; Mangold, Atilio J

    2013-09-01

    A study was conducted to investigate the distribution of Amblyomma triste in Argentina under the hypothesis that this tick prevails in riparian localities along the Paraná River and adjacent humid environments from 34° 30' S to 25° 20' S, approximately. Ticks were collected from mammals and vegetation in those environments from November 2008 to October 2012. Additionally, genetic variation was tested from Argentinean, Brazilian, Chilean, and Uruguayan populations of A. triste by comparing sequences of 16S rDNA mitochondrial gene. The hypothesis was not confirmed because A. triste were collected at 36° 16' S, well beyond the southern limit predicted, and the distribution along the banks of the Paraná River was not continuous. The northernmost population of A. triste within Argentina was found at 25° 42' S. Still undetermined abiotic factors and plant communities may play a role in modulating the abundance of A. triste because host availability does not appear to be a restriction factor. The genetic variation among A. triste populations from Argentina, Brazil, and Uruguay indicates that they belong to a unique taxon that is considered bona fide A. triste (type locality Montevideo, Uruguay) while it is unclear if the Chilean population of A. triste is conspecific with the other populations investigated in this study. It would be of importance to compare those genetically homogeneous populations with other populations of alleged A. triste, especially populations established in the Nearctic Zoogeographic Region in Mexico and USA.

  17. Biology of Amblyomma aureolatum (Pallas, 1772 (Acari: Ixodidae on some laboratory hosts in Brazil

    Directory of Open Access Journals (Sweden)

    Daniel Sobreira Rodrigues

    2002-09-01

    Full Text Available The ixodid Amblyomma aureolatum is suspected to play a role in the epidemiology of wild life-cycle hemoparasites, which frequently infect dogs in rural and hunting areas in Brazil. Little is known about its bionomics. The objective of the present study was to evaluate some bionomic aspects of A. aureolatum ticks in Brazil. One engorged female, collected from a dog (Canis familiaris in São Sebastião das Águas Claras, State of Minas Gerais, was used to establish a colony in the laboratory. Subsequently its parasitic stage progeny were fed on domestic dogs and laboratory animals. The free-living stages were incubated at 27ºC ± 2°C and minimum 70% relative humidity in a BOD incubator. The egg incubation period ranged from 31 to 34 days; the parasitic period of larvae ranged from 4 to 6 days and ecdysis to nymphs occurred from day 19 up to day 22. The parasitic period of nymphs ranged from 5 to 8 days and the period of ecdysis to adults from 31 to 33 days. The parasitic period of adults ranged from 11 to 15 days, the pre-oviposition period from 6 to 12 days, and the oviposition period from 9 to 38 days. The total duration of the life cycle ranged from 116 to 168 days.

  18. Primeiro relato de Amblyomma fuscum Neumann, 1907 (acari: ixodidae parasitando lagarto da espécie Tupinambis teguixin (L., no município de Glorinha, estado do Rio Grande do Sul, Brasil The first report of Amblyomma fuscum Neumann, 1907 (acari ixodidae on the lizard Tupinambis teguixin (L. at the municipality of Glorinha, state of Rio Grande do Sul, Brazil

    Directory of Open Access Journals (Sweden)

    João R Martins

    2007-12-01

    Full Text Available Amblyomma fuscum conhecida somente no Brasil, tem sido descrita como uma espécie rara de carrapato com relatos de sua ocorrência nas regiões sul e sudeste. Este é um novo registro desta espécie (9 fêmeas parasitando lagarto (Tupinambis teguixin, no Município de Glorinha, Estado do Rio Grande do Sul. As fêmeas foram depositadas na coleção do Instituto de Pesquisas Veterinárias Desidério Finamor (7 espécimes e na coleção de Acari do Instituto Butantan, Estado de São Paulo (2 espécimes. O achado confirma o estabelecimento de A. fuscum no Sul do Brasil.Amblyomma fuscum known only from Brazil has been described as a rare tick species with few reports of its occurrence in South and Southeast region. This is a new records this tick species (9 females parasitizing lizard (Tupinambis teguixin at the Municipality of Glorinha, State of Rio Grande do Sul. The females were deposited in the tick collection of Veterinary Research Institute Desiderio Finamor (7 specimens, Eldorado do Sul, RS and in the Acari collection from Instituto Butantan, São Paulo, State of São Paulo (2 specimens. The finding confirms establishment de A. fuscum in the South of Brazil.

  19. First records of the ticks Amblyomma calcaratum and A. pacae (Acari: Ixodidae parasitizing mammals of Mexico Primeros registros de las garrapatas Amblyomma calcaratum y A. pacae (Acari: Ixodidae parasitando mamíferos de México

    Directory of Open Access Journals (Sweden)

    Carmen Guzmán-Cornejo

    2006-06-01

    Full Text Available Based on study of ticks deposited in the Colección Nacional de Ácaros, Instituto de Biología, Universidad Nacional Autónoma de México, we report the first records in Mexico for two species of Amblyomma: Amblyomma calcaratum ex Tamandua mexicana, and Amblyomma pacae ex Tapirus bairdii. These new records increase the number of species recorded for the genus Amblyomma in Mexico to 26.Basado en la revisión de garrapatas depositadas en la Colección Nacional de Ácaros, Instituto de Biología, Universidad Nacional Autónoma de México, establecemos los primeros registros en México para 2 especies del género Amblyomma: Amblyomma calcaratum ex Tamandua mexicana y Amblyomma pacae ex Tapirus bairdii. Estos nuevos registros incrementan a 26 el número de especies del género Amblyomma distribuidas en México.

  20. Estudo biomolecular de Rickettsia rickettsii (Ricketts, 1909) em Amblyomma cajennense (Fabricius, 1787) e Amblyomma dubitatum (Neumann, 1899) (Acari: ixodidae) em Coronel Pacheco, Minas Gerais. 2004.

    OpenAIRE

    Elizangela Guedes

    2005-01-01

    Devido ao potencial papel atribuído a Amblyomma cajennense e a Amblyomma dubitatum no ciclo enzoótico de Rickettsia rickettsii, o agente etiológico da Febre Maculosa Brasileira (FMB), espécies de carrapatos, bem como a freqüência de infecção de carrapatos por R. rickettsii numa área focal de FMB em Minas Gerais. Um total de 78 exemplares de A. cajennense e 78 de A. dubitatum forma coletados e, posteriormente, submetidos ao teste de hemolinfa com resultado negativo para todas as amostras anali...

  1. Factors affecting patterns of Amblyomma triste (Acari: Ixodidae) parasitism in a rodent host.

    Science.gov (United States)

    Colombo, Valeria C; Nava, Santiago; Antoniazzi, Leandro R; Monje, Lucas D; Racca, Andrea L; Guglielmone, Alberto A; Beldomenico, Pablo M

    2015-07-30

    Here we offer a multivariable analysis that explores associations of different factors (i.e., environmental, host parameters, presence of other ectoparasites) with the interaction of Amblyomma triste immature stages and one of its main hosts in Argentina, the rodent Akodon azarae. Monthly and for two years, we captured and sampled rodents at 16 points located at 4 different sites in the Parana River Delta region. The analyses were conducted with Generalized Linear Mixed Models with a negative binomial response (counts of larvae or nymphs). The independent variables assessed were: (a) environmental: trapping year, season, presence of cattle; type of vegetation (natural grassland or implanted forest); rodent abundance; (b) host parameters: body length; sex; body condition; blood cell counts; natural antibody titres; and (c) co-infestation with other ectoparasites: other stage of A. triste; Ixodes loricatus; lice; mites; and fleas. Two-way interaction terms deemed a priori as relevant were also included in the analysis. Larvae were affected by all environmental variables assessed and by the presence of other ectoparasites (lice, fleas and other tick species). Host factors significantly associated with larval count were sex and levels of natural antibodies. Nymphs were associated with season, presence of cattle, body condition, body length and with burdens of I. loricatus. In most cases, the direction and magnitude of the associations were context-dependent (many interaction terms were significant). The findings of greater significance and implications of our study are two. Firstly, as burdens of A. triste larvae and nymphs were greater where cattle were present, and larval tick burdens were higher in implanted forests, silvopastoral practices developing in the region may affect the population dynamics of A. triste, and consequently the eco-epidemiology of Rickettsia parkeri. Secondly, strong associations and numerous interactions with other ectoparasites suggest that

  2. Evidence of Borrelia lonestari DNA in Amblyomma americanum (Acari: Ixodidae) removed from humans.

    Science.gov (United States)

    Stromdahl, Ellen Y; Williamson, Phillip C; Kollars, Thomas M; Evans, Sandra R; Barry, Ryan K; Vince, Mary A; Dobbs, Nicole A

    2003-12-01

    We used a nested PCR with Borrelia flagellin gene (flaB) primers and DNA sequencing to determine if Borrelia lonestari was present in Amblyomma americanum ticks removed from military personnel and sent to the Tick-Borne Disease Laboratory of the U.S. Army Center for Health Promotion and Preventive Medicine. In our preliminary investigation, we detected Borrelia sequences in 19 of 510 A. americanum adults and nymphs from Ft. A. P. Hill, Va. During the 2001 tick season, the flaB primers were used to test all A. americanum samples as they were received, and 29 of 2,358 A. americanum samples tested individually or in small pools were positive. PCRs with 2,146 A. americanum samples in 2002 yielded 26 more Borrelia-positive samples. The positive ticks in 2001 and 2002 were from Arkansas, Delaware, Kansas, Kentucky, Maryland, New Jersey, North Carolina, Tennessee, and Virginia. The last positive sample of the 2001 season was a pool of larvae. To further investigate larval infection, we collected and tested questing A. americanum larvae from Aberdeen Proving Ground, Md.; 4 of 33 pools (40 larvae per pool) were positive. Infection of unfed larvae provides evidence of the maintenance of B. lonestari by means of transovarial transmission. Sequence analysis revealed that the amplicons were identical to sequences of the B. lonestari flaB gene in GenBank. Despite the low prevalence of infection, the risk of B. lonestari transmission may be magnified because A. americanum is often abundant and aggressive, and many tick bite victims receive multiple bites.

  3. Cross-mating experiments with geographically different populations of Amblyomma cajennense (Acari: Ixodidae).

    Science.gov (United States)

    Labruna, Marcelo B; Soares, João F; Martins, Thiago F; Soares, Herbert S; Cabrera, Ricardo R

    2011-05-01

    The present study evaluated the reproductive compatibility of the crosses between adult ticks of the following three geographically different populations of Amblyomma cajennense: State of São Paulo (SP), southeastern Brazil; State of Rondônia (RO), northern Brazil; and Colombia (CO). In addition, crosses between A. cajennense ticks from Argentina (AR) and SP ticks were also performed. The Argentinean population (AR) was compatible with SP because their crosses resulted in high % egg hatching (mean values ranging from 71.5 to 93.5%), similarly to all homologous (intrapopulational) crosses. In contrast, the tick populations SP, RO, and CO were shown to be incompatible with each other, since their heterologous (interpopulational) crosses always resulted in very low % egg hatching (range: 0-5%). The F(1) larval offspring derived from some of these females that yielded 5% egg hatching were reared until the F(1) adult stage. In all cases, only adult females molted from engorged nymphs. These F(1) females were likely to be a product of thelytokous parthenogenesis of the SP, RO, and CO females that were used in the heterologous crosses. Reproductive incompatibility is not expected to occur between different populations of a single species. Thus, our results suggest that the taxon A. cajennense might be represented by a complex of different species, whereas SP and AR ticks might represent a single species. Further populational genetic studies, coupled with extensive morphological analyses, are needed to clarify and determine a possible complex of valid species that might have been classified under the taxon A. cajennense.

  4. Amblyomma parvum Aragão, 1908 (Acari: Ixodidae): Phylogeography and systematic considerations.

    Science.gov (United States)

    Lado, Paula; Nava, Santiago; Labruna, Marcelo B; Szabo, Matias P J; Durden, Lance A; Bermudez, Sergio; Montagna, Matteo; Sánchez Quirós, Ana C; Beati, Lorenza

    2016-07-01

    The geographical distribution of Amblyomma parvum Aragão 1908 in the New World is disjunct, with two main clusters separated from each other by the Amazon basin. The main objectives of this study were to further investigate the systematic relationships within A. parvum, to determine whether or not populations from different geographical areas might represent cryptic species, and to reconstruct the phylogeographical evolutionary history of the species. The genetic diversity of A. parvum collected throughout its distributional range was analyzed by using 6 molecular markers: 5 mitochondrial [the small and the large ribosomal subunits 12rDNA and 16SrDNA, the cytochrome oxidase I (COI) and II (COII) and the control region or d-loop (DL)], and one nuclear (ITS2, Inter transcribed spacer 2). Phylogenetic trees were inferred by using maximum parsimony and Bayesian analyses. In addition, node dating was attempted for the main lineages identified phylogenetically. Although mitochondrial and nuclear topologies were not totally congruent, they all identified at least two main supported clusters, a Central American lineage, and a Brazilian-Argentinian lineage. Clade support and divergence values strongly suggest that the two lineages correspond to different taxonomic entities. Node dating placed the split between the Central American and the Brazilian-Argentinian lineages at approximately 5.8-4.9 Mya, just after the progressive replacement of the dry areas that occupied the northern part of South America by the Amazon Basin in the early-mid Miocene. This event might be the cause of fragmentation and putative speciation within the ancestral relatively xerophilic A. parvum population.

  5. Amblyomma cajennense (Fabricius, 1787) (Acari: Ixodidae), the Cayenne tick: phylogeography and evidence for allopatric speciation.

    Science.gov (United States)

    Beati, Lorenza; Nava, Santiago; Burkman, Erica J; Barros-Battesti, Darci M; Labruna, Marcelo B; Guglielmone, Alberto A; Cáceres, Abraham G; Guzmán-Cornejo, Carmen M; León, Renato; Durden, Lance A; Faccini, João L H

    2013-12-09

    Amblyomma cajennense F. is one of the best known and studied ticks in the New World because of its very wide distribution, its economical importance as pest of domestic ungulates, and its association with a variety of animal and human pathogens. Recent observations, however, have challenged the taxonomic status of this tick and indicated that intraspecific cryptic speciation might be occurring. In the present study, we investigate the evolutionary and demographic history of this tick and examine its genetic structure based on the analyses of three mitochondrial (12SrDNA, d-loop, and COII) and one nuclear (ITS2) genes. Because A. cajennense is characterized by a typical trans-Amazonian distribution, lineage divergence dating is also performed to establish whether genetic diversity can be linked to dated vicariant events which shaped the topology of the Neotropics. Total evidence analyses of the concatenated mtDNA and nuclear + mtDNA datasets resulted in well-resolved and fully congruent reconstructions of the relationships within A. cajennense. The phylogenetic analyses consistently found A. cajennense to be monophyletic and to be separated into six genetic units defined by mutually exclusive haplotype compositions and habitat associations. Also, genetic divergence values showed that these lineages are as distinct from each other as recognized separate species of the same genus. The six clades are deeply split and node dating indicates that they started diverging in the middle-late Miocene. Behavioral differences and the results of laboratory cross-breeding experiments had already indicated that A. cajennense might be a complex of distinct taxonomic units. The combined and congruent mitochondrial and nuclear genetic evidence from this study reveals that A. cajennense is an assembly of six distinct species which have evolved separately from each other since at least 13.2 million years ago (Mya) in the earliest and 3.3 Mya in the latest lineages. The temporal and

  6. Parasitismo em humano por Amblyomma sp (Acari: Ixodidae, na cidade de Recife, estado de Pernambuco Parasitism by Amblyomma sp (Acari: Ixodidae in humans in the city of Recife, state of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Rafael Antonio do Nascimento Ramos

    2010-10-01

    Full Text Available INTRODUÇÃO: Os ixodídeos pertencentes ao gênero Amblyomma são encontrados no Brasil, sendo de grande importância em Saúde Pública por representarem risco na transmissão de patógenos. MÉTODOS: Este trabalho relata um caso de parasitismo em humano por Amblyomma sp, ocorrido na Cidade de Recife, Pernambuco. RESULTADOS: O parasitismo foi observado em uma senhora onde os ectoparasitos encontravam-se fixados em suas pernas e pés. CONCLUSÕES: Este tipo de achado é incomum e constitui o primeiro relato do parasitismo em humano por Amblyomma sp, no Estado de Pernambuco.INTRODUCTION: The Amblyomma genus is widely distribution in Brazil and is important regarding the public health risk represented by the transmission of pathogens. METHODS: This paper reports a case of parasitism in humans by Amblyomma sp that occurred in the City of Recife, State of Pernambuco. RESULTS: Parasitism was observed in a woman where the ticks were attached to her legs and feet. CONCLUSIONS: This finding is unusual and is the first report of parasitism in humans by Amblyomma sp in State of Pernambuco.

  7. Evaluation of DEET and eight essential oils for repellency against nymphs of the lone star tick, Amblyomma americanum (Acari: Ixodidae)

    Science.gov (United States)

    Eight commercially available essential oils (oregano, clove, thyme, vetiver, sandalwood, cinnamon, cedarwood, and peppermint) were evaluated for repellency against host-seeking nymphs of the lone star tick, Amblyomma americanum. Concentration- repellency response was established using the vertical ...

  8. Questing Amblyomma mixtum and Haemaphysalis juxtakochi (Acari: Ixodidae) Infected with Candidatus “Rickettsia amblyommii” from the Natural Environment in Panama Canal Basin, Panama

    OpenAIRE

    D., Angélica M. Castro; S., Gleidys G. García; Dzul-Rosado, Karla; Aguilar, Ana; Castillo,Juan; Gabster, Amanda; Trejos, Diomedes; Zavala-Castro, Jorge; Bermúdez C., Sergio E.

    2015-01-01

    This work emphasizes the detection of Candidatus “Rickettsia amblyommii” in questing Haemaphysalis juxtakochi and Amblyomma mixtum. From February 2009 to December 2012, questing ticks were collected from the vegetation and leaf-litter of four protected forests and two grassy areas around the Panama Canal basin. DNA was extracted from Amblyomma mixtum, Amblyomma naponense, Amblyomma oblongoguttatum, Amblyomma pecarium, Amblyomma tapirellum, Haemaphysalis juxtakochi, and unidentified immature A...

  9. Acaricidal properties of vetiver essential oil from Chrysopogon zizanioides (Poaceae) against the tick species Amblyomma cajennense and Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Campos, Roseane Nunes de Santana; Nascimento Lima, Cecília Beatriz; Passos Oliveira, Alexandre; Albano Araújo, Ana Paula; Fitzgerald Blank, Arie; Barreto Alves, Péricles; Nascimento Lima, Rafaely; Albano Araújo, Vinícius; Santana, Alisson Silva; Bacci, Leandro

    2015-09-15

    Ticks are arthropods widely distributed in tropical and subtropical regions, which can transmit infectious agents also responsible for zoonoses. Excessive use of conventional acaricides has resulted in the onset of drug resistance by these parasites, thus the need to use alternative methods for their control. This study evaluated the acaricidal activities of Chrysopogon zizanioides (vetiver) essential oils containing different zizanoic and khuzimol (high and low acidity) acid concentrations on Amblyomma cajennense and Rhipicephalus microplus (Acari: Ixodidae). To this aims, toxicity tests of different concentrations of examined essential oils were conducted on adult females and larval stages. Results showed that the essential oils of C. zizanioides with high and low acidity reduced oviposition of females, eggs hatch and larval survival, being more effective than some commercial products widely used to control these ectoparasites. These results indicate that the C. zizanoides essential oils are promising candidates as acaricidal agents and represent also an add value to vetiver oil with high acidity, which is commercially undervalued in the cosmetic industry.

  10. Dynamics of cell and tissue genesis in the male reproductive system of ticks (Acari: Ixodidae) Amblyomma cajennense [corrected] (Fabricius, 1787) and Amblyomma aureolatum (Pallas, 1772): a comparative analysis.

    Science.gov (United States)

    Sampieri, Bruno Rodrigues; Labruna, Marcelo Bahia; Bueno, Odair Correa; Camargo-Mathias, Maria Izabel

    2014-04-01

    Ticks are classified into three families: Argasidae, Ixodidae, and Nutalliellidae. The taxonomy and phylogeny within Ixodidae are still discussed by the specialists, thus requiring further studies. Amblyomma cajennese and Amblyomma aureolatum (Brazil) belong to two species complexes known as "cajennese" and "ovale", respectively, and are directly related to the transmission of the Brazilian spotted fever. This confirms the medical and veterinary significance of these species, as well as the need for further morphological studies that will bring a better understanding of their taxonomy, phylogeny, and control. In this context, the present study aimed to characterize the morphology of the male reproductive system of A. cajennese and A. aureolatum when unfed and after 4 days of feeding, thereby seeking to: (a) distinguish the two species or "complexes", and (b) study an internal system which has the potential to be targeted by acaricides. Therefore, males from both species (unfed and after 4 days of feeding) were cold-anesthetized, dissected, and had their reproductive systems removed for histological analysis. The results showed that the morphology of the male reproductive system is generally similar between both species, like in other Ixodidae ticks, exhibiting a multilobed accessory gland complex related to seminal fluid secretion, a pair of vasa deferentia and a pair of testes housing germ cells (spermatocytes) in different stages. The main differences were found in the development of the accessory gland complex cells and germ cells, showing that the maturation of the male reproductive system starts later in A. aureolatum, when compared to A. cajennese. However, during the blood meal, A. aureolatum development is increased, thus making germ cell maturation and gland complex activity higher than in A. cajennese. This study shows the differences in the development of the male reproductive systems of both species, while providing information that can assist in the

  11. The chemosensory appendage proteome of Amblyomma americanum (Acari: Ixodidae) reveals putative odorant-binding and other chemoreception-related proteins

    Science.gov (United States)

    Proteomic analyses were done on 2 chemosensory appendages of the lone star tick, Amblyomma americanum. Proteins in the fore tarsi, which contain the olfactory Haller's organ, and in the palps, that include gustatory sensilla, were compared with proteins in the third tarsi. Also, male and female tick...

  12. Detection of Rickettsia bellii and Rickettsia amblyommii in Amblyomma longirostre (Acari: Ixodidae) from Bahia state, Northeast Brazil.

    Science.gov (United States)

    McIntosh, Douglas; Bezerra, Rodrigo Alves; Luz, Hermes Ribeiro; Faccini, João Luiz Horacio; Gaiotto, Fernanda Amato; Giné, Gastón Andrés Fernandez; Albuquerque, George Rego

    2015-01-01

    Studies investigating rickettsial infections in ticks parasitizing wild animals in the Northeast region of Brazil have been confined to the detection of Rickettsia amblyommii in immature stages of Amblyomma longirostre collected from birds in the state of Bahia, and in immatures and females of Amblyomma auricularium collected from the striped hog-nosed skunk (Conepatus semistriatus) and armadillos (Euphractus sexcinctus) in the state of Pernambuco. The current study extends the distribution of R. amblyommii (strain Aranha), which was detected in A. longirostre collected from the thin-spined porcupine Chaetomys subspinosus and the hairy dwarf porcupine Coendou insidiosus. In addition, we report the first detection of Rickettsia bellii in adults of A. longirostre collected from C. insidiosus in the state of Bahia.

  13. Repellent efficacy of formic acid and the abdominal secretion of carpenter ants (Hymenoptera: Formicidae) against Amblyomma ticks (Acari: Ixodidae).

    Science.gov (United States)

    Falótico, Tiago; Labruna, Marcelo B; Verderane, Michele P; De Resende, Briseida D; Izar, Patrícia; Ottoni, Eduardo B

    2007-07-01

    Formic acid is a substance produced by some ants for defense, trail marking, and recruitment. Some animals are known to rub ants or other arthropods on parts of their plumage or fur to anoint themselves with released substances. A recent study with a semifree-ranging group of capuchin monkeys, Cebus apella L., in the Tietê Ecological Park, Sao Paulo, Brazil, an area of occurrence of the tick species Amblyomma cajennense (F.), revealed that "anting" with carpenter ants, Camponotus rufipes F. (Hymenoptera: Formicidae), occurs frequently, especially during the A. cajennense subadult season. Based on these observations, we tested the repellent effect of the formic acid and the ants themselves against A. cajennense and Amblyomma incisum Neumann nymphs, and Amblyomma parcum Aragdo adult ticks in the laboratory. The results revealed a significant repellent effect of formic acid and ant secretion, and a significant duration of the repellent effect. The results suggest that the anting behavior of capuchin monkeys, and other vertebrates, may be related with repellence of ticks and other ectoparasites.

  14. Feral pigs as hosts for Amblyomma sculptum (Acari: Ixodidae) populations in the Pantanal, Mato Grosso do Sul, Brazil.

    Science.gov (United States)

    Ramos, Vanessa do Nascimento; Piovezan, Ubiratan; Franco, Ana Helena Alves; Osava, Carolina Fonseca; Herrera, Heitor Miragaia; Szabó, Matias Pablo Juan

    2014-11-01

    The Pantanal in Brazil is the largest floodplain of the world. This ecosystem, rich in wildlife, has a large feral pig population. Such a large host biomass must have a strong influence on the parasite fauna. In this work, we evaluated the role of feral pigs in the maintenance of Amblyomma sculptum (formerly Amblyomma cajennense), the most prevalent tick species in the Pantanal. Tick infestations were evaluated on 243 feral pigs and their environment. The suitability of domestic pigs, representing their feral relatives, to A. sculptum adults and nymphs was assessed experimentally. Tick infestation of feral pigs was strongly associated with that of the environment: 96 and 97 % of the ticks, respectively, were A. sculptum. The infestation prevalence on this host species was close to 90 % in the dry season and 100 % in the wet season and mean infestation intensity was above 30 ticks in both seasons. Suitability of pigs as hosts for A. sculptum was shown by the high proportion of nymphs and female ticks found engorging on captured feral pigs and adequate biological parameters displayed by ticks from experimental infestations of domestic pigs. Other tick species on feral pigs, albeit in much lower numbers, were Amblyomma parvum and Ornithodorus rostratus. Results show that feral pigs feed a high proportion of the A. sculptum adults and nymphs in their territories and should be a target for tick-borne diseases studies. This is particularly relevant to public health because all the main tick species found on feral pigs are aggressive to humans as well.

  15. Primer registro de infestación en un reptil por larvas de Amblyomma parvitarsum (Acari: Ixodidae en Argentina

    Directory of Open Access Journals (Sweden)

    Gabriel Natalio Castillo

    2015-05-01

    Full Text Available Amblyomma parvitarsum es una garrapata endémica del Altiplano Andino de Argentina, Bolivia, Chile y Perú. En la provincia de San Juan adultos de esta garrapata fueron encontrados en el Parque Nacional San Guillermo sobre Vicugna vicugna. En Argentina también existen citas de adultos de A. parvitarsum sobre bovinos, ovinos y el ñandú . El primer caso de parasitismo de larvas de A. parvitarsum en Liolaemus fue realizado en Chile. El presente trabajo menciona por primera vez para Argentina la presencia de larvas de A. parvitarsum parasitando al lagarto Liolaemus eleodori.

  16. Questing Amblyomma mixtum and Haemaphysalis juxtakochi (Acari: Ixodidae) Infected with Candidatus "Rickettsia amblyommii" from the Natural Environment in Panama Canal Basin, Panama.

    Science.gov (United States)

    D, Angélica M Castro; S, Gleidys G García; Dzul-Rosado, Karla; Aguilar, Ana; Castillo, Juan; Gabster, Amanda; Trejos, Diomedes; Zavala-Castro, Jorge; Bermúdez C, Sergio E

    2015-12-01

    This work emphasizes the detection of Candidatus "Rickettsia amblyommii" in questing Haemaphysalis juxtakochi and Amblyomma mixtum. From February 2009 to December 2012, questing ticks were collected from the vegetation and leaf-litter of four protected forests and two grassy areas around the Panama Canal basin. DNA was extracted from Amblyomma mixtum, Amblyomma naponense, Amblyomma oblongoguttatum, Amblyomma pecarium, Amblyomma tapirellum, Haemaphysalis juxtakochi, and unidentified immature Amblyomma. Specific primers of citrate synthase gene gltA were used to detect and identify the rickettsiae. Amplicons with the expected band size were purified and sequenced. DNA of C. "R. amblyommii" was found in A. mixtum, H. juxtakochi and Amblyomma immatures. To our knowledge, these finding represent the first report of C. "R. amblyommii" in free-living ticks in the wilderness of Central America.

  17. Description of the larva of Amblyomma calcaratum Neumann, 1899 (Acari: Ixodidae) by light and scanning electron microscopy.

    Science.gov (United States)

    Barbieri, Fábio S; Brito, Luciana G; Labruna, Marcelo B; Barros-Battesti, Darci M; Camargo, Luis Marcelo A; Famadas, Kátia M

    2013-12-01

    The larval stage of Amblyomma calcaratum Neumann is described using optical and scanning electron microscopy. Unfed larvae were obtained from a colony of A. calcaratum originating from engorged females collected on Tamandua tetradactyla in the Jaraguá Mountain (23°40'S, 45°44'W), São Paulo County, Brazil. Eleven larvae were prepared and mounted on slides and observed under a light microscope equipped with a drawing tube. Three specimens were prepared for SEM. Several morphological characters are described, including the chaetotaxy of the idiosoma, palpi, and Haller's organ, as well as morphological features of the idiosoma, gnathosoma, and legs of A. calcaratum larvae. In addition, topographical and numerical patterns of integumentary structures on the larval idiosoma are described using a recently proposed nomenclature. On the idiosoma, setaes, lyrifissures, small glands, and large wax glands were found. These structures were observed isolated or associated over the entire idiosoma, except on the scutum, which lacks large wax glands. The topographical and numerical patterns of integumentary structures of the A. calcaratum larva showed only minor differences when compared with patterns of other Amblyomma larvae; however, a few key features can be used to differentiate A. calcaratum from other members of this genus. Copyright © 2013 Elsevier GmbH. All rights reserved.

  18. Effect of deer exclusion by fencing on abundance of Amblyomma americanum (Acari: Ixodidae) on Fire Island, New York, USA.

    Science.gov (United States)

    Ginsberg, Howard S; Butler, Mari; Zhioua, Elyes

    2002-12-01

    The effects of deer exclusion on northern populations of lone star ticks, Amblyomma americanum, were tested at the Lighthouse Tract, Fire Island, NY, USA, where densities of this species have increased recently. Game fencing was erected to exclude deer from two sites of roughly one ha each, and populations of nymphal and adult A. americanum within were compared with those at control sites outside the exclosures. Percent control of nymphs within vs. outside the exclosures averaged 48.4% in the four years post-treatment, compared to pretreatment values. Percent control varied markedly in different years, suggesting that factors in addition to deer densities had strong effects on population densities of A. americanum. Exclosures of this size did not control adult A. americanum. Effects of deer exclusion in this recently expanded northern population of A. americanum were similar to those that have been reported for southern populations of this species.

  19. Acaricidal activity of the essential oils from Eucalyptus citriodora and Cymbopogon nardus on larvae of Amblyomma cajennense (Acari: Ixodidae) and Anocentor nitens (Acari: Ixodidae).

    Science.gov (United States)

    Clemente, Mateus Aparecido; de Oliveira Monteiro, Caio Márcio; Scoralik, Márcio Goldner; Gomes, Fernando Teixeira; de Azevedo Prata, Márcia Cristina; Daemon, Erik

    2010-09-01

    The present study evaluated the acaricidal activity of essential oils from Eucalyptus citriodora and Cymbopogon nardus on non-engorged larvae of Amblyomma cajennense and Anocentor nitens. In order to carry out the study, six groups were formed, each concentration being a treatment (6.25%, 12.5%, 25%, and 50%, respectively) and also with the creation of a control group (distilled water) and a positive control (Deltametrine). For each treatment, approximately 100 larvae of these ticks were placed onto filter papers (2 x 2 cm) impregnated with the concentrations used to test. Next, the envelopes were closed bearing inside the filter paper with measurements of 6 x 6 cm. For each group, six repetitions were performed, and after 24 h live and dead larvae were counted. This procedure was carried out for two essential oils on the two species of ticks. For A. cajennense, the acaricide efficacy of E. citriodora oil was of 10.8%, 35.3%, 34.5%, and 53.1%, whereas the efficacy of C. nardus was of 0.0%, 0.0%, 0.0%, and 61.1% at concentrations of 6.25%, 12.5%, 25.0%, and 50.0%, respectively. In relation to A. nitens, the acaricide efficacy of E. citriodora oil was of 20.1%, 84.5%, 89.2%, and 100.0%, whereas the efficacy of C. nardus was of 0.0%, 90.8%, 100.0%, and 100.0% at concentrations of 6.25%, 12.5%, 25.0%, and 50.0%, respectively. The results indicate that the essential oils tested showed a promising acaricidal activity mainly on A. nitens larvae.

  20. New host records for Amblyomma rotundatum (Acari: Ixodidae from Grussaí restinga, Rio de Janeiro, Brazil Novos registros de hospedeiros para Amblyomma rotundatum (Acari: Ixodidae da restinga de Grussaí, Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Lúcio André Viana

    2012-09-01

    Full Text Available Amblyomma rotundatum Koch is a parthenogenetic tick usually associated with reptiles and amphibians. However, relatively few studies on occurrences of ticks in wild reptile populations in Brazil have been produced. The aim of this study was to analyze the presence of ticks associated with reptile species in the Grussaí restinga, in the municipality of São João da Barra, state of Rio de Janeiro, Brazil. Between December 2010 and January 2011, 131 individuals belonging to nine species of reptiles of the order Squamata were sampled: the lizards Tropidurus torquatus (n = 51, Hemidactylus mabouia (n = 25, Mabuya agilis (n = 30, Mabuya macrorhyncha (n = 6, Cnemidophorus littoralis (n = 5 and Ameiva ameiva (n = 10; and the snakes Philodryas olfersii (n = 2, Oxyrhopus rhombifer (n = 1 and Micrurus corallinus (n = 1. The only tick species found to be associated with any of the reptiles sampled was A. rotundatum. One adult female was detected on one individual of the lizard A. ameiva, one nymph on one individual of the lizard T. torquatus and four nymphs on one individual of the snake P. olfersii. This study is the first record of parasitism of A. rotundatum involving the reptiles T. torquatus and P. olfersii as hosts. Our results suggest that in the Grussaí restinga habitat, A. rotundatum may use different species of reptiles to complete its life cycle.Amblyomma rotundatum Koch é um carrapato partenogenético geralmente associado a répteis e anfíbios. Entretanto existem relativamente poucos estudos sobre a ocorrência de carrapatos em populações silvestres de répteis no Brasil. O objetivo deste estudo foi analisar a presença de carrapatos associados às espécies de répteis em uma comunidade na restinga de Grussaí, município de São João da Barra, Estado do Rio de Janeiro, Brasil. Foram amostradas, entre os meses de dezembro de 2010 e janeiro de 2011, 131 indivíduos pertencentes a nove espécies de répteis da ordem Squamata: lagartos

  1. Amblyomma rotundatum (Koch, 1844 (Acari: Ixodidae two-host life-cycle on Viperidae snakes Ciclo dioxênico em Amblyomma rotundatum (Koch, 1844 (Acari: Ixodidaeparasitando serpentes da família Viperidae

    Directory of Open Access Journals (Sweden)

    Daniel Sobreira Rodrigues

    2010-09-01

    Full Text Available Amblyomma rotundatum is an ixodid tick that infests ectothermic animals and reproduces exclusively by parthenogenesis. This tick has been frequently reported to infest reptiles and amphibians, under natural conditions and sometimes in captivity. It was described in Brazil and several other countries of South, Central and North America. Although many studies have reported aspects of its biology, none of them has used regularly either ophidian as hosts, or controlled temperature, humidity and luminosity for parasitic stages. The objective of this experiment was to study the life cycle of A. rotundatum feeding on Viperidae snakes under room controlled conditions at 27 ± 1 ºC temperature, 85 ± 10% relative humidity and 12:12 hours photoperiod for parasitic stages, and under B.O.D incubator conditions at 27 ± 1 ºC temperature, 85 ± 10% relative humidity and scotophase for non-parasitic stages. The total duration of the life cycle ranged from 56 to 163 days (mean of 105 days. Two-host life cycle was observed for most of the ixodid population studied.Amblyomma rotundatum é um carrapato da família Ixodidae, parasito de animais pecilotérmicos, e que se reproduz exclusivamente por partenogênese. Este carrapato é frequentemente relatado infestando répteis e anfíbios em condições naturais e, às vezes, em animais de cativeiro. Ele já foi relatado no Brasil e em vários outros países das Américas do Sul, Central e do Norte. Embora muitos estudos sobre sua biologia tenham sido publicados, nunca foram utilizados ofídios como hospedeiros e, tão pouco, foram realizados ensaios com os estádios parasitários sob condições controladas de temperatura, umidade e iluminação. O objetivo deste experimento foi estudar o ciclo biológico de A. rotundatum se alimentando em serpentes da família Viperidae sob condições ambientais controladas a 27 ± 1 ºC de temperatura, 85 ± 10% de umidade relativa do ar e 12:12 horas de fotoperíodo para est

  2. Primeiro relato de Amblyomma fuscum Neumann, 1907 (acari: ixodidae) parasitando lagarto da espécie Tupinambis teguixin (L.), no município de Glorinha, estado do Rio Grande do Sul, Brasil

    OpenAIRE

    João R Martins; Elida C. Monticelli; Onofrio,Valéria C.; Darcy M. Barros-Battesti; Rovaina L. Doyle

    2007-01-01

    Amblyomma fuscum conhecida somente no Brasil, tem sido descrita como uma espécie rara de carrapato com relatos de sua ocorrência nas regiões sul e sudeste. Este é um novo registro desta espécie (9 fêmeas) parasitando lagarto (Tupinambis teguixin), no Município de Glorinha, Estado do Rio Grande do Sul. As fêmeas foram depositadas na coleção do Instituto de Pesquisas Veterinárias Desidério Finamor (7 espécimes) e na coleção de Acari do Instituto Butantan, Estado de São Paulo (2 espécimes). O ac...

  3. Evaluation of DEET and eight essential oils for repellency against nymphs of the lone star tick, Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Meng, Hao; Li, Andrew Y; Costa Junior, Livio M; Castro-Arellano, Ivan; Liu, Jingze

    2016-02-01

    DEET and Eight commercially available essential oils (oregano, clove, thyme, vetiver, sandalwood, cinnamon, cedarwood, and peppermint) were evaluated for repellency against host-seeking nymphs of the lone star tick, Amblyomma americanum. Concentration-repellency response was established using the vertical paper bioassay technique for each essential oil and compared with that of N,N-diethyl-3-methyl benzamide (DEET), a standard repellent compound present in many commercial repellent formulations. The effective concentration of DEET that repels 50% of ticks (EC50) was estimated at 0.02 mg/cm(2), while EC50s of the essential oils fall between 0.113 and 0.297 mg/cm(2). Based on EC50 estimates, oregano essential oil was the most effective among all essential oils tested, followed by clove, thyme, vetiver, sandalwood, cinnamon, cedarwood, and peppermint oils. None of the tested essential oils demonstrated a level of tick repellency found with DEET. Results from this study illustrated the challenge in search for more effective natural tick repellents.

  4. Comparing feeding and reproductive parameters of Amblyomma parvum tick populations (Acari: Ixodidae) from Brazil and Argentina on various host species.

    Science.gov (United States)

    Gerardi, Monize; Martins, Maria Marlene; Nava, Santiago; Szabó, Matias Pablo Juan

    2013-10-18

    Amblyomma parvum is a Neotropical tick that is widely spread and a potential vector of pathogens, including Rickettsiae. Genetic differences are remarkable between A. parvum populations from Brazil and Argentina. In this work, feeding and reproduction parameters of A. parvum ticks from these two populations were compared on some key host species to evaluate possible differences in host suitability between them. On the whole parameters of these tick populations were similar when fed on the same host and varied similarly on different host species. Still, bovines were more suitable host for Argentinian larvae than for Brazilian cohorts. It was observed that guinea pigs were the best host A. parvum immatures from both origins, as depicted from higher recovery rate of larvae and heavier engorged nymph weights. Canids and bovids were host species most suitable to adults of both tick populations as shown by the highest number of larvae produced by adult females that engorged on these hosts. Taken together, results showed that in spite of the genetic divergence, A. parvum from Argentina and Brazil have similar biological performance on various host species.

  5. Comparison of the isozyme phenotypes of the morphologically similar ticks Amblyomma cajennense and A. imitator (Acari: Ixodidae) from south Texas.

    Science.gov (United States)

    Hilburn, L R; Gunn, S J; Castillo, C

    1989-01-01

    A survey of Amblyomma Koch tick populations in southern Texas revealed that A. imitator Kohls was restricted to the two most southern counties, but that A. cajennense (Fabricius) ranged at least as far north as Kingsville, Tex. Females of the two species could be distinguished by the presence of chitinous tubercles on the festoons of A. cajennense and the presence of projections over both sides of the apron of the genital aperture in A. imitator. Males were distinguished by size, ornamentation, and the elongate ventral scutes of A. imitator. In addition, six enzymes, AATA, ACONA, IDH2, LDH, MPI, and PEP, were diagnostic for the two species and two others, aGPD and ACONC, had high diagnostic values. Resulting interspecific divergence was significant, I = 0.582. Genetic variability was higher in A. imitator (h = 0.092) than in A. cajennense (h = 0.057), but neither species exhibited marked interpopulation divergence (I = 0.991 in A. imitator, I = 0.994 in A. cajennense).

  6. New host records for Amblyomma rotundatum (Acari: Ixodidae) from Grussaí restinga, Rio de Janeiro, Brazil.

    Science.gov (United States)

    Viana, Lúcio André; Winck, Gisele Regina; Almeida-Santos, Marlon; Telles, Felipe Bottona da Silva; Gazêta, Gilberto Salles; Rocha, Carlos Frederico Duarte

    2012-01-01

    Amblyomma rotundatum Koch is a parthenogenetic tick usually associated with reptiles and amphibians. However, relatively few studies on occurrences of ticks in wild reptile populations in Brazil have been produced. The aim of this study was to analyze the presence of ticks associated with reptile species in the Grussaí restinga, in the municipality of São João da Barra, state of Rio de Janeiro, Brazil. Between December 2010 and January 2011, 131 individuals belonging to nine species of reptiles of the order Squamata were sampled: the lizards Tropidurus torquatus (n = 51), Hemidactylus mabouia (n = 25), Mabuya agilis (n = 30), Mabuya macrorhyncha (n = 6), Cnemidophorus littoralis (n = 5) and Ameiva ameiva (n = 10); and the snakes Philodryas olfersii (n = 2), Oxyrhopus rhombifer (n = 1) and Micrurus corallinus (n = 1). The only tick species found to be associated with any of the reptiles sampled was A. rotundatum. One adult female was detected on one individual of the lizard A. ameiva, one nymph on one individual of the lizard T. torquatus and four nymphs on one individual of the snake P. olfersii. This study is the first record of parasitism of A. rotundatum involving the reptiles T. torquatus and P. olfersii as hosts. Our results suggest that in the Grussaí restinga habitat, A. rotundatum may use different species of reptiles to complete its life cycle.

  7. Host Specificity of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae with Comments on the Drop-off Rhythm

    Directory of Open Access Journals (Sweden)

    Cristina Marques Lisbôa Lopes

    1998-05-01

    Full Text Available The parasitic specificity of larval, nymph and adult Amblyomma cajennense on six different host species: Oryctolagus cuniculus, Rattus norvegicus, Gallus gallus domesticus, Anas platyrhynchus, Coturnix coturnix and Streptopelia decorata is described. In terms of the numbers of larvae and nymphs recovered, O. cuniculus was the best host species. The modal day for drop-off of larvae and nymphs was day three for the mammal hosts, but variable in the birds. We conclude that adult A. cajennense have a strong degree of specificity due to the fact that the tick failed to complete its life cycle on any of the evaluated hosts. The immature stages, on the other hand, showed a low level of specificity, most especially in the larval stage, indicating the existence of secondary hosts which probably serve as dispersers in the wild. The results also indicated a variable drop-off rhythm for larvae and nymphs in two periods, diurnal (6-18 hr and nocturnal (18-6 hr, which differed depending upon the host.

  8. Elemol and amyris oil repel the ticks Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae) in laboratory bioassays.

    Science.gov (United States)

    Carroll, J F; Paluch, G; Coats, J; Kramer, M

    2010-08-01

    The essential oil from Amyris balsamifera (Rutaceae) and elemol, a principal constituent of the essential oil of Osage orange, Maclura pomifera (Moraceae) were evaluated in in vitro and in vivo laboratory bioassays for repellent activity against host-seeking nymphs of the blacklegged tick, Ixodes scapularis, and the lone star tick, Amblyomma americanum. Both bioassays took advantage of the tendency of these host-seeking ticks to climb slender vertical surfaces. In one bioassay, the central portion of a vertical strip of filter paper was treated with test solution and ticks placed or allowed to crawl onto the untreated lower portion. In the other bioassay, a strip of organdy cloth treated with test solution was doubly wrapped (treatment on outer layer) around the middle phalanx of a forefinger and ticks released on the fingertip. Both amyris oil and elemol were repellent to both species of ticks. Elemol did not differ significantly in effectiveness against A. americanum from the widely used repellent deet. At 2 and 4 h after application to filter paper, 827 microg amyris oil/cm(2) paper repelled 80 and 55%, respectively, of A. americanum nymphs. Ixodes scapularis was repelled by lower concentrations of amyris oil and elemol than A. americanum.

  9. ThermaCELL and OFF! Clip-On Devices Tested for Repellency and Mortality Against Amblyomma americanum (Acari: Ixodida: Amblyommidae).

    Science.gov (United States)

    Bibbs, Christopher S; Xue, Rui-De

    2016-07-01

    The ThermaCELL with allethrin and OFF! Clip-on with metofluthrin were tested in a 939 m(2) vented enclosure against nymphal lone star ticks, Amblyomma americanum (L.). Repellency assays were conducted at varying distances relative to product specifications for repellency range. Nymphal ticks acclimated for 24 h in chambers attached to 10 repellency tracks per repetition. Devices were turned on, and the tick travel distance and delay until beginning to travel were recorded. Mortality of ticks was recorded after 24 h. Mortality assays were also conducted at the same distances with five ticks per cage, and 12 cages per distance radially distributed around a device. Cages were removed after 5 min, 15 min, 30 min, and 60 min of exposure and checked after 24 h for mortality. Significant travel distance was found when exposed to the ThermaCELL and OFF! Clip-on at their shortest test distances. Significant mortality also resulted at the same distances. Ticks exposed to active devices for longer than 15 min had significant mortality at the shortest distance for OFF! Clip-on and multiple distances for the ThermaCELL. Overall, the spatial repellent devices ThermaCELL with allethrin and OFF! Clip-on with metofluthrin both demonstrated desirable effects when tested against A. americanum nymphs. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  10. Topographical and numerical study of the idiosomal integumentary structures of the larva of four Neotropical species of Amblyomma Koch, 1844 (Acari: Ixodidae).

    Science.gov (United States)

    Barbieri, Fábio S; Chacón, Samuel C; Labruna, Marcelo B; Barros-Battesti, Darci M; Faccini, João L H; Famadas, Kátia M

    2007-09-01

    Integumentary structures of the larvae of Amblyomma longirostre (Koch, 1844), A. parvum Aragão, 1908, A. rotundatum Koch, 1844 and from three populations of A. cajennense (Fabricius, 1787) were studied using light microscopy. A new nomenclature for the localisation of the integumentary structures is proposed. Three types of integumentary structures were identified in the larval idiosoma of the four Amblyomma species: lyrifissures, small glands and large wax glands. These structures were observed isolated or associated over the entire idiosoma, except in the scutum, which lacked lyrifisures and large wax glands. Large wax glands were the most stable within and between the tick species, followed by lyrifissures and small glands. Small glands, although relatively stable, showed the highest number of numerical variations within and between the tick species. Even though there were intra-population variations in the topographical and numerical pattern of some integumentary structures of A. cajennense larvae, there was a definitive pattern for most of the specimens, as showed by the similar modal and mean numbers of integumentary structures per tick side. The patterns of lyrifissures, small glands and large wax glands showed little differences when compared between the four Amblyomma species; however, a few differences were well evident. These differences were sufficient to differentiate larvae of the four species. Thus, we expect that the study of integumentary structures on the larvae of other Amblyomma species will be useful in future taxonomic keys for the identification of Amblyomma larvae from the Neotropical region.

  11. La presencia de Ixodes luciae en el noroeste argentino y nuevos huéspedes para Ixodes pararicinus y algunas especies de Amblyomma (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Analía G. AUTINO

    2006-01-01

    Full Text Available El análisis de una colección de garrapatas de mamíferos del noroeste argentino, depositados en la Colección de Anexos de la Colección Mamíferos Lillo (CML de la Universidad Nacional de Tucumán, permitió ampliar el área de distribución de Ixodes luciae Sénevet, a las provincias de Salta y Tucumán e incrementar su rango de huéspedes al roedor sigmodontino Calomys callosus (Rengger y a los marsupiales de la familia Didelphidae Micoureus constantiae (Thomas, Thylamys cinderella Thomas y Thylamys venustus (Thomas. Se registró a C. callosus y Oligoryzomys destructor (Tschudi como nuevos huéspedes de Ixodes pararicinus Keirans & Clifford, y a los Carnivora Lycalopex gymnocercus (Fischer y Oncifelis geoffroyi (d ́Orbigny & Gervais como nuevos huéspedes de Amblyomma neumanni Ribaga y Amblyomma parvum Aragão, respectivamente. Adicionalmente, se observó la infestación de Lutreolina crassicaudata (Desmarest (Didelphidae por I. luciae y la presencia de Amblyomma tigrinum Koch, sobre L. gymnocercus. Ninfas de Amblyomma sp. se obtuvieron de Akodon Meyen (Sigmodontinae.

  12. Effects of two commercial neem-based insecticides on lone star tick, Amblyomma americanum (L.) (Acari: Ixodidae): deterrence, mortality, and reproduction

    Science.gov (United States)

    The lone star tick, Amblyomma americanum (L.), is a widely distributed three-host obligate blood-feeding parasite in the United States and Mexico. It mostly attaches to white-tailed deer, Odocoilus virginianus (Zimmerman) and wild turkey, Meleagris gallopavo L., as well as a wide variety of other do...

  13. Morfologia e desenvolvimento do sistema reprodutor masculino de carrapatos do gênero Amblyomma (Acari, Ixodidae): uma análise comparativa

    OpenAIRE

    Sampieri, Bruno Rodrigues

    2016-01-01

    Os carrapatos do gênero Amblyomma possuem importância médica e veterinária devido ao seu parasitismo em vertebrados de interesse econômico, silvestres e inclusive em humanos. A sistemática deste grupo foi, por muito tempo, bastante controversa quanto à taxonomia e às relações filogenéticas dentro do gênero e deste com outros grupos de carrapatos. O estudo da morfologia do sistema reprodutor masculino de carrapatos, tem se mostrado valioso, principalmente quando da obtenção de informações sobr...

  14. La presencia de Ixodes luciae en el noroeste argentino y nuevos huéspedes para Ixodes pararicinus y algunas especies de Amblyomma (Acari: Ixodidae Presence of Ixodes luciae in Argentina northwest and new hosts for Ixodes pararicinus and some species of Amblyomma (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Analía G. Autino

    2006-07-01

    Full Text Available El análisis de una colección de garrapatas de mamíferos del noroeste argentino, depositados en la Colección de Anexos de la Colección Mamíferos Lillo (CML de la Universidad Nacional de Tucumán, permitió ampliar el área de distribución de Ixodes luciae Sénevet, a las provincias de Salta y Tucumán e incrementar su rango de huéspedes al roedor sigmodontino Calomys callosus (Rengger y a los marsupiales de la familia Didelphidae Micoureus constantiae (Thomas, Thylamys cinderella Thomas y Thylamys venustus (Thomas. Se registró a C . callosus y Oligoryzomys destructor (Tschudi como nuevos huéspedes de Ixodes pararicinus Keirans & Clifford, y a los Carnivora Lycalopex gymnocercus (Fischer y Oncifelis geoffroyi (d´Orbigny & Gervais como nuevos huéspedes de Amblyomma neumanni Ribaga y Amblyomma parvum Aragão, respectivamente. Adicionalmente, se observó la infestación de Lutreolina crassicaudata (Desmarest (Didelphidae por I. luciae y la presencia de Amblyomma tigrinum Koch, sobre L. gymnocercus . Ninfas de Amblyomma sp . se obtuvieron de Akodon Meyen (Sigmodontinae.The analysis of a tick collection of mammals from northwestern Argentina deposited in the Annexes (ACML of Colección Mamíferos Lillo (CML National University of Tucumán, amplified the distribution of Ixodes luciae Sénevet, to Salta and Tucumán provinces and increased the host range to the sigmodontinae rodent Calomys callosus (Rengger and the Didelphidae Micoureus constantiae (Thomas, Thylamys cinderella Thomas and Thylamys venustus (Thomas. Calomys callosus and Oligoryzomys destructor (Tschudi were registered as new hosts of Ixodes pararicinus Keirans & Clifford, and the Carnivora Lycalopex gymnocercus (Fischer and Oncifelis geoffroyi (d´Orbigny & Gervais as new hosts of Amblyomma neumanni Ribaga, and Amblyomma parvum Aragão, respectively . Lutreolina crassicaudata (Desmarest (Didelphidae was also found infested with I. luciae while Amblyomma tigrinum Koch was

  15. Amblyomma tapirellum  (Acari: Ixodidae collected from tropical forest canopy [v2; ref status: indexed, http://f1000r.es/2uy

    Directory of Open Access Journals (Sweden)

    Jose R Loaiza

    2014-01-01

    Full Text Available Free-ranging ticks are widely known to be restricted to the ground level of vegetation. Here, we document the capture of the tick species Amblyomma tapirellum in light traps placed in the forest canopy of Barro Colorado Island, central Panama. A total of forty eight adults and three nymphs were removed from carbon dioxide–octenol baited CDC light traps suspended 20 meters above the ground during surveys for forest canopy mosquitoes. To our knowledge, this represents the first report of questing ticks from the canopy of tropical forests. Our finding suggests a novel ecological relationship between A. tapirellum and arboreal mammals, perhaps monkeys that come to the ground to drink or to feed on fallen fruits.

  16. Rapid detection methods and prevalence estimation for Borrelia lonestari glpQ in Amblyomma americanum (Acari: Ixodidae) pools of unequal size.

    Science.gov (United States)

    Bacon, Rendi Murphree; Pilgard, Mark A; Johnson, Barbara J B; Piesman, Joseph; Biggerstaff, Brad J; Quintana, Miguel

    2005-01-01

    DNA was extracted from pools of Amblyomma americanum ticks collected from vegetation at two sites in Fort Leonard Wood, Missouri and tested for the presence of Borrelia spp. Two new methods were developed to detect Borrelia lonestari DNA by targeting the glycerophosphodiester phosphodiesterase (glpQ) gene. The first method detected B. lonestari DNA using a SYBR green I melting curve analysis of the PCR product obtained with glpQ gene primers. The second method, a glpQ TaqMan assay, detected and confirmed the presence of B. lonestari glpQ-specific sequences. Twenty-two of 95 tick pools collected at site A148 contained B. lonestari DNA. None of 19 pools from site A241 contained B. lonestari DNA. No B. burgdorferi sensu lato DNA was detected using a SYBR green I melting curve analysis of the PCR product obtained with outer surface protein A (ospA) primers. The overall B. lonestari infection prevalence (with 95% confidence interval) at site A148 was estimated using two algorithms: minimum infection rate 4.14% (2.45, 5.84) and maximum likelihood with correction 4.82% (3.11, 7.16). The merits of each are discussed. Sequencing of the entire B. lonestari glpQ and partial 16S rRNA genes revealed two genetic variants circulating in this population of A. americanum from Missouri.

  17. Different lines of evidence used to delimit species in ticks: A study of the South American populations of Amblyomma parvum (Acari: Ixodidae).

    Science.gov (United States)

    Nava, Santiago; Gerardi, Monize; Szabó, Matias P J; Mastropaolo, Mariano; Martins, Thiago F; Labruna, Marcelo B; Beati, Lorenza; Estrada-Peña, Agustín; Guglielmone, Alberto A

    2016-10-01

    The goal of this work was to combine different lines of evidence besides that of molecular markers to delimit species in ticks when the molecular data are not totally congruent. Two groups (Argentina, Brazil) of South American populations of Amblyomma parvum were compared to test whether the splitting of these two lineages suggested by genetic analyses is complete. Comparative studies of reproductive compatibility, morphological analyses of fixed characters, and comparison of population distributions in spatially defined ecological niches were performed.The morphological comparisons of both discrete and morphometric characters showed no differences among A. parvum ticks from Argentina and Brazil. The intercrosses and backcrosses showed evidence of pre- and post-zygotic compatibility between the two groups. No significant differences in environmental traits were found which would justify the separation of the records of A. parvum in distinct groups. Although the gene flow between the two groups of populations is limited, the absence of reproductive barriers, the lack of significant morphological differences, and the absence of significant differences in the niche preferences indicate that populations of A. parvum from Argentina and Brazil should be treated as a single species. The speciation conjectures suggested by some analyses of mitochondrial DNA sequences were not supported when different lines of evidences were compared.

  18. High prevalence of "Candidatus Rickettsia andeanae" and apparent exclusion of Rickettsia parkeri in adult Amblyomma maculatum (Acari: Ixodidae) from Kansas and Oklahoma.

    Science.gov (United States)

    Paddock, Christopher D; Denison, Amy M; Dryden, Michael W; Noden, Bruce H; Lash, R Ryan; Abdelghani, Sarah S; Evans, Anna E; Kelly, Aubree R; Hecht, Joy A; Karpathy, Sandor E; Ganta, Roman R; Little, Susan E

    2015-04-01

    Amblyomma maculatum (the Gulf Coast tick), an aggressive, human-biting, Nearctic and Neotropical tick, is the principal vector of Rickettsia parkeri in the United States. This pathogenic spotted fever group Rickettsia species has been identified in 8-52% of questing adult Gulf Coast ticks in the southeastern United States. To our knowledge, R. parkeri has not been reported previously from adult specimens of A. maculatum collected in Kansas or Oklahoma. A total of 216 adult A. maculatum ticks were collected from 18 counties in Kansas and Oklahoma during 2011-2014 and evaluated by molecular methods for evidence of infection with R. parkeri. No infections with this agent were identified; however, 47% of 94 ticks collected from Kansas and 73% of 122 ticks from Oklahoma were infected with "Candidatus Rickettsia andeanae" a spotted fever group Rickettsia species of undetermined pathogenicity. These preliminary data suggest that "Ca. R. andeanae" is well-adapted to survival in populations of A. maculatum in Kansas and Oklahoma, and that its ubiquity in Gulf Coast ticks in these states may effectively exclude R. parkeri from their shared arthropod host, which could diminish markedly or preclude entirely the occurrence of R. parkeri rickettsiosis in this region of the United States.

  19. A dynamic population model to investigate effects of climate and climate-independent factors on the lifecycle of the tick Amblyomma americanum (Acari: Ixodidae)

    Science.gov (United States)

    Ludwig, Antoinette; Ginsberg, Howard; Hickling, Graham J.; Ogden, Nicholas H.

    2016-01-01

    The lone star tick, Amblyomma americanum, is a disease vector of significance for human and animal health throughout much of the eastern United States. To model the potential effects of climate change on this tick, a better understanding is needed of the relative roles of temperature-dependent and temperature-independent (day-length-dependent behavioral or morphogenetic diapause) processes acting on the tick lifecycle. In this study, we explored the roles of these processes by simulating seasonal activity patterns using models with site-specific temperature and day-length-dependent processes. We first modeled the transitions from engorged larvae to feeding nymphs, engorged nymphs to feeding adults, and engorged adult females to feeding larvae. The simulated seasonal patterns were compared against field observations at three locations in United States. Simulations suggested that 1) during the larva-to-nymph transition, some larvae undergo no diapause while others undergo morphogenetic diapause of engorged larvae; 2) molted adults undergo behavioral diapause during the transition from nymph-to-adult; and 3) there is no diapause during the adult-to-larva transition. A model constructed to simulate the full lifecycle of A. americanum successfully predicted observed tick activity at the three U.S. study locations. Some differences between observed and simulated seasonality patterns were observed, however, identifying the need for research to refine some model parameters. In simulations run using temperature data for Montreal, deterministic die-out of A. americanum populations did not occur, suggesting the possibility that current climate in parts of southern Canada is suitable for survival and reproduction of this tick.

  20. Susceptibility of four tick species, Amblyomma americanum, Dermacentor variabilis, Ixodes scapularis, and Rhipicephalus sanguineus (Acari: Ixodidae), to nootkatone from essential oil of grapefruit.

    Science.gov (United States)

    Flor-Weiler, Lina B; Behle, Robert W; Stafford, Kirby C

    2011-03-01

    Toxicity of nootkatone was determined in laboratory assays against unfed nymphs of Amblyomma americanum L., Dermacentor variabilis (Say), Ixodes scapularis Say, and Rhipicephalus sanguineus Latreille. We determined the 50% lethal concentration (LC50) and 90% lethal concentration (LC90) of nootkatone by recording tick mortality 24 h after exposure in treated glass vials. Nymphs were susceptible to nootkatone with LC50 values of 0.352, 0.233, 0.169, and 0.197 microg/cm2, and LC90 values of 1.001, 0.644, 0.549, and 0.485 microg/cm2 for A. americanum, D. variabilis, I. scapularis, and R. sanguineus, respectively. The LC50 value for R. sanquineus was not significantly different from D. variabilis or I. scapularis. Other LC50 comparisons were significantly different. The LC90 for A. americanum was higher when compared with the three other tick species, which were not significantly different. Because nootkatone is volatile, we measured the amount of nootkatone recovered from duplicate-treated vials before tick exposure and from vials after tick exposure. Nootkatone recovered from vials before exposure ranged from 82 to 112% of the expected amounts. The nootkatone recovered after the 24-h exposure period ranged from 89% from vials coated with higher concentrations of nootkatone, down to 29% from vials coated with low nootkatone concentrations. Determination of the nootkatone residue after vial coating demonstrated loss of the active compound while verifying the levels of tick exposure. Toxicity of low concentrations of nootkatone to the active questing stage of ticks reported in this study provides a reference point for future formulation research to exploit nootkatone as a safe and environment-friendly tick control.

  1. A Dynamic Population Model to Investigate Effects of Climate and Climate-Independent Factors on the Lifecycle of Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Ludwig, Antoinette; Ginsberg, Howard S; Hickling, Graham J; Ogden, Nicholas H

    2016-01-01

    The lone star tick, Amblyomma americanum, is a disease vector of significance for human and animal health throughout much of the eastern United States. To model the potential effects of climate change on this tick, a better understanding is needed of the relative roles of temperature-dependent and temperature-independent (day-length-dependent behavioral or morphogenetic diapause) processes acting on the tick lifecycle. In this study, we explored the roles of these processes by simulating seasonal activity patterns using models with site-specific temperature and day-length-dependent processes. We first modeled the transitions from engorged larvae to feeding nymphs, engorged nymphs to feeding adults, and engorged adult females to feeding larvae. The simulated seasonal patterns were compared against field observations at three locations in United States. Simulations suggested that 1) during the larva-to-nymph transition, some larvae undergo no diapause while others undergo morphogenetic diapause of engorged larvae; 2) molted adults undergo behavioral diapause during the transition from nymph-to-adult; and 3) there is no diapause during the adult-to-larva transition. A model constructed to simulate the full lifecycle of A. americanum successfully predicted observed tick activity at the three U.S. study locations. Some differences between observed and simulated seasonality patterns were observed, however, identifying the need for research to refine some model parameters. In simulations run using temperature data for Montreal, deterministic die-out of A. americanum populations did not occur, suggesting the possibility that current climate in parts of southern Canada is suitable for survival and reproduction of this tick.

  2. Activity of the plant-based repellent, TT-4302 against the ticks Amblyomma americanum, Dermacentor variabilis, Ixodes scapularis and Rhipicephalus sanguineus (Acari: Ixodidae).

    Science.gov (United States)

    Bissinger, B W; Schmidt, J P; Owens, J J; Mitchell, S M; Kennedy, M K

    2014-01-01

    The plant-based repellent TT-4302 (5 % geraniol) was compared to deet (15 %) in laboratory two-choice bioassays against the ticks Amblyomma americanum, Dermacentor variabilis, Ixodes scapularis, and Rhipicephalus sanguineus. At 2.5 and 3.5 h after treatment of filter paper with TT-4302, 100 % repellency was observed for all species at both time points with the exception of I. scapularis at the 3.5 h evaluation where repellency was 95.8 %. Deet was 100 % repellent at both time points for D. variabilis and R. sanguineus and was 100 % repellent at the 2.5 h evaluation for I. scapularis. Repellency of deet to A. americanum was 88.9 and 95.8 % at 2.5 and 3.5 h, respectively which was not significantly different than that of TT-4302. No significant difference against I. scapularis was observed between TT-4302 and deet at 3.5 h after treatment where deet was 87.5 % repellent. A variant of TT-4302, TT-4228 was tested in the laboratory against A. americanum and was compared to deet (15 %) in field trials against wild populations of ticks in North Carolina, USA. In the laboratory, TT-4228 was 94.4 and 87.5 % repellent at 2.5 and 3.5 h after treatment, respectively. In the field where the predominant tick species was A. americanum, significantly fewer ticks were collected from socks worn by human volunteers that were treated with TT-4228 compared to those treated with deet 2.5 or 3.5 h after treatment. Significantly fewer ticks were recovered from socks treated with TT-4228 than their paired untreated controls 2.5 or 3.5 h after treatment and repellencies were 90 and 70 %, respectively. Fewer ticks were collected from deet-treated compared to their paired untreated socks 2.5 h after application; however, no significant difference was found in the number of ticks collected from deet-and untreated socks 3.5 h after treatment.

  3. Ação in vitro dos fungos Beauveria bassiana (Bals Vuill e Metarhizium anisopliae (Metsch Sorok sobre ninfas e adultos de Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae In vitro action of the fungi Beauveria bassiana (Bals Vuill and Metarhizium anisopliae (Metsch Sorok on ninphs and adults of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    R.C.S. Reis

    2001-10-01

    Full Text Available O trabalho teve por objetivo verificar a mortalidade in vitro de ninfas e adultos de Amblyomma cajennense frente à ação de isolados dos fungos Beauveria bassiana e Metarhizium anisopliae. Foram avaliados três isolados de M. anisopliae (959, 319 e E9 e dois de B. bassiana (986 e 747. As suspensões de conídios foram preparadas a partir de fungos produzidos em meio de arroz, e cada bioensaio foi constituído de quatro tratamentos nas concentrações 10(5, 10(6, 10(7, 10(8 conídios/ml e um grupo-controle. A análise constou da observação do percentual de mortalidade, 15 dias após o tratamento ou após a ecdise de adultos. Foram observadas diferenças significativas entre os tratamentos quanto à mortalidade para todos os isolados e todos os instares. Nos grupos tratados houve aumento considerável na mortalidade à medida que se aumentava a concentração de conídios na suspensão. Conclui-se que todos os isolados testados causaram mortalidade em testes in vitro sobre esses estádios evolutivos, sugerindo o controle do A. cajennense pela ação desses fungos.This work aimed at the evaluation of the in vitro susceptibility of Amblyomma cajennense nimphs and adults to isolates of Beauveria bassiana and Metarhizium anisopliae fungi. Three isolates of M. anisopliae (959, 319 e E9 and two of B. bassiana (986 e 747 were used. Conidia suspensions were made from fungi grown up in a rice culture medium and each test consisted of four treated groups (10(5, 10(6, 10(7, 10(8 conidia/ ml plus a control group. Viability of individuals was assessed 15 days after treatment or after adult ecdisis. Significative differences were found for all treatments and for all stages studied. A large reduction in the viability of ticks was observed, and this effect increased as conidia concentration raised. Based upon the results obtained, it can be concluded that all isolates tested presented an in vitro lethality for the biological stages of A. cajennense evaluated

  4. Life cycle of female ticks of Amblyomma cooperi Nuttal & Warburton, 1908 (Acari: Ixodidae under laboratory conditions Ciclo biológico de fêmeas do carrapato Amblyomma cooperi Nuttal & Warburton, 1908 (Acari:Ixodidae sob condições de laboratório

    Directory of Open Access Journals (Sweden)

    A.T.S. Almeida

    2001-06-01

    Full Text Available The biological cycle of female ticks of Amblyomma cooperi was studied under controlled conditions. The study has begun with two engorged females collected in a naturally infested wild capybara. The larvae originated from the oviposition of these two females were used for collecting young adults through artificial infestations in rabbits. The female parasitic and free living phases were evaluated using artificial infestation of ticks in a capybara. The average body weight of females was 958.2± 175.6mg, the average pre-egg laying period was 8.5± 1.4 days, the reproductive efficiency index was 59.5± 4.2 and the nutritional efficiency index was 77.3± 4.8. The incubation and eclosion periods were 41.9 and 5.9 days, respectively, and the rate of eclosion was 64%. These figures were obtained under high relative humidity conditions which were necessary for the success of the egg incubation process of this species. The preliminary data obtained with the artificial infestation in rabbits raises the possibility of this and other domestic species be used as an epidemiologic link between the domestic and the wild environment with the potential exposure of human populations to A. cooperi and to the maculosa fever agent.O ciclo biológico de Amblyomma cooperi foi estudado sob condições de laboratório. O estudo iniciou-se com duas fêmeas ingurgitadas coletadas de uma capivara selvagem naturalmente infestada. As larvas provenientes da postura foram utilizadas para obtenção de adultos, por meio de infestação artificial em coelhos. As fases parasitária e de vida livre das fêmeas foram avaliadas utilizando-se infestação artificial em capivara. A média de peso corporal foi de 958,2± 175,6mg, a média do período de pré-postura de 8,5± 1,4 dias e dos índices de eficiência reprodutiva e nutricional de 59,5± 4,2 e 77,3± 4,6, respectivamente. Os períodos de incubação e eclosão foram de 41,9 e 5,9 dias, respectivamente. A taxa de eclosão foi

  5. Avaliação de parâmetros clínicos e hematológicos de eqüinos submetidos a um programa de controle estratégico de Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae Evaluation of clinical and hematological parameters of equines submitted to a strategic control program of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    A.P. Cunha

    2008-02-01

    Full Text Available Estudaram-se aspectos clínicos e hematológicos em eqüinos submetidos a um programa de controle estratégico de A. cajennense. Os tratamentos carrapaticidas foram realizados a cada sete dias e divididos em dois módulos, o primeiro com início em abril de 2004, e o segundo com início em julho do mesmo ano, utilizando-se a base química piretróide - cipermetrina na concentração de 0,015%. Além do acompanhamento clínico dos animais, foram realizados hemogramas completos antes e após o programa. As dosagens bioquímicas de bilirrubinas, gama-glutamiltransferase (GGT, aspartato aminotransferase (AST, creatina kinase (CK, proteína total, albumina e globulinas, foram realizadas antes, durante e ao final do programa. Os resultados demonstraram que houve uma melhora no quadro hematológico dos animais após o programa de controle. Os tratamentos carrapaticidas, na forma em foram aplicados, não provocaram alterações desfavoráveis nos parâmetros clínicos e hematológicos dos eqüinos. Tais informações podem ser consideradas na busca de alternativas viáveis e seguras para o controle dessa espécie de carrapato.Clinical and hematological parameters were studied in equines submitted to a strategic control program of Amblyomma cajennense. The acaricide treatments were carried to each seven days and divided in two batteries, the first one began in April 2004 and the second in July 2004. A pyrethroid chemical base - 0.015% cypermethrin was used. Clinical examinations of the animals and complete hemograms were carried before and after the control program of the tick. Seric dosages of bilirrubins, gamma-glutamiltransferase (GGT, aspartate aminotransferase (AST, creatin kinase (CK, total protein, albumin, and globulins, were carried before and throughout the experiment. The results showed an improvement in the hematological parameters of the animals after the end of control program. The acaricide treatments did not cause undesirable alterations

  6. Carrapatos do gênero amblyomma (acari: ixodidae e suas relações com os hospedeiros em área endêmica para febre maculosa no Estado de São Paulo Ticks of genus Amblyomma (Acari: Ixodidae and their relationship with hosts in endemic area for spotted fever in the state of São Paulo

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Perez

    2008-12-01

    Full Text Available Foram avaliadas 7 espécies da mastofauna e 36 da avifauna quanto à prevalência e intensidade de infestação por carrapatos na ESALQ/USP, no Município de Piracicaba, SP. Analisaram-se 52 indivíduos da mastofauna e 158 da avifauna, parasitados por 12418 carrapatos. Os exemplares adultos (N= 7343 foram encontrados em parasitismo nas capivaras enquanto que os imaturos foram, na maioria, coletados de pequenos mamíferos e aves. Os principais hospedeiros para as formas imaturas, em ordem decrescente, foram gambás (69,1%, capivaras (24,4% e urubus (3,7%. Entre a avifauna, o urubu apresentou o maior número de carrapatos com 69,9%, seguido por indivíduos das famílias Thamnophilidae e Turdidae. Os carrapatos adultos encontrados em capivaras foram A. cajennense (80,8% e A. dubitatum (19,2%. Ambas as espécies foram também coletadas em gambás, correspondendo a 72,4% e 27,6%, respectivamente. Pela facilidade de captura e atratividade de Amblyomma spp. o gambá pode ser usado como bioindicador de infestação em locais endêmicos para febre maculosa. Considerando os índices de parasitismo e prevalência bem como de abundância de carrapatos, susceptibilidade dos hospedeiros, proliferação e susceptibilidade para infecção por R. rickettsi, capivaras e gambás são potenciais hospedeiros amplificadores desse microrganismo no Campus da ESALQ, enquanto eqüídeos, urubus e gatos atuam como hospedeiros secundários.Seven species of mammals and 36 of birds were investigated to determine the tick prevalence and intensity of infestation. The study was conducted at the Esalq/USP in Piracicaba municipality, State of São Paulo. It was collected 52 mammals and 158 birds parasitized by 12,418 ticks. Adult ticks (N= 7,343 were found on capybaras, while the immature were mainly collected on small mammals and birds. The main hosts for immatures in descending order were opossums (69.1%, capybara (24.4% and black vultures (3.7%. Among the avifauna, the black

  7. The mitochondrial genome of the lone star tick (Amblyomma americanum).

    Science.gov (United States)

    Williams-Newkirk, Amanda J; Burroughs, Mark; Changayil, Shankar S; Dasch, Gregory A

    2015-09-01

    Amblyomma americanum is an abundant tick in the southeastern, midwestern, and northeastern United States. It is a vector of multiple diseases, but limited genomic resources are available for it. We sequenced the complete mitochondrial genome of a single female A. americanum collected in Georgia using the Illumina platform. The consensus sequence was 14,709 bp long, and the mean coverage across the assembly was >12,000×. All expected tick genomic features were present, including two "Tick-Box" motifs, and in the expected order for the Metastriata. Heteroplasmy rates were low compared to the most closely related tick for which data are available, Amblyomma cajennense. The phylogeny derived from the concatenated protein coding and rRNA genes from the 33 available tick mitochondrial genomes was consistent with those previously proposed for the Acari. This is the first complete mitochondrial sequence for A. americanum, which provides a useful reference for future studies of A. americanum population genetics and tick phylogeny.

  8. Relação parasito-hospedeiro na infestação artificial de Oryctolagos cuniculus (Linnaeus, 1758) (Lagomorpha: Ochotonidae) por Amblyomma cajennense (Fabricius, 1787) (Acari: ixodidae)

    OpenAIRE

    Carolina Maria Vianna de Freitas

    2005-01-01

    O presente estudo teve por objetivo, avaliar os aspectos imunológicos da relaçao parasitohospedeiro em coelhos artificialmente infestados por Amblyomma cajennense e iniciar a busca de antígenos passíveis de serem utilizados no controle deste parasito. Para tanto foram realizados três experimentos distintos: (1) no primeiro experimento estudou-se odesenvolvimento de resistência adquirida em coelhos submetidos às infestações artificiais por larvas, ninfas e adultos de A. cajennese. Os coelhos s...

  9. The international trade in reptiles (Reptilia)--the cause of the transfer of exotic ticks (Acari: Ixodida) to Poland.

    Science.gov (United States)

    Nowak, Magdalena

    2010-05-11

    The problem of the unnatural transfer of exotic ticks (Acari: Ixodida) on reptiles (Reptilia) imported to Poland is presented. In the period from 2003 to 2007, 382 specimens of reptiles belonging to the following genera were investigated: Testudo, Iguana, Varanus, Gongylophis, Python, Spalerosophis, Psammophis. The reptiles most infested with ticks are imported to Poland from Ghana in Africa, and are the commonly bred terrarium reptiles: Varanus exanthematicus and Python regius. As a result of the investigations, the transfer of exotic ticks on reptiles to Poland was confirmed. There were 2104 specimens of the genera Amblyomma and Hyalomma. The following species were found: Amblyomma exornatum Koch, 1844, Amblyomma flavomaculatum (Lucas, 1846), Amblyomma latum Koch, 1844, Amblyomma nuttalli Donitz, 1909, Amblyomma quadricavum (Schulze, 1941), Amblyomma transversale (Lucas, 1844), Amblyomma varanense (Supino, 1897), Amblyomma sp. Koch, 1844, Hyalomma aegyptium (Linnaeus, 1758). All the species of ticks of genus Amblyomma revealed have been discovered in Poland for the first time. During the research, 13 cases of anomalies of morphological structure were confirmed in the ticks A. flavomaculatum, A. latum and H. aegyptium. The expanding phenomenon of the import of exotic reptiles in Poland and Central Europe is important for parasitological and epidemiological considerations, and therefore requires monitoring and wide-ranging prophylactic activities to prevent the inflow of exotic parasites to Poland.

  10. Biological parameters of larvae, nymphs, and engorged females of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae obtained from artificial and successive infestations on Oryctolagus cuniculus (Linnaeus, 1758 (Lagomorpha: Ochotonidae Parâmetros biológicos de larvas, ninfas e fêmeas ingurgitadas de Amblyomma cajennense (Fabricius, 1787 (Acari:Ixodidae obtidas de infestações artificiais e sucessivas em Oryctolagus cuniculus (Lagomorpha:Ochotonidae

    Directory of Open Access Journals (Sweden)

    C.M.V. Freitas

    2009-10-01

    Full Text Available The development of acquired resistance to Amblyomma cajennense ticks was evaluated. A total of 18 rabbits were uniformly distributed into three groups named GL, GN, and GA that were submitted to three consecutive infestations with, respectively, larvae, nymphs, and adults of A. cajennense. After the infestations, the parasitic and reproductive parameters of recovered instars were evaluated. A significant reduction of recovery rates of inoculated ticks was observed only after the third infestation of animals in groups GL and GN (PAvaliou-se o desenvolvimento de resistência adquirida frente ao parasitismo por Amblyomma cajennense. Para tanto, 18 coelhos foram uniformemente distribuídos em três grupos denominados GL, GN e GA e submetidos a três infestações consecutivas por, respectivamente, larvas, ninfas ou adultos de A. cajennense. Após a infestação, estudaram-se os parâmetros parasitários e reprodutivos dos exemplares recuperados. Apenas a partir da terceira infestação dos animais dos grupos GL e GN, pôde-se observar uma queda significativa na taxa de recuperação dos ixodídeos inoculados (P<0,01. O dia modal de queda das larvas e ninfas recuperadas aumentou com o decorrer das infestações. As ninfas ingurgitadas recuperadas apresentaram uma redução significativa (P<0,01 no peso médio corporal entre a primeira e terceira infestação. Observou-se uma queda significativa na taxa média de recuperação das fêmeas ingurgitadas somente na terceira infestação (P<0,01. Todavia, a partir da segunda infestação observou-se nas teleóginas recuperadas, uma redução significativa no peso corporal, peso da postura e eclodibilidade das larvas (P<0,05. Os dados sugerem a ocorrência de resistência em coelhos à infestação por A. cajennense que foi mais evidente contra o estádio adulto.

  11. Molecular Detection of Rickettsia africae in Amblyomma variegatum Collected from Sudan.

    Science.gov (United States)

    Nakao, Ryo; Qiu, Yongjin; Salim, Bashir; Hassan, Shawgi Mohamed; Sugimoto, Chihiro

    2015-05-01

    Despite the increasing awareness of the importance of emerging vector-borne diseases, human tick-borne diseases, particularly rickettsial infections, are overlooked, especially in the countries such as Sudan with limited resources to perform molecular-based surveys. This study aimed at detection and genetic characterization of Rickettsia spp. in ticks collected from Sudan. The samples were first screened for the presence of rickettsial agents by gltA real-time PCR and subsequently characterized by gltA and ompA PCR and size-based multispacer typing. The results demonstrated the wide distribution of Rickettsia africae and/or closely related species across Sudan. The results of this report highlight the need for careful consideration of rickettsial infections in patients with nonmalarial febrile illness in this country. Nationwide surveillance on ticks associated with human rickettsial infections in Sudan is warranted.

  12. Preliminary survey of ticks (Acari : Ixodidae on cattle in northern Sudan

    Directory of Open Access Journals (Sweden)

    D.A. Salih

    2004-11-01

    Full Text Available In a cross sectional survey conducted during the period June 2001 to July 2002, the geographical distribution of ticks on cattle in the Sudan was determined. Seventeen locations were surveyed from Northern, Central, Eastern, Western, Blue Nile and White Nile Provinces. Total body collections of ticks were made from 20 cattle at each location. Four tick genera and 11 species were identified. The tick species collected included Amblyomma lepidum, Amblyomma variegatum, Boophilus decoloratus, Hyalomma anatolicum anatolicum, Hyalomma dromedarii, Hyalomma impeltatum, Hyalomma marginatum rufipes, Hyalomma truncatum, Rhipicephalus evertsi evertsi, Rhipicephalus sanguineus group and Rhipicephalus simus simus. Major ecological changes have occurred due to extensive animal movement, deforestation, desertification and establishment of large mechanized agricultural schemes. These factors have certainly affected the distribution of ticks and tick-borne diseases in the Sudan. The absence of A. variegatum and A. lepidum in northern Sudan was not surprising, since these tick species are known to survive in humid areas and not in the desert and semi-desert areas of northern Sudan. The absence of B. annulatus in northern and central Sudan is in accordance with the finding that this tick species is restricted to the southern parts of the central Sudan. The presence of H. anatolicum anatolicum in Um Benin in relatively high abundance is an interesting finding. The present finding may indicate that the southern limit of this species has changed and moved southwards to latitude 13o N. It is concluded that major changes in tick distribution have taken place in the Sudan

  13. Improved molecular detection of Ehrlichia and Anaplasma species applied to Amblyomma ticks collected from cattle and sheep in Ethiopia.

    Science.gov (United States)

    Teshale, S; Geysen, D; Ameni, G; Asfaw, Y; Berkvens, D

    2015-02-01

    Detection of Ehrlichia and Anaplasma species in animals and tick vectors is crucial for an understanding of the epidemiology of diseases caused by these pathogens. In this study, a pair of primers designated EBR2 and EBR3 was designed from the Anaplasma 16S rDNA sequence and was used along with a previously described primer EHR 16SD for the simultaneous detection of Ehrlichia and Anaplasma species by nested PCR. The primers were used to amplify 925bp of DNA from known species of Ehrlichia and Anaplasma. Restriction with MboII and MspI enzymes allowed Ehrlichia and Anaplasma speciation. Restriction with MboII differentiated between An. marginale, Anaplasma (formerly Ehrlichia) sp. Omatjenne, and An. centrale with An. marginale and Anaplasma (formerly Ehrlichia) sp. Omatjenne yielding 2 distinct fragments each while An. centrale produced 3 distinct bands. Ehrlichia ruminantium and An. phagocytophylum remained undigested. Subsequent restriction with MspI differentiated E. ruminantium from An. phagocytophylum with 2 and 4 fragments, respectively. When used on tick samples from the field, 63 ticks (16.4%) out of 384 collected from cattle and sheep were positive for one or more species of Ehrlichia and Anaplasma. The positivity ranged from 6.3% at Andasa to 36.7% at Habernosa. Higher overall infection rates were found in Amblyomma lepidum than in Amblyomma variegatum ticks (p=0.009). Amblyomma lepidum from Habernosa were more often infected with all detected species of Anaplasma and Ehrlichia than Am. variegatum. At Bako, however, Anaplasma (formerly Ehrlichia) sp. Omatjenne was detected only in Am. variegatum. A significantly higher proportion of ticks collected from cattle (20.6%) was found positive than in those collected from sheep (3.3%) (p=0.003). Simultaneous detection of Ehrlichia and Anaplasma species and correct identification of mixed infections was possible. Since the ticks were collected from animals, the occurrence of the major species of Ehrlichia and

  14. Ticks (Acari: Ixodida) on wild carnivores in Brazil.

    Science.gov (United States)

    Labruna, Marcelo B; Jorge, Rodrigo S P; Sana, Dênis A; Jácomo, Anah Tereza A; Kashivakura, Cyntia K; Furtado, Mariana M; Ferro, Claudia; Perez, Samuel A; Silveira, Leandro; Santos, Tarcísio S; Marques, Samuel R; Morato, Ronaldo G; Nava, Alessandra; Adania, Cristina H; Teixeira, Rodrigo H F; Gomes, Albério A B; Conforti, Valéria A; Azevedo, Fernando C C; Prada, Cristiana S; Silva, Jean C R; Batista, Adriana F; Marvulo, Maria Fernanda V; Morato, Rose L G; Alho, Cleber J R; Pinter, Adriano; Ferreira, Patrícia M; Ferreira, Fernado; Barros-Battesti, Darci M

    2005-01-01

    The present study reports field data of ticks infesting wild carnivores captured from July 1998 to September 2004 in Brazil. Additional data were obtained from one tick collection and from previous published data of ticks on carnivores in Brazil. During field work, a total of 3437 ticks were collected from 89 Cerdocyon thous (crab-eating fox), 58 Chrysocyon brachyurus (maned wolf), 30 Puma concolor (puma), 26 Panthera onca (jaguar), 12 Procyon cancrivorus (crab-eating raccoon), 4 Speothos venaticus (bush dog), 6 Pseudalopex vetulus (hoary fox), 6 Nasua nasua (coati), 6 Leopardus pardalis (ocelot), 2 Leopardus tigrinus (oncilla), 1 Leopardus wiedii (margay), 1 Herpailurus yagouaroundi (jaguarundi), 1 Oncifelis colocolo (pampas cat), 1 Eira barbara (tayara), 1 Galictis vittata (grison), 1 Lontra longicaudis (neotropical otter), and 1 Potus flavus (kinkajou). Data obtained from the Acari Collection IBSP included a total of 381 tick specimens collected on 13 C. thous, 8 C. brachyurus, 3 P. concolor, 10 P. onca, 3 P. cancrivorus, 4 N. nasua, 1 L. pardalis, 1 L. wiedii, 4 H. yagouaroundi, 1 Galictis cuja (lesser grison), and 1 L. longicaudis. The only tick-infested carnivore species previously reported in Brazil, for which we do not present any field data are Pseudalopex gymnocercus (pampas fox), Conepatus chinga (Molina's hog-nosed skunk), and Conepatus semistriatus (striped hog-nosed skunk). We report the first tick records in Brazil on two Felidae species (O. colocolo, H. yagouaroundi), two Canidae species (P. vetulus, S. venaticus), one Procyonidae species (P. flavus) and one Mustelidae (E. barbara). Tick infestation remains unreported for 5 of the 26 Carnivora species native in Brazil: Oncifelis geoffroyi (Geoffroy's cat), Atelocynus microtis (short-eared dog), Pteronura brasiliensis (giant otter), Mustela africana (Amazon weasel), and Bassaricyon gabbii (olingo). Our field data comprise 16 tick species represented by the genera Amblyomma (12 species), Ixodes (1

  15. Parasites of domestic and wild animals in South Africa. XLIX. Ticks (Acari: Ixodidae infesting white and black rhinoceroses in southern Africa

    Directory of Open Access Journals (Sweden)

    Ivan G. Horak

    2017-01-01

    Full Text Available The objectives of the study were to determine the species composition of ticks infesting white and black rhinoceroses in southern Africa as well as the conservation status of those tick species that prefer rhinos as hosts. Ticks were collected opportunistically from rhinos that had been immobilised for management purposes, and 447 white rhinoceroses (Ceratotherium simum and 164 black rhinoceroses (Diceros bicornis were sampled in South Africa, 61 black rhinos in Namibia, 18 white and 12 black rhinos in Zimbabwe, and 24 black rhinos in Zambia. Nineteen tick species were recovered, of which two species, Amblyomma rhinocerotis and Dermacentor rhinocerinus, prefer rhinos as hosts. A. rhinocerotis was collected only in the northeastern KwaZulu-Natal reserves of South Africa and is endangered, while D. rhinocerinus is present in these reserves as well as in the Kruger National Park and surrounding conservancies. Eight of the tick species collected from the rhinos are ornate, and seven species are regularly collected from cattle. The species present on rhinos in the eastern, moister reserves of South Africa were amongst others Amblyomma hebraeum, A. rhinocerotis, D. rhinocerinus, Rhipicephalus maculatus, Rhipicephalus simus and Rhipicephalus zumpti, while those on rhinos in the Karoo and the drier western regions, including Namibia, were the drought-tolerant species, Hyalomma glabrum, Hyalomma rufipes, Hyalomma truncatum and Rhipicephalus gertrudae. The species composition of ticks on rhinoceroses in Zambia differed markedly from those of the other southern African countries in that Amblyomma sparsum, Amblyomma tholloni and Amblyomma variegatum accounted for the majority of infestations.

  16. Multi-locus sequence typing of Ehrlichia ruminantium strains from geographically diverse origins and collected in Amblyomma variegatum from Uganda

    OpenAIRE

    Jongejan Frans; Zhou Lijia; Magona Joseph W; Nakao Ryo; Sugimoto Chihiro

    2011-01-01

    Abstract Background The rickettsial bacterium Ehrlichia ruminantium is the causative agent of heartwater in ruminants. A better understanding of the population genetics of its different strains is, however, needed for the development of novel diagnostic tools, therapeutics and prevention strategies. Specifically, the development of effective vaccination policies relies on the proper genotyping and characterisation of field isolates. Although multi-locus sequence typing (MLST) has been recentl...

  17. Acari in archaeology.

    Science.gov (United States)

    Baker, Anne S

    2009-10-01

    Mites and ticks (Acari) have been found in a variety of archaeological situations. Their identification has enabled data on habitat and dietary preferences to be obtained, and these have been used to interpret study sites. Despite this, Acari are not routinely considered in analyses in the way that other environmental components are. Like forensic science, archaeology draws on biological material to rebuild past human activity, and acarology has the potential to provide a much greater amount of evidence to both than is currently the case. As an aid to workers in these fields, an overview is presented of the Acari that have been extracted from archaeological samples, the situations in which they were found and the contribution their presence can make to the interpretation of sites.

  18. ACARI, CIDADE (MAIS) LIMPA

    OpenAIRE

    Maria Luiza de Medeiros Galvão

    2013-01-01

    Este trabalho tem por objetivo realizar uma breve reflexão acerca da concepção empírica de Acari como a cidade mais limpa do Brasil, assim referenciada na década de 70 do século XX. Como introdução, desenvolvemos considerações iniciais sobre cidade, tendo como recurso metodológico os conhecimentos adquiridos com a disciplina Arquitetura e Cidade no Brasil. Dando sequência ao texto, refletimos conceitualmente sobre cidade, espaço balizador para compreensão de Acari - cidade mais limpa; territó...

  19. Garrapatas (Acari: Ixodidae asociadas a perros en diferentes ambientes de la provincia de Corrientes, Argentina Ticks (Acari: Ixodidae of dogs in different environments of the Corrientes Province, Argentina

    Directory of Open Access Journals (Sweden)

    V.N. Debárbora

    2011-06-01

    Full Text Available Se estudiaron las garrapatas (Acari: Ixodidae de perros en ambientes urbanos, periurbanos y rurales de la provincia de Corrientes por medio de colecciones mensuales durante un año en siete sitios diferentes. De los 138 perros examinados, en 87 (63,04% se determinaron tres especies de garrapatas: Amblyomma tigrinum (n=35, Amblyomma ovale (n=2 y Rhipicephalus sanguineus sensu lato (n=523. Las mayores prevalencias para A. tigrinum y R. sanguineus s.l. fueron halladas en ambientes rurales. Especímenes de R. sanguineus s.l. fueron detectados a lo largo de todo el año, con picos de abundancia en primavera y verano, A. tigrinum fue encontrada en otoño, invierno y primavera con un pico en esta última estación, mientras que A. ovale fue colectada sólo en primavera. Rhipicephalus sanguineus s.l. y A. tigrinum fueron halladas en todos los ambientes muestreados, pero el primer taxón fue siempre el más abundante. Teniendo en cuenta que las especies del complejo R. sanguineus son potenciales vectores de microorganismos patógenos para los perros y humanos, y debido a la alta prevalencia registrada en este estudio, queda en evidencia la relevancia de aplicar métodos para su control en las áreas incluidas en este estudio.Ticks (Acari: Ixodidae of dogs in urban, peri-urban and rural areas from the Corrientes Province, Argentina, were studied. They were monthly collected during one year at 7 different sites. A total of 138 dogs were examined, and 87 (63.04% of them were infested; and three species were determined: Amblyomma tigrinum (n=35, Amblyomma ovale (n=2 and Rhipicephalus sanguineus sensu lato (n=523. Both A. tigrinum and R. sanguineus s.l. had the highest prevalence in rural areas. Specimens of R. sanguineus s.l. were collected in the four seasons, but the peaks of abundance were detected in spring and summer. Amblyomma tigrinum was found in autumn, winter and spring, with the peak of abundance in spring, and the two specimens of A. ovale were

  20. Acari uit Ambon

    NARCIS (Netherlands)

    Oudemans, A.C.

    1927-01-01

    Prof. Dr. E. D. VAN OORT, Directeur van 's Rijks Museum van Natuurlijke Historie te Leiden, was zoo vriendelijk, het materiaal aan Acari, door den Gouvernements-Arts Dr. PH. F. KOPSTEIN, thans te Weltevreden bij Batavia, gedurende zijn verblijf op Ambon 1922 en 1923 verzameld, mij ter determineering

  1. Pesquisa de Rickettsia spp em carrapatos Amblyomma cajennense e Amblyomma dubitatum no Estado de São Paulo Survey of Rickettsia spp in the ticks Amblyomma cajennense and Amblyomma dubitatum in the State of São Paulo

    Directory of Open Access Journals (Sweden)

    Richard Campos Pacheco

    2009-06-01

    Full Text Available Foi pesquisada a presença de riquétsias em 3.545 carrapatos Amblyomma cajennense e 2.666 Amblyomma dubitatum. Através do teste de hemolinfa, reação em cadeia pela polimerase e isolamento de rickettsia em cultivo celular, todos os Amblyomma cajennense foram negativos, sendo que 634 (23,8% Amblyomma dubitatum mostraram-se infectados com Rickettsia bellii.The presence of rickettsial infection was surveyed in 3,545 Amblyomma cajennense ticks and 2,666 Amblyomma dubitatum ticks. Using the hemolymph test, polymerase chain reaction and isolation of Rickettsia in cell cultures, all of the Amblyomma cajennense were negative, whereas 634 (23.8% of the Amblyomma dubitatum ticks were shown to be infected with Rickettsia bellii.

  2. ACARI, CIDADE (MAIS LIMPA

    Directory of Open Access Journals (Sweden)

    Maria Luiza Medeiros Galvão

    2013-10-01

    Full Text Available Este trabalho tem por objetivo realizar uma breve reflexão acerca da concepção empírica de Acari como a cidade mais limpa do Brasil, assim referenciada na década de 70 do século XX. Como introdução, desenvolvemos considerações iniciais sobre cidade, tendo como recurso metodológico os conhecimentos adquiridos com a disciplina Arquitetura e Cidade no Brasil. Dando sequência ao texto, refletimos conceitualmente sobre cidade, espaço balizador para compreensão de Acari - cidade mais limpa; território, para compreensão da cidade como construção histórica; e o Ambiente, cujo propósito foi associar o tema do trabalho à sustentabilidade socioambiental. Utilizamos dois contextos: o primeiro de crise e divulgação do título cidade mais limpa. O segundo, dizendo respeito à legislação urbanística e códigos de postura elaborados nos períodos imperial e republicano, que ordenaram o território de Acari nos dois últimos séculos, marcando a tradição de asseio, limpeza e higiene urbanas.

  3. Tick (Acari: Ixodidae) infestations in cattle along Geba River basin in Guinea-Bissau.

    Science.gov (United States)

    Zúquete, Sara Tudela; Coelho, João; Rosa, Fernanda; Vaz, Yolanda; Cassamá, Bernardo; Padre, Ludovina; Santos, Dulce; Basto, Afonso P; Leitão, Alexandre

    2017-01-01

    Tick infestations are a major problem for animal production in tropical areas where prevention and control remain deficient. The present study sought to assess the awareness of traditional cattle producers towards the importance of ticks and aimed at the identification of tick species infesting bovines within the Geba River basin, Guinea-Bissau. Interviews with producers revealed that the majority directly correlates the presence of ticks with the occurrence of diseases in cattle. However, insufficient or inadequate control approaches prevail. A total of 337 ticks were collected on bovines at 18 different villages (10 during dry season, and 8 during rainy season). The tick species collected during the dry season were Rhipicephalus (Boophilus) geigyi (56.5%), followed by Amblyomma variegatum (23.3%), Rhipicephalus (Boophilus) annulatus (17.6%) and Hyalomma truncatum (1%). In the rainy season A. variegatum was the most collected (88.9%), followed by R. (Boophilus) geigyi (4.2%), R. (Boophilus) annulatus (3.4%), Rhipicephalus sanguineus group (2.8%) and H. truncatum (0.7%). To support species identification, segments of both cytochrome c oxidase I (COI) and 12S ribosomal RNA (12S) genes were sequenced and the data gathered were analysed by maximum likelihood and parsimony. Morphological and genetic data of individual specimens gathered in this study provide relevant information for future studies on tick population dynamics in the region. In addition, it led to a deeper characterization of R. sulcatus and a R. sanguineus-like specimen, exploring their genetic relationship with other R. sanguineus, which supports their classification as distinct species within R. sanguineus group.

  4. Resistance status of ticks (Acari; Ixodidae) to amitraz and cypermethrin acaricides in Isoka District, Zambia.

    Science.gov (United States)

    Muyobela, Jackson; Nkunika, Philip Obed Yobe; Mwase, Enala Tembo

    2015-12-01

    This study was designed to obtain data on the farmer's approach to tick control and to determine whether Rhipicephalus appendiculatus Neuman, Amblyomma variegatum (Fabricius), and Rhipicephalus (Boophilus) microplus (Canestrini) were resistant to amitraz and cypermethrin acaricides, in Isoka District, Zambia. Prevailing tick control practices were documented by administering a semi-structured questionnaire to 80 randomly selected smallholder livestock farmers from four agricultural camps (Longwe, Kantenshya, Kapililonga, and Ndeke) in Isoka District. Modified larval packet test (LPT) bioassay experiments were used to determine the resistance status of the common tick species against amitraz and cypermethrin acaricides. Fifty percent of respondents practiced chemical tick control with amitraz (27 %) and cypermethrin (23 %) being the acaricides in use, and were applied with knapsack sprayers. Less than 3 l of spray wash per animal was used which was considerably lower than the recommended delivery rate of 10 l of spray wash per animal. No significant susceptibility change to amitraz at 95 % confidence level was observed in R. appendiculatus and A. variegatum against amitraz. However, a significant change in the susceptibility of R. (Bo.) microplus tested with amitraz was detected at 95 % confidence. The test population had a lower susceptibility (LD50 0.014 %; LD90 0.023 %) than the reference population (LD50 0.013 %; LD90 0.020 %). The results indicated that resistance to amitraz was developing in R. (Bo.) microplus. For cypermethrin, no significant susceptibility change at 95 % confidence was observed in any of the three species and thus resistance to this chemical was not observed.

  5. First molecular detection of Rickettsia parkeri in Amblyomma tigrinum and Amblyomma dubitatum ticks from Uruguay.

    Science.gov (United States)

    Lado, Paula; Castro, Oscar; Labruna, Marcelo B; Venzal, José M

    2014-10-01

    Rickettsia parkei is the etiological agent of spotted fever in Uruguay, where is transmitted to humans by the tick Amblyomma triste. In the present study, ticks were collected from capybaras (Hydrochoerus hydrochaeris) and domestic dogs during 2011-2012 in different parts of Uruguay. Three out of 11 (27.3%) Amblyomma dubitatum ticks collected from capybaras, and 4 out of 6 (66.7%) Amblyomma tigrinum ticks collected from dogs were shown by molecular analyses to be infected by Rickettsia parkeri strain Maculatum 20. Until the present work, A. triste was the only tick species that was found infected by R. parkeri in Uruguay. This is the first report of R. parkeri infecting these two tick species in Uruguay, expanding the current distribution of this rickettsial pathogen in the country.

  6. Isolation of Ricket tsia bellii from Amblyomma ovale and Amblyomma incisum ticks from southern Brazil

    OpenAIRE

    Richard Pacheco; Simone Rosa; Leonardo Richtzenhain; Szabó, Matias P. J.; Labruna, Marcelo B.

    2008-01-01

    Objetivo. Aislar Rickettsias mediante cultivo celular a partir de muestras de garrapatas Amblyomma ovale y Amblyomma incisum del estado de São Paulo Materiales y métodos. A. ovale y A. incisum adultas de vida libre fueron colectadas en una área de selva tropical Atlántica en el estado de São Paulo, Brazil. Cada garrapata fue sometida a la prueba de hemolinfa, las garrapatas positivas en esta prueba fueron evaluadas con la técnica de shell vial con el propósito de aislar rickettsias en cultivo...

  7. Isolation of Ricket tsia bellii from Amblyomma ovale and Amblyomma incisum ticks from southern Brazil

    OpenAIRE

    Richard Pacheco; Simone Rosa; Leonardo Richtzenhain; Szabó, Matias P. J.; Labruna, Marcelo B.

    2008-01-01

    Objetivo. Aislar Rickettsias mediante cultivo celular a partir de muestras de garrapatas Amblyomma ovale y Amblyomma incisum del estado de São Paulo Materiales y métodos. A. ovale y A. incisum adultas de vida libre fueron colectadas en una área de selva tropical Atlántica en el estado de São Paulo, Brazil. Cada garrapata fue sometida a la prueba de hemolinfa, las garrapatas positivas en esta prueba fueron evaluadas con la técnica de shell vial con el propósito de aislar rickettsias en cultivo...

  8. Micropropagation of Codiaeum variegatum (L.) Blume and regeneration induction via adventitious buds and somatic embryogenesis.

    Science.gov (United States)

    Radice, Silvia

    2010-01-01

    Codiaeum variegatum (L) Blume cv. "Corazon de oro" and cv. "Norma" are successfully micropropagated when culture are initiated with explants taken from newly sprouted shoots. The establishment and multiplication steps are possible when 1 mg/L BA or 1 mg/L IAA and 3 mg/L 2iP are added to MS medium, according to the cultivar respectively selected.Adventive organogenesis and somatic embryogenesis are induced from leaf explants taken from in vitro buds of croton. On leaf-sectioned of "Corazon de oro" cultured in vitro, 1 mg/L BA stimulates continuous somatic embryos development and induces some shoots too. Replacing BA with 1 mg/L TDZ induces up to 100% bud regeneration in the same explants. On the other hand, leaf-sectioned of C. variegatum cv. Norma does not start somatic embryo differentiation if 1 mg/L TDZ is not added to the MS basal medium. Incipient callus is observed after 30 days of culture, and then, subculture to MS with 1 mg/L BA allows the same process to show on the "Corazon de oro" cultivar. Somatic embryos show growth arrest that is partially overcome by transfer to hormone-free basal medium with activated charcoal. Root induction is possible on basal medium plus 1 mg/L IBA. Plantlets in the greenhouse have variegated leaves true-to-type.

  9. An electrophoretic and cytological study of hybridisation between Aconitum napellus ssp. skerisorae (2n= 32) and A. variegatum (2n= 16). I Electrophoretic evidence

    OpenAIRE

    Roman Zieliński

    2014-01-01

    The variability of six enzymes in pure and mixed populations of Aconitum napellus and A. variegatum, both from the Tatra Mountains was analysed by means of electrophoresis on starch and polyacrylamide gels. The enzymes differentiating the studied species are: glutamate dehydrogenase, isocitrate dehydrogenase, esterases and peroxidases. A group of plants was isolated with phenotypes intermediate between A. napellus and A. variegatum. Among them were most probably both F1 and introgressive hybr...

  10. An electrophoretic and cytological study of hybridisation between Aconitum napellus ssp. skerisorae (2n= 32 and A. variegatum (2n= 16. I Electrophoretic evidence

    Directory of Open Access Journals (Sweden)

    Roman Zieliński

    2014-01-01

    Full Text Available The variability of six enzymes in pure and mixed populations of Aconitum napellus and A. variegatum, both from the Tatra Mountains was analysed by means of electrophoresis on starch and polyacrylamide gels. The enzymes differentiating the studied species are: glutamate dehydrogenase, isocitrate dehydrogenase, esterases and peroxidases. A group of plants was isolated with phenotypes intermediate between A. napellus and A. variegatum. Among them were most probably both F1 and introgressive hybrids.

  11. Genetic markers for the identification of two tick species, Amblyomma dissimile and Amblyomma rotundatum.

    Science.gov (United States)

    Lampo, M; Rangel, Y; Mata, A

    1997-06-01

    Genetic markers are described for 2 species of reptile and amphibian ticks, Amblyomma dissimile and Amblyomma rotundatum, by allozyme electrophoresis. Fixed allelic differences in 4 out of the 8 examined loci allowed the unequivocal separation of both of these species. A strong correlation was found between these genetic markers and the relative size of the spurs in coxae IV but not with the punctuation pattern of the scutum. Moreover, no overlap was found in the distribution of relative spur sizes between samples of both species. The percent polymorphic loci and the mean percent heterozygosity per locus for A. rotundatum was considerably lower than that for A. dissimile. Differences in the amount of genetic variability may be related to their modes of reproduction.

  12. New records of Amblyomma multipunctum and Amblyomma naponense from Ecuador, with description of A. multipunctum nymph.

    Science.gov (United States)

    Labruna, Marcelo B; Martins, Thiago F; Nunes, Pablo H; Costa, Francisco B; Portero, Francisco; Venzal, Jose M

    2013-12-01

    We provide new data for the ticks Amblyomma multipunctum and Amblyomma naponense from Ecuador. In addition, we describe the nymph of A. multipunctum for the first time. During December 2012, ticks were collected by dragging in forest trails of 1 locality at Puyo, Pastaza Province (elevation 979 m), and another locality at Papallacta, Napo Province (3,474 m). A total of 10 adults of A. naponense were collected at Puyo, whereas 27 adults and 3 nymphs of A. multipunctum were collected at Papallacta. Compared to sequences of a fragment of the mitochondrial 16S rDNA gene of adult and nymphal ticks, the sequence of an Amblyomma nymph was identical to the sequences generated from the A. multipunctum adults. The 3 collected nymphs (including the 1 used for molecular analysis) had the same morphotype, and were used for the first morphological description of the nymphal stage of A. multipunctum. Sequences generated from the A. naponense specimens were closest (97% identity by BLAST) to a corresponding sequence of A. naponense from Brazil, whereas the A. multipunctum sequences were closer to (90-91% identity) several Neotropical Amblyomma species. Herein, we provide just the second record of A. naponense in Ecuador, more than 100 yr after this tick was reported in this country. Adults and nymphs of A. multipunctum were found in highland, humid montane forest areas, in agreement with the only 2 previous reports of A. multipunctum in Ecuador and Colombia. No genetic differences were found among A. multipunctum ticks that presented significant morphological differences, suggesting intraspecific polymorphism in the adult stages of this species.

  13. Tick Bite by Nymphal Amblyomma testudinarium

    Science.gov (United States)

    Kim, Yeong Ho; Lee, Ji Hyun; Park, Young Min

    2016-01-01

    Ticks are parasites that usually suck the blood of wild or domestic animals; rarely, they ingest human blood and spread various febrile infectious diseases along with skin problems. Out of 40 cases of tick bite reported in Korea, only 3 were caused by nymphal ticks, and tick bites by nymphal Amblyomma testudinarium have not been reported previously. Herein, we report a rare case of tick bite by nymphal A. testudinarium. A 57-year-old woman presented with an asymptomatic solitary erythematous nodule on the left thigh that had been present for 6 days. The tick, which the patient removed from the lesion and brought to the hospital, was identified as a nymphal A. testudinarium. Doxycycline (200 mg) was used as treatment, and after seven days of use, the patient improved and no other lesions were detected. PMID:27904278

  14. Molecular detection of Rickettsia species in Amblyomma ticks collected from snakes in Thailand.

    Science.gov (United States)

    Sumrandee, Chalao; Hirunkanokpun, Supanee; Doornbos, Kathryn; Kitthawee, Sangvorn; Baimai, Visut; Grubhoffer, Libor; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2014-10-01

    Some reptile ticks are potential vectors of pathogens such as spotted fever group (SFG) rickettsiae. Here, we report for the first time in detail the molecular evidence, DNA sequences and phylogenetic studies, for the presence of Rickettsia spp. in Amblyomma ticks (Amblyomma helvolum and Amblyomma varanense) from snakes in Thailand. A total of 24 tick samples was collected from 4 snake species and identified. A phylogenetic analysis inferred from the partial sequences of the gltA gene indicated that the Rickettsia spp. from 2 Amblyomma helvolum and 1 Amblyomma varanense belong to the same group as the SFG rickettsiae, which are closely related to Rickettsia raoultii strains. In contrast, there was 1 Rickettsia sp. from Amblyomma helvolum grouped into the same clade with other SFG rickettsiae (Rickettsia tamurae, Rickettsia monacensis, and a Rickettsia endosymbiont of Amblyomma dubitatum from Brazil). However, another Rickettsia sp. from Amblyomma varanense was closely related to Rickettsia bellii and Rickettsia sp. strain RDa420 from Thailand. In addition, from phylogenetic results based on the 16S rRNA gene and a concatenated tree of the 3 genes (gltA, ompA, and ompB), we found what may be a novel SFG rickettsia species closely related to Rickettsia raoultii (from both Amblyomma varanense and Amblyomma helvolum). In conclusion, our findings are the first report on the presence of novel SFG rickettsiae in 2 snake tick species, Amblyomma varanense and Amblyomma helvolum in Thailand and in south-eastern Asia.

  15. ISOLATION OF Rickettsia bellii FROM Amblyomma ovale AND Amblyomma incisum TICKS FROM SOUTHERN BRAZIL

    Directory of Open Access Journals (Sweden)

    Richard Pacheco

    2008-08-01

    Full Text Available Objective. To isolate and characterize rickettsiae from the ticks Amblyomma ovale and Amblyomma incisum collected in the state of São Paulo. Materials and methods. Adult, free-living A. ovale and A. incisum were collected in an Atlantic rainforest area in the state of São Paulo, Brazil. Each tick was tested using the hemolymph assay; samples from positive ticks were placed in shell vials in order to isolate rickettsiae and subsequently grown in Vero cells. Amplification of three rickettsial genes (gltA, htrA and ompA was attempted using polymerase chain reaction (PCR for each isolate obtained. Amplicons were subsequently sequenced. Results. A total of 388 A. incisum and 50 A. ovale were collected. Only one A. incisum and one A. ovale were hemolymph-test positive. Rickettsiae were successfully isolated from these ticks; however establishment in Vero cell culture was successful only for the isolate from A. ovale. Bacterial contamination in the first cell passage of the A. incisum isolate precluded successful isolation of the organism. PCR products were obtained with the gltA and htrA primers for the two isolates, but no product was obtained with the ompA primers. By BLAST analysis, partial gltA and htrA sequences of isolates from A. ovale and A. incisum were similar to the corresponding sequences of R. bellii. Conclusions. This is the first report of R. bellii infecting A. incisum and the first successful isolation from A. ovale.

  16. Ecology and genetic variation of Amblyomma tonelliae in Argentina.

    Science.gov (United States)

    Tarragona, E L; Mangold, A J; Mastropaolo, M; Guglielmone, A A; Nava, S

    2015-09-01

    The ecology of Amblyomma tonelliae (Ixodida: Ixodidae), including its seasonal distribution and the development periods of each stage, was investigated during a study carried out over two consecutive years in northwestern Argentina. In addition, the genetic variation of this tick was studied through analyses of 16S rDNA sequences. Amblyomma tonelliae has a 1-year lifecycle characterized by a long pre-moult period in larvae with no development of morphogenetic diapause. Larvae peak in abundance during late autumn and early winter; nymphs peak in abundance in spring, and adults do so from late spring to early summer. Amblyomma tonelliae shows a marked ecological preference for the driest areas of the Chaco ecoregion. In analyses of 16S rDNA sequences in genes from different populations of A. tonelliae, values for nucleotide diversity and the average number of nucleotide differences showed genetic diversity within this species to be low. No significant differences were found in comparisons among populations.

  17. Bacteria associated with Amblyomma cajennense tick eggs

    Directory of Open Access Journals (Sweden)

    Erik Machado-Ferreira

    2015-01-01

    Full Text Available AbstractTicks represent a large group of pathogen vectors that blood feed on a diversity of hosts. In the Americas, the Ixodidae ticks Amblyomma cajennense are responsible for severe impact on livestock and public health. In the present work, we present the isolation and molecular identification of a group of culturable bacteria associated with A. cajennense eggs from females sampled in distinct geographical sites in southeastern Brazil. Additional comparative analysis of the culturable bacteria from Anocentor nitens, Rhipicephalus sanguineus and Ixodes scapularis tick eggs were also performed. 16S rRNA gene sequence analyses identified 17 different bacterial types identified as Serratia marcescens, Stenotrophomonas maltophilia, Pseudomonas fluorescens, Enterobacter spp., Micrococcus luteus, Ochrobactrum anthropi, Bacillus cereus and Staphylococcus spp., distributed in 12 phylogroups. Staphylococcus spp., especially S. sciuri,was the most prevalent bacteria associated with A. cajennenseeggs, occurring in 65% of the samples and also frequently observed infecting A. nitens eggs. S. maltophilia, S. marcescens and B. cereus occurred infecting eggs derived from specific sampling sites, but in all cases rising almost as pure cultures from infected A. cajennense eggs. The potential role of these bacterial associations is discussed and they possibly represent new targets for biological control strategies of ticks and tick borne diseases.

  18. An electrophoretic and cytological study of hybridisation between Aconitum napellus ssp. skerisorae (2n= 32 and A. variegatum (2n= 16. II. Cytological evidence

    Directory of Open Access Journals (Sweden)

    Roman Zieliński

    2014-01-01

    Full Text Available The number of chromosomes was determined in mitosis, the course of meiosis was analysed and the degree of pollen viability determined in plants with intermediate enzymatic phenotypes between Aconitum napellus and A. variegatum. One allotriploid plant was found with 2n=24 and a group of plants with 2n=32 showing disturbances in mitosis and meiosis. In mitosis somatic reduction and polysomaty were observed and in meiosis monads, diads, triads and polyads were present. These plants are considered as introgressive hybrids arising owing to a small scale gene flow from A. variegatum to A. napellus.

  19. Aislamiento de Rickettsia bellii a partir de garrapatas Amblyomma ovale y Amblyomma incisum procedentes del sur de Brasil

    OpenAIRE

    PACHECO, Richard; ROSA, Simone; Richtzenhain,Leonardo José; Szabó,Matias Pablo Juan; LABRUNA, Marcelo Bahia

    2008-01-01

    Objective. To isolate and characterize rickettsiae from the ticks Amblyomma ovale and Amblyomma incisum collected in the state of São Paulo. Materials and methods. Adult, free-living A. ovale and A. incisum were collected in an Atlantic rainforest area in the state of São Paulo, Brazil. Each tick was tested using the hemolymph assay; samples from positive ticks were placed in shell vials in order to isolate rickettsiae and subsequently grown in Vero cells. Amplification of three rickettsial g...

  20. Rickettsia bellii infecting Amblyomma sabanerae ticks in El Salvador.

    Science.gov (United States)

    Barbieri, Amália R M; Romero, Luis; Labruna, Marcelo B

    2012-07-01

    Four Amblyomma sabanerae ticks collected from a turtle (Kinosternon sp.) in San Miguel, El Salvador, were found by molecular analysis to be infected by Rickettsia bellii. We provide the first report of Rickettsia bellii in Central America, and the first report of a Rickettsia species in El Salvador.

  1. New Records of Ixodes affinis (Acari: Ixodidae) Parasitizing Avian Hosts in Southeastern Virginia.

    Science.gov (United States)

    Heller, Erin L; Wright, Chelsea L; Nadolny, Robyn M; Hynes, Wayne L; Gaff, Holly D; Walters, Eric L

    2016-03-01

    Ixodes affinis Neumann (Acari: Ixodidae) is a hard-bodied tick species distributed throughout much of the southeastern United States. Although I. affinis does not parasitize humans, it is a competent vector of Borrelia burgdorferi sensu stricto, the causative-agent of Lyme disease, and thus contributes to the enzootic maintenance of this pathogen. This study presents evidence of I. affinis parasitizing five new host passerine species. During 2012-2014, 1,888 birds were captured and examined for ticks, and 18 immature I. affinis were collected from 12 birds-six Carolina Wrens (Thyrothorus ludovicianus); two Brown Thrashers (Toxostoma rufum); and one American Robin (Turdus migratorius), Eastern Towhee (Pipilo erythrophthalmus), Northern Cardinal (Cardinalis cardinalis), and White-throated Sparrow (Zonotrichia albicollis). Of 15 larvae and 3 nymphs collected, one nymph tested positive for B. burgdorferi DNA. I. affinis was found co-feeding on birds with immature Amblyomma americanum (L.), Ixodes brunneus Koch, Ixodes dentatus Marx, Ixodes scapularis Say, and Haemaphysalis leporispalustris Packard. The results of this research provide a better understanding of I. affinis hosts and identify avian taxa that may play a role in the maintenance and dispersal of this tick species.

  2. Paper chromatography of anthocyanins in two species of Aconitum from the Tatry .Mts.: A. variegatum (L.) Rchb., and A. napellus ssp. skerisorae (Gayer) Seitz.

    OpenAIRE

    Krzakowa, M.; R. Zieliński; Szweykowski, J.

    2015-01-01

    The results of studies on phenolic compounds occurence and variation in the two Aconitum species were reported in our previous paper (Szweykowski, Krzakowa, 1977a and b). A modified extraction method allowed us to get additional data on anthocyanin variation in flowers of the same species. In addition one albino plant of A. variegatum was also investigated in this respect.

  3. Paper chromatography of anthocyanins in two species of Aconitum from the Tatry .Mts.: A. variegatum (L. Rchb., and A. napellus ssp. skerisorae (Gayer Seitz.

    Directory of Open Access Journals (Sweden)

    M. Krzakowa

    2015-01-01

    Full Text Available The results of studies on phenolic compounds occurence and variation in the two Aconitum species were reported in our previous paper (Szweykowski, Krzakowa, 1977a and b. A modified extraction method allowed us to get additional data on anthocyanin variation in flowers of the same species. In addition one albino plant of A. variegatum was also investigated in this respect.

  4. Ticks (Acari: Ixodida: Argasidae, Ixodidae infesting humans in Northwestern Córdoba province, Argentina Garrapatas infestando humanos en el noroeste de la provincia de Córdoba, Argentina

    Directory of Open Access Journals (Sweden)

    Nava Santiago

    2006-06-01

    Full Text Available Ticks infesting humans were collected from September 2004 to August 2005 in Northwestern Córdoba in an area with a southern limit in the locality of Dean Funes (30°25´S 64°20´W and San José de las Salinas (30°00´S 64°37´W in the North. The collections consisted in ticks found attached on man obtained from three sources: 1 specimens fixed on two workers during two successive days per month of field work in the northern part of the area which belongs to Western Chaco district of the phytogeographical Chaco domain, 2 ticks attached to a man working in a farm close to Dean Funes in the Chaco Serrano district of the Chaco domain and, 3 ticks collected from a collaborator visiting daily a suburban property with dogsin the vicinities of Dean Funes. Most ticks collected were larvae, nymphs and adults of Amblyomma neumanni from the Chaco Serrano district where a nymph of Otobius megnini was also found on man. Adults of Amblyomma parvum and Amblyomma tigrinum were detected feeding on humans in the Western Chaco district and in the property close to Dean Funes, respectively. Amblyomma neumanni was absent on man from December to April while most specimens of A. parvum and A. tigrinum were collected during summer. Their role as potential vector of ticktransmitted diseases in the area is unknown.Se recolectaron garrapatas (Acari: Ixodida: Argasidae, Ixodidae infestando humanos entre septiembre de 2004 y agosto de 2005 en un área del noroeste de Córdoba cuyo límite al sur es la localidad Deán Funes (30º25´S 64°20´W y el límite al norte es la localidad de San José de las Salinas (30°00´S 64°37´W. Las colecciones consistieron en garrapatas fijadas a humanos obtenidas de tres fuentes: 1 garrapatas fijadas sobre dos trabajadores durante dos días sucesivos por mes de trabajo de campo en la parte norte del área, la cual pertenece al distrito chaqueño occidental del dominio fitogeográfico del Chaco, 2 garrapatas fijadas a un trabajador en

  5. Rickettsia infection in Amblyomma tonelliae, a tick species from the Amblyomma cajennense complex.

    Science.gov (United States)

    Tarragona, Evelina L; Cicuttin, Gabriel L; Mangold, Atilio J; Mastropaolo, Mariano; Nazarena De Salvo, M; Nava, Santiago

    2015-03-01

    The present study was performed to evaluate the Rickettsia infection in Amblyomma tonelliae ticks from Argentina. All ticks were subjected to DNA extraction and tested by a battery of PCRs to amplify fragments of four rickettsial genes, 23S-5S, gltA, ompA and htrA. Two ticks were positive. The Rickettsia detected in one tick represents a new lineage which is named Rickettsia sp. strain El Tunal. This new strain belongs to the canadensis group because it is closely related to Rickettsia monteiroi, Rickettsia canadensis and Candidatus "Rickettsia tarasevichiae". They clustered together on a high supported clade with both gltA and htrA genes. The other positive tick was infected with Candidatus "Rickettsia amblyommii". The results presented in this study constitute the first records of Rickettsia infection in A. tonelliae ticks. However, the medical relevance of these findings should be considered cautiously because the pathogenicity of Rickettsia sp. strain El Tunal and Candidatus "R. amblyommii" remains undetermined.

  6. Atlas van de Nederlandse watermijten (Acari: Hydrachnidia)

    NARCIS (Netherlands)

    Smit, H.; Hammen, van der H.

    2000-01-01

    Atlas of the Dutch water mites (Acari: Hydrachnidia) Few biogeographic studies have been published on water mites. Only Lundblad (1962) has published an atlas of the Swedish water mites. So far, there are no complete publications on the distribution of Dutch water mites. Acarologists who worked on D

  7. Review of cattle ticks (Acari, Ixodida) in Ivory Coast and geographic distribution of Rhipicephalus (Boophilus) microplus, an emerging tick in West Africa.

    Science.gov (United States)

    Boka, O M; Achi, L; Adakal, H; Azokou, A; Yao, P; Yapi, Y G; Kone, M; Dagnogo, K; Kaboret, Y Y

    2017-04-01

    The exotic tick Rhipicephalus (Boophilus) microplus was discovered in Ivory Coast in 2007 and then gradually in other countries in West Africa. It is known to induce significant losses in farming and to replace other species of the same genus. In order to contribute to improve health and productivity of cattle in Ivory Coast regarding the emergence of this dreaded tick, a study was conducted to determine the current geographic distribution of the tick R. (B.) microplus and review cattle ticks in general. To this end, 23,460 ticks were collected from 180 farms located throughout the country. Ten species of ticks belonging to the genus Rhipicephalus (including those of the subgenus Boophilus), Hyalomma and Ambyomma were identified. It was found that the exotic tick R. (B.) microplus has invaded the entire Ivorian territory and is now the main cattle tick (63.6% of ticks collected), followed by Amblyomma variegatum that remains still dominant in the North. The population of indigenous species of Rhipicephalus (Boophilus) is in drastic decline.

  8. An electrophoretic and cytological study of hybridisation between Aconitum napellus ssp. skerisorae (2n= 32) and A. variegatum (2n= 16). II. Cytological evidence

    OpenAIRE

    Roman Zieliński

    2014-01-01

    The number of chromosomes was determined in mitosis, the course of meiosis was analysed and the degree of pollen viability determined in plants with intermediate enzymatic phenotypes between Aconitum napellus and A. variegatum. One allotriploid plant was found with 2n=24 and a group of plants with 2n=32 showing disturbances in mitosis and meiosis. In mitosis somatic reduction and polysomaty were observed and in meiosis monads, diads, triads and polyads were present. These plants are considere...

  9. Cryptic speciation in the Acari: a function of species lifestyles or our ability to separate species?

    Science.gov (United States)

    There are approximately 55,000 described Acari species, accounting for almost half of all known Arachnida species, but total estimated Acari diversity is reckoned to be far greater. One important source of currently hidden Acari diversity is cryptic speciation, which poses challenges to taxonomists ...

  10. Elemol and Amyris Oil Repel the Ticks Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae) in Laboratory Bioassays

    Science.gov (United States)

    The essential oil from Amyris balsamifera (Rutaceae) and elemol, a principal constituent of the essential oil of Osage orange, Maclura pomifera (Moraceae) were evaluated in in vitro and in vivo laboratory bioassays for repellent activity against host-seeking nymphs of the blacklegged tick, Ixodes sc...

  11. Efficacy of Plant-Derived and Synthetic Compounds on Clothing as Repellents Against Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae)

    Science.gov (United States)

    2012-01-01

    efÞcacy of the repellent deet against Aedes aegypti . J. Am. Mosq. Control Assoc. 14: 178Ð182. Robbins, P. J., and M. G. Cherniack. 1986. Review of...VECTOR CONTROL , PEST MANAGEMENT, RESISTANCE, REPELLENTS Efficacy of Plant-Derived and Synthetic Compounds on Clothing as Repellents Against Ixodes...4 Division of Vector-BorneDiseases, National Center for Emerging and Zoonotic Infectious Diseases, Centers for Disease Control and Prevention

  12. Infection of the Gulf Coast Tick, Amblyomma Maculatum (Acari: Ixodidae), with Rickettsia Parkeri: First Report from the State of Delaware

    Science.gov (United States)

    2013-03-31

    ecology, distribution, and emergence as an arthropod of medical and veterinary impor- tance. Journal of Medical Entomology , 47, 707–722. http... Medical Research Center, Viral and Rickettsial Diseases Department, 503 Grant Avenue, Silver Spring, MD 20910- 7500, U.S.A. 3 Armed Forces Pest...specimens were immediately preserved in 100% ethanol and later transported to the Naval Medical Research Center, Silver Spring, MD, where

  13. Rickettsia amblyommii infecting Amblyomma sculptum in endemic spotted fever area from southeastern Brazil

    OpenAIRE

    Emília de Carvalho Nunes; Vinicius Figueiredo Vizzoni; Daniel Leal Navarro; Felipe Campos de Melo Iani; Liliane Silva Durães; Erik Daemon; Carlos Augusto Gomes Soares; Gilberto Salles Gazeta

    2015-01-01

    The Rickettsia bacteria include the aetiological agents for the human spotted fever (SF) disease. In the present study, a SF group Rickettsia amblyommii related bacterium was detected in a field collected Amblyomma sculptum (Amblyomma cajennense species complex) tick from a Brazilian SF endemic site in southeastern Brazil, in the municipality of Juiz de Fora, state of Minas Gerais. Genetic analysis based on genes ompA, ompB and htrA showed that the detected strain, named R. amblyo...

  14. Amblyomma americanum: a potential vector of human ehrlichiosis.

    Science.gov (United States)

    Anderson, B E; Sims, K G; Olson, J G; Childs, J E; Piesman, J F; Happ, C M; Maupin, G O; Johnson, B J

    1993-08-01

    Polymerase chain reaction primers specific for Ehrlichia chaffeensis were used to amplify DNA from extracts of pooled ticks. Amplification was performed on extracts from 140 pools (1,579 total ticks) consisting of three tick genera collected from five states. The characteristic 389-basepair product was observed after amplification of extracts from seven different pools of adult Amblyomma americanum (117 pools, 1,462 ticks), but not from pools of nymphs. No specific product was observed after amplification of 20 pools (105 ticks) of Dermacentor variabilis and three pools of Ixodes scapularis (12 ticks). Ehrlichia chaffeensis was present in A. americanum at a minimum frequency of > or = 0.48%, suggesting that A. americanum may be a vector of human ehrlichiosis.

  15. The ticks (Acari: Ixodida: Argasidae, Ixodidae) of Paraguay

    Science.gov (United States)

    2007-01-01

    Brazil, French Guiana, Surinam and Uruguay. Amblyomma rotundatum Koch. Although there have been no published reports of this reptile and amphibian ...Nicaragua, Surinam and the islands of the Greater and Lesser Antilles. Both species have been found in Colombia, Panama and Venezuela. IXODIDAE Murray...Guiana, Surinam and Uruguay (Guglielmone et al., 2003c). Amblyomma auricularium (Conil). Massi Pallarés and Benı́tez Usher (1982) reported this tick from

  16. Description of Amblyomma romitii in Capybara (Hydrochoerus hydrochaeris in São Francisco do Guapor, Rondônia

    Directory of Open Access Journals (Sweden)

    R. T. Kemper

    2013-03-01

    Full Text Available Abstract: The present work report the finding of the tick species Amblyomma romitii Tonelli Rondelli,1939, in S Francisco do Guaporcity, west of Rondia state, in the mesoregion Madeira-Guapor The specimen was found in a capybara (Hydrochoerus hydrochaeris found dead on a farm in the region.Keywords: parasitism, Amblyomma, Rondônia, capybara

  17. Description of Amblyomma romitii in Capybara (Hydrochoerus hydrochaeris) in São Francisco do Guapor, Rondônia

    OpenAIRE

    2013-01-01

    Abstract: The present work report the finding of the tick species Amblyomma romitii Tonelli Rondelli,1939, in S Francisco do Guaporcity, west of Rondia state, in the mesoregion Madeira-Guapor The specimen was found in a capybara (Hydrochoerus hydrochaeris) found dead on a farm in the region.Keywords: parasitism, Amblyomma, Rondônia, capybara

  18. Spotted fever group rickettsiae in Amblyomma ticks likely to infest humans in rural areas from northwestern Argentina.

    Science.gov (United States)

    Saracho Bottero, María N; Tarragona, Evelina L; Nava, Santiago

    2015-01-01

    This work was performed to detect Rickettsia species of the spotted fever group in Amblyomma ticks likely to infest humans in rural areas from northwestern Argentina. Free-living ticks were collected and determined as Amblyomma tigrinum, Amblyomma neumanni and Amblyomma tonelliae. Rickettsia infection was determined by polymerase chain reactions which amplify fragments of the rickettsial genes gltA and ompA. A high frequency (35/44, 79.5%) of Candidatus "Rickettsia andeanae" was observed in A. tigrinum ticks, and Candidatus "Rickettsia amblyommii" was found in three out of 14 nymphs of A. neumanni. All 14 Amblyomma tonelliae ticks were negative for rikettsiae. The infection with spotted fever group rickettsiae in ticks aggressive for humans reveals the potential risk of exposure to tick-borne pathogens of people inhabiting rural areas of northwestern Argentina.

  19. Disease agents in Amblyomma americanum from northeastern Georgia.

    Science.gov (United States)

    Varela, A S; Moore, V A; Little, S E

    2004-07-01

    Amblyomma americanum (lone star tick) is known or suspected to vector several organisms that are implicated as human pathogens, including Ehrlichia chaffeensis, E. ewingii, and Borrelia lonestari. These three agents have also been detected in white-tailed deer (Odocoileus virginianus). Because northeastern Georgia has a high abundance of both lone star ticks and white-tailed deer, and one of these organisms, E. chaffeensis, is already known to be endemic in the area, we assayed individual adult A. americanum, collected during the spring of 2001, 2002, and 2003, for these three organisms. A total of 400 ticks were dissected and tissues assayed by polymerase chain reaction (PCR) using Ehrlichia species-specific and Borrelia genus-wide primers. Of ticks tested, 2.0% (8/398) had evidence of E. chaffeensis, 4.8% (19/398) had evidence of E. ewingii, and 1.0% (4/398) had evidence of B. lonestari. Borrelia sp. spirochetes were also visualized by an indirect fluorescent antibody test, using an anti-flagellin monoclonal antibody (H9724), in a total of 10.7% (32/300) of ticks tested in 2003. These results reconfirm the presence of E. chaffeensis and establish evidence of E. ewingii and B. lonestari in questing adult A. americanum ticks from northeastern Georgia. Detection of at least two of the three organisms in ticks collected each year suggests that people in northeastern Georgia are at risk of infection with these organisms.

  20. Rickettsia amblyommii infecting Amblyomma sculptum in endemic spotted fever area from southeastern Brazil.

    Science.gov (United States)

    Nunes, Emília de Carvalho; Vizzoni, Vinicius Figueiredo; Navarro, Daniel Leal; Iani, Felipe Campos de Melo; Durães, Liliane Silva; Daemon, Erik; Soares, Carlos Augusto Gomes; Gazeta, Gilberto Salles

    2015-12-01

    The Rickettsia bacteria include the aetiological agents for the human spotted fever (SF) disease. In the present study, a SF group Rickettsia amblyommii related bacterium was detected in a field collected Amblyomma sculptum (Amblyomma cajennense species complex) tick from a Brazilian SF endemic site in southeastern Brazil, in the municipality of Juiz de Fora, state of Minas Gerais. Genetic analysis based on genes ompA,ompB and htrA showed that the detected strain, named R. amblyommii str. JF, is related to the species R. amblyommii.

  1. Rickettsia amblyommii infecting Amblyomma sculptum in endemic spotted fever area from southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Emília de Carvalho Nunes

    2015-12-01

    Full Text Available The Rickettsia bacteria include the aetiological agents for the human spotted fever (SF disease. In the present study, a SF groupRickettsia amblyommii related bacterium was detected in a field collected Amblyomma sculptum (Amblyomma cajennense species complex tick from a Brazilian SF endemic site in southeastern Brazil, in the municipality of Juiz de Fora, state of Minas Gerais. Genetic analysis based on genes ompA,ompB and htrA showed that the detected strain, named R. amblyommii str. JF, is related to the speciesR. amblyommii.

  2. Notas de ixodologia: IX. O complexo ovale do gênero Amblyomma

    Directory of Open Access Journals (Sweden)

    Henrique Aragão

    1961-07-01

    Full Text Available It was impossible to confirm either WARBUTON's conservative nor TONELLI RONDELLI's opposite belief on the number of valid species after studying many lots of ticks of the ovale group, mainly from Brazil. Two species are recognized: Amblyomma ovale Koch, 1844 and Amblyomma aureolatum (Pallas, 1772, corresponding respectively to A. fossum Neumann, 1898 and A. stratum Koch, 1844. A list of synonyms is presented. Both species are redescribed and intraspecific morphological variation show to be the cause of the multiplication of species by those working with insufficient material. Color plates of both species are presented and hosts and localities of captures are recorded.

  3. Rickettsia parkeri infecting free-living Amblyomma triste ticks in the Brazilian Pantanal.

    Science.gov (United States)

    Melo, Andréia L T; Alves, Alvair S; Nieri-Bastos, Fernanda A; Martins, Thiago F; Witter, Rute; Pacheco, Thábata A; Soares, Herbert S; Marcili, Arlei; Chitarra, Cristiane S; Dutra, Valéria; Nakazato, Luciano; Pacheco, Richard C; Labruna, Marcelo B; Aguiar, Daniel M

    2015-04-01

    The present study evaluated the infection of rickettsiae in 151 Rhipicephalus sanguineus, 59 Amblyomma ovale, 166 Amblyomma triste, one Amblyomma dissimile and four Amblyomma dubitatum ticks collected in the municipality of Poconé, State of Mato Grosso, within the Pantanal biome of Brazil. Ticks were individually processed by the hemolymph test with Gimenez staining, isolation of rickettsia in Vero cell culture by the shell vial technique, and polymerase chain reaction (PCR) targeting the citrate synthase rickettsial gene. Through the shell vial technique, rickettsiae were successfully isolated and established in Vero cell culture from one free-living A. triste female tick, which previously showed to contain Rickettsia-like organisms by the hemolymph test. Molecular characterization of the rickettsial isolate was achieved through DNA partial sequences of three rickettsial genes (gltA, ompA, ompB), which showed to be all 100% identical to Rickettsia parkeri. After testing all ticks by PCR, the frequency of R. parkeri infection was 7.23% (12/166) in A. triste adult ticks. The remaining ticks were negative by PCR. This is the first report of in vitro isolation of R. parkeri in the Pantanal biome, confirming the occurrence of this emerging rickettsial pathogen in this natural area of South America.

  4. Neuronal projections from the Haller's organ and palp sensilla to the synganglion of Amblyomma americanum

    Science.gov (United States)

    The present study was conducted to elucidate the neuronal pathways between peripheral olfactory and taste sensilla and the synganglion in an Ixodidae tick species. The tarsus of the front legs (olfactory nerves) and the fourth palpal segment (gustatory nerves) of unfed Amblyomma americanum males and...

  5. In vitro repellency of DEET against the ticks Rhipicephalus sanguineus sensu lato and Amblyomma sculptum

    Science.gov (United States)

    Rhipicephalus sanguineus sensu lato and Amblyomma sculptum can parasite humans and domestic animals and are vectors of pathogens, including zoonoses. Repellents are an important tool of tick control. This study aimed to compare the efficacy of N,N-diethyl- 3-methylbenzamide (DEET), a standard repell...

  6. Verified and potential pathogens of predatory mites (Acari: Phytoseiidae)

    NARCIS (Netherlands)

    Schütte, C.; Dicke, M.

    2008-01-01

    Several species of phytoseiid mites (Acari: Phytoseiidae), including species of the genera Amblyseius, Galendromus, Metaseiulus, Neoseiulus, Phytoseiulus and Typhlodromus, are currently reared for biological control of various crop pests and/or as model organisms for the study of predator¿prey inter

  7. First record of Typhlodromus (Anthoseius transvaalensis (Acari: Phytoseiidae from Argentina

    Directory of Open Access Journals (Sweden)

    Claudia CÉDOLA

    2014-01-01

    Full Text Available Se cita por primera vez de la Argentina a Typhlodromus (Anthoseius transvaalensis Nesbitt (Acari: Phytoseiidae sobre Capsicum annuum L. y Lycopersicum esculentum L. (Solanaceae en la localidad de Concordia, Entre Ríos. Se proporcionan datos morfométricos de los ejemplares argentinos.

  8. Genetic characterization of Coxiella burnetii in Amblyomma varigatum ticks from North-central Nigeria: public health importance

    Directory of Open Access Journals (Sweden)

    Ndudim Isaac Ogo

    2013-09-01

    Full Text Available Aim: The purpose of this pilot study was to genetically identify and characterize Coxiella burnetii from Amblyommavarigatum ticks collected on cattle in North central Nigeria.Materials and Methods: A total of 40 partially fed ticks morphologically identified as adult A. variegatum ticks collectedfrom cattle owned by Fulani pastoralists were evaluated for the presence of C. burnetii using PCR, cloning, and sequencing ofthe heat shock polypeptide gene htpB.Results: C. burnetii DNAwas detected in 10 (25% of the ticks analyzed. Sequences for the C. burnetii gene htpB detected inour samples had 99-100% identity to all other C. burnetii that have been described and that are deposited in the GenBankdatabase. Phylogenetic analysis using neighbor-joining method indicates the clustering of C. burnetii sequences from ourstudy areas with those collected from Oyo state, South-western Nigeria and Spain.Conclusion: This study shows a high infection rate of C. burnetii in A. variegatum ticks in the study areas. Phylogeneticinferences indicates that the strain of C. burnetii found in the North central states of Plateau and Nasarawa were same as thosepreviously reported in the South western state of Oyo. The presence of this pathogen in naturally occurring A. variegatum tickpopulations could present an additional risk of Q-fever disease to humans, especially to the pastoralists that are closelyassociated with their animals and are easily exposed to tick bites. Therefore, further studies are needed to assess thecompetence of A. variegatum ticks as vectors of C. burnetii pathogens.

  9. Two novel non-cationic defensin-like antimicrobial peptides from haemolymph of the female tick, Amblyomma hebraeum.

    Science.gov (United States)

    Lai, Ren; Lomas, Lee O; Jonczy, Jan; Turner, Philip C; Rees, Huw H

    2004-01-01

    Two non-cationic defensin-like antimicrobial peptides, named Amblyomma defensin peptide 1 and Amblyomma defensin peptide 2, were identified from the hard tick, Amblyomma hebraeum, by a combination of suppression subtractive hybridization for differentially expressed genes and proteomics. cDNA clones encoding each of these two defensin-like antimicrobial peptides were isolated from the differentially expressed cDNA library of the tick synganglia (central nervous system). The preproproteins deduced from the cDNA sequences each have 92 amino acid residues. Amblyomma defensin peptide 2 was purified from the haemolymph of fed female ticks. The purified peptide displayed antibacterial activity against Gram-negative and Gram-positive bacteria. Amblyomma defensin peptide 1 was further identified by protein chip capture combined with SELDI-TOF (surface-enhanced laser desorption/ionization-time-of-flight) MS. By screening for differentially expressed proteins, it was found that the expression of Amblyomma defensin peptide 1 was upregulated during 4 days post-feeding. Our findings firstly provide two defensin-like antimicrobial peptides that are particularly novel in being anionic, together with corresponding cDNA sequences, in hard ticks, and prove that the combination of suppression subtractive hybridization and protein profiling is a powerful method to study differentially expressed proteins, especially for organisms without available genome sequence information. PMID:14705963

  10. Characterization of the Bacterial Communities of Life Stages of Free Living Lone Star Ticks (Amblyomma americanum)

    OpenAIRE

    Amanda Jo Williams-Newkirk; Rowe, Lori A.; Mixson-Hayden, Tonya R.; Dasch, Gregory A.

    2014-01-01

    The lone star tick (Amblyomma americanum) is an abundant and aggressive biter of humans, domestic animals, and wildlife in the southeastern-central USA and an important vector of several known and suspected zoonotic bacterial pathogens. However, the biological drivers of bacterial community variation in this tick are still poorly defined. Knowing the community context in which tick-borne bacterial pathogens exist and evolve is required to fully understand the ecology and immunobiology of the ...

  11. Geographic distribution and genetic diversity of the Ehrlichia sp. from Panola Mountain in Amblyomma americanum

    OpenAIRE

    Williamson Phillip C; Garrison Laurel E; Yabsley Michael J; Mixson Tonya R; Stromdahl Ellen Y; Loftis Amanda D; Fitak Robert R; Fuerst Paul A; Kelly Daryl J; Blount Keith W

    2008-01-01

    Abstract Background A novel Ehrlichia, closely related to Ehrlichia ruminantium, was recently discovered from Panola Mountain State Park, GA, USA. We conducted a study to determine if this agent was recently introduced into the United States. Methods We developed a sensitive PCR assay based on the conserved gltA (citrate synthase) gene and tested DNA samples extracted from 1964 field-collected and 1835 human-biting Amblyomma americanum from 23 eastern states of the USA. Results The novel agen...

  12. Discovery of filarial nematode DNA in Amblyomma americanum in Northern Virginia

    OpenAIRE

    Henning, Tyler C.; Orr, John M.; Smith, Joshua D.; Arias, Jorge R.; Rasgon, Jason L.; Norris, Douglas E.

    2015-01-01

    Ticks collected in 2011 were screened for the presence of filarial nematode genetic material, and positive samples were sequenced for analysis. Monanema-like filarial nematode DNA was recently discovered in Amblyomma americanum in northern Virginia, marking the first time genetic material from this parasite has been discovered in ticks in the state. Phylogenetic analysis revealed that this material was directly related to a previously discovered filarial nematode in A. americanum populations ...

  13. Primary isolation of spotted fever group rickettsiae from Amblyomma cooperi collected from Hydrochaeris hydrochaeris in Brazil

    Directory of Open Access Journals (Sweden)

    Elba Regina Sampaio de Lemos

    1996-06-01

    Full Text Available This paper reports the first isolation of a spotted fever group rickettsia from an Amblyomma cooperi ixodid collected from a capybara (Hydrochaeris hydrochaeris in an endemic area of spotted fever in the County of Pedreira, State of São Paulo, Brazil. Isolation was performed in Vero cell culture and submitted to immunofluorescence, using antibody from Rickettsia rickettsii-positive human serum.

  14. Infection of Amblyomma ovale by Rickettsia sp. strain Atlantic rainforest, Colombia.

    Science.gov (United States)

    Londoño, Andrés F; Díaz, Francisco J; Valbuena, Gustavo; Gazi, Michal; Labruna, Marcelo B; Hidalgo, Marylin; Mattar, Salim; Contreras, Verónica; Rodas, Juan D

    2014-10-01

    Our goal was to understand rickettsial spotted fevers' circulation in areas of previous outbreaks reported from 2006 to 2008 in Colombia. We herein present molecular identification and isolation of Rickettsia sp. Atlantic rainforest strain from Amblyomma ovale ticks, a strain shown to be pathogenic to humans. Infected ticks were found on dogs and a rodent in Antioquia and Córdoba Provinces. This is the first report of this rickettsia outside Brazil, which expands its known range considerably.

  15. Analysis of Amblyomma sculptum haplotypes in an area endemic for Brazilian spotted fever.

    Science.gov (United States)

    Bitencourth, K; Voloch, C M; Serra-Freire, N M; Machado-Ferreira, E; Amorim, M; Gazêta, G S

    2016-09-01

    Amblyomma sculptum (Ixodida: Ixodidae) Berlese, 1888, a member of the Amblyomma cajennense complex, is the major vector of Brazilian spotted fever (BSF) in southeastern Brazil. In this study, the genetic diversity of A. sculptum populations in the state of Rio de Janeiro (RJ), Brazil, was investigated because genetic variability in tick populations may be related to vector competence. Samples of A. sculptum from 19 municipalities in 7 regions of RJ were subjected to DNA extraction, amplification and sequencing of D-loop, cytochrome oxidase II and 12S rDNA mitochondrial genes. These sequences were used to map the genetic diversity of this tick. Amblyomma sculptum populations are genetically diverse in RJ, especially in the South Centre and Highland regions. Few unique haplotypes were observed in all populations, and the majority of genetic variation found was among ticks within each population. Phylogenetic reconstruction reinforced the assumption that all the haplotypes identified in RJ belong to A. sculptum. However, some RJ haplotypes are closer to A. sculptum from Argentina than to A. sculptum from elsewhere in Brazil. In RJ, A. sculptum has high genetic diversity, although little genetic differentiation. Observations also indicated a high level of gene flow among the studied populations and no evidence of population structure according to region in RJ.

  16. Occurrence of Amblyomma longirostre in Ramphastos dicolorus in Southern Brazil Ocorrência de Amblyomma longirostre em Ramphastos dicolorus no Sul do Brasil

    Directory of Open Access Journals (Sweden)

    João Fabio Soares

    2009-06-01

    Full Text Available The species Amblyomma longirostre Koch, 1844 is poorly known in the state of Rio Grande do Sul. Usually the adult stage could be found on Sphigurus spp. and the immatures on birds (Passeriformes. Although A. longirostre is distributed in the Neotropical region, from Panama to Uruguay, it also occurs in Central America and the United States. The aim of this study was to report that Ramphastos dicolorus Linnaeus 1766 is a new host record for this tick species.A espécie Amblyomma longirostre Koch, 1844 é pouco conhecida no Estado do Rio Grande do Sul. Normalmente a fase adulta pode ser encontrada em porquinhos Sphigurus spp., e as fases imaturas podem ser encontradas em aves (Passeriformes. A. longirostre distribui-se na região neotropical, do Panamá ao Uruguai. Ela também ocorre na América Central e nos Estados Unidos. Este estudo tem como objetivo relatar que Ramphastos dicolorus Linnaeus 1766 é um novo hospedeiro dessa espécie de carrapato.

  17. A review of the ticks (Acari, Ixodida of Brazil, their hosts and geographic distribution - 1. The State of Rio Grande do Sul, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Evans DE

    2000-01-01

    Full Text Available A review of the ticks (Acari, Ixodida of the State of Rio Grande do Sul, southern Brazil, was completed as a step towards a definitive list (currently indicated as 12 of such species, their hosts and distribution. The ticks: Argas miniatus (poultry, Ixodes loricatus (opossums, Amblyomma aureolatum (dogs, A. calcaratum (anteaters, A. cooperi (capybaras, A. nodosum (anteaters, A. tigrinum (dogs (Neotropical and Rhipicephalus sanguineus (dogs (introduced, cosmopolitan, Afrotropical were confirmed as present, in addition to the predominant, Boophilus microplus (cattle (introduced, pan-tropical, Oriental. Of the further 18 species thus far reported in the literature as present in the state, but unavailable for examination: only Ornithodoros brasiliensis (humans and their habitations (Neotropical, Ixodes affinis (deer (Nearctic/Neotropical and I. auritulus (birds (Nearctic/Neotropical/Afrotropical/ Australasian are considered likely; 13 species would benefit from corroborative local data but the majority appear unlikely; reports of A. maculatum (Nearctic/Neotropical, but circum-Caribbean are considered erroneous; the validity of A. fuscum is in doubt. The very recent, first known report of the tropical Anocentor nitens (horses(Nearctic/Neotropical, but still apparent absence of the tropical A. cajennense (catholic (Nearctic/Neotropical and the sub-tropical/temperate Ixodes pararicinus (cattle (Neotropical in Rio Grande do Sul are important for considerations on their current biogeographical distribution and its dynamics in South America. The state has relatively long established, introduced ("exotic", Old World tick species (B. microplus, R. sanguineus that continue to represent significant pests and disease vectors to their traditional, introduced domestic animal hosts, cattle and urban dogs. There are also indigenous, New World ticks (A. miniatus, O. brasiliensis, A. aureolatum, A. nitens, as both long established and possibly newly locally

  18. New records of water mites (Acari: Hydrachnidia, Halacaroidea) from Patagonia (Chile)

    NARCIS (Netherlands)

    Pešić, V.; Smit, H.; Datry, T.

    2010-01-01

    New records of water mite species (Acari: Hydrachnidia, Halacaroidea) from Patagonia (Southern Chile) are reported. Four species, Anisitsiellides australis Smit, 2002, Peregrinacarus falklandensis Bartsch, 2001, Lobohalacarus weberi (Romijn & Viets, 1924) and Soldanellonyx monardi Walter, 1919 are

  19. A new genus and species Mangalaus krishianusandhanus (Acari: Eriophyidae) from India

    Science.gov (United States)

    Mangalaus ikrishianusandhanus n. gen., n. sp., (Acari: Prostigmata: Eriophyoidea), collected from erineum on the underside of leaves of Cordia dichotoma (Boraginaceae) is described and illustrated from specimens collected at the Indian Agricultural Research Institute (IARI) in New Delhi, India....

  20. New records of water mites (Acari: Hydrachnidia) from Malaysia, with descriptions of three new species

    NARCIS (Netherlands)

    Pesic, V.; Smit, H.

    2010-01-01

    New records of water mites (Acari: Hydrachnidia) from Malaysia are presented. Three species new to science, Torrenticola haliki, Monatractides cameronensis and Atractides cameronensis are described; first records are given for Monatractides parviventris (K. Viets, 1935) and M. roseus (Lundblad, 1941

  1. Bacteria of the genus Rickettsia in ticks (Acari: Ixodidae) collected from birds in Costa Rica.

    Science.gov (United States)

    Ogrzewalska, Maria; Literák, Ivan; Capek, Miroslav; Sychra, Oldřich; Calderón, Víctor Álvarez; Rodríguez, Bernardo Calvo; Prudencio, Carlos; Martins, Thiago F; Labruna, Marcelo B

    2015-06-01

    The aim of this study was to document the presence of Rickettsia spp. in ticks parasitizing wild birds in Costa Rica. Birds were trapped at seven locations in Costa Rica during 2004, 2009, and 2010; then visually examined for the presence of ticks. Ticks were identified, and part of them was tested individually for the presence of Rickettsia spp. by polymerase chain reaction (PCR) using primers targeting fragments of the rickettsial genes gltA and ompA. PCR products were DNA-sequenced and analyzed in BLAST to determine similarities with previously reported rickettsial agents. A total of 1878 birds were examined, from which 163 birds (9%) were infested with 388 ticks of the genera Amblyomma and Ixodes. The following Amblyomma (in decreasing order of abundance) were found in immature stages (larvae and nymphs): Amblyomma longirostre, Amblyomma calcaratum, Amblyomma coelebs, Amblyomma sabanerae, Amblyomma varium, Amblyomma maculatum, and Amblyomma ovale. Ixodes ticks were represented by Ixodes minor and two unclassified species, designated here as Ixodes sp. genotype I, and Ixodes sp. genotype II. Twelve of 24 tested A. longirostre ticks were found to be infected with 'Candidatus Rickettsia amblyommii', and 2 of 4 A. sabanerae were found to be infected with Rickettsia bellii. Eight of 10 larval Ixodes minor were infected with an endosymbiont (a novel Rickettsia sp. agent) genetically related to the Ixodes scapularis endosymbiont. No rickettsial DNA was found in A. calcaratum, A. coelebs, A. maculatum, A. ovale, A. varium, Ixodes sp. I, and Ixodes sp. II. We report the occurrence of I. minor in Costa Rica for the first time and a number of new bird host-tick associations. Moreover, 'Candidatus R. amblyommii' and R. bellii were found in A. longirostre and A. sabanerae, respectively, in Costa Rica for the first time.

  2. Ticks (Acari: Ixodidae) on wild birds in north-central Argentina.

    Science.gov (United States)

    Flores, Fernando S; Nava, Santiago; Batallán, Gonzalo; Tauro, Laura B; Contigiani, Marta S; Diaz, Luis A; Guglielmone, Alberto A

    2014-10-01

    Ixodid ticks were collected from wild birds in five ecoregions in north-central Argentina, namely: Selva de las Yungas, Esteros del Iberá, Delta e Islas del Paraná, Selva Paranaense and Chaco Seco. A total of 2199 birds belonging to 139 species, 106 genera, 31 families and 11 orders were captured, but ticks were collected only from 121 birds (prevalence=5.5%) belonging to 39 species (28.1%) and three Orders: Tinamiformes (Tinamidae) and Falconiformes (Falconidae) in Selva de las Yungas and Passeriformes (Conopophagidae, Corvidae, Emberizidae, Furnariidae, Icteridae, Parulidae, Thamnophilidae, Thraupidae, Troglodytidae, Turdidae) for all ecoregions. The following tick species were found: Haemaphysalis juxtakochi, Haemaphysalis leporispalustris, Ixodes pararicinus plus Amblyomma sp. and Haemaphysalis sp. in Selva de las Yungas; Amblyomma triste and Ixodes auritulus in Delta e Islas del Paraná; Amblyomma dubitatum, A. triste and Amblyomma sp. in Esteros del Iberá; Amblyomma ovale and Amblyomma sp. in Selva Paranaense, and Amblyomma tigrinum in Chaco Seco. Amblyomma dubitatum was found for the first time on Passeriformes, while the records of A. ovale on avian hosts are the first for Argentina. Birds are also new hosts for I. pararicinus females. Besides 2 larvae and 1 nymph, and 1 larvae found on Tinamidae (Tinamiformes) and Falconidae (Falconiformes), respectively, all other ticks (691 larvae, 74 nymphs and 2 females) were found on Passeriformes with a relevant contribution of the family Turdidae. Birds are important hosts for I. pararicinus as shown by a prevalence of 45% while all others prevalence were below 15%. All the species of Amblyomma and Haemaphysalis found on birds in Argentina have been also detected on humans and are proven or potential vectors for human diseases. Therefore, their avian hosts are probable reservoirs of human pathogens in Argentina. Copyright © 2014 Elsevier GmbH. All rights reserved.

  3. Ability of Two Natural Products, Nootkatone and Carvacrol, to Suppress Ixodes Scapularis and Amblyomma americanum (Acari: Ixodidae) in a Lyme Disease Endemic Area of New Jersey

    Science.gov (United States)

    2009-12-01

    steam - distilled ex- tracts from Alaska...ap- plication, at 24 and 48 h postapplication, and at weekly intervals thereafter in all years. Plots were sampled using a combination of dragging ...Ginsberg and Ewing 1989, Schulze et al. 1997). The entire surface of each plot was sampled each time. Drags and coveralls were examined at

  4. New records for Amblyomma sculptum (Ixodidae on non-passerine birds in Brazil

    Directory of Open Access Journals (Sweden)

    Hermes Ribeiro Luz

    2016-03-01

    Full Text Available Abstract The aim of this paper was to provide new records of Amblyomma sculptum on two species of terricolous birds in two areas of the Cerrado (savannah- like bioma: two specimens of Cariama cristata were captured in the state of Goiás and one specimen ofCrax fasciolata was captured in the state of Minas Gerais. One of the C. cristata was parasitized by 15 larvae, six nymphs, one male and two females whereas the C. fasciolata was parasitized by seven larvae and eight nymphs. This paper presents a new locality for occurrence of parasitism A. sculptum in C. cristata and a new host for C fasciolata.

  5. Discovery of filarial nematode DNA in Amblyomma americanum in Northern Virginia.

    Science.gov (United States)

    Henning, Tyler C; Orr, John M; Smith, Joshua D; Arias, Jorge R; Rasgon, Jason L; Norris, Douglas E

    2016-03-01

    Ticks collected in 2011 were screened for the presence of filarial nematode genetic material, and positive samples were sequenced for analysis. Monanema-like filarial nematode DNA was recently discovered in Amblyomma americanum in northern Virginia, marking the first time genetic material from this parasite has been discovered in ticks in the state. Phylogenetic analysis revealed that this material was directly related to a previously discovered filarial nematode in A. americanum populations in Maryland as well as recently identified parasites in Ixodes scapularis from southern Connecticut. Further study is warranted to visually confirm the presence of these nematodes, characterize their distribution, and determine if these ticks are intermediate hosts.

  6. Rickettsia bellii in Amblyomma rotundatum ticks parasitizing Rhinella jimi from northeastern Brazil.

    Science.gov (United States)

    Horta, Mauricio C; Saraiva, Danilo G; Oliveira, Glauber M B; Martins, Thiago F; Labruna, Marcelo B

    2015-01-01

    This study evaluated rickettsial infection in Amblyomma rotundatum ticks collected from toads (Rhinella jimi) in the Brazilian Caatinga biome, an unique semiarid region of South America. Tick infestations were observed in 57.8% toads (26/45); mean infestation: 1.6 ticks/toad. DNA extraction from 42 ticks (6 larvae, 22 nymphs and 11 female adults) was tested by polymerase chain reaction (PCR) targeting Rickettsia organisms, which were detected in 100% of the ticks. Amplicons' DNA sequences were identical to each other and 99% identical to Rickettsia bellii from GenBank. DNA samples extracted from the blood of the 45 toads were negative by rickettsia-PCR protocols.

  7. New records for Amblyomma sculptum (Ixodidae) on non-passerine birds in Brazil.

    Science.gov (United States)

    Luz, Hermes Ribeiro; Faccini, João Luiz Horacio; Landulfo, Gabriel Alves; Costa Neto, Sócrates Fraga; Famadas, Kátia Maria

    2016-01-01

    The aim of this paper was to provide new records of Amblyomma sculptum on two species of terricolous birds in two areas of the Cerrado (savannah- like) bioma: two specimens of Cariama cristata were captured in the state of Goiás and one specimen ofCrax fasciolata was captured in the state of Minas Gerais. One of the C. cristata was parasitized by 15 larvae, six nymphs, one male and two females whereas the C. fasciolata was parasitized by seven larvae and eight nymphs. This paper presents a new locality for occurrence of parasitism A. sculptum in C. cristata and a new host for C fasciolata.

  8. Molecular evidence of potential novel spotted fever group rickettsiae, Anaplasma and Ehrlichia species in Amblyomma ticks parasitizing wild snakes.

    Science.gov (United States)

    Kho, Kai Ling; Koh, Fui Xian; Tay, Sun Tee

    2015-02-19

    Amblyomma ticks parasitize a wide range of animals in tropical regions. This study describes the identification of Amblyomma ticks from wild snakes in Malaysia and the detection of potential human pathogens such as Rickettsia, Anaplasma, Ehrlichia and bartonellae in the ticks. Twenty one adult ticks (twelve A. varanense and nine Amblyomma helvolum ticks) identified from seven Python molurus snakes in Sepang and a pool of six A. helvolum ticks from a Naja sumatrana snake in Johore, Malaysia were investigated in this study. Amplification of the citrate synthase (gltA), 190-kDa surface antigen gene (ompA), 135-kDa surface antigen (ompB) and surface cell antigen (sca4) genes followed by sequence analysis confirmed the presence of two potential novel spotted fever group rickettsiae in the ticks. Candidatus Rickettsia sepangensis from an engorged A. varanense tick demonstrated high sequence similarity to Rickettsia tamurae; while Candidatus Rickettsia johorensis from two samples (individual and pooled) of A. helvolum and two A. varanense ticks were closely related to Rickettsia raoultii. Anaplasma and Ehrlichia DNA were detected from seven and two ticks, respectively. No bartonellae was detected from any of the ticks. The finding in this study suggests that Amblyomma ticks parasitizing wild snakes may serve as reservoir hosts and carriers for rickettsioses, anaplasmosis and ehrlichiosis in this region.

  9. In vitro membrane feeding of the lone star tick (Amblyomma americanum) and its use in evaluation of acaricidal compounds

    Science.gov (United States)

    The lone star tick, Amblyomma americanum, is one of important Ixodid tick species that are known ectoparasites and disease vectors affecting animal and human health in the United States. New pesticides or repellents with novel mode of action would help control resistant ticks and protect humans from...

  10. Distribution and habitat utilization of the gopher tortoise tick (Amblyomma tuberculatum) in southern Mississippi

    Science.gov (United States)

    Ennen, Joshua R.; Qualls, Carl P.

    2011-01-01

    The distribution of the gopher tortoise tick (Amblyomma tuberculatum) has been considered intrinsically linked to the distribution of its primary host, gopher tortoises (Gopherus polyphemus). However, the presence of G. polyphemus does not always equate to the presence of A. tuberculatum. There is a paucity of data on the ecology, habitat preferences, and distribution of A. tuberculatum. The goals of this study were to assess the distribution of A. tuberculatum in southern Mississippi and to determine which, if any, habitat parameters explain the distribution pattern of A. tuberculatum. During 2006-2007, we examined 13 G. polyphemus populations in southern Mississippi for the presence of A. tuberculatum, and we measured a suite of habitat parameters at each site. Only 23% of the G. polyphemus populations supported A. tuberculatum, suggesting a more restricted distribution than its host. The results of our multivariate analyses identified several habitat variables, e.g., depth of sand and percentage of sand in the topsoil and burrow apron, as being important in discriminating between sites with, and without, A. tuberculatum. Amblyomma tuberculatum was only found at sites with a mean sand depth of >100 cm and a mean percentage of topsoil and burrow apron sand composition >94.0 and 92.4, respectively. Thus, environmental factors, and not just its host's range, seem to influence the distribution of A. tuberculatum.

  11. An acarologic survey and Amblyomma americanum distribution map with implications for tularemia risk in Missouri

    Science.gov (United States)

    Brown, H.E.; Yates, K.F.; Dietrich, G.; MacMillan, K.; Graham, C.B.; Reese, S.M.; Helterbrand, Wm. S.; Nicholson, W.L.; Blount, K.; Mead, P.S.; Patrick, S.L.; Eisen, R.J.

    2011-01-01

    In the United States, tickborne diseases occur focally. Missouri represents a major focus of several tickborne diseases that includes spotted fever rickettsiosis, tularemia, and ehrlichiosis. Our study sought to determine the potential risk of human exposure to human-biting vector ticks in this area. We collected ticks in 79 sites in southern Missouri during June 7-10, 2009, which yielded 1,047 adult and 3,585 nymphal Amblyomma americanum, 5 adult Amblyomma maculatum, 19 adult Dermacentor variabilis, and 5 nymphal Ixodes brunneus. Logistic regression analysis showed that areas posing an elevated risk of exposure to A. americanum nymphs or adults were more likely to be classified as forested than grassland, and the probability of being classified as elevated risk increased with increasing relative humidity during the month of June (30-year average). Overall accuracy of each of the two models was greater than 70% and showed that 20% and 30% of the state were classified as elevated risk for human exposure to nymphs and adults, respectively. We also found a significant positive association between heightened acarologic risk and counties reporting tularemia cases. Our study provides an updated distribution map for A. americanum in Missouri and suggests a wide-spread risk of human exposure to A. americanum and their associated pathogens in this region. Copyright ?? 2011 by The American Society of Tropical Medicine and Hygiene.

  12. Molecular detection of Rickettsia bellii in Amblyomma rotundatum from imported red-footed tortoise (Chelonoides carbonaria).

    Science.gov (United States)

    Erster, Oran; Roth, Asael; Avni, Zvi; King, Rony; Shkap, Varda

    2015-06-01

    Introduction of exotic ticks and pathogens through international animal trade (farm animals and pets) is a serious threat to public health and local fauna. Rapid and correct identification of potential threats is an important step on the way to conduct an efficient control of imported pests. In this report we describe the molecular identification of the neotropic tick Amblyomma rotundatum intercepted from red-footed tortoise (Chelonoides carbonaria), imported to Israel from Florida, USA. Molecular analysis of the ticks conducted upon their identification, revealed that they were infected with Rickettsia bellii. Following their collection, the ticks were examined morphologically and five molecular markers were used to determine their taxonomic identity: cytochrome c oxidase subunit 1 (COX1), cytochrome b (CytB), 12S rRNA, 16S rRNA and internal transcribed sequence 2 (ITS-2). Molecular analysis indicated that all of the collected ticks were Amblyomma rotundatum. Using rickettsial gltA (citrate synthase) gene in real-time PCR analysis we found that approximately 25% of the intercepted ticks (8 of 33) were infected with Rickettsia bellii. It is concluded that accurate and timely identification of imported exotic ticks prevented their introduction to Israel, and that use of molecular tools may further improve the response to such potential threats.

  13. Amblyomma ticks and future climate: Range contraction due to climate warming.

    Science.gov (United States)

    Oliveira, Stefan Vilges de; Romero-Alvarez, Daniel; Martins, Thiago Fernandes; Santos, Janduhy Pereira Dos; Labruna, Marcelo B; Gazeta, Gilberto Salles; Escobar, Luis E; Gurgel-Gonçalves, Rodrigo

    2017-09-01

    Ticks of the Amblyomma cajennense species complex are important vectors of spotted fever in Latin America. Environmental conditions determine the geographic distribution of ticks, such that climate change could influence the distribution of tick-borne diseases. This study aimed to analyze the potential geographic distribution of A. cajennense complex ticks in a Brazil region under present-day and future climate models, assuming dispersal limitations and non-evolutionary adaptation of these tick populations to climate warming. Records of A. cajennense sensu stricto (s.s.) and Amblyomma sculptum were analyzed. Niche models were calibrated using Maxent considering climate variables for 1950-2000 and projecting models to conditions anticipated for 2050 and 2070 under two models of future climate (CCSM4 and HadGEM2-AO). Broad suitable areas for A. cajennense s.s. and A. sculptum were found in present-day climate models, but suitability was reduced when models were projected to future conditions. Our exploration of future climates showed that broad areas had novel climates not existing currently in the study region, including novel extremely high temperatures. Indeed, predicted suitability in these novel conditions would lead to biologically unrealistic results and therefore incorrect forecasts of future tick-distribution. Previous studies anticipating expansions of vectors populations due to climate change should be considered with caution as they assume that model extrapolation anticipates that species would evolve rapidly for adaptation to novel climatic conditions. Copyright © 2017. Published by Elsevier B.V.

  14. The ticks (Acari: Ixodida: Argasidae, Ixodidae) of Bolivia.

    Science.gov (United States)

    Mastropaolo, Mariano; Beltrán-Saavedra, L Fabián; Guglielmone, Alberto A

    2014-03-01

    The tick species reported in Bolivia are reviewed here as (1) endemic or established: Ornithodoros echimys, O. guaporensis, O. hasei, O. kohlsi, O. mimon, O. peropteryx, O. rostratus, Otobius megnini, Amblyomma auricularium, A. cajennense, A. calcaratum, A. coelebs, A. dubitatum, A. humerale, A. incisum, A. longirostre, A. naponense, A. nodosum, A. oblongoguttatum, A. ovale, A. parvitarsum, A. parvum, A. pecarium, A. pseudoconcolor, A. rotundatum, A. scalpturatum, A. tigrinum, A. triste, Dermacentor nitens, Haemaphysalis juxtakochi, H. leporispalustris, I. boliviensis, I. cooleyi, I. luciae, Rhipicephalus microplus, R. sanguineus, and (2) erroneously reported: Ornithodoros puertoricensis, O. talaje, O. turicata, Amblyomma americanum, A. maculatum, A. multipunctum, Ixodes ricinus, I. scapularis, Rhipicephalus annulatus. Many of these records are lacking locality and/or host, and some of them need new findings for confirmation. Some of the species recorded may represent a threat for human and animal health, therefore would be of great value to make a countrywide survey of ticks in order to update the information presented in this work. Copyright © 2013 Elsevier GmbH. All rights reserved.

  15. Transmission of Hepatozoon americanum (Apicomplexa: Adeleorina) by ixodids (Acari: Ixodidae).

    Science.gov (United States)

    Ewing, S A; Mathew, J S; Panciera, R J

    2002-07-01

    American canine hepatozoonosis (ACH) caused by Hepatozoon americanum Vincent-Johnson, Macintire, Lindsay, Lenz, Baneth, and Shkap is an emerging, often fatal, tick-borne protozoal disease of dogs in the United States of America. Dogs acquire infection by ingesting ticks that contain oocysts. To understand the invertebrate (definitive) host range of H. americanum, experiments were carried out using four ixodids, Rhipicephalus sanguineus (Latreille), Dermacentor variabilis Say, Amblyomma americanum (L.), and Amblyomma maculatum Koch. Laboratory-reared nymphal ticks were fed on dogs that were either naturally or experimentally infected with H. americanum; when these ticks molted to the adult stage they were either fed to susceptible dogs or were dissected and examined for the presence of oocysts. Mature H. americanum oocysts were found in >90% of A. maculatum (both males and females), whereas oocysts were not found in any of the other three species. These results confirm that A. maculatum is an excellent host and vector for H. americanum and also suggest that this apicomplexan may have a narrow invertebrate host range, at least among ixodid ticks that are likely candidate vectors in the United States.

  16. Candidatus Rickettsia andeanae, a spotted fever group agent infecting Amblyomma parvum ticks in two Brazilian biomes.

    Science.gov (United States)

    Nieri-Bastos, Fernanda Aparecida; Lopes, Marcos Gomes; Cançado, Paulo Henrique Duarte; Rossa, Giselle Ayres Razera; Faccini, João Luiz Horácio; Gennari, Solange Maria; Labruna, Marcelo Bahia

    2014-04-01

    Adult ticks of the species Amblyomma parvum were collected from the vegetation in the Pantanal biome (state of Mato Grosso do Sul) and from horses in the Cerrado biome (state of Piauí) in Brazil. The ticks were individually tested for rickettsial infection via polymerase chain reaction (PCR) targeting three rickettsial genes, gltA, ompA and ompB. Overall, 63.5% (40/63) and 66.7% (2/3) of A. parvum ticks from Pantanal and Cerrado, respectively, contained rickettsial DNA, which were all confirmed by DNA sequencing to be 100% identical to the corresponding fragments of the gltA, ompA and ompB genes of Candidatus Rickettsia andeanae. This report is the first to describe Ca. R. andeanae in Brazil.

  17. Candidatus Rickettsia andeanae, a spotted fever group agent infecting Amblyomma parvum ticks in two Brazilian biomes

    Directory of Open Access Journals (Sweden)

    Fernanda Aparecida Nieri-Bastos

    2014-04-01

    Full Text Available Adult ticks of the species Amblyomma parvum were collected from the vegetation in the Pantanal biome (state of Mato Grosso do Sul and from horses in the Cerrado biome (state of Piauí in Brazil. The ticks were individually tested for rickettsial infection via polymerase chain reaction (PCR targeting three rickettsial genes, gltA, ompA and ompB. Overall, 63.5% (40/63 and 66.7% (2/3 of A. parvum ticks from Pantanal and Cerrado, respectively, contained rickettsial DNA, which were all confirmed by DNA sequencing to be 100% identical to the corresponding fragments of the gltA, ompA and ompB genes of Candidatus Rickettsia andeanae. This report is the first to describe Ca. R. andeanae in Brazil.

  18. The Microbiome of Ehrlichia-Infected and Uninfected Lone Star Ticks (Amblyomma americanum)

    Science.gov (United States)

    Trout Fryxell, R. T.; DeBruyn, J. M.

    2016-01-01

    The Lone Star tick, Amblyomma americanum, transmits several bacterial pathogens including species of Anaplasma and Ehrlichia. Amblyomma americanum also hosts a number of non-pathogenic bacterial endosymbionts. Recent studies of other arthropod and insect vectors have documented that commensal microflora can influence transmission of vector-borne pathogens; however, little is known about tick microbiomes and their possible influence on tick-borne diseases. Our objective was to compare bacterial communities associated with A. americanum, comparing Anaplasma/Ehrlichia -infected and uninfected ticks. Field-collected questing specimens (n = 50) were used in the analyses, of which 17 were identified as Anaplasma/Ehrlichia infected based on PCR amplification and sequencing of groEL genes. Bacterial communities from each specimen were characterized using Illumina sequencing of 16S rRNA gene amplicon libraries. There was a broad range in diversity between samples, with inverse Simpson’s Diversity indices ranging from 1.28–89.5. There were no statistical differences in the overall microbial community structure between PCR diagnosed Anaplasma/Ehrlichia-positive and negative ticks, but there were differences based on collection method (P Anaplasma. Other taxa of interest in these specimens included Coxiella, Borrelia, and Rickettsia. Identification of bacterial community differences between specimens of a single tick species from a single geographical site indicates that intra-species differences in microbiomes were not due solely to pathogen presence/absence, but may be also driven by vector life history factors, including environment, life stage, population structure, and host choice. PMID:26751816

  19. Rickettsia infection in dogs and Rickettsia parkeri in Amblyomma tigrinum ticks, Cochabamba Department, Bolivia.

    Science.gov (United States)

    Tomassone, Laura; Conte, Valeria; Parrilla, Guillermo; De Meneghi, Daniele

    2010-12-01

    Only few published data are available on ticks and tick-borne zoonotic pathogens in Bolivia. To evaluate rickettsial seroprevalence and infection in dogs and ticks, during February-April 2007, we collected whole blood, sera, and ticks from dogs living in the rural, peri-urban, and urban areas of Cochabamba, Bolivia. Dog sera were subjected to enzyme-linked immunosorbent assay test to detect IgG antibodies against Rickettsia rickettsii and 68.2% of samples were found to be positive (n = 30; 95% confidence interval [CI]: 52.4-81.4). Blood samples and ticks were tested using polymerase chain reaction to detect spotted fever group (SFG) rickettsiae. One blood sample was positive for Rickettsia parkeri (2.3%; 95% CI: 0.06-12.3). Ticks were collected from 10 dogs and were identified as Amblyomma tigrinum (n = 44) and Rhipicephalus sanguineus (n = 1). All A. tigrinum ticks were collected from resident dogs from the rural areas of Cochabamba, whereas R. sanguineus was from a dog originating from Santa Cruz. Of 42 DNA samples extracted from ticks, 23 (54.8%; 95% CI: 38.7-70.1) were polymerase chain reaction positive for Rickettsia spp. Sequencing analysis identified 22 samples as R. parkeri and one as Rickettsia aeschlimannii. Positive ticks (all A. tigrinum) were collected from six dogs, all of which were seropositive. This is the first report of SFG rickettsiae in A. tigrinum, suggesting that this tick-like others species in the Amblyomma maculatum group--may play a role in the biological cycle of Ri. parkeri. The high infection prevalence of SFG rickettsiae in ticks and the even higher seroprevalence in dogs suggest an active circulation of agents of rickettsiosis in the study area, although there are no confirmed cases of infection in humans. Our study supports the use of canine serology as risk indicator for SF rickettsioses.

  20. Myrmecophilous pygmephoroid mites (Acari: Pygmephoroidea) associated with Lasius flavus (Hymenoptera: Formicidae) in Russia.

    Science.gov (United States)

    Khaustov, Alexander A

    2015-11-19

    Twenty four species of pygmephoroid mites (Acari: Pygmephoroidea: Neopygmephoridae, Scutacaridae, Microdispidae) are recorded from the ant Lasius flavus (Fabricius) or from its nests from Western Siberia and Crimea. Four of them of the genus Scutacarus Gros, 1845 (Acari: Scutacaridae), S. insolitus sp. nov., S. heterotrichus sp. nov., S. moseri sp. nov. and S. sibiriensis sp. nov. are described as new for science. Four species of scutacarid mites are recorded for the first time in Russia. The comparison of pygmephoroid mite communities associated with Lasius flavus from Crimean and West Siberian populations and notes on phoresy of pygmephoroid mites on ants are provided.

  1. Phytocystatins: Defense Proteins against Phytophagous Insects and Acari

    Science.gov (United States)

    Martinez, Manuel; Santamaria, Maria Estrella; Diaz-Mendoza, Mercedes; Arnaiz, Ana; Carrillo, Laura; Ortego, Felix; Diaz, Isabel

    2016-01-01

    This review deals with phytocystatins, focussing on their potential role as defence proteins against phytophagous arthropods. Information about the evolutionary, molecular and biochemical features and inhibitory properties of phytocystatins are presented. Cystatin ability to inhibit heterologous cysteine protease activities is commented on as well as some approaches of tailoring cystatin specificity to enhance their defence function towards pests. A general landscape on the digestive proteases of phytophagous insects and acari and the remarkable plasticity of their digestive physiology after feeding on cystatins are highlighted. Biotechnological approaches to produce recombinant cystatins to be added to artificial diets or to be sprayed as insecticide–acaricide compounds and the of use cystatins as transgenes are discussed. Multiple examples and applications are included to end with some conclusions and future perspectives. PMID:27775606

  2. Phytocystatins: Defense Proteins against Phytophagous Insects and Acari

    Directory of Open Access Journals (Sweden)

    Manuel Martinez

    2016-10-01

    Full Text Available This review deals with phytocystatins, focussing on their potential role as defence proteins against phytophagous arthropods. Information about the evolutionary, molecular and biochemical features and inhibitory properties of phytocystatins are presented. Cystatin ability to inhibit heterologous cysteine protease activities is commented on as well as some approaches of tailoring cystatin specificity to enhance their defence function towards pests. A general landscape on the digestive proteases of phytophagous insects and acari and the remarkable plasticity of their digestive physiology after feeding on cystatins are highlighted. Biotechnological approaches to produce recombinant cystatins to be added to artificial diets or to be sprayed as insecticide–acaricide compounds and the of use cystatins as transgenes are discussed. Multiple examples and applications are included to end with some conclusions and future perspectives.

  3. Phytocystatins: Defense Proteins against Phytophagous Insects and Acari.

    Science.gov (United States)

    Martinez, Manuel; Santamaria, Maria Estrella; Diaz-Mendoza, Mercedes; Arnaiz, Ana; Carrillo, Laura; Ortego, Felix; Diaz, Isabel

    2016-10-20

    This review deals with phytocystatins, focussing on their potential role as defence proteins against phytophagous arthropods. Information about the evolutionary, molecular and biochemical features and inhibitory properties of phytocystatins are presented. Cystatin ability to inhibit heterologous cysteine protease activities is commented on as well as some approaches of tailoring cystatin specificity to enhance their defence function towards pests. A general landscape on the digestive proteases of phytophagous insects and acari and the remarkable plasticity of their digestive physiology after feeding on cystatins are highlighted. Biotechnological approaches to produce recombinant cystatins to be added to artificial diets or to be sprayed as insecticide-acaricide compounds and the of use cystatins as transgenes are discussed. Multiple examples and applications are included to end with some conclusions and future perspectives.

  4. Second contribution to the knowledge of water mites from the Comoros, with the description of one new species (Acari: Hydrachnidia)

    NARCIS (Netherlands)

    Smit, H.; Pesic, V.; Mary-Sasal, N.

    2010-01-01

    New records of water mites (Acari: Hydrachnidia) from the Comoros are presented. One species new to science, Africasia comorosensis is described; first records are given for Torrenticola sp. and Atractides thoracatus Koenike, 1898.

  5. Acquisition and expression of resistance by Bos indicus and Bos indicus X Bos taurus calves to Amblyomma americanum infestation.

    Science.gov (United States)

    George, J E; Osburn, R L; Wikel, S K

    1985-04-01

    Purebred and crossbred Bos indicus calves were infested 1, 2, or 3 times with 10 female and 5 male Amblyomma americanum. Resistance was acquired by both the purebred and the crossbred calves after 1 infestation and resulted in statistically significant decreases in the percentages of females that engorged, the mean weights of engorged females, and the mean weights of egg masses. Comparisons between breeds of the percent of female ticks that engorged during the first and second infestations indicate that purebred B. indicus expressed a stronger acquired resistance to A. americanum more readily than did crossbred animals. However, calves of both genetic compositions displayed similar levels of resistance during a third exposure. All tick-exposed and control animals were skin tested with salivary gland extracts of A. americanum, A. cajennense and Dermacentor andersoni. Control, uninfested calves, did not display significant cutaneous reactivity to these extracts. All calves that had been infested had immediate, 30-min, 5-hr and delayed, 24-hr, skin reactions to Amblyomma species antigens. Reactions to D. andersoni salivary antigens in tests of both purebred and crossbred calves with acquired resistance to A. americanum suggest that Amblyomma species salivary gland antigens might have cross reactive moieties with a salivary extract prepared from D. andersoni. Peripheral blood lymphocyte in vitro responsiveness to Amblyomma species antigens was detected in purebred calves after a first, second, and third infestation, indicating the presence of cells of the immune system capable of recognizing and undergoing blast transformation in response to tick salivary components.(ABSTRACT TRUNCATED AT 250 WORDS)

  6. The Distinct Transcriptional Response of the Midgut of Amblyomma sculptum and Amblyomma aureolatum Ticks to Rickettsia rickettsii Correlates to Their Differences in Susceptibility to Infection

    Directory of Open Access Journals (Sweden)

    Andréa C. Fogaça

    2017-04-01

    Full Text Available Rickettsia rickettsii is a tick-borne obligate intracellular bacterium that causes Rocky Mountain Spotted Fever (RMSF. In Brazil, two species of ticks in the genus Amblyomma, A. sculptum and A. aureolatum, are incriminated as vectors of this bacterium. Importantly, these two species present remarkable differences in susceptibility to R. rickettsii infection, where A. aureolatum is more susceptible than A. sculptum. In the current study, A. aureolatum and A. sculptum ticks were fed on suitable hosts previously inoculated with R. rickettsii, mimicking a natural infection. As control, ticks were fed on non-infected animals. Both midgut and salivary glands of all positively infected ticks were colonized by R. rickettsii. We did not observe ticks with infection restricted to midgut, suggesting that important factors for controlling rickettsial colonization were produced in this organ. In order to identify such factors, the total RNA extracted from the midgut (MG was submitted to next generation RNA sequencing (RNA-seq. The majority of the coding sequences (CDSs of A. sculptum differentially expressed by infection were upregulated, whereas most of modulated CDSs of A. aureolatum were downregulated. The functional categories that comprise upregulated CDSs of A. sculptum, for instance, metabolism, signal transduction, protein modification, extracellular matrix, and immunity also include CDSs of A. aureolatum that were downregulated by infection. This is the first study that reports the effects of an experimental infection with the highly virulent R. rickettsii on the gene expression of two natural tick vectors. The distinct transcriptional profiles of MG of A. sculptum and A. aureolatum upon infection stimulus strongly suggest that molecular factors in this organ are responsible for delineating the susceptibility to R. rickettsii. Functional studies to determine the role played by proteins encoded by differentially expressed CDSs in the acquisition of R

  7. Preparing soft-bodied arthropods for arthropods for microscope examination: Mites (Arachnida: Acari)

    Science.gov (United States)

    Proper identification of mites (Arachnida: Acari) require preparation of the specimen on a microscope slide. This training video provides visual instruction on how to prepare mite specimens on microscope slides for examination and identification. Steps ranging from collection, specimen clearing, use...

  8. Sexual selection and mating behavior in spider mites of the genus Tetranychus (Acari: Tetranychidae)

    NARCIS (Netherlands)

    Oku, K.

    2014-01-01

    As sexual selection is a coevolutionary process between males and females, various morphological and behavioral traits have evolved in each sex. In the tetranychid mites Tetranychus urticae Koch and T. kanzawai Kishida (Acari: Tetranychidae), males can mate repeatedly, whereas females normally

  9. Investigations of Gamasina mites in natural and man-affected soils in Latvia (Acari: Mesostigmata)

    NARCIS (Netherlands)

    Salmane, I.

    2003-01-01

    Investigations of Gamasina mites in natural and man-affected soils in Latvia (Acari: Mesostigmata) A short overview is presented on Gamasina material collected in 22 natural and man-disturbed habitats in Latvia. Species diversity, average density and species dominance were investigated. Altogether 1

  10. Role of excreta in predator avoidance by the Kanzawa spider mite, Tetranychus kanzawai (Acari: Tetranychidae)

    NARCIS (Netherlands)

    Oku, K.

    2008-01-01

    The Kanzawa spider mite, Tetranychus kanzawai (Acari: Tetranychidae) constructs webs over leaf surfaces and usually lives under these webs. T. kanzawai produces two types of excreta, black and yellow pellets, and uses its webs as a place for excretion. T. kanzawai also uses its webs as a refuge when

  11. Evaluation of four bed bug traps for surveillances of brown dog ticks (Acari: Ixodidae)

    Science.gov (United States)

    The brown dog tick can be a serious residential pest due to its unique ability, among ticks, to complete its lifecycle indoors. A single engorged and fertilized female tick can oviposit around 4,000 eggs, allowing indoor establishment to be rapid and easy to miss in early-stage infestations. Acari...

  12. Recovery of some of the missing wrappers of Berlese's Acari, Myriopoda et Scorpiones

    NARCIS (Netherlands)

    Hammen, van der L.

    1986-01-01

    Reproductions are given of the original wrappers of A. Berlese's Acari, Myriopoda et Scorpiones, fasc. II, IV, VI, VII and XIV. These wrappers (on some of which the first descriptions of new species are published) could not be included in the 1979 reprint edition of the work, as no extant copies of

  13. De corticole fauna van platanen: i. Arachniden (Arachnida: Araneae, Pseudoscorpiones, Acari)

    NARCIS (Netherlands)

    Noordijk, J.; Berg, M.P.

    2001-01-01

    The corticolous fauna of plane trees: I. Arachnids (Arachnida: Araneae, Pseudoscorpiones, Acari) From February until September 2000 an inventory was made of the bark-dwelling arthropod fauna of more than 400 plane trees (Platanus hybrida), all over the Netherlands. Arthropods were collected from bar

  14. Water mite species of the genus Hydrodroma Koch (Acari: Hydrachnidia, Hydrodromidae) from Australia. Part II.

    NARCIS (Netherlands)

    Pesic, V.; Smit, H.

    2007-01-01

    Abstract: Two new water mite species of the genus Hydrodroma Koch (Acari: Hydrachnidia, Hydrodromidae), characterized by single or absence of swimming setae on II-L-5, are reported from Australia: Hydrodroma wilesi sp. nov. and H. cooki sp. nov. New information is provided for H. tonapii Cook from I

  15. Sexual selection and mating behavior in spider mites of the genus Tetranychus (Acari: Tetranychidae)

    NARCIS (Netherlands)

    Oku, K.

    2014-01-01

    As sexual selection is a coevolutionary process between males and females, various morphological and behavioral traits have evolved in each sex. In the tetranychid mites Tetranychus urticae Koch and T. kanzawai Kishida (Acari: Tetranychidae), males can mate repeatedly, whereas females normally accep

  16. A new species of the genus Acarothrix (Acari: Halacaridae) from Brunei Darussalam and India

    Digital Repository Service at National Institute of Oceanography (India)

    Chatterjee, T.; Marshall, D.J.; Guru, B.C.; Ingole B.S.; Pesic V.

    ) in mangroves of Singapore. I. Description of three species. The Raffles Bulletin of Zoology, 54: 83-92. Proches S. 2002. New species of Copidognathinae (Acari: Halacaridae) from southern Africa. Journal of Natural History, 36: 999-1007. 6    Figure 1...

  17. Effects of radiation (Cobalt-60) on the elimination of Brevipalpus phoenicis (Acari: Tenuipalpidae) Cardinum endosymbiont

    Science.gov (United States)

    Brevipalpus phoenicis (Geijskes) (Acari: Tenuipalpidae) is a polyphagous mite with worldwide distribution and it is also a vector of several plant viruses. In citrus, B. phoenicis transmits Citrus leprosis virus (CiLV), the causal agent of leprosis, a disease that costs millions of dollars/year for ...

  18. The Microbiome of Ehrlichia-Infected and Uninfected Lone Star Ticks (Amblyomma americanum.

    Directory of Open Access Journals (Sweden)

    R T Trout Fryxell

    Full Text Available The Lone Star tick, Amblyomma americanum, transmits several bacterial pathogens including species of Anaplasma and Ehrlichia. Amblyomma americanum also hosts a number of non-pathogenic bacterial endosymbionts. Recent studies of other arthropod and insect vectors have documented that commensal microflora can influence transmission of vector-borne pathogens; however, little is known about tick microbiomes and their possible influence on tick-borne diseases. Our objective was to compare bacterial communities associated with A. americanum, comparing Anaplasma/Ehrlichia -infected and uninfected ticks. Field-collected questing specimens (n = 50 were used in the analyses, of which 17 were identified as Anaplasma/Ehrlichia infected based on PCR amplification and sequencing of groEL genes. Bacterial communities from each specimen were characterized using Illumina sequencing of 16S rRNA gene amplicon libraries. There was a broad range in diversity between samples, with inverse Simpson's Diversity indices ranging from 1.28-89.5. There were no statistical differences in the overall microbial community structure between PCR diagnosed Anaplasma/Ehrlichia-positive and negative ticks, but there were differences based on collection method (P < 0.05, collection site (P < 0.05, and sex (P < 0.1 suggesting that environmental factors may structure A. americanum microbiomes. Interestingly, there was not always agreement between Illumina sequencing and PCR diagnostics: Ehrlichia was identified in 16S rRNA gene libraries from three PCR-negative specimens; conversely, Ehrlichia was not found in libraries of six PCR-positive ticks. Illumina sequencing also helped identify co-infections, for example, one specimen had both Ehrlichia and Anaplasma. Other taxa of interest in these specimens included Coxiella, Borrelia, and Rickettsia. Identification of bacterial community differences between specimens of a single tick species from a single geographical site indicates that

  19. Population analyses of Amblyomma maculatum ticks and Rickettsia parkeri using single-strand conformation polymorphism.

    Science.gov (United States)

    Ferrari, Flavia A G; Goddard, Jerome; Caprio, Michael; Paddock, Christopher D; Mixson-Hayden, Tonya; Varela-Stokes, Andrea S

    2013-09-01

    Gulf Coast ticks, Amblyomma maculatum, and the zoonotic agents they transmit, Rickettsia parkeri, are expanding into areas in the United States where they were not previously reported, and are emerging threats for public and veterinary health. The dynamics of this tick-pathogen system and implications for disease transmission are still unclear. To assess genetic variation of tick and rickettsial populations, we collected adult A. maculatum from 10 sites in Mississippi, 4 in the northern, one in the central, and 5 in the southern part of the state. PCR amplicons from tick mitochondrial 16S rRNA and rickettsial ompA genes as well as 5 intergenic spacer regions were evaluated for genetic variation using single-strand conformation polymorphism analysis. Frequencies of the 4 tick 16S haplotypes were not significantly different among regions of Mississippi, but within sites there were differences in distribution that can be explained by high migration rates. Phylogenetically, one lineage of tick haplotypes was a species-poor sister group to remaining haplotypes in the species-rich sister group. No genetic variation was identified in any of the 6 selected gene targets of R. parkeri examined in the infected ticks, suggesting high levels of intermixing.

  20. Population genetic structure of a three-host tick, Amblyomma dissimile, in eastern Venezuela.

    Science.gov (United States)

    Lampo, M; Rangel, Y; Mata, A

    1998-12-01

    Patterns of genetic variation for the tick Amblyomma dissimile were analyzed from a total of 200 ticks collected on 12 toads (Bufo marinus), 14 snakes (Boa constrictor), and 8 lizards (Iguana iguana) at 11 localities. The analyses were performed on electrophoretic data from 8 isozyme loci. Mean heterozygosity per locus was 6% (+/-3.1) per population. Differences in allelic frequencies among ticks from different individual hosts were the major source of genetic variability in this study. Host species was a smaller source of genetic variation. Genetic distances between localities varied according to which host species was present in each locality, and these appeared to be related to the extent of habitat overlap between host species. The smallest genetic distances between samples from different host species were recorded for I. iguana and B. constrictor. In contrast, the genetic distances between tick samples from B. marinus and either of the reptile species were significantly larger than between tick samples from this amphibian species. Ecological variables or the geographic distance did not explain the local patterns of differentiation observed in A. dissimile. Major genetic differences between island and mainland sites (0.03702) suggested an association between genetic distances and geographic isolation. The consistency between patterns of genetic variation and those of host home range overlap suggests that host dispersion is the main force structuring the genetic variation within this tick species.

  1. Inferring the population structure and demographic history of the tick, Amblyomma americanum Linnaeus.

    Science.gov (United States)

    Mixson, Tonya R; Lydy, Shari L; Dasch, Gregory A; Real, Leslie A

    2006-06-01

    A hierarchial population genetic study was conducted on 703 individual Amblyomma americanum from nine populations in Georgia, U.S.A. Populations were sampled from the Coastal Plain, midland Piedmont region, and the upper Piedmont region. Twenty-nine distinct haplotypes were found. A minimum spanning tree was constructed that indicated these haplotypes comprised two lineages, the root of which was distinctly star-like. The majority of the variation found was among ticks within each population, indicating high amounts of gene flow and little genetic differentiation between the three regions. An overall F(ST) value of 0.006 supported the lack of genetic structuring between collection sites in Georgia. Mantel regression analysis revealed no isolation by distance. Signatures of population expansion were detected in the shapes of the mismatch distribution and tests of neutrality. The absence of genetic differentiation combined with the rejection of the null model of isolation by distance may indicate recent range expansion in Georgia or insufficient time to reach an equilibrium where genetic drift may have affected allele frequencies. Alternatively, the high degree of panmixia found within A. americanum in Georgia may be due to bird-mediated dispersal of ticks increasing the genetic similarity between geographically separated populations.

  2. Geographic distribution and genetic diversity of the Ehrlichia sp. from Panola Mountain in Amblyomma americanum

    Directory of Open Access Journals (Sweden)

    Williamson Phillip C

    2008-04-01

    Full Text Available Abstract Background A novel Ehrlichia, closely related to Ehrlichia ruminantium, was recently discovered from Panola Mountain State Park, GA, USA. We conducted a study to determine if this agent was recently introduced into the United States. Methods We developed a sensitive PCR assay based on the conserved gltA (citrate synthase gene and tested DNA samples extracted from 1964 field-collected and 1835 human-biting Amblyomma americanum from 23 eastern states of the USA. Results The novel agent was detected in 36 ticks collected from 10 states between 1998 and 2006. Infected ticks were collected both from vegetation (n = 14, 0.7% and from humans (n = 22, 1.2%. Fragments of the conserved gltA gene and the variable map1 gene were sequenced from positive samples. Two distinct clades, with 10.5% nucleic acid divergence over the 730 bp map1 sequence, were identified. Conclusion These data suggest that the Panola Mountain Ehrlichia was not recently introduced to the United States; this agent has an extensive distribution throughout the range of its tick vector, has been present in some locations for several years, and displays genetic variability. Furthermore, people in several states were exposed to this agent through the bite of infected ticks, underscoring the potential public health risk of this emerging ehrlichiosis.

  3. Demonstration of lumpy skin disease virus infection in Amblyomma hebraeum and Rhipicephalus appendiculatus ticks using immunohistochemistry.

    Science.gov (United States)

    Lubinga, Jimmy C; Clift, Sarah J; Tuppurainen, Eeva S M; Stoltsz, Wilhem H; Babiuk, Shawn; Coetzer, Jacobus A W; Venter, Estelle H

    2014-03-01

    Lumpy skin disease (LSD) is caused by lumpy skin disease virus (LSDV), a member of the genus Capripoxvirus. Transmission of the virus has been associated with haematophagous insects such as Stomoxys calcitrans as well as Aedes and Culex species of mosquitoes. Recent studies have reported the transmission of the virus by Amblyomma hebraeum, Rhipicephalus appendiculatus, and Rhipicephalus decoloratus ticks and the presence of LSDV in saliva of A. hebraeum and R. appendiculatus ticks. The aim of this study was to determine which tick organs become infected by LSDV following intrastadial infection and transstadial persistence of the virus in A. hebraeum and R. appendiculatus ticks. Nymphal and adult ticks were orally infected by feeding them on LSDV-infected cattle. Partially fed adult ticks were processed for testing while nymphs were fed to repletion and allowed to moult to adults before being processed for testing. The infection in tick organs was determined by testing for the presence of the viral antigen using monoclonal antibodies with immunohistochemical staining. The viral antigen was detected in salivary glands, haemocytes, synganglia, ovaries, testes, fat bodies, and midgut. Since the virus was shown to be able to cross the midgut wall and infect various tick organs, this may indicate potential for biological development and transmission of LSDV in ticks. This study strengthens the previously reported evidence of the occurrence of LSDV in tick saliva. Copyright © 2013 Elsevier GmbH. All rights reserved.

  4. A deep insight into the sialotranscriptome of the gulf coast tick, Amblyomma maculatum.

    Directory of Open Access Journals (Sweden)

    Shahid Karim

    Full Text Available BACKGROUND: Saliva of blood sucking arthropods contains compounds that antagonize their hosts' hemostasis, which include platelet aggregation, vasoconstriction and blood clotting; saliva of these organisms also has anti-inflammatory and immunomodullatory properties. Perhaps because hosts mount an active immune response against these compounds, the diversity of these compounds is large even among related blood sucking species. Because of these properties, saliva helps blood feeding as well as help the establishment of pathogens that can be transmitted during blood feeding. METHODOLOGY/PRINCIPAL FINDINGS: We have obtained 1,626,969 reads by pyrosequencing a salivary gland cDNA library from adult females Amblyomma maculatum ticks at different times of feeding. Assembly of this data produced 72,441 sequences larger than 149 nucleotides from which 15,914 coding sequences were extracted. Of these, 5,353 had >75% coverage to their best match in the non-redundant database from the National Center for Biotechnology information, allowing for the deposition of 4,850 sequences to GenBank. The annotated data sets are available as hyperlinked spreadsheets. Putative secreted proteins were classified in 133 families, most of which have no known function. CONCLUSIONS/SIGNIFICANCE: This data set of proteins constitutes a mining platform for novel pharmacologically active proteins and for uncovering vaccine targets against A. maculatum and the diseases they carry.

  5. Ticks (Acari: Ixodidae) associated with wildlife and vegetation of Haller park along the Kenyan coastline.

    Science.gov (United States)

    Wanzala, W; Okanga, S

    2006-09-01

    This artcile describes the results obtained from a tick survey conducted in Haller park along the Kenyan coastline. The survey aimed at evaluating tick-host associations, assessing tick population density, and providing baseline information for planning future tick control and management in the park. Ticks (2,968) were collected by handpicking from eight species of wildlife and by dragging in 14 selected sites within the park. A considerable proportion of ticks were also collected from leaves, stems, and bark of most dominant trees, namely, Casuarina equisetifolia L. (Forst. and Forst.), Cocos nucifera L., Adansonia digitata L., Musa paradisiaca L., and Azadiracta indica Adr. Juss. Dragging was conducted in sites predominantly occupied by Cynodon dactylon L. (Pers.), Cenchrus ciliaris L., Stenotaphrum dimidiatum L. (Kuntze.) Brongn., and Brachiaria xantholeuca Hack. Ex Schinz Stapf. and Loudetia kagerensis K. Schum. Hutch. Eight tick species were identified, and the collection included Rhipicephalus pravus Dönitz 1910, Rhipicephalus pulchellus Gerstäcker 1873, Hyalomma marginatum rufipes Koch 1844, Amblyomma gemma Dönitz 1910, Amblyomma hebraeum Koch 1844, Amblyomma sparsum Neumann 1899, Amblyomma nuttalli Dönitz 1909, and Boophilus decoloratus Koch 1844. Given that the identified tick species are known to parasitize humans as well as livestock, there exist risks of emergence of zoonotic infections mediated by tick vectors. In the recreational environment of Haller park, where tick vectors share habitats with hosts, there is a need to develop sustainable and effective tick control and management strategies to minimize economic losses that tick infestation may cause.

  6. New quill mites of the family Syringophilidae (Acari: Cheyletoidea).

    Science.gov (United States)

    Bochkov, A V; Fain, A; Skoracki, M

    2004-02-01

    Five new species and two new genera belonging to the family Syringophilidae (Acari: Cheyletoidea) are described from birds that died in the Antwerp Zoo during their quarantine: Charadriaulobia vanelli n. g., n. sp. from Vanellus chilensis (Charadriiformes: Charadriidae) in Brazil; Fritschisyringophilus lonchurae n. g., n. sp. from Lonchura punctulata (Passeriformes: Estrildidae) in India; Mironovia coturnae n. sp. from Coturnix coturnix (Galliformes: Phasianidae) in Europe; Syringophiloidus daberti n. sp. from Passerina ciris (Passeriformes: Emberizidae) in Mexico; and S. serini n. sp. from Serinus mozambicus (Passeriformes: Fringillidae) in Central Africa. Charadriaulobia n. g. differs from the closely related Aulobia Kethley, 1970, in both sexes, by the divergent epimeres I; in females, by the absence of protuberances on the hypostomal apex and by the situation of the bases of setae l4 distinctly anterior the bases of setae d4. Fritschisyringophilus n. g. differs from the closely related Syringophiloidus Kethley, 1972, in both sexes, by the presence of setae vs ' on legs II, the absence of setae dT on legs III and IV; in females, by the presence of median hypostomal protuberances and by short setae l1, l2 and l3. The relationships between the Syringophilidae and their hosts are briefly discussed. A list of all known syringophilid genera and their distribution on bird families is provided.

  7. New Wolbachia supergroups detected in quill mites (Acari: Syringophilidae).

    Science.gov (United States)

    Glowska, Eliza; Dragun-Damian, Anna; Dabert, Miroslawa; Gerth, Michael

    2015-03-01

    Wolbachia is the most abundant intracellular bacterial genus infecting a wide range of arthropods and filarial nematodes. Wolbachia have evolved parasitic, mutualistic and commensal relationships with their hosts but in arthropods generally act as reproductive parasites, inducing a wide range of phenotypic effects such as cytoplasmic incompatibility, parthenogenesis, feminization and male-killing. Up to now, the genus has been divided into 14 supergroups successively named A-O. Here, we describe two new Wolbachia supergroups from syringophilid mites (Acari: Cheyletoidea). These obligatory ectoparasites of birds inhabit the quills of feathers in many avian groups. The species of this family reproduce in a haplodiploid mode sensu arrhenotoky and are usually strongly female-biased. Based on the sequences of four protein-coding genes (ftsZ, gltA and groEL and coxA) and the 16S rRNA we identified strains of three Wolbachia supergroups (F and two distinct, yet undescribed ones) in five quill mite species. Our results suggest that in some cases the distribution of the bacteria can be better correlated with the mite's bird host rather than with mite taxonomy as such. The discovery of two new Wolbachia supergroups not only broadens the knowledge of the diversity of this bacterium but also raises questions about potential effects induced in quill mites and transmission mechanisms of the endosymbionts in this peculiar bacteria-quill mite-bird system.

  8. Ecology of the tick Amblyomma hebraeum Koch in the Eastern Cape Province of South Africa. I. Distribution and seasonal activity.

    Science.gov (United States)

    Norval, R A

    1977-08-01

    In the Eastern Cape Province of South Africa larvae of Amblyomma hebraeum Koch occur in well-drained, shaded habitats, with a ground cover of grass. The life cycle is normally of 3 years duration. Peak larval activity occurs in the summer of the 1st year, peak nymphal activity in the spring of the 2nd year, and peak adult activity in the summer of the 3rd year. Larval activity shows no direct correlation with macroclimate. Adult activity is correlated with, in the following order of signficance, daylength, temperature, and rainfall. Nymphal activity appears to be regulated by the same factors.

  9. Infection of Amblyomma ovale with Rickettsia species Atlantic rainforest in Serra do Mar, São Paulo State, Brazil.

    Science.gov (United States)

    Luz, Hermes Ribeiro; McIntosh, Douglas; Furusawa, Guilherme P; Flausino, Walter; Rozental, Tatiana; Lemos, Elba R S; Landulfo, Gabriel A; Faccini, João Luiz H

    2016-10-01

    Rickettsia rickettsii and Rickettsia sp. strain Atlantic rainforest, that is considered to represent a genetic variant of Rickettsia parkeri, are confirmed as being capable of infecting humans in Brazil. This study reports the detection and characterization, by PCR and nucleotide sequencing, of Rickettsia sp. strain Atlantic rain forest in Amblyomma ovale parasitizing a human, in ticks infesting dogs and in free-living ticks collected from the environment where the human infestation was recorded. The data contribute to our knowledge of infection rates in A. ovale with Rickettsia sp. strain Atlantic rainforest and identified an additional location in the state of São Paulo populated with ticks infected with this emerging pathogen.

  10. Isolation of Tacaribe virus, a Caribbean arenavirus, from host-seeking Amblyomma americanum ticks in Florida.

    Directory of Open Access Journals (Sweden)

    Katherine A Sayler

    Full Text Available Arenaviridae are a family of single stranded RNA viruses of mammals and boid snakes. Twenty-nine distinct mammalian arenaviruses have been identified, many of which cause severe hemorrhagic disease in humans, particularly in parts of sub-Saharan Africa, and in Central and South America. Humans typically become infected with an arenavirus through contact with excreta from infected rodents. Tacaribe virus (TCRV is an arenavirus that was first isolated from bats and mosquitoes during a rabies surveillance survey conducted in Trinidad from 1956 to 1958. Tacaribe virus is unusual because it has never been associated with a rodent host and since that one time isolation, the virus has not been isolated from any vertebrate or invertebrate hosts. We report the re-isolation of the virus from a pool of 100 host-seeking Amblyomma americanum (lone star ticks collected in a Florida state park in 2012. TCRV was isolated in two cell lines and its complete genome was sequenced. The tick-derived isolate is nearly identical to the only remaining isolate from Trinidad (TRVL-11573, with 99.6% nucleotide identity across the genome. A quantitative RT-PCR assay was developed to test for viral RNA in host-seeking ticks collected from 3 Florida state parks. Virus RNA was detected in 56/500 (11.2% of surveyed ticks. As this virus was isolated from ticks that parasitize humans, the ability of the tick to transmit the virus to people should be evaluated. Furthermore, reservoir hosts for the virus need to be identified in order to develop risk assessment models of human infection.

  11. Isolation of Tacaribe virus, a Caribbean arenavirus, from host-seeking Amblyomma americanum ticks in Florida.

    Science.gov (United States)

    Sayler, Katherine A; Barbet, Anthony F; Chamberlain, Casey; Clapp, William L; Alleman, Rick; Loeb, Julia C; Lednicky, John A

    2014-01-01

    Arenaviridae are a family of single stranded RNA viruses of mammals and boid snakes. Twenty-nine distinct mammalian arenaviruses have been identified, many of which cause severe hemorrhagic disease in humans, particularly in parts of sub-Saharan Africa, and in Central and South America. Humans typically become infected with an arenavirus through contact with excreta from infected rodents. Tacaribe virus (TCRV) is an arenavirus that was first isolated from bats and mosquitoes during a rabies surveillance survey conducted in Trinidad from 1956 to 1958. Tacaribe virus is unusual because it has never been associated with a rodent host and since that one time isolation, the virus has not been isolated from any vertebrate or invertebrate hosts. We report the re-isolation of the virus from a pool of 100 host-seeking Amblyomma americanum (lone star ticks) collected in a Florida state park in 2012. TCRV was isolated in two cell lines and its complete genome was sequenced. The tick-derived isolate is nearly identical to the only remaining isolate from Trinidad (TRVL-11573), with 99.6% nucleotide identity across the genome. A quantitative RT-PCR assay was developed to test for viral RNA in host-seeking ticks collected from 3 Florida state parks. Virus RNA was detected in 56/500 (11.2%) of surveyed ticks. As this virus was isolated from ticks that parasitize humans, the ability of the tick to transmit the virus to people should be evaluated. Furthermore, reservoir hosts for the virus need to be identified in order to develop risk assessment models of human infection.

  12. Antibiotic treatment of the tick vector Amblyomma americanum reduced reproductive fitness.

    Directory of Open Access Journals (Sweden)

    Jianmin Zhong

    Full Text Available BACKGROUND: The lone star tick Amblyomma americanum is a common pest and vector of infectious diseases for humans and other mammals in the southern and eastern United States. A Coxiella sp. bacterial endosymbiont was highly prevalent in both laboratory-reared and field-collected A. americanum. The Coxiella sp. was demonstrated in all stages of tick and in greatest densities in nymphs and adult females, while a Rickettsia sp. was less prevalent and in lower densities when present. METHODOLOGY/PRINCIPAL FINDINGS: We manipulated the numbers of both bacterial species in laboratory-reared A. americanum by injecting engorged nymphs or engorged, mated females with single doses of an antibiotic (rifampin or tetracycline or buffer alone. Burdens of the bacteria after molting or after oviposition were estimated by quantitative polymerase chain reaction with primers and probes specific for each bacterial species or, as an internal standard, the host tick. Post-molt adult ticks that had been treated with rifampin or tetracycline had lower numbers of the Coxiella sp. and Rickettsia sp. and generally weighed less than ticks that received buffer alone. Similarly, after oviposition, females treated previously with either antibiotic had lower burdens of both bacterial species in comparison to controls. Treatment of engorged females with either antibiotic was associated with prolonged time to oviposition, lower proportions of ticks that hatched, lower proportions of viable larvae among total larvae, and lower numbers of viable larvae per tick. These fitness estimators were associated with reduced numbers of the Coxiella sp. but not the Rickettsia sp. CONCLUSION/SIGNIFICANCE: The findings indicate that the Coxiella sp. is a primary endosymbiont, perhaps provisioning the obligately hematophagous parasites with essential nutrients. The results also suggest that antibiotics could be incorporated into an integrated pest management plan for control of these and other

  13. Characterization of the bacterial communities of life stages of free living lone star ticks (Amblyomma americanum).

    Science.gov (United States)

    Williams-Newkirk, Amanda Jo; Rowe, Lori A; Mixson-Hayden, Tonya R; Dasch, Gregory A

    2014-01-01

    The lone star tick (Amblyomma americanum) is an abundant and aggressive biter of humans, domestic animals, and wildlife in the southeastern-central USA and an important vector of several known and suspected zoonotic bacterial pathogens. However, the biological drivers of bacterial community variation in this tick are still poorly defined. Knowing the community context in which tick-borne bacterial pathogens exist and evolve is required to fully understand the ecology and immunobiology of the ticks and to design effective public health and veterinary interventions. We performed a metagenomic survey of the bacterial communities of questing A. americanum and tested 131 individuals (66 nymphs, 24 males, and 41 females) from five sites in three states. Pyrosequencing was performed with barcoded eubacterial primers targeting variable 16S rRNA gene regions 5-3. The bacterial communities were dominated by Rickettsia (likely R. amblyommii) and an obligate Coxiella symbiont, together accounting for 6.7-100% of sequences per tick. DNAs from Midichloria, Borrelia, Wolbachia, Ehrlichia, Pseudomonas, or unidentified Bacillales, Enterobacteriaceae, or Rhizobiales groups were also detected frequently. Wolbachia and Midichloria significantly co-occurred in Georgia (p<0.00001), but not in other states. The significance of the Midichloria-Wolbachia co-occurrence is unknown. Among ticks collected in Georgia, nymphs differed from adults in both the composition (p = 0.002) and structure (p = 0.002) of their bacterial communities. Adults differed only in their community structure (p = 0.002) with males containing more Rickettsia and females containing more Coxiella. Comparisons among adult ticks collected in New York and North Carolina supported the findings from the Georgia collection despite differences in geography, collection date, and sample handling, implying that the differences detected are consistent attributes. The data also suggest that some members of the

  14. Characterization of the bacterial communities of life stages of free living lone star ticks (Amblyomma americanum.

    Directory of Open Access Journals (Sweden)

    Amanda Jo Williams-Newkirk

    Full Text Available The lone star tick (Amblyomma americanum is an abundant and aggressive biter of humans, domestic animals, and wildlife in the southeastern-central USA and an important vector of several known and suspected zoonotic bacterial pathogens. However, the biological drivers of bacterial community variation in this tick are still poorly defined. Knowing the community context in which tick-borne bacterial pathogens exist and evolve is required to fully understand the ecology and immunobiology of the ticks and to design effective public health and veterinary interventions. We performed a metagenomic survey of the bacterial communities of questing A. americanum and tested 131 individuals (66 nymphs, 24 males, and 41 females from five sites in three states. Pyrosequencing was performed with barcoded eubacterial primers targeting variable 16S rRNA gene regions 5-3. The bacterial communities were dominated by Rickettsia (likely R. amblyommii and an obligate Coxiella symbiont, together accounting for 6.7-100% of sequences per tick. DNAs from Midichloria, Borrelia, Wolbachia, Ehrlichia, Pseudomonas, or unidentified Bacillales, Enterobacteriaceae, or Rhizobiales groups were also detected frequently. Wolbachia and Midichloria significantly co-occurred in Georgia (p<0.00001, but not in other states. The significance of the Midichloria-Wolbachia co-occurrence is unknown. Among ticks collected in Georgia, nymphs differed from adults in both the composition (p = 0.002 and structure (p = 0.002 of their bacterial communities. Adults differed only in their community structure (p = 0.002 with males containing more Rickettsia and females containing more Coxiella. Comparisons among adult ticks collected in New York and North Carolina supported the findings from the Georgia collection despite differences in geography, collection date, and sample handling, implying that the differences detected are consistent attributes. The data also suggest that some members of

  15. Population and Evolutionary Genomics of Amblyomma americanum, an Expanding Arthropod Disease Vector.

    Science.gov (United States)

    Monzón, Javier D; Atkinson, Elizabeth G; Henn, Brenna M; Benach, Jorge L

    2016-05-12

    The lone star tick, Amblyomma americanum, is an important disease vector and the most frequent tick found attached to humans in the eastern United States. The lone star tick has recently experienced a rapid range expansion into the Northeast and Midwest, but despite this emerging infectious threat to wildlife, livestock, and human health, little is known about the genetic causes and consequences of the geographic expansion. In the first population genomic analysis of any tick species, we characterize the genetic diversity and population structure of A. americanum across its current geographic range, which has recently expanded. Using a high-throughput genotyping-by-sequencing approach, we discovered more than 8,000 single nucleotide polymorphisms in 90 ticks from five locations. Surprisingly, newly established populations in New York (NY) and Oklahoma (OK) are as diverse as historic range populations in North and South Carolina. However, substantial population structure occurs among regions, such that new populations in NY and OK are genetically distinct from historic range populations and from one another. Ticks from a laboratory colony are genetically distinct from wild populations, underscoring the need to account for natural variation when conducting transmission or immunological studies, many of which utilize laboratory-reared ticks. An FST-outlier analysis comparing a recently established population to a long-standing population detected numerous outlier sites, compatible with positive and balancing selection, highlighting the potential for adaptation during the range expansion. This study provides a framework for applying high-throughput DNA sequencing technologies for future investigations of ticks, which are common vectors of diseases.

  16. Minimum infection rate of Ehrlichia minasensis in Rhipicephalus microplus and Amblyomma sculptum ticks in Brazil.

    Science.gov (United States)

    Carvalho, Izabelle T S; Melo, Andréia L T; Freitas, Leodil C; Verçoza, Rodolfo V; Alves, Alvair S; Costa, Jackeliny S; Chitarra, Cristiane S; Nakazato, Luciano; Dutra, Valéria; Pacheco, Richard C; Aguiar, Daniel M

    2016-07-01

    A new genotype phylogenetically close to Ehrlichia canis named as Ehrlichia minasensis was identified infecting cattle and deer in Canada, as well as Rhipicephalus microplus ticks and cattle in Brazil. Although it was detected in R. microplus, little is known about the epidemiology of this ehrlichiosis, especially in other tick species. This study evaluated the minimum infection rate of E. minasensis in Amblyomma sculptum and R. microplus ticks from locations where naturally infected cattle were previously detected. Overall, 45 engorged R. microplus ticks after molting [43 pools of adults (13.4%), and 2 pools of nymphs (4%)], and 42 engorged females post-oviposition (30.6%) (p=0.008) were positive by PCR for Ehrlichia sp. using the dsb, 16S rRNA and TRP36 genes, making a total of 87 R. microplus samples positive for Ehrlichia spp. (17.1%, IC 95% 14.01-20.75%). The partial sequences generated in the present study were 99-100% similar to the dsb DNA sequence of E. minasensis genotypes UFMG-EV and UFMT-BV, respectively, 100% similar to the 16S rRNA sequence of the E. minasensis genotype BOV2010 from Canada, and 99% similar to the TRP36 sequence of the Ehrlichia sp. UFMT-BV. The results of this study confirm the occurrence of transstadial transmission of this agent in R. microplus ticks and highlight the importance of R. microplus in the epidemiology and transmission of ehrlichiosis in cattle. No A. sculptum ticks were positive by PCR for E. minasensis.

  17. Amblyomma maculatum Feeding Augments Rickettsia parkeri Infection in a Rhesus Macaque Model: A Pilot Study.

    Science.gov (United States)

    Banajee, Kaikhushroo H; Embers, Monica E; Langohr, Ingeborg M; Doyle, Lara A; Hasenkampf, Nicole R; Macaluso, Kevin R

    2015-01-01

    Rickettsia parkeri is an emerging eschar-causing human pathogen in the spotted fever group of Rickettsia and is transmitted by the Gulf coast tick, Amblyomma maculatum. Tick saliva has been shown to alter both the cellular and humoral components of the innate and adaptive immune systems. However, the effect of this immunomodulation on Rickettsia transmission and pathology in an immunocompetent vertebrate host has not been fully examined. We hypothesize that, by modifying the host immune response, tick feeding enhances infection and pathology of pathogenic spotted fever group Rickettsia sp. In order to assess this interaction in vivo, a pilot study was conducted using five rhesus macaques that were divided into three groups. One group was intradermally inoculated with low passage R. parkeri (Portsmouth strain) alone (n = 2) and another group was inoculated during infestation by adult, R. parkeri-free A. maculatum (n = 2). The final macaque was infested with ticks alone (tick feeding control group). Blood, lymph node and skin biopsies were collected at several time points post-inoculation/infestation to assess pathology and quantify rickettsial DNA. As opposed to the tick-only animal, all Rickettsia-inoculated macaques developed inflammatory leukograms, elevated C-reactive protein concentrations, and elevated TH1 (interferon-γ, interleukin-15) and acute phase inflammatory cytokines (interleukin-6) post-inoculation, with greater neutrophilia and interleukin-6 concentrations in the tick plus R. parkeri group. While eschars formed at all R. parkeri inoculation sites, larger and slower healing eschars were observed in the tick feeding plus R. parkeri group. Furthermore, dissemination of R. parkeri to draining lymph nodes early in infection and increased persistence at the inoculation site were observed in the tick plus R. parkeri group. This study indicates that rhesus macaques can be used to model R. parkeri rickettsiosis, and suggests that immunomodulatory factors

  18. The ticks (Acari: Ixodida: Argasidae, Ixodidae) of Paraguay.

    Science.gov (United States)

    Nava, S; Lareschi, M; Rebollo, C; Benítez Usher, C; Beati, L; Robbins, R G; Durden, L A; Mangold, A J; Guglielmone, A A

    2007-04-01

    The ticks reported in Paraguay, which are here reviewed, can be categorized as 'endemic or established' (Argas persicus or a sibling species, Ornithodoros hasei, O. rostratus, O. rudis, O. talaje/O. puertoricensis, Amblyomma aureolatum, Am. auricularium, Am. brasiliense, Am. cajennense, Am. calcaratum, Am. coelebs, Am. dissimile, Am. dubitatum, Am. incisum, Am. longirostre, Am. nodosum, Am. ovale, Am. pacae, Am. parvum, Am. pseudoconcolor, Am. rotundatum, Am. scutatum, Am. tigrinum, Am. triste, Dermacentor nitens, Haemaphysalis juxtakochi, H. leporispalustris, Ixodes loricatus, Rhipicephalus microplus, and Rh. sanguineus), 'probably endemic or established' (Ar. miniatus, Ar. monachus, Am. argentinae, Am. humerale, Am. naponense, Am. oblongoguttatum, Am. pseudoparvum, I. aragaoi/I. pararicinus, I. auritulus, I. luciae), or 'erroneously reported from Paraguay' (O. coriaceus, Am. americanum and Am. maculatum). Most Paraguayan tick collections have been made in the Chaco phyto-geographical domain, in the central part of the country. Argas persicus or a related species, Am. cajennense, D. nitens, Rh. microplus and Rh. sanguineus are important parasites of domestic animals. Ornithodoros rudis, Am. aureolatum, Am. brasiliense, Am. cajennense, Am. coelebs, Am. incisum, Am. ovale and Am. tigrinum have all been collected from humans. In terms of public health, the collections of Am. cajennense and Am. triste from humans may be particularly significant, as these species are potential vectors of Rickettsia rickettsii and Ri. parkeri, respectively.

  19. Rhipicephalus sanguineus (ACARI: IXODIDAE) BITING A HUMAN BEING IN PORTOALEGRE CITY, RIO GRANDE DO SUL, BRAZIL

    Science.gov (United States)

    MENTZ, Márcia Bohrer; TROMBKA, Marcelo; da SILVA, Guilherme Liberato; SILVA, Carlos Eugênio

    2016-01-01

    We report the finding of a female brown dog tick, Rhipicephalus sanguineus (Acari: Ixodidae) on the scalp of a male patient in Porto Alegre, Rio Grande do Sul, Brazil. Human parasitism by this tick is rare and has seldomly been reported in the literature, despite its recognized importance since it can act as a vector of Rickettsia rickettsii, the agent of spotted fever. PMID:27074329

  20. A large parasitengonid mite (Acari, Erythraeoidea from the Early Cretaceous Crato Formation of Brazil

    Directory of Open Access Journals (Sweden)

    J. A. Dunlop

    2007-08-01

    Full Text Available A new large, fossil mite (Arachnida: Acari, Pararainbowia martilli n. gen. n. sp., is described from the Early Cretaceous (Aptian Crato Formation from Ceará State, Brazil. It is assigned to the Cohort Parasitengona and the superfamily Erythraeoidea, some extant members of which can reach up to seven millimetres in body length. Given that doubts have been raised about the identity of putative Crato feather mite eggs, this new fossil represents the first unequivocal record of Acari from the Crato Formation, the first non-amber record of an erythraeoid mite and the oldest named example of this superfamily. Fossil erythraeoids from Mesozoic and Tertiary ambers are briefly reviewed – including a widely overlooked Late Cretaceous species – with comments on Mesozoic mites in general. Thirteen Baltic amber erythraeoids have been formally described, but much unstudied material from various amber sources remains. Ein neues großes Milbenfossil (Arachnida: Acari, Pararainbowia martilli n. gen. n. sp., wird aus der Crato Formation (Unterkreide, Aptium des Ceará Gebietes in Brasilien beschrieben. Es wird der Kohorte Parasitengona und der Überfamilie Erythraeoidea zugeordnet; die modernen Vertreter erreichen eine Körperlänge bis zu sieben mm. Weil die Identität von Federmilbeneiern aus der Crato Formation in Frage gestellt wurde, ist dieser Neufund der erste klare Hinweis von Acari aus der Crato Formation. Es ist die erste erythraeoide Milbe, die nicht aus dem Bernstein stammt sowie das älteste genannte Beispiel dieser Überfamilie. Fossile erythraeoide Milben aus dem Bernstein des Mesozoikum und des Tertiärs werden kurz zusammengefasst – u. a. eine weitgehend übersehene Art aus der Oberkreide – mit allgemeinen Anmerkungen zu den mesozoischen Milben. Dreizehn erythraeoide Milbenarten sind aus dem baltischen Bernstein genannt und beschrieben worden, aber weiteres unbearbeitetes Material von verschiedenen Bernstein-Fundpunkten liegt noch vor

  1. De corticole fauna van platanen: i. Arachniden (Arachnida: Araneae, Pseudoscorpiones, Acari)

    OpenAIRE

    Noordijk, J.; Berg, M.P.

    2001-01-01

    The corticolous fauna of plane trees: I. Arachnids (Arachnida: Araneae, Pseudoscorpiones, Acari) From February until September 2000 an inventory was made of the bark-dwelling arthropod fauna of more than 400 plane trees (Platanus hybrida), all over the Netherlands. Arthropods were collected from bark and under the ‘loose’ bark fragments at a height of 160-175 cm from the ground. Algae, mosses and fungi are important resources for the corticolous fauna. Crevices in the tree trunk and loose bar...

  2. Acaricide resistance in Tetranychus urticae (Acari: Tetranychidae) populations from Cyprus.

    Science.gov (United States)

    Vassiliou, Vassilis A; Kitsis, Pavlos

    2013-08-01

    Five field and greenhouse populations of the twospotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae), were collected from five different districts across the island of Cyprus, both in field and greenhouse crops, and tested to determine levels of resistance. Standard leaf-disk spray application bioassay procedures were used to determine the LC50s for five chemicals: abamectin, acrinathrin, fenazaquin, pirimiphos methyl, and bifenazate. Selection of these compounds was based on the widespread use by farmers as well as on the frequent control failures against T. urticae reported in the past. Resistance of T. urticae was detected to abamectin, acrinathrin, fenazaquin, and pirimiphos methyl. The resistance ratios were calculated relative to the German susceptible reference strain. The highest resistance ratios at LC50 value were recorded for abamectin in a greenhouse rose population (RR = 3822), followed by a field bean (RR = 1356) and field tomato population (RR = 1320). Significantly high resistance levels were also found for acrinathrin where the highest resistance ratios at LC50 were recorded in a field bean T. urticae population (RR = 903). For fenazaquin, the highest resistance levels were recorded in a field tomato population (RR = 310). Lower resistance levels were found for pirimiphos methyl (13.3 < RR < 77.4) in all populations. Low susceptibility of T. urticae was observed for bifenazate (2.7 < RR < 24.4) in all populations. These results suggest that at least the use of abamectin and acrinathrin should be avoided or minimized for the control of T. urticae populations in indoor and outdoor environments.

  3. [Transfer of exotic ticks (Acari: ixodida) on reptiles (Reptilia) imported to Poland].

    Science.gov (United States)

    2009-01-01

    In the of period 2003-2007, a total of 382 specimens of reptiles belonging to the following genera were investigated: Testudo, Iguana, Varanus, Gongylophis, Python, Spalerosophis, Psammophis. The material for the present study was a collection of reptiles owned by the "Animals" Ltd from Swietochłowice (Upper Silesia, Poland), specialising in import of exotic animals to Poland, as well as the reptile collections of private breeders. The reptiles that turned out to be the most heavily infected with ticks were the commonly bred terrarium reptiles: Varanus exanthematicus and Python regius and they were imported to Poland from Ghana, Africa. Exotic reptiles are also imported from Southern Europe, Asia and Central America. The presently reported study helped to confirm the fact of transfer of exotic ticks on reptiles to Poland. A total of 2104 tick specimens, representing all stages of development (males, females, nymphs, larvae), were collected. They represented species of the genera Amblyomma and Hyalomma. The following species were found: Amblyomma exornatum Koch, 1844, Amblyomma flavomaculatum (Lucas, 1846), Amblyomma latum Koch, 1844, Amblyomma nuttalli Dönitz, 1909, Amblyomma quadricavum Schulze, 1941, Amblyomma transversale (Lucas, 1844), Amblyomma varanense (Supino, 1897), Amblyomma spp. Koch, 1844, Hyalomma aegyptium (Linnaeus, 1758). All the species of ticks of genus Ambylomma revealed have been discovered in Poland for the first time. The overall prevalence of infection was 77.6%. The highest prevalence value (81.2%) was observed on pythons (Python regius) and (78.7%) on monitor lizards (Varanus exanthematicus). The highest number of ticks was collected from Python regius and Varanus exanthematicus. The mean infection intensity for V. exanthematicus was 7.6 ticks per host, while for P. regius the intensity reached 4.7 ticks. The most abundant tick transferred to Poland on a host was an African tick, Amblyomma latum. Fifty eight specimens of monitor lizards

  4. Amblyomma americanum as a Bridging Vector for Human Infection with Francisella tularensis.

    Directory of Open Access Journals (Sweden)

    Rinosh J Mani

    Full Text Available The γ-proteobacterium Francisella tularensis causes seasonal tick-transmitted tularemia outbreaks in natural rabbit hosts and incidental infections in humans in the south-central United States. Although Dermacentor variabilis is considered a primary vector for F. tularensis, Amblyomma americanum is the most abundant tick species in this endemic region. A systematic study of F. tularensis colonization of A. americanum was undertaken to better understand its potential to serve as an overwintering reservoir for F. tularensis and as a bridging vector for human infections. Colony-reared A. americanum were artificially fed F. tularensis subspecies holarctica strain LVS via glass capillaries and colonization levels determined. Capillary-fed larva and nymph were initially infected with 10(4 CFU/tick which declined prior to molting for both stages, but rebounded post-molting in nymphs and persisted in 53% at 10(3 to 10(8 CFU/nymph at 168 days post-capillary feeding (longest sampling time in the study. In contrast, only 18% of adults molted from colonized nymphs maintained LVS colonization at 10(1 to 10(5 CFU/adult at 168 days post-capillary feeding (longest sampling time. For adults, LVS initially colonized the gut and disseminated to salivary glands by 24 h and had an ID50 of <5CFU in mice. Francisella tularensis infected the ovaries of gravid females, but transmission to eggs was infrequent and transovarial transmission to hatched larvae was not observed. The prolonged persistence of F. tularensis in A. americanum nymphs supports A. americanum as an overwintering reservoir for F. tularensis from which seasonal epizootics may originate; however, although the rapid dissemination of F. tularensis from gut to salivary glands in adults A. americanum is compatible with intermittent feeding adult males acting as bridging vectors for incidental F. tularensis infections of humans, acquisition of F. tularensis by adults may be unlikely based on adult feeding

  5. Ticks (Acari: Ixodidae on wild animals from the Porto-Primavera Hydroelectric power station area, Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo B Labruna

    2002-12-01

    Full Text Available From June 2000 to June 2001, a total of 741 ticks were collected from 51 free-living wild animals captured at the Porto-Primavera Hydroelectric power station area, located alongside an approximately 180 km course of the Paraná river, between the states of São Paulo and Mato Grosso do Sul, comprising 9 species of 3 genera: Ambly-omma (7 species, Boophilus (1 and Anocentor (1. A total of 421 immature Amblyomma ticks were reared in laboratory until the adult stage, allowing identification of the species. A. cajennense was the most frequent tick species (mostly immature stages collected on 9 host species: Myrmecophaga tridactyla, Tamandua tetradactyla,Cerdocyon thous, Puma concolor,Tayassu tajacu, Mazama gouazoubira,Hydrochaeris hydrochaeris,Alouatta caraya, Cebus apella. Other tick species were less common, generally restricted to certain host taxa.

  6. [Interrelatio of acari Ixodidae and hosts of Edentata of the Serra da Canastra, Minas Gerais, Brazil].

    Science.gov (United States)

    Botelho, J R; Linardi, P M; da Encarnação, C D

    1989-01-01

    We received for examination a small colection of ticks captured in the National Park of the Serra da Canastra (MG), between 1979 and 1980. The authors demonstrated the existence of a broad co-accomodation of Amblyomma pseudoconcolor on Edentata of the family Dasypodidae, being Dasypodini the tribe more adjusted to this infestation. In conformity to the Figs 1 and 2, Dasypodini are probably the real hosts of A. pseudoconcolor and also the oldest hosts. For the first time, A. pseudoconcolor is also recorded on Cabassous tatouay, C. unicinctus, Priodontes maximus and Euphractus sexcincuts. Also for the first time A. pseudoconcolor and Amblyomma calcaratum were recorded in the State of Minas Gerais. The ectoparasites are deposited in the "Departamento de Parasitologia da Universidade Federal de Minas Gerais, Brasil".

  7. Ticks (Acari: Ixodidae) on wild animals from the Porto-Primavera Hydroelectric power station area, Brazil.

    Science.gov (United States)

    Labruna, Marcelo B; de Paula, Cátia D; Lima, Thiago F; Sana, Dênis A

    2002-12-01

    From June 2000 to June 2001, a total of 741 ticks were collected from 51 free-living wild animals captured at the Porto-Primavera Hydroelectric power station area, located alongside an approximately 180 km course of the Paran river, between the states of S o Paulo and Mato Grosso do Sul, comprising 9 species of 3 genera: Ambly-omma (7 species), Boophilus (1) and Anocentor (1). A total of 421 immature Amblyomma ticks were reared in laboratory until the adult stage, allowing identification of the species. A. cajennense was the most frequent tick species (mostly immature stages) collected on 9 host species: Myrmecophaga tridactyla, Tamandua tetradactyla,Cerdocyon thous, Puma concolor,Tayassu tajacu, Mazama gouazoubira,Hydrochaeris hydrochaeris,Alouatta caraya, Cebus apella. Other tick species were less common, generally restricted to certain host taxa.

  8. A new species of Atractides Koch, 1837 (Acari: Hydrachnidia, Hygrobatidae from Ethiopia, with a discussion on the biodiversity of the genus Atractides in the Afrotropical region

    Directory of Open Access Journals (Sweden)

    Vladimir Pesic

    2011-03-01

    Full Text Available A new species of Atractides Koch, 1837 (Acari, Hydrachnidia is described from Ethiopia. The world number of Atractides now tallies 297 species. The diversity of the genus Atractides in the Afrotropical region is briefly discussed.

  9. Garrapatas (Acari: Ixodidae) en perros de la ciudad de Concepción, Chile Ticks (Acari: Ixodidae) on dogs in Concepción city, Chile

    OpenAIRE

    Muñoz, L.; M. E. CASANUEVA

    2002-01-01

    Con la finalidad de determinar las especies de garrapatas que parasitan a los perros de la ciudad de Concepción, se extrajeron 137 garrapatas desde perros de ocho clínicas veterinarias de cuatro comunas de la ciudad de Concepción. Los ejemplares encontradas fueron observados mediante lupa estereoscópica y algunos fotografiados a microscopio electrónico. Como resultados se obtuvo que el 38.7% correspondían a Amblyomma tigrinum adultos y el 61.3% a Rhipicephalus sanguineus adultos e inmadurosA ...

  10. Maximum Entropy-Based Ecological Niche Model and Bio-Climatic Determinants of Lone Star Tick (Amblyomma americanum) Niche.

    Science.gov (United States)

    Raghavan, Ram K; Goodin, Douglas G; Hanzlicek, Gregg A; Zolnerowich, Gregory; Dryden, Michael W; Anderson, Gary A; Ganta, Roman R

    2016-03-01

    The potential distribution of Amblyomma americanum ticks in Kansas was modeled using maximum entropy (MaxEnt) approaches based on museum and field-collected species occurrence data. Various bioclimatic variables were used in the model as potentially influential factors affecting the A. americanum niche. Following reduction of dimensionality among predictor variables using principal components analysis, which revealed that the first two principal axes explain over 87% of the variance, the model indicated that suitable conditions for this medically important tick species cover a larger area in Kansas than currently believed. Soil moisture, temperature, and precipitation were highly correlated with the first two principal components and were influential factors in the A. americanum ecological niche. Assuming that the niche estimated in this study covers the occupied distribution, which needs to be further confirmed by systematic surveys, human exposure to this known disease vector may be considerably under-appreciated in the state.

  11. Rickettsia parkeri Rickettsiosis in Different Ecological Regions of Argentina and Its Association with Amblyomma tigrinum as a Potential Vector

    Science.gov (United States)

    Romer, Yamila; Nava, Santiago; Govedic, Francisco; Cicuttin, Gabriel; Denison, Amy M.; Singleton, Joseph; Kelly, Aubree J.; Kato, Cecilia Y.; Paddock, Christopher D.

    2014-01-01

    Rickettsia parkeri, a newly recognized tick-borne pathogen of humans in the Americas, is a confirmed cause of spotted fever group rickettsiosis in Argentina. Until recently, almost all cases of R. parkeri rickettsiosis in Argentina have originated from the Paraná River Delta, where entomological surveys have identified populations of R. parkeri-infected Amblyomma triste ticks. In this report, we describe confirmed cases of R. parkeri rickettsiosis from Córdoba and La Rioja provinces, which are located several hundred kilometers inland, and in a more arid ecological region, where A. triste ticks do not occur. Additionally, we identified questing A. tigrinum ticks naturally infected with R. parkeri in Córdoba province. These data provide evidence that another human-biting tick species serves as a potential vector of R. parkeri in Argentina and possibly, other countries of South America. PMID:25349376

  12. Molecular detection of the human pathogenic Rickettsia sp. strain Atlantic rainforest in Amblyomma dubitatum ticks from Argentina.

    Science.gov (United States)

    Monje, Lucas D; Nava, Santiago; Eberhardt, Ayelen T; Correa, Ana I; Guglielmone, Alberto A; Beldomenico, Pablo M

    2015-02-01

    To date, three tick-borne pathogenic Rickettsia species have been reported in different regions of Argentina, namely, R. rickettsii, R. parkeri, and R. massiliae. However, there are no reports available for the presence of tick-borne pathogens from the northeastern region of Argentina. This study evaluated the infection with Rickettsia species of Amblyomma dubitatum ticks collected from vegetation and feeding from capybaras (Hydrochoerus hydrochaeris) in northeastern Argentina. From a total of 374 A. dubitatum ticks collected and evaluated by PCR for the presence of rickettsial DNA, 19 were positive for the presence of Rickettsia bellii DNA, two were positive for Rickettsia sp. strain COOPERI, and one was positive for the pathogenic Rickettsia sp. strain Atlantic rainforest. To our knowledge, this study is the first report of the presence of the human pathogen Rickettsia sp. strain Atlantic rainforest and Rickettsia sp. strain COOPERI in Argentina. Moreover, our findings posit A. dubitatum as a potential vector for this pathogenic strain of Rickettsia.

  13. Borrelia sp. phylogenetically different from Lyme disease- and relapsing fever-related Borrelia spp. in Amblyomma varanense from Python reticulatus.

    Science.gov (United States)

    Trinachartvanit, Wachareeporn; Hirunkanokpun, Supanee; Sudsangiem, Ronnayuth; Lijuan, Wanwisa; Boonkusol, Duangjai; Baimai, Visut; Ahantarig, Arunee

    2016-06-24

    Species of the genus Borrelia are causative agents of Lyme disease and relapsing fever. Lyme disease is the most commonly reported vector-borne disease in the northern hemisphere. However, in some parts of the world Lyme borreliosis and relapsing fever may be caused by novel Borrelia genotypes. Herein, we report the presence of a Borrelia sp. in an Amblyomma varanense collected from Python reticulatus. Ticks were collected from snakes, identified to species level and examined by PCR for the presence of Borrelia spp. flaB and 16S rRNA genes. Phylogenetic trees were constructed using the neighbour-joining method. Three A. varanense ticks collected from P. reticulatus were positive for a unique Borrelia sp., which was phylogenetically divergent from both Lyme disease- and relapsing fever-associated Borrelia spp. The results of this study suggest for the first time that there is a Borrelia sp. in A. varanense tick in the snake P. reticulatus that might be novel.

  14. Amblyomma sculptum tick saliva: α-Gal identification, antibody response and possible association with red meat allergy in Brazil.

    Science.gov (United States)

    Araujo, Ricardo Nascimento; Franco, Paula Ferreira; Rodrigues, Henrique; Santos, Luiza C B; McKay, Craig S; Sanhueza, Carlos A; Brito, Carlos Ramon Nascimento; Azevedo, Maíra Araújo; Venuto, Ana Paula; Cowan, Peter J; Almeida, Igor C; Finn, M G; Marques, Alexandre F

    2016-03-01

    The anaphylaxis response is frequently associated with food allergies, representing a significant public health hazard. Recently, exposure to tick bites and production of specific IgE against α-galactosyl (α-Gal)-containing epitopes has been correlated to red meat allergy. However, this association and the source of terminal, non-reducing α-Gal-containing epitopes have not previously been established in Brazil. Here, we employed the α-1,3-galactosyltransferase knockout mouse (α1,3-GalT-KO) model and bacteriophage Qβ-virus like particles (Qβ-VLPs) displaying Galα1,3Galβ1,4GlcNAc (Galα3LN) epitopes to investigate the presence of α-Gal-containing epitopes in the saliva of Amblyomma sculptum, a species of the Amblyomma cajennense complex, which represents the main tick that infests humans in Brazil. We confirmed that the α-1,3-galactosyltransferase knockout animals produce significant levels of anti-α-Gal antibodies against the Galα1,3Galβ1,4GlcNAc epitopes displayed on Qβ-virus like particles. The injection of A. sculptum saliva or exposure to feeding ticks was also found to induce both IgG and IgE anti-α-Gal antibodies in α-1,3-galactosyltransferase knockout mice, thus indicating the presence of α-Gal-containing epitopes in the tick saliva. The presence of α-Gal-containing epitopes was confirmed by ELISA and immunoblotting following removal of terminal α-Gal epitopes by α-galactosidase treatment. These results suggest for the first known time that bites from the A. sculptum tick may be associated with the unknown etiology of allergic reactions to red meat in Brazil.

  15. Effect of coconut palm proximities and Musa spp. germplasm resistance to colonization by Raoiella indica (Acari: Tenuipalpidae)

    Science.gov (United States)

    Although coconut (Cocos nucifera L.) is the predominant host for Raoiella indica Hirst (Acari: Tenuipalpidae), false spider mite infestations do occur on bananas and plantains (Musa spp. Colla). Since its introduction, the banana and plantain industries have been negatively impacted to different deg...

  16. The first record of the watermite Arrenurus beolinensis from the Netherlands, with the first description of the female (Acari: Hydrachnidia).

    NARCIS (Netherlands)

    Smit, H.; Didderen, K.; Wiggers, R.

    2007-01-01

    De watermijt Arrenurus berolinensis in Nederland, met de eerste beschrijving van het vrouwtje (Acari: Hydrachnidia) De zeer zeldzame watermijt Arrenurus berolinensis is in 2006 voor het eerst in Nederland gevonden, in een petgat in de Wieden (Overijssel). Tot nu toe was deze soort slechts twee keer

  17. Novel bacterial pathogen Acaricomes phytoseiuli causes severe disease symptoms and histopathological changes in the predatory mite Phytoseiulus persimilis (Acari, Phytoseiidae)

    NARCIS (Netherlands)

    Schütte, C.; Gols, R.; Kleespies, R.G.; Poitevin, O.J.L.; Dicke, M.

    2008-01-01

    Adult female Phytoseiulus persimilis Athias-Henriot (Acari, Phytoseiidae) of a laboratory population show a set of characteristic symptoms, designated as non-responding (NR) syndrome. Mature predators shrink, cease oviposition and die. They show a lower degree of attraction to herbivore-induced

  18. The presence of webbing affects the oviposition rate of two-spotted spider mites, Tetranychus urticae (Acari: Tetranychidae)

    NARCIS (Netherlands)

    Oku, K.; Magalhães, S.; Dicke, M.

    2009-01-01

    Several species of tetranychid mites including Tetranychus urticae Koch (Acari: Tetranychidae) construct complicated three-dimensional webs on plant leaves. These webs provide protection against biotic and abiotic stress. As producing web is likely to entail a cost, mites that arrive on a leaf with

  19. New Australian hygrobatids (Acari: Hydrachnidia: Hygrobatidae), with the description of two new genera and three new species

    NARCIS (Netherlands)

    Smit, H.

    2009-01-01

    Two new genera of the water mite family Hygrobatidae (Acari: Hydrachnidia) are described from Australia, Ioannibates gen. nov. and Pseudoaustraliobates gen. nov.. In addition, three new species are described, Ioannibates papillosus sp. nov., Pseudoaustraliobates flindersi sp. nov. and the second spe

  20. Comparative speed of kill of sarolaner (Simparica™) and afoxolaner (NexGard®) against induced infestations of Amblyomma americanum on dogs

    OpenAIRE

    Six, Robert H.; Everett, William R.; Chapin, Sara; Mahabir, Sean P.

    2016-01-01

    Background The lone star tick, Amblyomma americanum, infests dogs and cats in North America and is the vector of the pathogens that cause monocytic and granulocytic ehrlichiosis in dogs and humans. A parasiticide’s speed of kill is important to minimize the direct and deleterious effects of tick infestation and especially to reduce the risk of transmission of tick-borne pathogens. In this study, speed of kill of a novel orally administered isoxazoline parasiticide, sarolaner (Simparica™ chewa...

  1. A prevalent alpha-proteobacterium Paracoccus sp. in a population of the Cayenne ticks (Amblyomma cajennense) from Rio de Janeiro, Brazil

    OpenAIRE

    Erik Machado-Ferreira; Joseph Piesman; Zeidner, Nordin S; Soares, Carlos A.G.

    2012-01-01

    As Rocky Mountain Spotted Fever is the most common tick-borne disease in South America, the presence of Rickettsia sp. in Amblyomma ticks is a possible indication of its endemicity in certain geographic regions. In the present work, bacterial DNA sequences related to Rickettsia amblyommii genes in A. dubitatum ticks, collected in the Brazilian state of Mato Grosso, were discovered. Simultaneously, Paracoccus sp. was detected in aproximately 77% of A. cajennense specimens collected in Rio de J...

  2. Primary embryonic cells of Rhipicephalus microplus and Amblyomma cajennense ticks as a substrate for the development of Borrelia burgdorferi (strain G39/40)

    OpenAIRE

    Rezende,J.; CP. Rangel; NC. Cunha; AH. Fonseca

    2012-01-01

    Borrelia burgdorferi, the agent of Lyme borreliosis, is a spirochetes transmitted by ticks to humans and animals. Its cultivation in vitro in tick cells allows studies of its biology and provides methodology for future research in Brazil, and for the isolation of Borrelia spp. We examined in vitro the characteristics of embryonic cells of Rhipicephalus microplus and Amblyomma cajennense in cell culture and investigated the suitability of embryonic cells as a substrate for cultivation of B. bu...

  3. Seroprevalence of Rickettsia spp. in Equids and Molecular Detection of 'Candidatus Rickettsia amblyommii' in Amblyomma cajennense Sensu Lato Ticks From the Pantanal Region of Mato Grosso, Brazil.

    Science.gov (United States)

    Alves, Alvair Da S; Melo, Andréia L T; Amorim, Marcus V; Borges, Alice M C M; Gaíva E Silva, Lucas; Martins, Thiago F; Labruna, Marcelo B; Aguiar, Daniel M; Pacheco, Richard C

    2014-11-01

    The aim of the study was to evaluate exposure of equids to rickettsial agents (Rickettsia rickettsii, Rickettsia parkeri, 'Candidatus Rickettsia amblyommii', Rickettsia rhipicephali, and Rickettsia bellii) and rickettsial infection in ticks of a Pantanal region of Brazil. Sera of 547 equids (500 horses and 47 donkeys) were evaluated by indirect immunofluorescence assay. In total, 665 adults and 106 nymphal pools of Amblyomma cajennense F. sensu lato, 10 Dermacentor nitens Neumann ticks, and 88 larval pools of Amblyomma sp. were tested by polymerase chain reaction (PCR). Overall, 337 (61.6%) equids were reactive (titer ≥64) to at least one antigen of Rickettsia spp. The prevalence values for Rickettsia were 66%, and the highest endpoint titers were observed for 'Ca. R. amblyommii'. By PCR 3 (0.45%) A. cajennense s.l. females were positive for 'Ca. R. amblyommii'. Minimum infection rates of 0.75% for nymphs and 0.34% for larvae were calculated. Positive samples of ticks have had a fragment of the 16S mitochondrial rRNA gene sequenced and sequences showed 99% identity to Amblyomma sculptum Berlese. This study reports a wide exposure of equids to Rickettsia agents, and PCR evidence of infection with 'Ca. R. amblyommii', for the first time, in A. sculptum.

  4. A rare finding of mites (Arachnida: Acari: Leeuwenhoekiidae) parasitising a whip spider (Arachnida: Amblypygi: Charinidae).

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Giupponi, Alessandro P L; Hernandes, Fabio A

    2014-04-01

    Twelve larvae of unidentified species of Odontacarus Ewing, 1929 (Acari: Leeuwenhoekiidae) were found parasitising an adult male whip spider Charinus brasilianus Weygoldt (Charinidae) in Santa Teresa, mountainous region of Espirito Santo state, southeastern Brazil. These larvae occurred in the intersegmental membrane of prosoma and legs. This is the first report of ectoparasitic mites infecting a charinid whip spider and the first record of leeuwenhoekiid mites parasitising an invertebrate host. We suggest that future studies are essential to understand the reasons why these events of parasitism are so rare in the order Amblypygi.

  5. New and little known species of Halolaelaps (Acari: Mesostigmata: Halolaelapidae) from Ukraine.

    Science.gov (United States)

    Trach, Viacheslav A

    2016-08-23

    A new species of the family Halolaelapidae (Acari: Mesostigmata), Halolaelaps euxinus sp. nov. is described from Black Sea coast. Adult mites were found in seaweed, while deutonymphs were collected from the amphipod Talorchestia deshayesii and from seaweed. The adult female of Halolaelaps saproincisus Hirschmann & Götz, 1968 is recorded in new localities of Ukraine for the first time, in soil and bird faeces in chicken coops, and new morphological information is provided. The adult male (collected from chicken coops) and the deutonymph (collected from chicken coops and on dung-beetles) of H. saproincisus are described for the first time.

  6. Mites (Acari Associated with the Desert Seed Harvester Ant, Messor pergandei (Mayr

    Directory of Open Access Journals (Sweden)

    Kaitlin A. Uppstrom

    2011-01-01

    Full Text Available Mites (Acari associated with the seed harvester ant Messor pergandei were investigated in the Sonoran desert of Arizona. At least seven representatives of the mite genera Armacarus, Lemanniella, Petalomium, Forcellinia, Histiostoma, Unguidispus, and Cosmoglyphus are phoretically associated with M. pergandei. Most of these morphospecies show preference for specific phoretic attachment sites and primarily use female alates rather than male alates for dispersal. Five mite morphospecies were found in low numbers inhabiting the chaff piles: Tydeidae sp., Procaeculus sp., Anystidae sp., Bakerdania sp., and Tetranychidae sp. The phoretic Petalomium sp. was observed consuming fungus growing on a dead queen, but the roles of the other mite species remain mostly unresolved.

  7. Description of Lyrifissella gen. n. and Lyrifissellidae fam. n. (Acari, Oribatei

    Directory of Open Access Journals (Sweden)

    Adilson D. Paschoal

    1989-01-01

    Full Text Available Lyrifissella new genus and Lyrifissellidae new family (Acari, Oribatei are described. The type species, Pedrocortesella latoclava Hammer, 1966, from Milford, New Zealand, is fully redescribed from the holotype. The congeneric species, Pedrocortesella cryptonota Hammer, 1966, Lake Ratoitis, New Zealand, is compared with the type species and transferred to the new genus. Plateremaeus vestitus Tragardh, 1931, the species thought to be very close to Plateremaeus ornatissimus (Berlese, and which was erroneously used to characterize Plateremaeus and Plateremaeidae, causing them to be misunderstood for about five decades, is now placed in Lyrifissella.

  8. Molecular Detection of Rickettsia Species Within Ticks (Acari: Ixodidae) Collected from Arkansas United States.

    Science.gov (United States)

    Trout Fryxell, R T; Steelman, C D; Szalanski, A L; Billingsley, P M; Williamson, P C

    2015-05-01

    Rocky Mountain spotted fever (RMSF), caused by the etiological agent Rickettsia rickettsii, is the most severe and frequently reported rickettsial illness in the United States, and is commonly diagnosed throughout the southeast. With the discoveries of Rickettsia parkeri and other spotted fever group rickettsiae (SFGR) in ticks, it remains inconclusive if the cases reported as RMSF are truly caused by R. rickettsii or other SFGR. Arkansas reports one of the highest incidence rates of RMSF in the country; consequently, to identify the rickettsiae in Arkansas, 1,731 ticks, 250 white-tailed deer, and 189 canines were screened by polymerase chain reaction (PCR) for the rickettsial genes gltA, rompB, and ompA. None of the white-tailed deer were positive, while two of the canines (1.1%) and 502 (29.0%) of the ticks were PCR positive. Five different tick species were PCR positive: 244 (37%) Amblyomma americanum L., 130 (38%) Ixodes scapularis Say, 65 (39%) Amblyomma maculatum (Koch), 30 (9%) Rhipicephalus sanguineus Latreille, 7 (4%) Dermacentor variabilis Say, and 26 (44%) unidentified Amblyomma ticks. None of the sequenced products were homologous to R. rickettsii. The most common Rickettsia via rompB amplification was Rickettsia montanensis and nonpathogenic Candidatus Rickettsia amblyommii, whereas with ompA amplification the most common Rickettsia was Ca. R. amblyommii. Many tick specimens collected in northwest Arkansas were PCR positive and these were commonly A. americanum harboring Ca. R. amblyommii, a currently nonpathogenic Rickettsia. Data reported here indicate that pathogenic R. rickettsii was absent from these ticks and suggest by extension that other SFGR are likely the causative agents for Arkansas diagnosed RMSF cases.

  9. Phytoseiid mites of the Canary Islands (Acari, Phytoseiidae. II. Tenerife and La Gomera Islands

    Directory of Open Access Journals (Sweden)

    Ferragut, F.

    2007-12-01

    Full Text Available Phytoseiid mites (Acari, Phytoseiidae inhabiting plants in natural ecosystems from Tenerife and La Gomera islands (Canary Islands have been studied. Surveys were conducted from 1997 to 2002. Eleven species were collected, one of them being reported for the first time from the Canary Islands and six of them reported for the first time from Tenerife and La Gomera islands. Euseius machadoi n. sp. collected from woody plants in the Canarian laurisilva is proposed as a new species.

    En muestreos realizados desde 1997 hasta 2002 se ha estudiado la fauna de ácaros fitoseidos (Acari, Phytoseiidae asociada a plantas de ecosistemas naturales de las islas de Tenerife y La Gomera (Islas Canarias. Se han recolectado un total de 11 especies, siendo una de ellas citada por vez primera en las islas Canarias y seis de ellas citadas por primera vez en las islas de Tenerife y La Gomera. Euseius machadoi n. sp., recolectado en plantas leñosas de la laurisilva canaria, se propone como una nueva especie.

  10. Repellent efficacy of DEET, Icaridin, and EBAAP against Ixodes ricinus and Ixodes scapularis nymphs (Acari, Ixodidae).

    Science.gov (United States)

    Büchel, Kerstin; Bendin, Juliane; Gharbi, Amina; Rahlenbeck, Sibylle; Dautel, Hans

    2015-06-01

    Repellent efficacy of 10% EBAAP (3-[N-butyl-N-acetyl]-aminopropionic acid, ethyl ester) and 10% Icaridin ((2-(2-hydroxyethyl)-1-piperidinecarboxylic acid 1-methylpropyl ester)) were evaluated against 20% DEET (N,N-diethyl-3-methylbenzamide) in human subject trials against ticks. Responses of host-seeking nymphs of the European castor bean tick (Ixodes ricinus L.; Acari: Ixodidae) and the North American blacklegged tick (I. scapularis Say; Acari: Ixodidae) were compared. Tests were carried out according to the US-EPA standard protocol with ethanolic solutions of the active ingredients of repellents being applied to the forearm of 10 volunteers. The upward movement of ticks was monitored until repellent failure taking up to 12.5 h. Application of 20% DEET resulted in median complete protection times (CPT; Kaplan-Meier median) between 4 and 4.5 h, while 10% EBAAP yielded CPTs of 3.5-4h. No significant differences were found between the efficacies of two repellents nor between the two species tested. The median of the CPT of a 10% Icaridin solution was 5h in nymphs of I. scapularis, but 8h in those of I. ricinus (Prepellent activity against nymphs of the two Ixodes ticks with Icaridin demonstrating particularly promising results against I. ricinus. Future research should investigate whether similar results occur when adult Ixodes ticks or other tick species are tested.

  11. Reproductive parameters of Phytoseiulus macropilis (Banks fed with Tetranychus urticae Koch (Acari: Phytoseiidae, Tetranychidae in laboratory

    Directory of Open Access Journals (Sweden)

    G. C. Souza-Pimentel

    Full Text Available Abstract Predatory mites that belong to the Phytoseiidae family are one of the main natural enemies of phytophagous mites, thus allowing for their use as a biological control. Phytoseiulus macropilis (Banks, 1904 (Acari: Phytoseiidae is among the main species of predatory mites used for this purpose. Tetranychus urticae Koch, 1836 (Acari: Tetranychidae is considered to be one of the most important species of mite pests and has been described as attacking over 1,100 species of plants in 140 families with economic value. The objective of the present study was to investigate, in the laboratory, the reproductive parameters of the predatory mite P. macropilis when fed T. urticae. Experiments were conducted under laboratory conditions at 25 ± 2 °C of temperature, 70 ± 10% RH and 14 hours of photophase. In addition, biological aspects were evaluated and a fertility life table was established. The results of these experiments demonstrated that the longevity of adult female was 27.5 days and adult male was 29.0 days. The population was estimated to increase approximately 27 times (Ro in mean generation time (T, which was 17.7 days. Lastly, the mite population grew 1.2 times/day (λ and doubled every 3.7 days (TD.

  12. Presence, genetic variability, and potential significance of "Candidatus Midichloria mitochondrii" in the lone star tick Amblyomma americanum.

    Science.gov (United States)

    Williams-Newkirk, Amanda Jo; Rowe, Lori A; Mixson-Hayden, Tonya R; Dasch, Gregory A

    2012-11-01

    We used next generation sequencing to detect the bacterium "Candidatus Midichloria mitochondrii" for the first time in lone star ticks (Amblyomma americanum) from the eastern United States. 177 individuals and 11 tick pools from seven sites in four states were tested by pyrosequencing with barcoded 16S rRNA gene eubacterial primers targeting variable regions 5-3. Average infection prevalence was 0.15 across all surveyed populations (range 0-0.29) and only the site with the smallest sample size (n = 5) was negative. Three genotypes differing by 2.6-4.1 % in a 271 bp region of 16S rRNA gene were identified. Two variants co-occurred in sites in North Carolina and New York, but were not observed in the same tick at those sites. The third genotype was found only in Georgia. Phylogenetic analysis of this fragment indicated that the three variants are more closely related to "Candidatus Midichloria mitochondrii" genotypes from other tick species than to each other. This variation suggests that multiple independent introductions occurred in A. americanum which may provide insight into bacterial spread within its ecosystem and parasitism on this tick. Whether the presence of this bacterium affects acquisition or maintenance of other pathogens and symbionts in A. americanum or the survival, biology and evolution of the tick itself is unknown.

  13. Neuronal projections from the Haller's organ and palp sensilla to the synganglion of Amblyomma americanum§.

    Science.gov (United States)

    Borges, Lígia Miranda Ferreira; Li, Andrew Yongsheng; Olafson, Pia Untalan; Renthal, Robert; Bauchan, Gary Roy; Lohmeyer, Kimberly Hutchison; León, Adalberto Angel Pérez de

    2016-06-14

    The present study was conducted to elucidate the neuronal pathways between peripheral olfactory and taste sensilla and the synganglion in an Ixodidae tick species. The tarsus of the front legs (olfactory nerves) and the fourth palpal segment (gustatory nerves) of unfed Amblyomma americanum males and females were excised. A neuronal tracer, dextran tetramethylrhodamine, was used for filling of the sensory neurons. The synganglion preparations were examined using a confocal microscope. Neuronal arborizations from the Haller's organ were confined to the olfactory lobes and the first pedal ganglion. The estimated number of olfactory glomeruli ranged from 16 to 22 per olfactory lobe in the females. The number of glomeruli was not counted in males because they were densely packed. Sensory neurons associated with sensilla at the distal end of the palpal organ projected into the palpal ganglion in the synganglion through the palpal nerve. Gustatory sensory neurons associated with palpal sensilla projected into a commissure with several bulges, which are confined in the palpal ganglion. The findings of distinct projection patterns of sensory neurons associated with the Haller's organ and palpal organ in the lone star tick from this study advanced our knowledge on mechanisms of sensory information processing in ticks.

  14. Beklemishevia hispaniola n. sp., nuevo representante de la Cohorte Palaeosomata (Acari, Oribatei en España

    Directory of Open Access Journals (Sweden)

    Pérez-Iñigo, C.

    1996-12-01

    Full Text Available A new species of oribatid mite (Acari, Oribatei belonging to the family Ctenacaridae (Cohors Palaeosomata is described; this species was recorded several times in Spain as Beklemishevia galeodula Zachvatkin, 1945. The new species is easily distinguishable from the mentioned one because of the presence of three claws in every leg, a noticeable pigidial neotrichy and the absence of short, almost spiniform, setae on the pygidium.Se describe una nueva especie de oribátido (Acari, Oribatei perteneciente a la familia Ctenacaridae (Cohorte Palaeosomata que habia sido citada varias veces en España como Beklemishevia galeodula Zachvatkin, 1945, y de la que se diferencia por presentar tres uñas en todas las patas, una acentuada neotriquia pigidial y carecer de setas cortas espiniformes en el pigidio.

  15. Evaluation of Gulf Coast Ticks (Acari: Ixodidae) for Ehrlichia and Anaplasma Species.

    Science.gov (United States)

    Allerdice, Michelle E J; Hecht, Joy A; Karpathy, Sandor E; Paddock, Christopher D

    2017-03-01

    Amblyomma maculatum Koch (the Gulf Coast tick) is an aggressive, human-biting ixodid tick distributed throughout much of the southeastern United States and is the primary vector for Rickettsia parkeri, an emerging human pathogen. Amblyomma maculatum has diverse host preferences that include white-tailed deer, a known reservoir for Ehrlichia and Anaplasma species, including the human pathogens E. ewingii and E. chaffeensis. To examine more closely the potential role of A. maculatum in the maintenance of various pathogenic Ehrlichia and Anaplasma species, we screened DNA samples from 493 questing adult A. maculatum collected from six U.S. states using broad-range Anaplasmataceae and Ehrlichia genus-specific PCR assays. Of the samples tested, four (0.8%) were positive for DNA of Ehrlichia ewingii, one (0.2%) was positive for Anaplasma platys, and one (0.2%) was positive for a previously unreported Ehrlichia species closely related to Ehrlichia muris and an uncultivated Ehrlichia species from Haemaphysalis longicornis ticks in Japan. No ticks contained DNA of Ehrlichia chaffeensis, Ehrlichia canis, the Panola Mountain Ehrlichia, or Anaplasma phagocytophilum. This is the first identification of E. ewingii, A. platys, and the novel Ehrlichia in questing Gulf Coast ticks; nonetheless the low prevalence of these agents suggests that A. maculatum is not likely an important vector of these zoonotic pathogens. Published by Oxford University Press on behalf of Entomological Society of America 2016. This work is written by US Government employees and is in the public domain in the US.

  16. Ticks (Acari: Ixodidae infesting cattle and African buffaloes in the Tsavo conservation area, Kenya

    Directory of Open Access Journals (Sweden)

    Edward K. Kariuki

    2012-02-01

    Full Text Available Several ixodid tick species are shared between domestic cattle and African buffaloes (Syncerus caffer. So too, are a number of tick-borne diseases. The aim of the study was to compare the species composition of ticks that infest cattle and buffaloes utilising the same habitat within the Tsavo Conservation Area, Kenya. To this end, 25 cattle and 62 buffaloes were each opportunistically sampled for ticks on a single occasion in February 2010. Eight species, namely Amblyomma gemma, Amblyomma lepidum, Hyalomma albiparmatum, Hyalomma rufipes, Hyalomma truncatum, Rhipicephalus evertsi evertsi, Rhipicephalus pravus and Rhipicephalus pulchellus infested both cattle and buffaloes. Three species, Rhipicephalus (Boophilus sp., Rhipicephalus kochi, and Rhipicephalus muehlensi were collected only from cattle, and three species, Hyalomma impeltatum, Rhipicephalus humeralis and Rhipicephalus praetextatus were present only on buffaloes. The attachment sites of the various tick species were also recorded. New locality records for H. impeltatum and H. truncatum and the first confirmed locality record for Rhipicephalus praetextatus sensu stricto in Kenya were documented.

  17. Prolixus (Acari: Trombidiformes: Tenuipalpidae) newly recorded from New Zealand: A new species from Cyperaceae and its ontogenetic patterns in chaetotaxy.

    Science.gov (United States)

    Xu, Yun; Zhang, Zhi-Qiang

    2014-12-19

    The genus Prolixus (Acari: Tenuipalpidae) was represented by two species from Australian sedges prior to this study. A new species, Prolixus meyerae sp. nov., is here described and illustrated from leaves of Gahnia (Cyperaceae) in Auckland, New Zealand. In this paper, we present the ontogenetic additions in idiosomal and leg chaetotaxy from larva to adult. A key to world species of Prolixus is also proposed.

  18. A new genus and species of Schizogyniidae (Acari: Mesostigmata) associated with carabid beetles (Coleoptera: Carabidae) from Ukraine.

    Science.gov (United States)

    Trach, Viacheslav A; Seeman, Owen D

    2014-04-29

    A new genus and species of Schizogyniidae (Acari: Mesostigmata: Celaenopsoidea), Euroschizogynium calvum gen. nov. and sp. nov., associated with Scarites terricola Bonelli, 1813 (Coleoptera: Carabidae) is described from Ukraine, representing the first record of the family from the Palaearctic. Fusura civica Valle & Fox, 1966 is moved out of the Schizogyniidae and placed into the Megacelaenopsidae. A new diagnosis for the family Schizogyniidae and a key to genera are provided.

  19. Chlorotic spots on Clerodendrum, a disease caused by a nuclear type of Brevipalpus (Acari:Tenuipalpidae) transmitted virus

    OpenAIRE

    Kitajima, Elliot Watanabe; Kubo,Karen Sumire; Ferreira,Paulo de Tarso Oliveira; Alcântara,Berenice Kussumoto; Boari,Alessandra de Jesus; Gomes,Renata Takassugi; Freitas-Astua,Juliana; Rezende,Jorge Alberto Marques; Morais,Gilberto José de; Salaroli,Renato Barbosa

    2008-01-01

    Chlorotic spots have been observed in plants of Clerodendrum x speciosum growing in residential gardens and parks in Piracicaba, SP, Brazil. Thin sections of diseased tissues revealed characteristic cytopathic effects of the nuclear type of the Brevipalpus (Acari: Tenuipalpidae) mite-transmitted viruses (BTrV). Brevipalpus mites, identified as B. phoenicis, infesting symptomatic C. x speciosum plants transmitted the pathogen to healthy C. x speciosum and to C. thomsonae, Gomphrena globosa, Hi...

  20. Detection of Rickettsia rickettsii in the tick Amblyomma cajennense in a new Brazilian spotted fever-endemic area in the state of Minas Gerais

    OpenAIRE

    Elizângela Guedes; Leite,Romário C.; Márcia CA Prata; PACHECO, Richard C.; Walker, David H.; Labruna, Marcelo B.

    2005-01-01

    The present study evaluated rickettsial infection in Amblyomma spp. ticks collected in a farm in Coronel Pacheco, a Brazilian spotted fever (BSF) endemic area. A total of 78 A. cajennense and 78 A. dubitatum free-living adult ticks were collected and tested by polymerase chain reaction (PCR) targeting a fragment of the rickettsial gene gltA. Only one pool of three A. cajennense ticks showed the expected product by PCR. This pool was further tested by PCR using sets of primers targeting the ri...

  1. SELETIVIDADE DE CHLORFENAPYR E FENBUTATIN-OXIDE SOBRE DUAS ESPÉCIES DE ÁCAROS PREDADORES (ACARI: PHYTOSEIIDAE) EM CITROS

    OpenAIRE

    REIS PAULO REBELLES; SOUSA ÉLBER OLIVEIRA

    2001-01-01

    Com o uso de bioensaios, verificaram-se os efeitos residual de contato, ovicida e de persistência dos produtos chlorfenapyr e fenbutatin-oxide sobre duas espécies de ácaros predadores, Iphiseiodes zuluagai Denmark & Muma e Euseius alatus DeLeon (Acari: Phytoseiidae), associados ao ácaro da leprose-dos-citros Brevipalpus phoenicis (Geijskes) (Acari: Tenuipalpidae). O efeito total sobre os adultos foi estudado por meio do método residual de contato com pulverização em superfície de vidro, confo...

  2. The complete mitochondrial genome of the citrus red mite Panonychus citri (Acari: Tetranychidae): high genome rearrangement and extremely truncated tRNAs.

    Science.gov (United States)

    Yuan, Ming-Long; Wei, Dan-Dan; Wang, Bao-Jun; Dou, Wei; Wang, Jin-Jun

    2010-10-23

    The family Tetranychidae (Chelicerata: Acari) includes ~1200 species, many of which are of agronomic importance. To date, mitochondrial genomes of only two Tetranychidae species have been sequenced, and it has been found that these two mitochondrial genomes are characterized by many unusual features in genome organization and structure such as gene order and nucleotide frequency. The scarcity of available sequence data has greatly impeded evolutionary studies in Acari (mites and ticks). Information on Tetranychidae mitochondrial genomes is quite important for phylogenetic evaluation and population genetics, as well as the molecular evolution of functional genes such as acaricide-resistance genes. In this study, we sequenced the complete mitochondrial genome of Panonychus citri (Family Tetranychidae), a worldwide citrus pest, and provide a comparison to other Acari. The mitochondrial genome of P. citri is a typical circular molecule of 13,077 bp, and contains the complete set of 37 genes that are usually found in metazoans. This is the smallest mitochondrial genome within all sequenced Acari and other Chelicerata, primarily due to the significant size reduction of protein coding genes (PCGs), a large rRNA gene, and the A + T-rich region. The mitochondrial gene order for P. citri is the same as those for P. ulmi and Tetranychus urticae, but distinctly different from other Acari by a series of gene translocations and/or inversions. The majority of the P. citri mitochondrial genome has a high A + T content (85.28%), which is also reflected by AT-rich codons being used more frequently, but exhibits a positive GC-skew (0.03). The Acari mitochondrial nad1 exhibits a faster amino acid substitution rate than other genes, and the variation of nucleotide substitution patterns of PCGs is significantly correlated with the G + C content. Most tRNA genes of P. citri are extremely truncated and atypical (44-65, 54.1 ± 4.1 bp), lacking either the T- or D-arm, as found in P. ulmi

  3. The complete mitochondrial genome of the citrus red mite Panonychus citri (Acari: Tetranychidae: high genome rearrangement and extremely truncated tRNAs

    Directory of Open Access Journals (Sweden)

    Dou Wei

    2010-10-01

    Full Text Available Abstract Background The family Tetranychidae (Chelicerata: Acari includes ~1200 species, many of which are of agronomic importance. To date, mitochondrial genomes of only two Tetranychidae species have been sequenced, and it has been found that these two mitochondrial genomes are characterized by many unusual features in genome organization and structure such as gene order and nucleotide frequency. The scarcity of available sequence data has greatly impeded evolutionary studies in Acari (mites and ticks. Information on Tetranychidae mitochondrial genomes is quite important for phylogenetic evaluation and population genetics, as well as the molecular evolution of functional genes such as acaricide-resistance genes. In this study, we sequenced the complete mitochondrial genome of Panonychus citri (Family Tetranychidae, a worldwide citrus pest, and provide a comparison to other Acari. Results The mitochondrial genome of P. citri is a typical circular molecule of 13,077 bp, and contains the complete set of 37 genes that are usually found in metazoans. This is the smallest mitochondrial genome within all sequenced Acari and other Chelicerata, primarily due to the significant size reduction of protein coding genes (PCGs, a large rRNA gene, and the A + T-rich region. The mitochondrial gene order for P. citri is the same as those for P. ulmi and Tetranychus urticae, but distinctly different from other Acari by a series of gene translocations and/or inversions. The majority of the P. citri mitochondrial genome has a high A + T content (85.28%, which is also reflected by AT-rich codons being used more frequently, but exhibits a positive GC-skew (0.03. The Acari mitochondrial nad1 exhibits a faster amino acid substitution rate than other genes, and the variation of nucleotide substitution patterns of PCGs is significantly correlated with the G + C content. Most tRNA genes of P. citri are extremely truncated and atypical (44-65, 54.1 ± 4.1 bp, lacking

  4. New records of water mites (Acari: Hydrachnidia and Halacaroidea from Bosnia and Herzegovina, with description of a new species, Aturus gordani

    Directory of Open Access Journals (Sweden)

    Pešić Vladimir M.

    2003-01-01

    Full Text Available A presented faunistic catalogue of water mites (Acari: Hydrachnidia and Halacaroidea from Republic of Srpska (Bosnia and Herzegovina is based on all published data and numerous new records from the investigated area. Twenty two species were identified, 12 of which new to Bosnia and Herzegovina and one species Mideopsis roztoczensis was recorded for the first time in the Balkans. The species Aturus gordani was described as new to science; halacarid mites were recorded (Acari: Halacaroidea for the first time in the fauna of Bosnia and Herzegovina. The ecological significance of the new records was briefly discussed.

  5. Quill mites of the subfamily Picobiinae (Acari: Syringophilidae) associated with woodpeckers (Aves: Piciformes: Picidae).

    Science.gov (United States)

    Skoracki, Maciej; Unsoeld, Markus; Kavetska, Katarzyna; Kaszewska, Katarzyna

    2014-03-01

    The paper contains a review of quill mites of the subfamily Picobiinae (Acari: Prostigmata: Syringophilidae) associated with woodpeckers (Aves: Piciformes: Picidae). Three new species are described: Picobia mentalis Skoracki et Unsoeld sp. nov. from Picus mentalis Temminck, Neopicobia ea Skoracki et Unsoeld sp. nov. from Celeus flavus (St. Mueller) (type host), C. elegans (St. Mueller), C. torquatus (Boddaert), and Neopicobia freya Skoracki et Unsoeld sp. nov. from Dryocopus galeatus (Temminck) (type host) and Piculus rubiginosus (Swainson). Additionally, six new host species for Picobia heeri Haller, 1878 and 12 new host species for Picobia dryobatis (Fritsch, 1956) are reported. A complete list of the picobiines parasitising birds of the family Picidae is presented in the tabular form.

  6. First Report of Raoiella indica (Hirst) (Acari: Tenuipalpide) in Southern Brazil.

    Science.gov (United States)

    Hata, F T; Silva, J E P; Ventura, M U; Pasini, A; Roggia, S

    2017-06-01

    The red palm mite (RPM), Raoiella indica (Hirst) (Acari: Tenuipalpidae), was found for the first time in the Paraná State, in southern Brazil. The first observations occurred in September 2015, on strawberry (Fragaria × ananassa Duch) leaves, which is not considered a typical host plant of RPM. It is probable that its occurrence on this plant was serendipitous. Visual surveys for RPM were carried out on four typical host plants (banana, coconut, foxtail palm, and real palm), in five cities of the Paraná State (Bela Vista do Paraíso, Londrina, Maringá, Marialva, and Sarandi). RPM was found on each of the four typical host plants, in each of the five cities. Our survey extends RPM occurrence to the southern region of Brazil and indicates that the pest could be widespread in the country.

  7. A review of the natural enemies of the red palm mite, Raoiella indica (Acari: Tenuipalpidae).

    Science.gov (United States)

    Carrillo, Daniel; Frank, J Howard; Rodrigues, Jose Carlos V; Peña, Jorge E

    2012-08-01

    A review of all the available information about the natural enemies reported in association with the red palm mite, Raoiella indica is presented. Twenty-eight species of predatory arthropods, including mites and insects, have been reported in association with R. indica in Asia, Africa and the Neotropics. In addition, pathogenic fungi associated with R. indica in the Caribbean have been reported. The available literature indicates that each site has a different natural enemy complex with only one predator species, Amblyseius largoensis (Acari: Phytoseiidae), present in all the geographical areas. The phytoseiids, Amblyseius caudatus Berlese, Amblyseius channabasavanni Gupta and A. largoensis, were regarded as important natural enemies of R. indica, and their predatory efficiency was studied in some detail. Among the predatory insects the coccinellids Stethorus keralicus Kapur and Telsimia ephippiger Chapin were reported as major predators of R. indica. The known distribution, abundance and relative importance of each species reported in association with R. indica are discussed.

  8. Javanese species of the mite genus Macrocheles (Arachnida: Acari: Gamasina: Macrochelidae).

    Science.gov (United States)

    Hartini, Sri; Takaku, Gen

    2003-10-01

    Twelve mite species of the genus Macrocheles (Acari: Macrochelidae) were collected from the body surface of dung beetles in Java, Indonesia. Of these, three species, i.e., Macrocheles jabarensis, M. jonggolensis, and M. sukabumiensis, were described as new to science. Female of M. dispar was redescribed. Two species, i.e., M. baliensis and M. sukaramiensis, were recorded from Java for the first time. The occurrence of five species previously recorded from Java, i.e., M. hallidayi, M. kraepelini, M. limue, M. oigru, and M. merdarius, were reconfirmed. Taxonomic status of M. sp. aff. glaber was not settled in the present study, because we could not obtain the male and immatures which are indispensable for exact identification. In total 15 species of the genus Macrocheles, including 3 species already recorded but not collected in this research (M. crispa, M. krantzi, and M. subbadius), are known from Java up to date.

  9. In vitro repellency of DEET and β-citronellol against the ticks Rhipicephalus sanguineus sensu lato and Amblyomma sculptum.

    Science.gov (United States)

    Ferreira, Lorena Lopes; Oliveira Filho, Jaires Gomes de; Mascarin, Gabriel Moura; León, Adalberto A Pérez de; Borges, Lígia Miranda Ferreira

    2017-05-30

    Rhipicephalus sanguineus sensu lato and Amblyomma sculptum can parasite humans and domestic animals and are vectors of pathogens, including zoonoses. Repellents are an important tool of tick control. This study aimed to compare the efficacy of N,N-diethyl- 3-methylbenzamide (DEET), a standard repellent, versus β-citronellol in a Petri dish bioassay. A semicircle of filter paper (31.8cm(2)) was treated with 87μl of one of four concentrations (0.200, 0.100, 0.050 and 0.025mg/cm(2)) of β-citronellol, DEET or solvent (ethanol). A head-to-head test was developed treating one side with increasing concentrations of β-citronellol as above mentioned, against the highest concentration of DEET. Besides that a blank assay was performed. Three males and three females were placed in the middle of the plate and their location was evaluated 5, 10 and 30min after the test was initiated. As a result, the time had no significant effect on repellency response of the ticks exposed to both compounds and their concentrations. The repellency response raised according with the increase of concentration. Additionally, our findings indicate that the tick A. sculptum was more sensitive to the compounds tested and β-citronellol showed a higher efficacy than DEET. In addition, β-citronellol could be formulated to protect humans and other animals from R. sanguineus s. l. and A. sculptum infestation, as well as the diseases transmitted by these species. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. The genome sequence of Lone Star virus, a highly divergent bunyavirus found in the Amblyomma americanum tick.

    Directory of Open Access Journals (Sweden)

    Andrea Swei

    Full Text Available Viruses in the family Bunyaviridae infect a wide range of plant, insect, and animal hosts. Tick-borne bunyaviruses in the Phlebovirus genus, including Severe Fever with Thrombocytopenia Syndrome virus (SFTSV in China, Heartland virus (HRTV in the United States, and Bhanja virus in Eurasia and Africa have been associated with acute febrile illness in humans. Here we sought to characterize the growth characteristics and genome of Lone Star virus (LSV, an unclassified bunyavirus originally isolated from the lone star tick Amblyomma americanum. LSV was able to infect both human (HeLa and monkey (Vero cells. Cytopathic effects were seen within 72 h in both cell lines; vacuolization was observed in infected Vero, but not HeLa, cells. Viral culture supernatants were examined by unbiased deep sequencing and analysis using an in-house developed rapid computational pipeline for viral discovery, which definitively identified LSV as a phlebovirus. De novo assembly of the full genome revealed that LSV is highly divergent, sharing <61% overall amino acid identity with any other bunyavirus. Despite this sequence diversity, LSV was found by phylogenetic analysis to be part of a well-supported clade that includes members of the Bhanja group viruses, which are most closely related to SFSTV/HRTV. The genome sequencing of LSV is a critical first step in developing diagnostic tools to determine the risk of arbovirus transmission by A. americanum, a tick of growing importance given its expanding geographic range and competence as a disease vector. This study also underscores the power of deep sequencing analysis in rapidly identifying and sequencing the genomes of viruses of potential clinical and public health significance.

  11. Tick (Amblyomma chabaudi) infestation of endemic tortoises in southwest Madagascar and investigation of tick-borne pathogens.

    Science.gov (United States)

    Ehlers, Julian; Ganzhorn, Jörg U; Silaghi, Cornelia; Krüger, Andreas; Pothmann, Daniela; Ratovonamana, R Yedidya; Veit, Alexandra; Keller, Christian; Poppert, Sven

    2016-03-01

    Little is known about the role of endemic ticks as vectors for bacterial and protozoan pathogens for animals and humans in Madagascar and their interaction in anthropogenic habitats where humans, their livestock and native Malagasy species (vectors and hosts) come into more frequent contact than in natural forest ecosystems. The aims of the study were (1) to test whether habitat degradation is associated with increased infestation of tortoises by ticks and (2) to investigate whether ticks carried Babesia, Borrelia or Rickettsia species that might be pathogenic for humans and livestock. We studied hard ticks of two endemic Malagasy tortoises, Astrochelys radiata and Pyxis arachnoides in March and April 2013 in southwest Madagascar. Two tortoise habitats were compared, the National Park of Tsimanampetsotsa and the adjacent degraded pasture and agricultural land at the end of the wet season. Ticks were screened for protozoan and bacterial pathogens via PCR on DNA isolated from ticks using genus-specific primers. Only one out of 42 A. radiata collected from both habitats had ticks. The low prevalence did not allow further analyses of the effect of habitat degradation. Forty-two P. arachnoides were found in the anthropogenic habitat and 36 individuals in the national park. Tick infestation rates of P. arachnoides differed significantly between the two study sites. Tortoises inside the park had lower tick prevalence than outside (8 of 36 (22%) versus 32 of 42 individuals (76%)) and infected animals tended to have fewer ticks inside than outside the park. All ticks collected in both habitats were adults of the ixodid tick Amblyomma chabaudi, which is supposed to be a host-specific tick of P. arachnoides. Screening for Borrelia sp. and Babesia sp. was negative in all ticks. But all A. chabaudi ticks were infected with Rickettsia africae, known to cause spotted fever in humans. Thus, habitat degradation seems to be linked to higher infestation of tortoises with ticks with

  12. The first report of Rickettsia spp. in Amblyomma nodosum in the State of Mato Grosso do Sul, Brazil.

    Science.gov (United States)

    Almeida, Robson F C; Garcia, Marcos V; Cunha, Rodrigo C; Matias, Jaqueline; Labruna, Marcelo B; Andreotti, Renato

    2013-02-01

    Ticks are vectors of various pathogens, including Rickettsia spp., which are responsible for causing an emerging disease of global significance. In the present study, an epidemiological survey was performed to identify Rickettsia spp. of the spotted fever group (SFG) in ticks and wild hosts in a native forest adjacent to livestock farming activity. The ticks and blood were evaluated by a hemolymph test and by PCR using the primers CS78 and CS323, which target a partial sequence of the enzyme citrate synthase (gltA) gene. Positive samples by PCR were further tested with the primers Rr190.70p and Rr190.602n, which target a 532-bp fragment of the rickettsial 190-kDa outer membrane protein gene (ompA). In addition, an indirect immunofluorescence assay (IFA) was performed to detect antibodies against Rickettsia spp. in horses that inhabited the same area. From the 43 animals that were captured, 192 ticks were collected; the ticks belonged to the species Amblyomma cajennense, A. ovale, and A. nodosum. All blood samples and hemolymph tests were negative. Four samples of A. nodosum that were collected from Tamandua tetradactyla were positive for Rickettsia spp. by PCR, and 8 samples of horse serum displayed titers greater than or equal to 1:64 by IFA. The phylogenetic analysis based on the DNA sequence of the ompACG gene demonstrated that Rickettsia spp. CG (the canadensis group) segregate in the same cluster as Rickettsia parkeri strain COOPERI, with a bootstrap value of 78%. These results indicate that Rickettsia spp. CG circulate among the tick population in the study area, which has a constant presence of livestock and humans. This may be the same species of Rickettsia that was recorded in A. nodosum throughout the Atlantic forest.

  13. Comparison of differentially expressed genes in the salivary glands of male ticks, Amblyomma americanum and Dermacentor andersoni.

    Science.gov (United States)

    Bior, Abdelaziz D; Essenberg, Richard C; Sauer, John R

    2002-06-01

    Genes expressed differentially in the salivary glands of unfed and fed male ticks, Amblyomma americanum (L.), were identified, cloned and sequenced, and some were compared with those expressed in the salivary glands of Dermacentor andersoni. Total protein and RNA increased sixfold in the salivary glands of fed male A. americanum, while in fed male D. andersoni salivary glands, RNA increased approximately 3.5 times. Feeding D. andersoni in the presence of females increased total RNA by 25% over those fed in the absence of females. Complementary DNAs were synthesized from RNA obtained from unfed and fed ticks and amplified using RNA arbitrarily primed polymerase chain reaction (RAP-PCR) with three different primers in separate reactions. Differential display showed clear banding differences between the fed and the unfed ticks in A. americanum and D. andersoni. Sixty-one cDNA fragments that appeared to be from differentially expressed genes in A. americanum were isolated, cloned and sequenced. Hybridization reactions with labeled cDNA probes confirmed the differential expression of many of the genes in unfed and fed ticks' salivary glands; however, many of the bands contained more than one fragment and some of the fragments isolated from apparently differential bands were not specific. Sequences for 28 of the cDNA fragments (150-600 nucleotides in length) demonstrated similarity to genes in the databases, but nine of these were similar to sequences of unknown function. Some of the gene fragments identified may be important to tick feeding or tick salivary gland physiology, including a histamine-binding protein, an organic ion transporter, an apoptosis inhibitor, a cathepsin-B-like cysteine protease, proteins involved in gene regulation and several proteins involved in protein synthesis. Cross-hybridization of identified cDNAs from A. americanum with cDNA probes synthesized from D. andersoni total RNA did not show significant similarity between the two species.

  14. Benefits and risks of the subcutaneous immunotherapy with acari extracts in allergic rhinoconjunctivitis and bronchial asthma

    Directory of Open Access Journals (Sweden)

    Olimpio Rodríguez-Santos

    2014-12-01

    Full Text Available The records of patients from the Allergology Service in the Previsora Policlinic, Camagüey were revised to evaluate benefits and risks of the subcutaneous immunotherapy (ITSC with extracts of acari. The study was observational, analytic and retrospective of cases and controls in allergic rhinoconjunctivitis and bronchial asthma. A total of 160 subjects, older than 18 years old, were chosen. Eighty out of them had already received ITSC with dose increase during 13 weeks and maintenance with monthly injections during 18 months. A total of 80 patients who only received prevention measures and medications during the crises were paired. Questionnaires were applied for quality of rhinoconjunctivitis life and asthma, about the consumption of medications and the frequency of the crises. The adverse events were measured, as they were local and systemic to the cutaneous tests, to the ITSC and the different pharmacological treatments. There was a significant increase of the punctuation of life quality questionnaires, (p=0.011. The consumption of medications decreased in both the cases and the controls, without significant differences (p=0.083. The frequency of the rhinitis and asthma crises decrease in the group of ITSC (p=0.029. Slight local and systemic reactions were reported in both groups with Odds ratio (OR=2.029 in the ITSC group, with a 95% confidence interval of 1.114–3.967 (p=0.019. The results show that the subcutaneous immunotherapy with acari offers benefits and few risks to patients with allergic rhinoconjunctivitis and asthma.

  15. In vitro isolation and infection intensity of Rickettsia parkeri in Amblyomma triste ticks from the Paraná River Delta region, Argentina.

    Science.gov (United States)

    Monje, Lucas D; Nava, Santiago; Antoniazzi, Leandro R; Colombo, Valeria C; Beldomenico, Pablo M

    2014-10-01

    In the present study, we report the first in vitro isolation and infection intensity of Rickettsia parkeri in Amblyomma triste ticks from Argentina. No genetic differences in the molecular targets evaluated were found between R. parkeri isolates from Argentina and those R. parkeri isolates reported in Uruguay and Brazil, both obtained from A. triste. Only a minor difference was observed when compared to R. parkeri isolated from Amblyomma maculatum from United States. Moreover, the prevalence of infection by R. parkeri in ticks collected from the vegetation in the Paraná Delta was high (20.4%). Interestingly, the distribution of R. parkeri infection intensity observed in A. triste ticks was distinctly bimodal, with approximately 60% of the infected ticks presenting high rickettsial loads (3.8×10(5)-4.5×10(7) ompA copies/tick) and the remainder with low rickettsial levels (5.6×10(1)-6.5×10(3) ompA copies/tick). This bimodality in R. parkeri infection intensity in ticks could determine differences in the severity of the disease, but also be important for the infection dynamics of this pathogen. Further research exploring the distribution of rickettsial infection levels in ticks, as well as its determinants and implications, is warranted.

  16. Potential of astigmatid mites (Acari: Astigmatina) as prey for rearing edaphic predatory mites of the families Laelapidae and Rhodacaridae (Acari: Mesostigmata).

    Science.gov (United States)

    Barbosa, Marina F C; de Moraes, Gilberto J

    2016-07-01

    Laelapidae and Rhodacaridae are important families of edaphic predatory mites and species of these families have been considered for use in biological control programs of soil pests. Mites of Cohort Astigmatina (Acari: Sarcoptiformes) have been largely used as factitious prey in the mass rearing of various edaphic or plant-inhabiting predatory mites. Stratiolaelaps scimitus (Womersley) (Mesostigmata: Laelapidae) (widely commercialized for the control of fungus gnats and thrips) and Protogamasellopsis zaheri Abo-Shnaf, Castilho and Moraes (Mesostigmata: Rhodacaridae) (not available commercially but promising for the control of thrips and nematodes) are known to be reared on Tyrophagus putrescentiae (Schrank) (Astigmatina: Acaridae), but the possibility to find a perhaps more efficient prey has not been evaluated. The objective of this paper was to evaluate different astigmatid species as prey for these predators. S. scimitus and P. zaheri oviposited on all evaluated astigmatids and the acarid mites T. putrescentiae and Aleuroglyphus ovatus (Tropeau) were the most suitable prey; to confirm the effect of prey on oviposition rates, pregnant females of the predators were kept under starvation conditions and oviposition was negligible or null. Survivorship was always higher than 78 % and was not influenced by prey species or starvation.

  17. Preliminary survey of ticks (Acari: Ixodidae) parasitizing wild turkeys (Aves: Phasianidae) in eastern Kansas.

    Science.gov (United States)

    Mock, D E; Applegate, R D; Fox, L B

    2001-01-01

    During the spring and fall turkey hunting seasons of 1999, hunters and Kansas Department of Wildlife and Parks field personnel examined wild turkeys, Meleagris gallopavo L., for ticks and submitted them to us for identification. From springtime hunting, we received 113 ticks from 12 turkeys killed in nine counties, all in the eastern one-third of Kansas. Collectors reported examining three additional wild turkeys on which no ticks were found. All ticks were nymphal lone star ticks, Amblyomma americanum (L.). Of 11 wild turkeys examined in seven counties during October, one was parasitized by 30 A. americanum larvae. Data from this study and accounts from the published literature suggest that parasitism of wild turkeys by immature lone star ticks is commonplace wherever this host and ectoparasite are sympatric. Our study suggests that M. gallopavo may be an important host that supports lone star tick populations.

  18. Ticks (Acari: Ixodidae) parasitizing wild carnivores in Phu Khieo Wildlife Sanctuary, Thailand.

    Science.gov (United States)

    Grassman, L I; Sarataphan, N; Tewes, M E; Silvy, N J; Nakanakrat, T

    2004-06-01

    Ixodid ticks were collected and identified from 8 wild carnivore species in Phu Khieo Wildlife Sanctuary, northeastern Thailand. Six tick species belonging to 4 genera were recovered and identified from 132 individuals. These included Amblyomma testudinarium (n = 36), Haemaphysalis asiatica (n = 58), H. hystricis (n = 31), H. semermis (n = 3), Rhipicephalus haemaphysaloides (n = 3), and Ixodes granulatus (n = 1). Leopard cats (Prionailurus bengalensis) (n = 19) were infested with 4 tick species, whereas yellow-throated marten (Martes flavigula) (n = 4), clouded leopard (Neofelis nebulosa) (n = 2), and dhole (Cuon alpinus) (n = 1) were infested with 3 tick species, Asiatic golden cat (Catopuma temmincki) (n = 2) with 2 species, and marbled cat (Pardofelis marmorata), binturong (Arctictis binturong), and large Indian civet (Viverra zibetha) each infested with 1 species. This information contributes to the knowledge available on the ectoparasites of wild carnivores in Southeast Asia.

  19. Ticks (Acari: Ixodidae) and spirochetes (spirochaetaceae: spirochaetales) recovered from birds on a Georgia Barrier Island.

    Science.gov (United States)

    Durden, L A; Oliver, J H; Kinsey, A A

    2001-03-01

    From September 1997 through July 1999, 300 individuals and 46 species of birds were mist-netted and screened for ticks and spirochetes on St. Catherine's Island, Liberty County, GA. Seventy-six (25%) of the birds were parasitized by a meal intensity of 4.6 ticks. Seasonally, more birds were infested with ticks during the summer (50% in 1998, 34% in 1999) than in spring (15% in 1998, 11% in 1999) or fall (21% in 1997, 20% in 1998), mainly because of severe infestations on some birds by immature stages of the lone star tick, Amblyomma americanum (L.), during this season. Eight species ofticks were recovered from 14 species of birds during this study: A. americanum (74 nymphs, 168 larvae); the blacklegged tick, Ixodes scapularis Say (11 nymphs, 28 larvae), the Gulf Coast tick, Amblyomma maculatum Koch (two nymphs, 29 larvae); Ixodes minor Neumann (16 larvae); the rabbit tick. Haemaphysalis leporispalustris (Packard) (one nymph, 14 larvae); the bird tick Ixodes brunneus Koch (two larvae); the American dog tick, Dermacentor variabilis (Say) (one nymph); and Ixodes affinis Neumann (one larva). The Carolina wren was parasitized by more species of ticks (seven) than any other bird species, followed by the northern cardinal (five), white-throated sparrow (four) and painted bunting (three). Spirochetes were isolated in BSK II medium from one tick (a nymphal A. americanum) and from skin biopsies of 12 (4%) of the individual birds (three downy woodpeckers, three northern waterthrushes, two Carolina wrens, one American redstart, one pine warbler, one Swainson's thrush, and one white-eyed vireo) all in fall 1997. This concentrated phenology of spirochete isolations might reflect periodic amplification or recrudescence of spirochetes in reservoir avian hosts.

  20. Marine water mites (Acari: Hydrachnidia: Pontarachnidae) from Taiwan, Korea and India, with the first description of the male of Pontarachna australis Smit, 2003

    Digital Repository Service at National Institute of Oceanography (India)

    Pesic, V.; Chatterjee, T.; Chan, B.K.K.; Ingole, B.S.

    –264. Lohmann, H. (1909) Marine Hydrachnidae und Halacaridae. In: Michaelsen, W. & Hartmeyer, R. (Eds), Die fauna Südwest-Australiens, Gustav Fischer, Jena, 2, 151–154. Smit, H. (2002) Two new species of the water mite family Pontarachnidae (Acari: Hydrachnidia...

  1. New species and new records of mites of the genus Stigmaeus(Acari: Prostigmata: Stigmaeidae) from Crimea.

    Science.gov (United States)

    Khaustov, Alexander A

    2014-05-06

    Three new species of the genus Stigmaeus Koch, 1836 (Acari: Stigmaeidae) are described from various habitats in Crimea: Stigmaeus kuznetsovi sp. nov. from nests of Microtus socialis (Rodentia: Cricetidae); S. mitrofanovi sp. nov. from galleries of Pityogenes bistridentatus (Coleoptera: Curculionidae) under the bark of Pinus pallasiana, and S. silvestris sp. nov. from rotten log of Pinus pallasiana. Stigmaeus corticeus Kuznetsov and Wainstein, 1977 and S. maraghehiensis Bagheri and Ueckermann, 2012 are recorded for the first time in Crimea. A key to species of the genus Stigmaeus of Crimea is provided.

  2. Primeiro registro de Oligonychus yothersi (McGregor (Acari: Tetranychidae em Eucalyptus grandis Hill ex Maiden no Brasil First record of Oligonychus yothersi (McGregor (Acari: Tetranychidae on Eucalyptus grandis Hill ex Maiden in Brazil

    Directory of Open Access Journals (Sweden)

    Fabrício Fagundes Pereira

    2005-08-01

    Full Text Available Relata-se a infestação de um ácaro-vermelho em mudas clonais de Eucalyptus grandis Hill ex Maiden, mantidas em casa de vegetação no município de Martinho Campos, Minas Gerais. O ácaro foi observado na parte superior das folhas que exibiam sinais de sucção de seiva e bronzeamento. Essas injúrias causaram desenvolvimento anormal e morte de plantas. O ácaro foi identificado como Oligonychus yothersi (McGregor (Acari: Tetranychidae, e isso representa o primeiro registro dessa espécie em mudas clonais de E. grandis no Brasil.An infestation of the red spider mite was reported in clone seedlings of Eucalyptus grandis Hill ex Maiden under greenhouse conditions, in the municipality of Martinho Campos, Minas Gerais State. The spider mite was found on the leaf upper faces with signs of sap suction and bronzing. Such injuries caused abnormal development and plant death. The spider mite was identified as Oligonychus yothersi (McGregor (Acari: Tetranychidae. This is the first record of O. yothersi on E. grandis seedlings in Brazil.

  3. Preliminary assays for efficiency avaliation of neem oil for control of Oligonychus yothersi (Acari: Tetranychidae / Ensaios preliminares para avaliação da eficiência de óleo de neem no controle de Oligonychus yothersi (Acari: Tetranychidae

    Directory of Open Access Journals (Sweden)

    Renato C. Oliveira

    2003-05-01

    Full Text Available The effect of a commercial formulation of the neem oil (azadirachtina was evaluated in different stages of the biological cycle of the red mite of the paraguay tea Oligonychus yothersi (Acari: Tetranychidae. The formulation was shown efficient in the adults control, as well as it affected the fecundity of the females of the mite, however it didn’t inhabited oviposition, when the leaves were treated with the product.Avaliou-se o efeito de uma formulação comercial a base de neem (azadirachtina em diferentes etapas do ciclo biológico do ácaro vermelho da erva-mate Oligonychus yothersi (Acari: Tetranychidae. A formulação mostrou-se eficiente no controle de adultos, bem como afetou a fecundidade das fêmeas do ácaro, contudo não ocasionou inibição na oviposição, quando as folhas foram tratadas com o produto.

  4. Study of Acari and Collembola Populations in Four Cultivation Systems in Dourados - MS

    Directory of Open Access Journals (Sweden)

    Rosilda Mara Mussury

    2002-09-01

    Full Text Available The impact four cultivation systems on the soil fauna was studied, using Oribatida and Gamasida acarids as bioindicators and collembolan. The research was carried out in experimental fields, located in EMBRAPA - CPAO in Dourados, Centerwest of Brazil from July 1997 to December 1999. The constant pasture system presented smaller impact on the soil fauna followed by agricultural cattle rotation and a direct plantation system. In the conventional plantation series, the populational density of the mesofauna organisms was low, especially collembolan families.O impacto de quatro sistemas de cultivo sobre a fauna de solo foram estudados, utilizando-se como bioindicadores os acari Oribatida e Gamasida e os Collembola. A pesquisa foi conduzida em campos experimentais, localizados na EMBRAPA - CPAO no município de Dourados, MS, no período de julho de 1997 à dezembro de 1999. O sistema de pastagem contínua apresentou menor impacto sobre a fauna de solo seguido da rotação agricultura pecuária e do sistema de plantio direto. Nas sucessões do plantio convencional, a densidade populacional dos organismos da mesofauna foi baixa, em especial as famílias de colembolos.

  5. Comparing oxalic acid and sucrocide treatments for Varroa destructor (Acari: Varroidae) control under desert conditions.

    Science.gov (United States)

    Sammataro, D; Finley, J; Underwood, R

    2008-08-01

    The effectiveness of oxalic acid (OA) and Sucrocide (S) (AVA Chemical Ventures, L.L.C., Portsmouth, NH) in reducing populations of the varroa mite Varroa destructor Anderson & Trueman (Acari: Varroidae) in honey bee, Apis mellifera L. (Hymenoptera: Apidae) colonies was measured under the desert conditions of Arizona, USA. OA and S were applied three times 7 d apart. A 3.2% solution of OA was applied in sugar syrup via a large volume syringe, trickling 5 ml per space between frames in the colony. S was applied at a concentration of 0.625% (mixed with water), according to the label directions, using a compressed air Chapin sprayer at 20 psi to apply 59 ml per frame space. Varroa mites, collected on a sticky board before, during, and after the treatments, were counted to assess the effectiveness of the treatments. This study showed that a desert climate zone did not confer any positive or negative results on the acaricidal properties of OA. Even with brood present in colonies, significant varroa mite mortality occurred in the OA colonies. In contrast, we found that Sucrocide was not effective as a mite control technique. Despite its ability to increase mite mortality in the short-term, varroa mite populations measured posttreatment were not affected any more by Sucrocide than by no treatment at all.

  6. Multiple resistance and biochemical mechanisms of pyridaben resistance in Tetranychus urticae (Acari: Tetranychidae).

    Science.gov (United States)

    Kim, Young-Joon; Park, Hyung-Man; Cho, Jum-Rae; Ahn, Young-Joon

    2006-06-01

    A field colony of Tetranychus urticae (Koch) (Acari: Tetranychidae) resistant to pyridaben was selected with pyridaben successively for 20 generations to produce the PR-20 strain. Resistance and multiple resistance levels of the PR-20 strain to 15 acaricides were determined using a spray bioassay. The PR-20 strain was extremely resistant to pyridaben (resistance ratio [RR] = 240]. The strain exhibited extremely strong resistance to fenpyroximate (RR=373) and acrinathrin (RR=329) and strong resistance to benzoximate (RR=84). An RR = 10-40 was observed with abamectin, fenazaquin, fenbutatin oxide, fenpropathrin, and tebufenpyrad. The PR-20 strain showed low levels of resistance (RR <10) to azocyclotin, bromopropylate, chlorfenapyr, dicofol, milbemectin, and propargite. Synergist experiments with different metabolic inhibitors revealed that piperonyl butoxide (PBO), a mixed function oxidase (MFO) inhibitor, had the greatest effect on pyridaben resistance. PBO significantly caused pyridaben resistance in the PR-20 strain to drop to the full susceptibility level of the susceptible (S) strain. However, there was no significant difference in MFO activities measured using a model substrate between the S and PR-20 strains. These results suggest that use of certain acaricides with little multiple resistance or PBO will be useful for the management of pyridaben resistance in the field.

  7. Sublethal effects of fenazaquin on life table parameters of the predatory mite Amblyseius swirskii (Acari: Phytoseiidae).

    Science.gov (United States)

    Alinejad, Marzieh; Kheradmand, Katayoon; Fathipour, Yaghoub

    2014-11-01

    Knowledge of the impact of acaricides on predatory mites is crucial for integrated pest management programs. The present study evaluated the sublethal effect of fenazaquin (Pride(®) 20 % SC, Behavar, Iran) on life table parameters of the subsequent generation of the predatory mite, Amblyseius swirskii Athias-Henriot (Acari: Phytoseiidae), fed on Tetranychus urticae Koch under laboratory conditions [26 ± 1 °C, 70 ± 3 % RH and 16:8 (L:D) h]. The sublethal concentrations including LC10, LC20 and LC30 were determined using a dose-effect assay. The total development time of both sexes enhanced with an increase in concentration. The oviposition period and total fecundity decreased in dose-dependent manner. The intrinsic rate of increase (r) and finite rate of increase (λ) significantly descended with concentration enhancing from LC10 to LC30, compared with the control. The net reproductive rate (R 0) ranged between 2.76 and 7.37 offspring. Overall, the results indicated that fenazaquin had negative effects on development and life table parameters of the subsequent generation of A. swirskii. In conclusion, fenazaquin is not a compatible acaricide with A. swirskii and should not be used with this predatory mite in integrated management of T. urticae.

  8. Acaricidal and repellent activities of essential oil of Eucalyptus globulus against Dermanyssus gallinae (Acari: Mesostigmata

    Directory of Open Access Journals (Sweden)

    Dehghani-Samani Amir

    2015-07-01

    Full Text Available Introduction: By considering an increase in drug resistance against red mites, finding the nonchemical herbal acaricide against Dermanyssus gallinae (De Geer (Acari: Mesostigmata is necessary to kill them and to reduce the chemical resistance against chemical acaricides in this specie. Dermanyssus gallinae is a potential vector of the causal agent of several viral diseases such as Equine encephalitis and St. Louis encephalitis. It can be a vector of bacteria such as Salmonella spp., Mycobacterium spp. and Erysipelothrix rhusiopathiae. It is also known to cause itching dermatosis in humans. In this study acaricidal and repellent activities of essential oil of Eucalyptus globulus against Dermanyssus gallinae were studied. Methods: After extracting the essential oil, different concentrations of the plant extract were prepared. Then, acaricidal effect of different concentrations was tested on poultry red mite, Dermanyssus gallinae, by dropping 3-4 drops of essential oil on mites. Repellent activity of essential oil was tested by Y-tube olfactometer bioassay. After the test, total number of killed and repellent mites reported. Results: Concentration of 1:2 or 50% had more acaricidal effect on mites. Also essential oil of Eucalyptus globulus had repellent activity against red mites. Conclusion: This study showed that essential oil of Eucalyptus globulus had acaricidal and repellent activities against red mites. Hence it might be used as a herbal acaricide against it to kill and to reduce the chemical resistance in this specie.

  9. Morphometric variations of laelapine mite (Acari: Mesostigmata populations infesting small mammals (Mammalia in Brazil

    Directory of Open Access Journals (Sweden)

    F. Martins-Hatano

    Full Text Available The goal of this study was to evaluate the morphometric variation of laelapine populations (Acari, Mesostigmata associated with neotropical oryzomyine rodents at different geographic localities in Brazil. Three nominal mite species were selected for study, all infesting the pelage of small mammals at different localities in Rio de Janeiro, Espírito Santo, Bahia, and the Federal District, Brazil. To analyse morphometric characteristics, thirty-seven morphological characters distributed across the whole body of each specimen were measured. We use the Analysis of Principal Components, extracting the three first axes and projecting each mite in these axes. Major species level changes in the taxonomy of the host mammals allows an independent examination of morphometric variation of mites infesting a set of distinctly different host species at different geographic localities. Gigantolaelaps vitzthumi and Laelaps differens are associated with oryzomyine rodents of the genus Cerradomys, and consistently showed a tendency to cluster by host phylogeny. Laelaps manguinhosi associated with Nectomys rattus in central Brazil is morphometrically distinct from mites infesting N. squamipes in the coastal restingas of Rio de Janeiro and Espírito Santo. The results obtained here indicate that laelapine mite populations can vary among geographic areas and among phylogenetically related host species. Clearly, the study of these mites at the population level can be an important tool for clarifying the taxonomy of both mites and hosts.

  10. Ticks (Acari: Ixodidae of livestock and their seasonal activities, northwest of Iran

    Directory of Open Access Journals (Sweden)

    Zahra Ramezani

    2014-09-01

    Full Text Available Objective: To identify the ticks (Acari: Ixodidae of livestock and their seasonal activities, in northwest of Iran, including the combination of two of the geographical regions of Iran (Caspian and mountain plateau where the majority of the domestic ruminants in Iran exist. Methods: Fifteen villages of Meshkin-Shahr County were selected randomly from different areas of the county. The animal dwellings were visited and the whole body of sheep, cows, goats and dogs were examined for their probable infestation. Samples were identified at the level of species according to the standard morphological key. Results: In this study 1 208 specimen were collected and totally nine species (Dermacentor marginatus, Dermacentor niveus, Haemaphysalis erinacei, Haemaphysalis punctata, Hyalomma anatolicum, Hyalomma asiaticum, Hyalomma marginatum, Rhipicephalus bursa and Rhipicephalus sanguineus were identified in this study. Also 569 host including 40 cows, 450 sheep, 70 goats and 9 dogs were examined for infestation and among them 255 were infested which showed a 44% of infestation among examined livestock. The infestation rate among sheep (46% was higher than other hosts. The infestation rates among the rest of hosts were as: cows (40%, goat (37% and dogs (33%. Conclusions: The results of this study and other studies of the region showed the probability of the establishment and development of the burden of several tick-borne diseases.

  11. Practical sampling plans for Varroa destructor (Acari: Varroidae) in Apis mellifera (Hymenoptera: Apidae) colonies and apiaries.

    Science.gov (United States)

    Lee, K V; Moon, R D; Burkness, E C; Hutchison, W D; Spivak, M

    2010-08-01

    The parasitic mite Varroa destructor Anderson & Trueman (Acari: Varroidae) is arguably the most detrimental pest of the European-derived honey bee, Apis mellifera L. Unfortunately, beekeepers lack a standardized sampling plan to make informed treatment decisions. Based on data from 31 commercial apiaries, we developed sampling plans for use by beekeepers and researchers to estimate the density of mites in individual colonies or whole apiaries. Beekeepers can estimate a colony's mite density with chosen level of precision by dislodging mites from approximately to 300 adult bees taken from one brood box frame in the colony, and they can extrapolate to mite density on a colony's adults and pupae combined by doubling the number of mites on adults. For sampling whole apiaries, beekeepers can repeat the process in each of n = 8 colonies, regardless of apiary size. Researchers desiring greater precision can estimate mite density in an individual colony by examining three, 300-bee sample units. Extrapolation to density on adults and pupae may require independent estimates of numbers of adults, of pupae, and of their respective mite densities. Researchers can estimate apiary-level mite density by taking one 300-bee sample unit per colony, but should do so from a variable number of colonies, depending on apiary size. These practical sampling plans will allow beekeepers and researchers to quantify mite infestation levels and enhance understanding and management of V. destructor.

  12. Desiccation tolerance in diapausing spider mites Tetranychus urticae and T. kanzawai (Acari: Tetranychidae).

    Science.gov (United States)

    Ghazy, Noureldin Abuelfadl; Suzuki, Takeshi

    2014-05-01

    We investigated the effects of changes in vapor pressure deficit (VPD) on the survival of diapausing (winter form) and non-diapausing (summer form) spider mites Tetranychus urticae Koch and Tetranychus kanzawai Kishida (Acari: Tetranychidae). Adult females of both species were kept without food at VPDs of 0.0, 0.4, 0.7, 1.5, 1.9, or 2.7 kPa for 3, 6, 9, 12, or 15 days at 25 °C. Diapausing females of both species kept at a VPD of ≥0.4 kPa for ≥6 days clearly tolerated desiccation. Under water-saturated conditions (VPD = 0.0 kPa), in which no desiccation occurred, diapausing females showed high starvation tolerance: 90 % survived for up to 15 days. No interspecific differences in tolerance to desiccation or starvation were observed under most conditions. These results indicate that diapause functions increase tolerance to desiccation and starvation. Such multiple tolerances to harsh environments might support winter survival in spider mites.

  13. Historical review of the genus Dermanyssus Dugès, 1834 (Acari: Mesostigmata: Dermanyssidae

    Directory of Open Access Journals (Sweden)

    Roy L.

    2007-06-01

    Full Text Available A synthetic review of the historical systematics of Dermanyssus Dugès, 1834 (Acari: Mesostigmata: Dermanyssidae is provided. The classification at the specific level in this early genus has not really been clarified during more than a century despite its economic impact, and the history of the genus is complex and includes various stages. Moreover, Dermanyssus currently includes 23 species, whereas the last review took only 18 species into account. Changes in the species status and position in the genus Dermanyssus from 1834 until today are presented. The evolution of the generic definition is explored and compared with other genera of the group. How the discrimination between the different species evolved in the genus is also examined. Some difficulties in the specific definitions are discussed. A current diagnosis of the genus Dermanyssus is given. A table of the species included in this genus since its first description along with their respective current positions, a list of the currently included species in Dermanyssus with their hosts, and a world map presenting their geographic distribution are provided.

  14. Identification of a dieldrin resistance-associated mutation in Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Hope, Michelle; Menzies, Moira; Kemp, David

    2010-08-01

    The southern cattle tick, Rhipicephalus (Boophilus) microplus (Canestrini) (Acari: Ixodidae), is a major vector of tick fever organisms affecting cattle in many parts of the world, including Australia, Africa, and South America. Control of the southern cattle tick through acaricide use is an important approach in disease management. Resistance has emerged to many of the acaricides currently and previously used, including the cyclodienes. Although cyclodiene resistance mechanisms have been characterized in many insect species, this report is the first to identify mutations associated with dieldrin resistance in the cattle tick. A novel two base pair mutation in the GABA-gated chloride channel gene has been identified at position 868-9 and causes a codon change from threonine to leucine. Analysis of a small number of field-collected samples resistant to dieldrin shows this mutation has been maintained without selection pressure since the withdrawal of dieldrin in Australia > 20 yr ago. The mutation is not found in other laboratory-maintained strains of R. microplus that were subject to selection pressure with various acaricides.

  15. A new subfamily, Bothriocrotoninae n. subfam., for the genus Bothriocroton Keirans, King & Sharrad, 1994 status amend. (Ixodida: Ixodidae), and the synonymy of Aponomma Neumann, 1899 with Amblyomma Koch, 1844.

    Science.gov (United States)

    Klompen, Hans; Dobson, Susan J; Barker, Stephen C

    2002-10-01

    Evidence suggesting polyphyly of the traditionally recognised tick genus Aponomma Neumann, 1899 is summarized. Continued recognition of this genus in its current concept leaves a polyphyletic genus Aponomma and a paraphyletic genus Amblyomma Koch, 1844. To improve the correlation between our understanding of phylogenetic relationships in metastriate ticks and their classification, a few changes in classification are proposed. The members of the 'indigenous Australian Aponomma' group (sensu Kaufman, 1972), A. auruginans Schulze, 1936, A. concolor Neumann, 1899, A. glebopalma Keirans, King & Sharrad, 1994, A. hydrosauri (Denny, 1843) and A. undatum (Fabricius, 1775), are transferred to Bothriocroton Keirans, King & Sharrad, 1994, which is raised to full generic rank. The remaining members of Aponomma are transferred to Amblyomma. Uncertainty remains on relationships of Bothriocroton to other metastriate lineages and on the systematic position of the two species formerly included in the 'primitive Aponomma' group, A. elaphense Price, 1959 and A. sphenodonti Dumbleton, 1943.

  16. Two new families (Acari: Alicorhagiidae and Platyhelminthes: Prorhynchidae reported for the Hungarian fauna From leaf litter in the Bükk Mountains

    Directory of Open Access Journals (Sweden)

    Pfliegler, W.

    2016-06-01

    Full Text Available Two new members of the Hungarian fauna are reported, both of them were collected in beech forest leaf litter in the Bükk Mountains, North-East Hungary: Alicorhagia fragilis Berlese, 1910 (Arthropoda: Arachnida: Acari: Sarcoptiformes: Endeostigmata: Alicorhagiidae and Geocentrophora baltica (Kennel, 1883 (Platyhelminthes: Rhabditophora: Trepaxonemata: Amplimatricata: 'Lecithoepitheliata': Prorhynchida: Prorhynchidae. The families Alicorhagiidae and Prorhynchidae both represent new taxa in the fauna of the country.

  17. Secondary structure of expansion segment D1 in LSU rDNA from Arachnida and its phylogenetic application in Eriophyoid mites and in Acari.

    Science.gov (United States)

    Wang, Zheng-Hang; Zhao, Ya-E; Xu, Yang; Hu, Li; Chen, Yi-Meng

    2015-12-01

    An increasing number of researchers have applied secondary-structure based multiple alignments of rDNA genes in phylogeny. These studies mostly depended on a few valuable divergent domains in LSU and SSU rDNA. Yet other divergent domains, e.g. D1, were poorly investigated and rarely used. However, these domains might contain additional evolutionary data and play a vital role in DNA-based phylogenetic study. Here, we investigated all available D1 sequences of Arachnida taxa and predicted corresponding secondary structures to help identify homologous positions in the D1 region. Long insertions were found exclusive to Eriophyoidea and folded into three newly proposed helices. Non-Acari taxa were all GC rich. In Acari, most Trombidiformes and all Mesostigmata (Parasitiformes) taxa were AT rich and Ixodida (Parasitiformes) GC rich; however there was no consistent base bias in Sarcoptiformes sequences. For Eriophyoid mites, genera Cecidophyopsis and Aceria were both well supported in MP, NJ, ME and ML tress based on D1 sequences, and clusters of Cecidophyopsis species were identical with former study. This demonstrated that the D1 region could act as a valuable molecular marker in phylogenetic reconstruction of Eriophyoidea. Additionally, D1 has been proven suitable in phylogenetic analysis at the family and genus level in Acari, but not in Opiliones.

  18. Effects of Insecticides and Fungicides Commonly Used in Tomato Production on Phytoseiulus persimilis (Acari: Phtyoseiidae).

    Science.gov (United States)

    Ditillo, J L; Kennedy, G G; Walgenbach, J F

    2016-12-01

    The twospotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae), is an important pest of tomatoes in North Carolina. Resident populations of the predatory mite Phytoseiulus persimilis have recently been detected on field-grown tomatoes in central North Carolina, and potentially can be a useful biological control agent against T. urticae Laboratory bioassays were used to assess lethal and reproductive effects of 10 insecticides and five fungicides commonly used in commercial tomato production (chlorantraniliprole, spinetoram, permethrin, imidacloprid, dimethoate, dinotefuran, thiamethoxam, bifenthrin, fenpropathrin, lambda-cyhalothrin, azoxystrobin, chlorothalonil, boscalid, cyazofamid, and mancozeb) on P. persimilis adult females and eggs. Insecticides were tested using concentrations equivalent to 1×, 0.5×, and 0.1× of the recommended field rates. Fungicides were tested at the 1× rate only. Dimethoate strongly impacted P. persimilis with high adult mortality, reduced fecundity, and reduced hatch of eggs laid by treated adults, particularly at high concentrations. The pyrethroids lambda-cyhalothrin, bifenthrin, and fenpropathrin were associated with repellency and reproductive effects at high concentrations. Bifenthrin additionally caused increased mortality at high concentrations. Chlorantraniliprole, dinotefuran, and permethrin did not significantly affect mortality or reproduction. Imidacloprid significantly reduced fecundity and egg viability, but was not lethal to adult P. persimilis Thiamethoxam negatively impacted fecundity at the 1× rate. There were no negative effects associated with fungicide exposure with the exception of mancozeb, which impacted fecundity. Field trials were conducted to explore the in vivo impacts of screened insecticides on P. persimilis populations in the field. Field trials supported the incompatibility of dimethoate with P. persimilis populations. © The Authors 2016. Published by Oxford University Press on behalf

  19. Repellent activities of dichloromethane extract of Allium sativum (garlic (Liliaceae against Hyalomma rufipes (Acari

    Directory of Open Access Journals (Sweden)

    Felix Nchu

    2016-02-01

    Full Text Available Dichloromethane (DCM extract of garlic (Allium sativum Linn. bulbs was assessed for its repellent effect against the hard tick, Hyalomma rufipes (Acari: Ixodidae using two tick behavioural bioassays; Type A and Type B repellency bioassays, under laboratory conditions. These bioassays exploit the questing behaviour of H. rufipes, a tick that in nature displays ambush strategy, seeking its host by climbing up on vegetation and attaching to a passing host. One hundred microlitres (100 µL of the test solution containing DCM extract of garlic bulbs and DCM at concentrations of 0.35%, 0.7% or 1.4% w/v were evaluated. DCM only was used for control. Tick repellency increased significantly (R2 = 0.98 with increasing concentration (40.03% – 86.96% yielding an EC50 of 0.45% w/v in Type B repellency bioassay. At concentration of 1.4% w/v, the DCM extract of garlic bulbs produced high repellency index of 87% (male ticks and 87.5% (female ticks in the Type A repellency bioassay. Only 4% avoidance of male ticks or female ticks was recorded in the Type B repellency bioassay. In the corresponding controls, the mean numbers of non-repelled male or female ticks were 80% and 41 males or 38 females of 50 ticks in the Type A and Type B repellency bioassays, respectively. The variations in the results could be attributed to the difference in tick repellent behaviours that were assessed by the two repellency bioassays; the Type A repellency bioassay assessed repellent effect of garlic extracts without discriminating between deterrence and avoidance whereas the Type B repellency bioassay only assessed avoidance response. Generally, DCM extract of garlic was repellent against H. rufipes, albeit weak tick repellency was obtained in the Type B repellency bioassay. Furthermore, this study established that the tick repellent activity of garlic extracts is predominantly by deterrence.

  20. Pest management systems affect composition but not abundance of phytoseiid mites (Acari: Phytoseiidae) in apple orchards.

    Science.gov (United States)

    Szabó, Árpád; Pénzes, Béla; Sipos, Péter; Hegyi, Tamás; Hajdú, Zsuzsanna; Markó, Viktor

    2014-04-01

    We examined the faunal composition and abundance of phytoseiid mites (Acari: Phytoseiidae) in apple orchards under different pest management systems in Hungary. A total of 30 apple orchards were surveyed, including abandoned and organic orchards and orchards where integrated pest management (IPM) or broad spectrum insecticides (conventional pest management) were applied. A total of 18 phytoseiid species were found in the canopy of apple trees. Species richness was greatest in the organic orchards (mean: 3.3 species/400 leaves) and the least in the conventional orchards (1.4), with IPM (2.1) and abandoned (2.7) orchards showing intermediate values. The phytoseiid community's Rényi diversity displayed a similar pattern. However, the total phytoseiid abundance in the orchards with different pest management systems did not differ, with abundance varying between 1.8 and 2.6 phytoseiids/10 leaves. Amblyseius andersoni, Euseius finlandicus, and Typhlodromus pyri were the three most common species. The relative abundance of A. andersoni increased with the pesticide load of the orchards whereas the relative abundance of E. finlandicus decreased. The abundance of T. pyri did not change in the apple orchards under different pest management strategies; regardless of the type of applied treatment, they only displayed greater abundance in five of the orchards. The remaining 15 phytoseiid species only occurred in small numbers, mostly from the abandoned and organic orchards. We identified a negative correlation between the abundance of T. pyri and the other phytoseiids in the abandoned and organic orchards. However, we did not find any similar link between the abundance of A. andersoni and E. finlandicus.

  1. Repellent activities of dichloromethane extract of Allium sativum (garlic) (Liliaceae) against Hyalomma rufipes (Acari).

    Science.gov (United States)

    Nchu, Felix; Magano, Solomon R; Eloff, Jacobus N

    2016-12-02

    Dichloromethane (DCM) extract of garlic (Allium sativum Linn.) bulbs was assessed for its repellent effect against the hard tick, Hyalomma rufipes (Acari: Ixodidae) using two tick behavioural bioassays; Type A and Type B repellency bioassays, under laboratory conditions. These bioassays exploit the questing behaviour of H. rufipes, a tick that in nature displays ambush strategy, seeking its host by climbing up on vegetation and attaching to a passing host. One hundred microlitres (100 µL) of the test solution containing DCM extract of garlic bulbs and DCM at concentrations of 0.35%, 0.7% or 1.4% w/v were evaluated. DCM only was used for control. Tick repellency increased significantly (R2 = 0.98) with increasing concentration (40.03% - 86.96%) yielding an EC50 of 0.45% w/v in Type B repellency bioassay. At concentration of 1.4% w/v, the DCM extract of garlic bulbs produced high repellency index of 87% (male ticks) and 87.5% (female ticks) in the Type A repellency bioassay. Only 4% avoidance of male ticks or female ticks was recorded in the Type B repellency bioassay. In the corresponding controls, the mean numbers of non-repelled male or female ticks were 80% and 41 males or 38 females of 50 ticks in the Type A and Type B repellency bioassays, respectively. The variations in the results could be attributed to the difference in tick repellent behaviours that were assessed by the two repellency bioassays; the Type A repellency bioassay assessed repellent effect of garlic extracts without discriminating between deterrence and avoidance whereas the Type B repellency bioassay only assessed avoidance response. Generally, DCM extract of garlic was repellent against H. rufipes, albeit weak tick repellency was obtained in the Type B repellency bioassay. Furthermore, this study established that the tick repellent activity of garlic extracts is predominantly by deterrence.

  2. Efeitos de Beauveria bassiana (Bals Vuill e Metarhizium anisopliae (Metsc Sorok sobre fêmeas ingurgitadas de Amblyomma cajennense (Fabricius, 1787 em condições de laboratório Effects of Beauveria bassiana (Bals Vuill and Metarhizium anisopliae (Metsc Sorok on engorged females of Amblyomma cajennense (Fabricius, 1787 in laboratory conditions

    Directory of Open Access Journals (Sweden)

    R.C.S. Reis

    2004-12-01

    Full Text Available The in vitro susceptibility of Amblyomma cajennense engorged females to some isolated of the fungus Beauveria bassiana and Metarhizium anisopliae was verified and lethal concentrations (LC 50 and LC 90 were calculated. The females were dived in conidia suspensions for five minutes, and kept in climatically controlled chambers BOD under 27° C and 80% relative humidity. Each bioassay had four treatments in concentrations of 10(5,10(6,10(7e10(8 conidia/ml. A control group was also used. The following characteristics were evaluated: weight and period of oviposition, indexes of reproductive and nutritional efficiency and percentage of microbiological control. A dose dependent negative effect was observed in ticks treated with the suspension. All isolates tested cause a negative effect on in vitro tests of engorged females of A. cajennense, suggesting its potential for microbiological control of tick's species.

  3. Effect of Pollen from Different Plant Species on Development of Typhlodromus pyri (Sheuten (Acari: Phytoseiidae Efecto del Polen de Diferentes Especies Vegetales sobre el Desarrollo de Typhlodromus pyri (Sheuten (Acari: Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Paulina Bermúdez

    2010-09-01

    Full Text Available Typhlodromus pyri (Sheuten (Acari: Phytoseiidae is a phytoseiid mite with a high potential in controlling the false Chilean mite (Brevipalpus chilensis Baker; Acari: Tenuipalpidae. The purpose of this study was to determine the effect of different plant species pollen as a complementary food in the development of T. pyri when its prey is in low levels of availability. Mites were individually placed on black plastic boxes with pollen and maintained at a temperature of 26 ± 2 °C, 70 ± 5% relative humidity (RH, and a photoperiod of 16:8 h (L:D. Postembryonic development of T. pyri was studied in 11 pollen species, as well as in a mixed diet of Hirschfeldia incana (L. and B. chilensis. Results show that H. incana was the only pollen in which there was no mortality (P > 0.05 along with the control (Oxalis pes-caprae L.. Mean duration from egg to adult with H. incana was 8.70 ± 1.66 d, protonymph 3.27 ± 0.21 d, and deutonymph 2.90 ± 1.45 d (P > 0.05. The mix feeding of T. pyri did not show any significant differences neither in the mean time from egg to adult, nor in mortality by feeding only with B. chilensis. Survival curves of T. pyri fed only with H. incana pollen, combined with B. chilensis, and only with B. chilensis are higher in the first 14 d of life. The sex ratio was not significantly affected by being fed only with H. incana pollen, B. chilensis, or by a combination of both.Typhlodromus pyri (Sheuten (Acari: Phytoseiidae es un ácaro que presenta un alto potencial de uso para el control de la falsa arañita roja de la vid (Brevipalpus chilensis Baker; Acari: Tenuipalpidae. El objetivo de este estudio fue determinar el efecto del polen de diferentes especies vegetales como alimento complementario para T. pyri cuando escasea su presa. Los parámetros post-embrionarios de T. pyri se estudiaron en 11 especies de polen, en una dieta mixta de polen de Hirschfeldia incana (L. y B. chilensis. Los ácaros se colocaron individualmente sobre

  4. Acari; Tetranychidae

    African Journals Online (AJOL)

    do not specifically target T. urticae in terms of control but use insecticides at high dosages ... leaves were taken from the plants and sprayed with serial dilutions of the ... The LD50 values and slopes were determined using probit analysis and ...

  5. Primer registro del hongo Neozygites sp. (Zygomycota: Entomophthorales, patógeno de Tetranychus urticae (Acari: Tetranychidae en la República Argentina First record of Neozygites sp. (Zygomycota: Entomophthorales, pathogen of Tetranychus urticae (Acari: Tetranychidae in Argentina

    Directory of Open Access Journals (Sweden)

    Ana C. Scorsetti

    Full Text Available En el presente trabajo se cita por primera vez para la Argentina la presencia del hongo entomopatógeno Neozygites cf. floridana (Zygomycota: Zygomycetes: Entomophthorales como patógeno de la «arañuela roja», Tetranychus urticae (Acari: Tetranychidae, importante plaga de cultivos hortícolas en la región. Los muestreos fueron realizados en el cinturón hortícola del Gran La Plata sobre cultivos de tomate, pimiento, berenjena, y otras hortalizas. El material de herbario, como preparaciones microscópicas y ácaros infectados fue depositado en el Herbario del Instituto de Botánica C. Spegazzini y en el herbario micológico del CEPAVE. Este trabajo contribuye a ampliar la distribución y el espectro de hospedadores de Neozygites , así como ampliar la información de los hongos entomopatógenos en la Argentina.In this paper, the presence of the fungi Neozygites cf. floridana (Zygomycota: Zygomycetes: Entomophthorales, as pathogen of the mite Tetranychus urticae (Acari: Tetranychidae, is recorded for first time in Argentina. Samplings were carried out in La Plata , on tomato, pepper, egg-plant, and other horticultural crops. Microscopic slides and mites infected were placed in the Herbarium of the Institute of Botany C. Spegazzini and in the Herbarium of CEPAVE. This work contributes to further expand the distribution and the host range of Neozygites as well as the information of entomopathogenic fungi in Argentina.

  6. SELETIVIDADE DE INSETICIDAS A Neoseiulus californicus MCGREGOR (ACARI: PHYTOSEIIDAE EM MACIEIRA, NO RIO GRANDE DO SUL AGROCHEMICAL SELECTIVITY TO Neoseiulus californicus MCGREGOR (ACARI: PHYTOSEIIDAE ON APPLE IN RIO GRANDE DO SUL

    Directory of Open Access Journals (Sweden)

    LINO BITTENCOURT MONTEIRO

    2001-12-01

    Full Text Available Testes para determinar os efeitos de agroquímicos homologados para macieira foram realizados em laboratório sobre Neoseiulus californicus (Acari: Phytoseiidae. Os indivíduos testados foram coletados de um pomar comercial da Agriflor Ltda, em Vacaria, Rio Grande do Sul, após várias liberações inoculativas. Os inseticidas utilizados foram os tradicionalmente recomendados para o controle de pragas, principalmente mosca-das-frutas Anastrepha fraterculus (Diptera: Tephritidae. A oviposição e a mortalidade dos ácaros foram avaliadas 12; 24; 48 e 96 horas após a pulverização, cujos produtos foram classificados em quatro classes de toxicidade (IOBC/WPRS. Azinphos ethyl, deltametrina e fenthion provocaram 100% de mortalidade, sendo que dimethoate, fenitrotion, paration, phosmet e triclorfon foram levemente nocivos (classe 2. Malation foi considerado neutro para esta população.The side-effects of agrochemical to Neoseiulus californicus (Acari: Phytoseiidae were studied in laboratory. The mites were collected in commercial apple orchard of Agropastoril Rincão das Flores, in Vacaria, Rio Grande do Sul, Brazil, after successive inoculative releases. The insecticids used were recommended to control of same pest, as Anastrepha fraterculus (Diptera: Tephritidae. The reproduction effect and mortality were evalued 12, 24, 48 and 96 hours after pulverization, while the agrochemical were ranked in toxicity classes, according to IOBC/WPRS. Azinphos ethyl, deltametrina e fenthion were harmful with ca. 100% of mortality in 24 hours, dimethoate, fenitrotion, paration, phosmet e triclorfon were slightly harmful (class 2. Malation was harmless.

  7. TAMBO VIEJO: UN ASENTAMIENTO FORTIFICADO EN EL VALLE DE ACARÍ, PERÚ (Tambo Viejo: A Fortified Settlement in the Acari Valley, Peru

    Directory of Open Access Journals (Sweden)

    Lidio M. Valdez

    2013-10-01

    Full Text Available La aparición de los asentamientos fortificados y el origen del conflicto violento son temas poco discutidos en el contexto de la arqueología peruana. Considero que es oportuno investigar y determinar cuándo y por qué surgieron los primeros asentamientos fortificados. El propósito central de este artículo está precisamente orientado a responder tales interrogantes y discutir el tema del conflicto violento en el valle de Acarí y, por extensión, en la costa sur del Perú. Las evidencias arqueológicas disponibles señalan que, durante el periodo Intermedio Temprano, Tambo Viejo fue un asentamiento defendido por varias estructuras perimétricas. Otros sitios contemporáneos de Tambo Viejo en Acarí también fueron fortificados. Además, existe en el mismo valle evidencia tangible de violencia en la forma de prisioneros que posteriormente fueron decapitados. En contraste a la evidencia proveniente de Acarí, no existen asentamientos del periodo Intermedio Temprano identificables como fortificaciones, lo que hace de los sitios de Acarí los primeros asentamientos fortificados de toda la costa sur. ENGLISH: The emergence of violent conflict and of fortified settlements is a subject little studied within Peruvian archaeology. However, I consider it vital to investigate and determine the time and the reasons under which fortified settlements were first established. The central aim of this paper is to discuss when and why fortified settlements emerged first in the Acari Valley and, by extension, in the south coast of Peru. Available archaeological evidence indicates that during the Early Intermediate Period, Tambo Viejo was a fortified settlement protected by several massive walls. Other neighbouring sites in Acari were also fortified. Furthermore, in Acari there is conclusive evidence for violence in the form of decapitated individuals. In contrast to evidence coming from Acari, not a single Early Intermediate Period settlement from other

  8. Demodex castoris sp. nov. (Acari: Demodecidae) parasitizing Castor fiber (Rodentia), and other parasitic arthropods associated with Castor spp.

    Science.gov (United States)

    Izdebska, Joanna N; Fryderyk, Sławomira; Rolbiecki, Leszek

    2016-02-11

    A new species of demodecid mite, Demodex castoris sp. nov. (Acari: Prostigmata: Demodecidae), is described based on adult stages from the skin of the nasal region of the Eurasian beaver Castor fiber Linnaeus, 1758, collected in Poland. This is the first detection of a representative demodecid mite in rodents of the suborder Castorimorpha and also represents the first detection of a skin mite in Eurasian beavers. The new species is a small skin mite (average 173 µm in length) characterized by sexual dimorphism related to body proportions. D. castoris sp. nov. was observed in 4 out of 6 beavers examined (66.6%), with a mean intensity of 10.8 and an intensity range of 2-23 ind. host(-1). This paper also contains a checklist of parasitic arthropods known from Castor spp.

  9. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    LUIS E. PATERNINA

    2009-01-01

    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfoló- gicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se reco- lectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fue- ron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

  10. The Evolving Medical and Veterinary Importance of the Gulf Coast tick (Acari: Ixodidae).

    Science.gov (United States)

    Paddock, Christopher D; Goddard, Jerome

    2015-03-01

    Amblyomma maculatum Koch (the Gulf Coast tick) is a three-host, ixodid tick that is distributed throughout much of the southeastern and south-central United States, as well as several countries throughout Central and South America. A considerable amount of scientific literature followed the original description of A. maculatum in 1844; nonetheless, the Gulf Coast tick was not recognized as a vector of any known pathogen of animals or humans for >150 years. It is now identified as the principal vector of Hepatozoon americanum, the agent responsible for American canine hepatozoonosis, and Rickettsia parkeri, the cause of an emerging, eschar-associated spotted fever group rickettsiosis identified throughout much of the Western Hemisphere. Coincident with these discoveries has been recognition that the geographical distribution of A. maculatum in the United States is far more extensive than described 70 yr ago, supporting the idea that range and abundance of certain tick species, particularly those with diverse host preferences, are not fixed in time or space, and may change over relatively short intervals. Renewed interest in the Gulf Coast tick reinforces the notion that the perceived importance of a particular tick species to human or animal health can be relatively fluid, and may shift dramatically with changes in the distribution and abundance of the arthropod, its vertebrate hosts, or the microbial agents that transit among these organisms. Published by Oxford University Press on behalf of Entomological Society of America 2015. This work is written by US Government employees and is in the public domain in the US.

  11. Ecology of the interaction between Ixodes loricatus (Acari: Ixodidae) and Akodon azarae (Rodentia: Criceridae).

    Science.gov (United States)

    Colombo, Valeria C; Nava, Santiago; Antoniazzi, Leandro R; Monje, Lucas D; Racca, Andrea L; Guglielmone, Alberto A; Beldomenico, Pablo M

    2015-10-01

    The present study explores associations of different factors (i.e. host parameters, presence of other ectoparasites and [mainly biotic] environmental factors) with burdens of Ixodes loricatus immature stages in one of its main hosts in Argentina, the rodent Akodon azarae. For 2 years, rodents were trapped and sampled monthly at 16 points located in four different sites in the Parana River Delta region. Data were analysed with generalized linear mixed models with a negative binomial response (counts of larvae or nymphs). The independent variables assessed were (a) environmental: trapping year, presence of cattle, type of vegetation, rodent abundance; (b) host parameters: body length, sex, body condition, blood cell counts, natural antibody titers and (c) co-infestation with other ectoparasites. Two-way interaction terms deemed a priori as relevant were also included in the analysis. Most of the associations investigated were found significant, but in general, the direction and magnitude of the associations were context-dependent. An exception was the presence of cattle, which was consistently negatively associated with both larvae and nymphs independently of all other variables considered and had the strongest effect on tick burdens. Mites, fleas and Amblyomma triste were also significantly associated (mostly positively) with larval and nymph burdens, and in many cases, they influenced associations with environmental or host factors. Our findings strongly support that raising cattle may have a substantial impact on the dynamics of I. loricatus and that interactions within the ectoparasite community may be an important-but generally ignored-driver of tick dynamics.

  12. A prevalent alpha-proteobacterium Paracoccus sp. in a population of the Cayenne ticks (Amblyomma cajennense from Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Erik Machado-Ferreira

    2012-01-01

    Full Text Available As Rocky Mountain Spotted Fever is the most common tick-borne disease in South America, the presence of Rickettsia sp. in Amblyomma ticks is a possible indication of its endemicity in certain geographic regions. In the present work, bacterial DNA sequences related to Rickettsia amblyommii genes in A. dubitatum ticks, collected in the Brazilian state of Mato Grosso, were discovered. Simultaneously, Paracoccus sp. was detected in aproximately 77% of A. cajennense specimens collected in Rio de Janeiro, Brazil. This is the first report of Paracoccus sp. infection in a specific tick population, and raises the possibility of these bacteria being maintained and/or transmitted by ticks. Whether Paracoccus sp. represents another group of pathogenic Rhodobacteraceae or simply plays a role in A. cajennense physiology, is unknown. The data also demonstrate that the rickettsial 16S rRNA specific primers used forRickettsia spp. screening can also detect Paracoccus alpha-proteobacteria infection in biological samples. Hence, a PCRRFLP strategy is presented to distinguish between these two groups of bacteria.

  13. Detection of Rickettsia rickettsii in the tick Amblyomma cajennense in a new Brazilian spotted fever-endemic area in the state of Minas Gerais

    Directory of Open Access Journals (Sweden)

    Elizângela Guedes

    2005-12-01

    Full Text Available The present study evaluated rickettsial infection in Amblyomma spp. ticks collected in a farm in Coronel Pacheco, a Brazilian spotted fever (BSF endemic area. A total of 78 A. cajennense and 78 A. dubitatum free-living adult ticks were collected and tested by polymerase chain reaction (PCR targeting a fragment of the rickettsial gene gltA. Only one pool of three A. cajennense ticks showed the expected product by PCR. This pool was further tested by PCR using sets of primers targeting the rickettsial genes gltA, ompA, and ompB. All reactions yielded the expected bands that by sequencing, showed 100% identity to the corresponding sequences of the Rickettsia rickettsii gene fragments gltA (1063-bp, ompA (457-bp, and ompB (720-bp. The minimal infection rate of R. rickettii in the A. cajennense population was 1.28% (at least one infected tick within 78 ticks.The present study showed molecular evidence for the presence of R. rickettsii in A. cajennense from a BSF-endemic area in Coronel Pacheco, state of Minas Gerais. Although R. rickettsii has been previously reported infecting A. cajennense ticks in Brazil and other Latin American countries, the present study performed the first molecular characterization of R. rickettsii from the tick A. cajennense.

  14. A prevalent alpha-proteobacterium Paracoccus sp. in a population of the Cayenne ticks (Amblyomma cajennense) from Rio de Janeiro, Brazil.

    Science.gov (United States)

    Machado-Ferreira, Erik; Piesman, Joseph; Zeidner, Nordin S; Soares, Carlos A G

    2012-12-01

    As Rocky Mountain Spotted Fever is the most common tick-borne disease in South America, the presence of Rickettsia sp. in Amblyomma ticks is a possible indication of its endemicity in certain geographic regions. In the present work, bacterial DNA sequences related to Rickettsia amblyommii genes in A. dubitatum ticks, collected in the Brazilian state of Mato Grosso, were discovered. Simultaneously, Paracoccus sp. was detected in aproximately 77% of A. cajennense specimens collected in Rio de Janeiro, Brazil. This is the first report of Paracoccus sp. infection in a specific tick population, and raises the possibility of these bacteria being maintained and/or transmitted by ticks. Whether Paracoccus sp. represents another group of pathogenic Rhodobacteraceae or simply plays a role in A. cajennense physiology, is unknown. The data also demonstrate that the rickettsial 16S rRNA specific primers used forRickettsia spp. screening can also detect Paracoccus alpha-proteobacteria infection in biological samples. Hence, a PCR-RFLP strategy is presented to distinguish between these two groups of bacteria.

  15. Detection of Rickettsia rickettsii in the tick Amblyomma cajennense in a new Brazilian spotted fever-endemic area in the state of Minas Gerais.

    Science.gov (United States)

    Guedes, Elizângela; Leite, Romário C; Prata, Márcia C A; Pacheco, Richard C; Walker, David H; Labruna, Marcelo B

    2005-12-01

    The present study evaluated rickettsial infection in Amblyomma spp. ticks collected in a farm in Coronel Pacheco, a Brazilian spotted fever (BSF) endemic area. A total of 78 A. cajennense and 78 A. dubitatum free-living adult ticks were collected and tested by polymerase chain reaction (PCR) targeting a fragment of the rickettsial gene gltA. Only one pool of three A. cajennense ticks showed the expected product by PCR. This pool was further tested by PCR using sets of primers targeting the rickettsial genes gltA, ompA, and ompB. All reactions yielded the expected bands that by sequencing, showed 100% identity to the corresponding sequences of the Rickettsia rickettsii gene fragments gltA (1063-bp), ompA (457-bp), and ompB (720-bp). The minimal infection rate of R. rickettii in the A. cajennense population was 1.28% (at least one infected tick within 78 ticks). The present study showed molecular evidence for the presence of R. rickettsii in A. cajennense from a BSF-endemic area in Coronel Pacheco, state of Minas Gerais. Although R. rickettsii has been previously reported infecting A. cajennense ticks in Brazil and other Latin American countries, the present study performed the first molecular characterization of R. rickettsii from the tick A. cajennense.

  16. Field collection and genetic classification of tick-borne Rickettsiae and Rickettsiae-like pathogens from South Texas: Coxiella burnetii isolated from field-collected Amblyomma cajennense.

    Science.gov (United States)

    Sanders, David M; Parker, Jill E; Walker, Wes W; Buchholz, Matt W; Blount, Keith; Kiel, Johnathan L

    2008-12-01

    We are reporting the first known isolation of the Q-fever agent Coxiella burnetii from field-collected cayenne ticks Amblyomma cajennense in North America. Q-fever affects a number of domestic ungulates where it can lead to abortion in sheep and goats. There is far less known about the disease's effects on wild species, primarily because of the tendency of the disease to self resolve and to provide long-term immunity to subsequent infections. The first recovery of C. burnetii in North America was from the tick species Dermacentor andersoni. Since the original isolation C. burnetii has been recovered from five other North American tick species. The currently accepted mode for the majority of human infections is inhalation. The Centers for Disease Control and Prevention, Division of Viral and Rickettsial Diseases, Rickettsial Zoonoses Branch asserts the Q-fever agent as requiring as few as one organism to cause disease via inhalation in susceptible humans. However, with more and more isolations from ticks, evidence linking C. burnetii and ticks is mounting. The true role of tick species as competent vectors is still unconfirmed. Preemptive field collections of possible vector arthropods, hosts, and reservoirs can provide invaluable baseline environmental data that will prove supportive in follow-up studies and abatement efforts.

  17. Isolation of Rickettsia parkeri and identification of a novel spotted fever group Rickettsia sp. from Gulf Coast ticks (Amblyomma maculatum) in the United States.

    Science.gov (United States)

    Paddock, Christopher D; Fournier, Pierre-Edouard; Sumner, John W; Goddard, Jerome; Elshenawy, Yasmin; Metcalfe, Maureen G; Loftis, Amanda D; Varela-Stokes, Andrea

    2010-05-01

    Until recently, Amblyomma maculatum (the Gulf Coast tick) had garnered little attention compared to other species of human-biting ticks in the United States. A. maculatum is now recognized as the principal vector of Rickettsia parkeri, a pathogenic spotted fever group rickettsia (SFGR) that causes an eschar-associated illness in humans that resembles Rocky Mountain spotted fever. A novel SFGR, distinct from other recognized Rickettsia spp., has also been detected recently in A. maculatum specimens collected in several regions of the southeastern United States. In this study, 198 questing adult Gulf Coast ticks were collected at 4 locations in Florida and Mississippi; 28% of these ticks were infected with R. parkeri, and 2% of these were infected with a novel SFGR. Seventeen isolates of R. parkeri from individual specimens of A. maculatum were cultivated in Vero E6 cells; however, all attempts to isolate the novel SFGR were unsuccessful. Partial genetic characterization of the novel SFGR revealed identity with several recently described, incompletely characterized, and noncultivated SFGR, including "Candidatus Rickettsia andeanae" and Rickettsia sp. Argentina detected in several species of Neotropical ticks from Argentina and Peru. These findings suggest that each of these "novel" rickettsiae represent the same species. This study considerably expanded the number of low-passage, A. maculatum-derived isolates of R. parkeri and characterized a second, sympatric Rickettsia sp. found in Gulf Coast ticks.

  18. More about the role of 2,6-dichlorophenol in tick courtship: identification and olfactometer bioassay in Amblyomma cajennense and Rhipicephalus sanguineus

    Directory of Open Access Journals (Sweden)

    Carla Cristina Braz Louly

    2008-02-01

    Full Text Available This study aimed to identify 2,6-dichlorophenol (2,6-DCP in Amblyomma cajennense and to evaluate its role in A. cajennense and Rhipicephalus sanguineus courtship. Hexanic extract from attractive females was purified by solid phase extraction and the phenol was identified by the single ion monitoring method using GC/MS. In an olfactometer, the responses of A. cajennense and R. sanguineus males to females, control rubber septa or rubber septa impregnated with 2,6-DCP at 50, 500, and 5000 ng, respectively, were studied. 2,6-DCP was identified in A. cajennense extract and the males oriented themselves toward the concentration of 500 ng. These septa and the females were recognized as copula partners. The septa treated with 2,6-DCP did not attract and were not even recognized by the R. sanguineus males, whereas the females were recognized. Due to the presence of 2,6-DCP in A. cajennense and the results of biological bioassays, it was concluded that this compound acts as an attractant and mounting sex pheromone in this tick, but it does not play any role in R. sanguineus courtship.

  19. Chlorotic spots on Clerodendrum, a disease caused by a nuclear type of Brevipalpus (Acari:Tenuipalpidae) transmitted virus Mancha clorótica do Clerodendrum, uma enfermidade causada por um vírus do tipo nuclear, transmitido pelo ácaro Brevipalpus phoenicis (Acari:Tenuipalpidae)

    OpenAIRE

    Elliot Watanabe Kitajima; Karen Sumire Kubo; Paulo de Tarso de Oliveira Ferreira; Berenice Kussumoto de Alcântara; Alessandra de Jesus Boari; Renata Takassugi Gomes; Juliana Freitas-Astua; Jorge Alberto Marques Rezende; Gilberto José de Morais; Renato Barbosa Salaroli

    2008-01-01

    Chlorotic spots have been observed in plants of Clerodendrum x speciosum growing in residential gardens and parks in Piracicaba, SP, Brazil. Thin sections of diseased tissues revealed characteristic cytopathic effects of the nuclear type of the Brevipalpus (Acari: Tenuipalpidae) mite-transmitted viruses (BTrV). Brevipalpus mites, identified as B. phoenicis, infesting symptomatic C. x speciosum plants transmitted the pathogen to healthy C. x speciosum and to C. thomsonae, Gomphrena globosa, Hi...

  20. Comparative residual toxicities of pesticides to the predator Agistemus industani (Acari: Stigmaeidae) on citrus in Florida.

    Science.gov (United States)

    Childers, C C; Villanueva, R; Aguilar, H; Chewning, R; Michaud, J P

    2001-01-01

    Residual toxicities of registered and selected experimental pesticides used on citrus against Agistemus industani Gonzalez (Acari: Stigmaeidae) were compared. Pesticides considered highly toxic to A. industani were: abamectin 0.15 EC at 731 ml/ha + FC 435-66 petroleum oil at 46.8 l/ha, pyridaben 75 WP at 469 g/ha, ethion 4 EC at 7.01 l/ha + FC 435-66 petroleum oil at 46.8 l/ha, propargite 6.55 EC at 3.51 l/ha, chlorfenapyr 2 SC at 1.46 l/ha applied alone or in combination with FC 435-66 petroleum oil at 46.8 l/ha, sulphur 80 DF at 16.81 kg/ha. dicofol 4EC at 7.01 l/ha, fenbutatin oxide 50 WP at 2.24 kg/ha, benomyl 50 WP at 2.24 kg/ha, benomyl 50 WP at 1.68 kg/ha + ferbam 76 GF at 5.60 kg/ha, ferbam 76 GF at 11.21 kg/ha, neem oil 90 EC at 46.8 l/ha, and copper hydroxide DF (40% metallic copper) at 4.48 kg metallic copper/ha + FC 435-66 petroleum oil at 46.8 l/ha. Pesticides that were moderately to slightly toxic included: copper sulphate 98% at 4.48 kg metallic copper/ha + FC 435-66 petroleum oil at 46.8 l/ha, fenbuconazole 2 F at 280 ml/ha + FC 435-66 petroleum oil at 46.8 l/ha, FC 435-66 petroleum oil applied alone at 46.8 l/ha or 23.41/ha, and diflubenzuron 25 WP at 1.40 kg/ha. Pesticides that were non-toxic included: fenbuconazole 2 F at 585 ml/ha, malathion 57 EC at 5.85 l/ha, FC 435-66 petroleum oil at 46.8 l/ha, carbaryl 80 S at 3.36 kg/ha. chlorpyrifos 4 EC at 4.68 l/ha, and formetanate 92 SP at 1.12 kg/ha. Understanding the toxic effects of field weathered pesticides against key predacious mite species is important for effective IPM. The results of this study provide a comparison of direct and indirect toxic effects of various pesticides to A. industani under field conditions.

  1. Bazı bitkisel kökenli uçucu yağların Tetranychus cinnabarinus (Boisduval, 1867) (Acari: Tetranychidae) üzerine kontakt ve repellent etkileri

    OpenAIRE

    TOPUZ, Emine; MADANLAR, Nilgün

    2010-01-01

    In this study, contact and repellent effects of 5 different plant essential oils against Tetranychus cinnabarinus (Boisduval, 1867) (Acari: Tetranychidae) were investigated under laboratory conditions. Essential oils of aerial parts, leaves or seeds of Mentha pulegium Linnaeus (Labiatae), Foeniculum vulgare Miller (Umbellifera), Pistacia terebinthus Linnaeus (Anacardiaceae), Schinus molle Linnaeus (Anacardiaceae) and Vitex agnus-castus Linnaeus (Verbenaceae) plants, grown around Antalya regio...

  2. Structural characterization of tick cement cones collected from in vivo and artificial membrane blood-fed Lone Star ticks (Amblyomma americanum).

    Science.gov (United States)

    Bullard, Rebekah; Allen, Paige; Chao, Chien-Chung; Douglas, Jessica; Das, Pradipta; Morgan, Sarah E; Ching, Wei-Mei; Karim, Shahid

    2016-07-01

    The Lone Star tick, Amblyomma americanum, is endemic to the southeastern United States and capable of transmitting pathogenic diseases and causing non-pathogenic conditions. To remain firmly attached to the host, the tick secretes a proteinaceous matrix termed the cement cone which hardens around the tick's mouthparts to assist in the attachment of the tick as well as to protect the mouthparts from the host immune system. Cement cones collected from ticks on a host are commonly contaminated with host skin and hair making analysis of the cone difficult. To reduce the contamination found in the cement cone, we have adapted an artificial membrane feeding system used to feed long mouthpart ticks. Cones collected from in vivo and membrane fed ticks are analyzed to determine changes in the cone morphology. Comparisons of the cement cones using light microscopy shows similar structures and color however using scanning electron microscopy the cones have drastically different structures. The in vivo cones contain fibrils, sheets, and are heavily textured whereas cones from membrane fed ticks are remarkably smooth with no distinct structures. Analysis of the secondary protein structures using FTIR-ATR show both in vivo and membrane fed cement cones contain β sheets but only in vivo cement cones contain helical protein structures. Additionally, proteomic analysis using LC-MS/MS identifies many proteins including glycine rich proteins, metalloproteases, and protease inhibitors. Proteomic analysis of the cones identified both secreted and non-secreted tick proteins. Artificial membrane feeding is a suitable model for increased collection of cement cones for proteomic analysis however, structurally there are significant differences.

  3. Temporal Gene Expression Analysis and RNA Silencing of Single and Multiple Members of Gene Family in the Lone Star Tick Amblyomma americanum

    Science.gov (United States)

    Karim, Shahid

    2016-01-01

    Saliva is an integral factor in the feeding success of veterinary and medically important ticks. Therefore, the characterization of the proteins present in tick saliva is an important area of tick research. Here, we confirmed previously generated sialotranscriptome data using quantitative real-time PCR. The information obtained in this in-depth study of gene expression was used to measure the effects of metalloprotease gene silencing on tick feeding. We analyzed the temporal expression of seven housekeeping genes and 44 differentially expressed salivary molecules selected from a previously published Amblyomma americanum sialotranscriptome. Separate reference genes were selected for the salivary glands and midgut from among the seven housekeeping genes, to normalize the transcriptional expression of differentially expressed genes. The salivary gland reference gene, ubiquitin, was used to normalize the expression of 44 salivary genes. Unsurprisingly, each gene family was expressed throughout the blood meal, but the expression of specific genes differed at each time point. To further clarify the complex nature of the many proteins found in the saliva, we disrupted the translation of several members of the metalloprotease family. Intriguingly, the nucleotide sequence similarity of the reprolysin metalloprotease gene family is so homologous that a single synthesized dsRNA sequence knocked down multiple members of the family. The use of multigene knockdown yielded a more significant picture of the role of metalloproteases in tick feeding success, and changes were observed in the female engorgement weight and larval hatching success. Interestingly, the depletion of metalloprotease transcripts also reduced the total number of bacteria present in the salivary glands. These data provide insight into the expression and functions of tick salivary proteins expressed while feeding on its host. PMID:26872360

  4. Molecular characterisation of cAMP-dependent protein kinase (PK-A) catalytic subunit isoforms in the male tick, Amblyomma hebraeum.

    Science.gov (United States)

    Tabish, Mohammad; Clegg, Roger A; Turner, Philip C; Jonczy, Jan; Rees, Huw H; Fisher, Michael J

    2006-12-01

    The cAMP-dependent protein kinase (protein kinase A, PK-A) plays a central role in the regulation of diverse aspects of cellular activity. Specifically, PK-A appears to play a key controlling role in the maturation of spermatids. Using a PCR-based approach, with degenerate primers from the highly conserved regions of the PK-A catalytic (C) subunit in combination with 5' and 3' RACE, we have cloned three cDNAs for the PK-A C-subunit of the male tick, Amblyomma hebraeum. The three cDNAs have open reading frames of 1059, 1275 and 1404bp which encode proteins of 40.6, 48.2 and 52.5kDa, respectively. These transcripts appear to arise from 5' alternative splicing of RNA derived from a single gene for the PK-A C-subunit. One isoform (AH-PK-A C1), in common with PK-A C-subunits from a range of species, contains a consensus sequence for N-myristoylation. RT-PCR and Western blot experiments suggest that the three splice variants are expressed ubiquitously; however, expression of the myristoylatable AH-PK-A C1 isoform is predominant in all investigated tissues (accessory gland, midgut, Malpighian tubules, salivary gland, testis and immature spermatids). There is no evidence for a sperm-specific PK-A C-subunit (Cs) in tick sperm; however, tyrosine protein phosphorylation, previously shown to be modulated by PK-A activity during mammalian sperm maturation, was observed in tick sperm.

  5. Efficacy of an imidacloprid 10 % / flumethrin 4.5 % collar (Seresto®, Bayer) for preventing the transmission of Cytauxzoon felis to domestic cats by Amblyomma americanum.

    Science.gov (United States)

    Reichard, Mason V; Thomas, Jennifer E; Arther, Robert G; Hostetler, Joseph A; Raetzel, Kara L; Meinkoth, James H; Little, Susan E

    2013-08-01

    Infection of Cytauxzoon felis in domestic cats produces a severe disease characterised by fever, lethargy, inappetence, anorexia, depression, dehydration, icterus and often death. Transmission of C. felis to cats is dependent on being fed upon by infected Amblyomma americanum (lone star ticks). The purpose of the present study was to determine if application of a 10 % imidacloprid/4.5 % flumethrin collar (Seresto®, Bayer) on cats prevents transmission of C. felis by repelling ticks. Twenty cats were randomised to either a treated (n = 10) or non-treated control group (n = 10) based on their susceptibility to ticks. Cats of high, medium and low tick susceptibility were represented in both groups. Treated cats were fitted with 10 % imidacloprid/4.5 % flumethrin collars on study day 0 and both groups were then infested with C. felis-infected A. americanum on study day 30. Tick thumb counts were performed at 24 and 48 hours post infestation. Transmission of C. felis was determined by examining blood of cats by DNA extraction followed by PCR amplification with piroplasm-specific primers. Ticks did not attach to any of the 10 % imidacloprid/4.5 % flumethrin- treated cats. However, ticks attached and fed on all the non-treated control cats. The geometric mean number of ticks attached to the non-treated control cats at 24 and 48 hours was 15.3 and 14.2, respectively. Cytauxzoon felis was transmitted to 9 of 10 (90 %) non-treated control cats; C. felis was not transmitted to any of the treated cats. Transmission of C. felis to the non-treated cats was first detected between 8 and 16 days post infestation. Our results indicate that application of the 10 % imidacloprid/4.5 % flumethrin collar to cats prevented ticks from attaching, feeding and transmitting C. felis.

  6. Amblyomma americanum tick saliva insulin-like growth factor binding protein-related protein 1 binds insulin but not insulin-like growth factors.

    Science.gov (United States)

    Radulović, Ž M; Porter, L M; Kim, T K; Bakshi, M; Mulenga, A

    2015-10-01

    Silencing Amblyomma americanum insulin-like growth factor binding protein-related protein 1 (AamIGFBP-rP1) mRNA prevented ticks from feeding to repletion. In this study, we used recombinant (r)AamIGFBP-rP1 in a series of assays to obtain further insight into the role(s) of this protein in tick feeding regulation. Our results suggest that AamIGFBP-1 is an antigenic protein that is apparently exclusively expressed in salivary glands. We found that both males and females secrete AamIGFBP-rP1 into the host during feeding and confirmed that female ticks secrete this protein from within 24-48 h after attachment. Our data suggest that native AamIGFBP-rP1 is a functional insulin binding protein in that both yeast- and insect cell-expressed rAamIGFBP-rP1 bound insulin, but not insulin-like growth factors. When subjected to anti-blood clotting and platelet aggregation assays, rAamIGFBP-rP1 did not have any effect. Unlike human IGFBP-rP1, which is controlled by trypsinization, rAamIGFBP-rP1 is resistant to digestion, suggesting that the tick protein may not be under mammalian host control at the tick feeding site. The majority of tick-borne pathogens are transmitted 48 h after the tick has attached. Thus, the demonstrated antigenicity and secretion into the host within 24-48 h of the tick starting to feed makes AamIGFBP-rP1 an attractive target for antitick vaccine development.

  7. Temporal Gene Expression Analysis and RNA Silencing of Single and Multiple Members of Gene Family in the Lone Star Tick Amblyomma americanum.

    Science.gov (United States)

    Bullard, Rebekah L; Williams, Jaclyn; Karim, Shahid

    2016-01-01

    Saliva is an integral factor in the feeding success of veterinary and medically important ticks. Therefore, the characterization of the proteins present in tick saliva is an important area of tick research. Here, we confirmed previously generated sialotranscriptome data using quantitative real-time PCR. The information obtained in this in-depth study of gene expression was used to measure the effects of metalloprotease gene silencing on tick feeding. We analyzed the temporal expression of seven housekeeping genes and 44 differentially expressed salivary molecules selected from a previously published Amblyomma americanum sialotranscriptome. Separate reference genes were selected for the salivary glands and midgut from among the seven housekeeping genes, to normalize the transcriptional expression of differentially expressed genes. The salivary gland reference gene, ubiquitin, was used to normalize the expression of 44 salivary genes. Unsurprisingly, each gene family was expressed throughout the blood meal, but the expression of specific genes differed at each time point. To further clarify the complex nature of the many proteins found in the saliva, we disrupted the translation of several members of the metalloprotease family. Intriguingly, the nucleotide sequence similarity of the reprolysin metalloprotease gene family is so homologous that a single synthesized dsRNA sequence knocked down multiple members of the family. The use of multigene knockdown yielded a more significant picture of the role of metalloproteases in tick feeding success, and changes were observed in the female engorgement weight and larval hatching success. Interestingly, the depletion of metalloprotease transcripts also reduced the total number of bacteria present in the salivary glands. These data provide insight into the expression and functions of tick salivary proteins expressed while feeding on its host.

  8. Parâmetros biológicos de fêmeas adultas Amblyomma cajennense alimentadas em coelhos tratados com bioterápico ultradiluído Biological parameters of Amblyomma cajennense adult females fed on rabbits treated with ultradiluted biotherapic

    Directory of Open Access Journals (Sweden)

    Luciana Rodrigues de Almeida

    2008-08-01

    Full Text Available Os bioterápicos são considerados medicamentos homeopáticos por serem preparados de acordo com a farmacotécnica homeopática, submetidos à diluição e dinamização. Com o objetivo de avaliar os efeitos da administração de bioterápico ultradiluído sobre parâmetros biológicos de carrapatos Amblyomma cajennense, oito coelhos de três meses de idade, separados em dois grupos de quatro animais, constituindo os grupos tratado e controle, receberam o bioterápico na potência 30 DH (Decimal Hering e soro fisiológico 30DH, respectivamente. Em seguida, os animais foram infestados experimentalmente com 10 casais de carrapatos A. cajennense e submetidos novamente aos referidos tratamentos. O bioterápico ultradiluído foi preparado a partir de carrapatos adultos machos e fêmeas de A. cajennense. Foram avaliados parâmetros biológicos relativos à postura e à eclosão larval de A. cajennense. De acordo com os resultados obtidos, não foram detectados efeitos significativos sobre os parâmetros biológicos de fêmeas A. cajennense alimentadas em coelhos tratados com o bioterápico, quando comparados ao grupo controle. Novos testes, envolvendo outras espécies hospedeiras e o acompanhamento de infestações subseqüentes, devem ser dedicados à avaliação do potencial terapêutico profilático dos bioterápicos ultradiluídos nas ectoparasitoses dos animais domésticos.The biotherapics are considered homeopathic medicine because are produced in agreement to the homeopathic pharmacotechnic being diluted and dinamizated. To evaluate the effects of ultradiluted biotherapic on biologic parameters of Amblyomma cajennense ticks, 8 rabbits, about 3 months old, were divided into 2 groups of 4 animals each: treated and control groups which received biotherapic 30 DH potency (Hering’s decimal and 30DH physiologic serum, respectively. Following, the animals were infested with 10 couples A. cajennense and treated again. The ultradiluted biotherapic was

  9. Induction of complete courtship ritual in Amblyomma cajennense using 2,6-dichlorophenol at female-equivalent quantities Indução dos comportamentos de cortejo em Amblyomma cajennense pelo 2,6-diclorofenol em quantidades equivalentes às das fêmeas

    Directory of Open Access Journals (Sweden)

    Kennedy Kiriira Gachoka

    2011-12-01

    Full Text Available In order to clarify the role of 2,6-dichlorophenol (2,6-DCP in the courtship of Amblyomma cajennense, sexually mature males that had previously fed on rabbits were tested in bioassays. The males were released onto dummies treated with whole female extract or synthetic 2,6-DCP at a concentration of two female equivalents, or with hexane (control, and their responses were observed. In the presence of both the extract and 2,6-DCP, excitation was observed among the males, expressed in the form of touching and probing the dummy, and mounting occurred readily. The percentages of mounting (73% and tipping over (60% were equal in the two treatments and higher than in the control group (27 and 20%, respectively. Relatively short durations of mounting were recorded, and these were statistically similar in all treatments. Almost all instances of mounting resulted in tipping-over behavior. A few isolated cases of males that went directly to ventral positioning without mounting were observed. It was confirmed that 2,6-DCP alone is capable of mediation of mounting behavior in A. cajennense.Visando elucidar o papel do 2,6-diclorofenol (2,6-DCF no cortejo de Amblyomma cajennense, machos sexualmente maduros, previamente alimentados em coelhos, foram avaliados em testes biológicos. Os machos foram liberados sobre manequins tratados com um extrato de fêmeas, ou com 2,6-DCF sintético na concentração equivalente a duas fêmeas, ou com hexano (controle, e suas respostas foram observadas. Na presença do extrato e do 2,6-DCF, a excitação dos machos foi expressa na forma de toques e sondagens, e a monta ocorreu rapidamente. As porcentagens de respostas observadas nos dois tratamentos foram iguais, sendo a monta (73% e retorno na superfície ventral (60% mais altos que no controle (27 e 20%, respectivamente. Foram observados períodos de monta relativamente curtos, sendo esses estatisticamente iguais em todos os tratamentos, e quase todos resultando em

  10. Report on Lyme disease Prepared for U.S. Army Corps of Engineers Field Personnel

    Science.gov (United States)

    1992-01-01

    of the bacterium involves its genetic mechanism. Like most bacteria, B. burgdorferi possesses a circular "chromosome" composed of double-stranded DNA...the Southeast have all been shown to serve as vectors for Lyme disease. Other tick species known to harbor B. burgdorferi include Amblyomma ...Ixodes scapularis, Dermacentor variabilis, and Amblyomma americanus (Acari: Ixodidae) to acquire, maintain, and transmit Lyme disease spirochetes

  11. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    BEJARANO EDUAR E. E.

    2009-04-01

    Full Text Available

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

    Palabras clave

  12. Avaliação de extratos vegetais no controle de Oligonychus ilicis (McGregor, 1917) (Acari: Tetranychidae) em laboratório

    OpenAIRE

    Carvalho, Thaiana Mansur Botelho de; EPAMIG-CTSM/EcoCentro; Reis, Paulo Rebelles; EPAMIG-CTSM/EcoCentro; Oliveira, Denilson Ferreira de; Universidade Federal de Lavras - UFLA; Carvalho, Geraldo Andrade; Universidade Federal de Lavras - UFLA; Carvalho, Douglas Antônio de; Universidade Federal de Lavras - UFLA

    2008-01-01

    Oligonychus ilicis (McGregor, 1917) (Acari: Tetranychidae) já foi referido como a segunda praga em importância para o cafeeiro Conillon, considerado mais sensível ao ácaro que o Arábica. A aplicação de pesticidas sintéticos no seu controle pode provocar impactos negativos ao ambiente e ao homem. Alternativamente ao uso de tais produtos, surgem outros menos impactantes, como por exemplo, extratos de plantas. Com o presente trabalho, teve-se por objetivo avaliar o efeito de extratos de plantas ...

  13. Otoacariasis due to Edentalges bradypus Fonseca 1954 (Acari; Psoroptidae) infestation in the brown-throated three-toed sloth Bradypus variegatus from Brazil.

    Science.gov (United States)

    de Souza, Clarissa Pimentel; Verocai, Guilherme Gomes; de Arruda, Julio Almeida Alencar Matos; Pires, Jeferson Rocha; Takitani, Andréa Yuri; Faccini, João Luiz Horacio

    2009-09-01

    The aim of this paper is to report the first description of gross pathological aspects of otoacariasis due to Edentalges bradypus Fonseca 1954 (Acari; Psoroptidae) infestation in the brown-throated three-toed sloth Bradypus variegatus Schinz, 1825 (Xenarthra; Bradypodidae) in Brazil. Mites were collected from massive skin crusts seen in both external ear canals and around both eyes of an extremely debilitated advanced-aged female sloth brought to the Wildlife Care Section of Universidade Estácio de Sá, Rio de Janeiro, Brazil.

  14. [Morphological adaptations of acariform mites (Acari: Acariformes) to permanent parasitism on mammals].

    Science.gov (United States)

    Bochkov, A V

    2007-01-01

    The external morphological adaptations to parasitism in acariform mites (Acari: Acariformes), permanently parasiting mammals, are briefly summated and analyzed. According to several external morphological criteria (structures of gnathosoma, idiosoma, setation, legs and life cycle), the following six morphoecotypes were established: skin mites (i)-- Cheyletidae, Chirorhynchobiidae, Lobalgidae, Myobiidae, Myocoptidae (the most part), Rhyncoptidae, Psoroptidae; fur mites (ii)--Atopomelidae, Clirodiscidae, Listrophoridae, Myocoptidae (Trichoecius only); skin burrowing mites (iii)--Sarcoptidae; intradermal mites (iv) - sorergatidae and Demodicidae; interstitial mites (v) - pimyodicidae; respiratory mites (vi) - reynetidae, Gastronyssidae, Lemurnyssidae, Pneumocoptidae. In the case of prostigmatic mites, the detailed reconstruction of the origin and evolution of "parasitic" morphoecotypes is possible due to the tentative phylogenetic hypotheses, which were proposed for the infraorder Eleutherengon, a, including the most part of the permanent mammalian parasites among prostigmatic mites (Kethley in Norton, 1993; Bochkov, 2002). The parasitism of Speleognathinae (Ereynetidae) in the mammalian respiratory tract arose independently of the other prostigmats. It is quite possible that these mites switched on mammals from birds, because they are more widely represented on these hosts than on mammals. The prostigmatic parasitism on mammalian skin seems to be originated independently in myobiids, in the five cheyletid tribes, Cheyletiellini, Niheliini, and Teinocheylini, Chelonotini, Cheyletini, and, probably, in a cheyletoid ansector of the sister families Psorergatidae-Demodicidae (Bochkov, Fain, 2001; Bochkov, 2002). Demodicids and psorergatids developed adaptations to parasitism in the skin gland ducts and directly in the epithelial level, respectively in the process of the subsequent specialization. Mites of the family Epimyodicidae belong to the phylogenetic line

  15. Primary embryonic cells of Rhipicephalus microplus and Amblyomma cajennense ticks as a substrate for the development of Borrelia burgdorferi (strain G39/40

    Directory of Open Access Journals (Sweden)

    J. Rezende

    Full Text Available Borrelia burgdorferi, the agent of Lyme borreliosis, is a spirochetes transmitted by ticks to humans and animals. Its cultivation in vitro in tick cells allows studies of its biology and provides methodology for future research in Brazil, and for the isolation of Borrelia spp. We examined in vitro the characteristics of embryonic cells of Rhipicephalus microplus and Amblyomma cajennense in cell culture and investigated the suitability of embryonic cells as a substrate for cultivation of B. burgdorferi. Subcultures were prepared from primary cultures of embrionary cells of R. microplus and A. cajennense maintained in Leibovitz's (L-15 complete medium at 28 ºC and 31 ºC, respectively. When a monolayer had formed, the L-15 was replaced with Barbour-Stoener-Kelly medium for experiments to infect cell cultures with B. burgdorferi. After 72 hours of cultivation, the spirochetes were counted using an inverted phase contrast microscope and dark-field illumination (400×. Survival, multiplication and the adherence of B. burgdorferi for embryonic cells of R. microplus and A. cajennense were observed. B. burgdorferi cultured with embryonic cells of R. microplus grew on average to a density (final count of 2.4 × 10(7 spirochetes/mL, whereas in cell-free culture, an average of 2.5 × 10(7 spirochetes/mL were counted. When cultivated with A. cajennense cells, the final count of spirochetes was on average 1.7 × 10(7 spirochetes/mL, while spirochetes cultured under cell-free conditions replicated on average of 2.2 × 10(7 spirochetes/mL. Similar results were observed in the final count of Spirochetes cultivated in cells of R. microplus and A. cajennense, when compared with cell-free control. These results demonstrated that cells of R. microplus and A. cajennense have the potential to be used as growth substrate for B. burgdorferi in the study of its interaction with host cells.

  16. New Miticides for Integrated Pest Management of Varroa destructor (Acari: Varroidae) in Honey Bee Colonies on the Canadian Prairies.

    Science.gov (United States)

    Vandervalk, L P; Nasr, M E; Dosdall, L M

    2014-12-01

    Varroa destructor Anderson and Trueman 2000 (Acari: Varroidae) is an ectoparasitic mite of the honey bee, Apis mellifera L. (Hymenoptera: Apidae). Honey bee colonies require extensive management to prevent mortality caused by varroa mites and the viruses they vector. New miticides (Thymovar and HopGuard) to manage varroa mites were evaluated during the spring and fall treatment windows of the Canadian prairies to determine their effectiveness as part of an integrated management strategy. Thymovar and HopGuard were evaluated alongside the currently used industry standards: Apivar and formic acid. Results demonstrated that Apivar and formic acid remain effective V. destructor management options under spring and fall conditions. Applications of Thymovar during spring were associated with a reduction in brood area, and therefore should be limited to the fall season. The miticide HopGuard was not effective in managing V. destructor, and alteration of the current delivery system is necessary. This study demonstrates the potential for new effective treatment options to supplement currently used V. destructor integrated pest management systems.

  17. The role of the bacterial community in the nutritional ecology of the bulb mite Rhizoglyphus robini (Acari: Astigmata: Acaridae).

    Science.gov (United States)

    Zindel, Renate; Ofek, Maya; Minz, Dror; Palevsky, Eric; Zchori-Fein, Einat; Aebi, Alexandre

    2013-04-01

    The biology of many arthropods can only be understood when their associated microbiome is considered. The nutritional requirements of the bulb mite Rhizoglyphus robini Claparede (Acari: Astigmata: Acaridae) in the laboratory have been shown to be very easily satisfied, and in the field the mites prefer fungus-infected over uninfected plants. To test whether symbiotic bacteria facilitate the survival of R. robini on a temporarily nutritionally unbalanced diet, we investigated the composition of its microbiome. Using 454 pyrosequencing of 16S rRNA gene fragments, 3 genera were found to dominate the bacterial community: Myroides (41.4%), Serratia (11.4%), and Alcaligenes (4.5%); the latter 2 are known to include chitinase-producing species. Laboratory experiments demonstrated that mite fecundity is significantly higher (2 times) on fungus than on controls (sterilized potato dextrose agar and filter paper). Also, when mite homogenate was applied to a chitin layer, the halo produced through degradation was clearly visible, while the saline control did not produce a halo. We thus concluded that R. robini utilizes fungal chitin, at least to a certain extent, as a food source with the help of its associated bacteria. This information supports the general concept of multigenome organisms and the involvement of bacteria in the mite's nutritional ecology.

  18. Impact of ectohumus application in birch and pine nurseries on the presence of soil mites (Acari, Oribatida in particular

    Directory of Open Access Journals (Sweden)

    Klimek Andrzej

    2016-03-01

    Full Text Available Intensively used forest nurseries are characterised by degradation processes that lead to a drop in the quality of seedlings. The main reason of this problem is a decrease in biological soil diversity. Therefore, an attempt of nursery soil enrichment by introducing ectohumus – as compost and fresh litter – from the pine forest was carried out. The research was carried out in 2009–2011 in the Bielawy forest nursery near the city of Toruń, Poland. The objective of the study was to determine the impact of organic fertilisation (compost made up of forest humus and mulching using fresh ectohumus on the density and community composition of Acari mites and on species composition of oribatid mites (Oribatida in the nurseries of silver birch and Scots pine. Mites, especially oribatid mites, were treated as bioindicators of soil biological activity. Research has shown that mulching using fresh ectohumus caused a multiple increase in the density of mites, especially in saprophagous mites Oribatida. Oribatid mites were clearly more numerous in birch cultivation than in that of pine. Overall, 27 species of oribatid mites were found. Mulching resulted in a significant growth in species diversity in both cultivations. The most numerous oribatid mite in the area under the study was Oribatula tibialis. This species was present in all plots and showed clear preference for birch cultivation. Tectocepheus velatus and Oppiella nova, common and known to be present in a variety of environments, were slightly less numerous.

  19. Development and reproductive potential of Tyrophagus putrescentiae (Acari: Acaridae) on plant-parasitic nematodes and artificial diets.

    Science.gov (United States)

    Abou El-Atta, Doaa Abd El-Maksoud; Osman, Mohamed Ali

    2016-04-01

    This study investigated development, reproduction and life table parameters of the astigmatid mold mite Tyrophagus putrescentiae (Schrank) (Acari: Acaridae) feeding on egg-masses or adult females of the nematode Meloidogyne incognita, egg-masses of the nematode Rotylenchulus reniformis, ras cheese or yeast at 25 ± 1 °C, 70 ± 10 % RH in the dark. Immature developmental times were shorter when the mite was fed females of M. incognita followed by yeast. Different prey/diet types had no significant effect on longevity and lifespan of both males and females. Daily oviposition rate (eggs/female/day) was highest for mites fed yeast (20.8 ± 1.8 eggs) and lowest for mites fed females of M. incognita (6.6 ± 0.5). Intrinsic rate of natural increase (r m) was highest for mites fed yeast compared to other prey/diet; no significant differences in r m were observed among mites fed on non-yeast diets. This result may suggest a role of T. putrescentiae as biocontrol agent of plant-parasitic nematodes and the yeast may be used for mite mass-production purposes.

  20. Relative contribution of biotic and abiotic factors to the population density of the cassava green mite, Mononychellus tanajoa (Acari: Tetranychidae).

    Science.gov (United States)

    Rêgo, Adriano S; Teodoro, Adenir V; Maciel, Anilde G S; Sarmento, Renato A

    2013-08-01

    The cassava green mite, Mononychellus tanajoa, is a key pest of cassava, Manihot esculenta Crantz (Euphorbiaceae), and it may be kept in check by naturally occurring predatory mites of the family Phytoseiidae. In addition to predatory mites, abiotic factors may also contribute to regulate pest mite populations in the field. Here, we evaluated the population densities of both M. tanajoa and the generalist predatory mite Euseius ho DeLeon (Acari: Phytoseiidae) over the cultivation cycle (11 months) of cassava in four study sites located around the city of Miranda do Norte, Maranhão, Brazil. The abiotic variables rainfall, temperature and relative humidity were also recorded throughout the cultivation cycle of cassava. We determined the relative importance of biotic (density of E. ho) and abiotic (rainfall, temperature and relative humidity) factors to the density of M. tanajoa. The density of M. tanajoa increased whereas the density of E. ho remained constant throughout time. A hierarchical partitioning analysis revealed that most of the variance for the density of M. tanajoa was explained by rainfall and relative humidity followed by E. ho density and temperature. We conclude that abiotic factors, especially rainfall, were the main mechanisms driving M. tanajoa densities.

  1. THE EFFECT OF CATTLE LIQUID MANURE FERTILIZATION ON THE SOIL MITES (ACARI OF PERMANENT MEADOW IN POLAND

    Directory of Open Access Journals (Sweden)

    RADOMIR GRACZYK

    2009-06-01

    Full Text Available The effect of different doses of cattle liquid manure, with or without the VIT-TRA agent, on the mites of permanent meadow, with species analysis of oribatid mites (Acari, Oribatida was investigated. Samples were taken from 13 plots, fertilized with cattle liquid manure in doses 40, 60 and 80 m3· ha-1 and VIT-TRA agent. The dose 40 m3· ha-1 increased the abundance of mites, comparing to the control plot, while doses 60 and 80 m3· ha-1 decreased it. The fungicidal agent, with medium and high dose of fertilizer, signifi cantly decreased the density of Oribatida, Gamasida and Actinedida in relation to small dose of fertilizer with this agent. The mites reacted in a similar way to the bactericidal agent, but acting of virocidal agent was indistinct. The Oribatida dominated among the mites, while the Actinedida and Gamasida were less abundant. Among the Oribatida the most abundant were: Parachipteria bella, Liebstadia humerata, Achipteria coleoptrata and Scheloribates laevigatus. The Oribatida preferred the lower part of grasses, and their density distinctly decreased with the soil depth.

  2. SELECTION OF MODELS FOR SEQUENTIAL SAMPLING OF THE TAN-MITE Dichopelmus notus KEIFER (ACARI, ERIOPHYIDAE IN MATE-TEA

    Directory of Open Access Journals (Sweden)

    João Vieira Neto

    2007-09-01

    Full Text Available This research established models for the construction of plans of binomial sequential sampling for the tan-miteDichopelmus notus Keifer (Acari, Eriophyidae in mate-tea orchards. The study was carried out in a ten years old orchard, locatedin Chapecó, Santa Catarina state, Brazil. In three areas of approximately 2,500 m2, 30 plants had been selected randomly. Fortnightly,from January to December, 2004, infestation of D. notus in 18 mature leaves of ten plants in each area were evaluated. Theevaluations were executed directly in the orchard, using lenses (10x and 1 cm2 of fixed field. The lines of the sequential plans wereconstructed using the methodology based on the confidence interval of Iwao (1975, considering the models of Normal Approach withCorrection of Continuity, Normal Approach of Blyth (1986, Approach of Hall (1982 modified by Blyth (1986, Normal Approach ofMolenaar (1973, Normal Approach of Pratt (1968 and Leemis & Trivedi (1996 methodology. The models were evaluatedconsidering amplitude analysis of the confidence intervals. The results had evidenced that the Model of Normal Approach withCorrection of Continuity must preferentiably be used in the elaboration of plans of binomial sequential sampling for the tan-mite inmate-tea orchards.

  3. Transcriptome Analysis of the Carmine Spider Mite, Tetranychus cinnabarinus (Boisduval, 1867 (Acari: Tetranychidae, and Its Response to β-Sitosterol

    Directory of Open Access Journals (Sweden)

    Chunya Bu

    2015-01-01

    Full Text Available Tetranychus cinnabarinus (Acari: Tetranychidae is a worldwide polyphagous agricultural pest that has the title of resistance champion among arthropods. We reported previously the identification of the acaricidal compound β-sitosterol from Mentha piperita and Inula japonica. However, the acaricidal mechanism of β-sitosterol is unclear. Due to the limited genetic research carried out, we de novo assembled the transcriptome of T. cinnabarinus using Illumina sequencing and conducted a differential expression analysis of control and β-sitosterol-treated mites. In total, we obtained >5.4 G high-quality bases for each sample with unprecedented sequencing depth and assembled them into 22,941 unigenes. We identified 617 xenobiotic metabolism-related genes involved in detoxification, binding, and transporting of xenobiotics. A highly expanded xenobiotic metabolic system was found in mites. T. cinnabarinus detoxification genes—including carboxyl/cholinesterase and ABC transporter class C—were upregulated after β-sitosterol treatment. Defense-related proteins, such as Toll-like receptor, legumain, and serine proteases, were also activated. Furthermore, other important genes—such as the chloride channel protein, cytochrome b, carboxypeptidase, peritrophic membrane chitin binding protein, and calphostin—may also play important roles in mites’ response to β-sitosterol. Our results demonstrate that high-throughput-omics tool facilitates identification of xenobiotic metabolism-related genes and illustration of the acaricidal mechanisms of β-sitosterol.

  4. Effect of coconut palm proximities and Musa spp. germplasm resistance to colonization by Raoiella indica (Acari: Tenuipalpidae).

    Science.gov (United States)

    Rodrigues, Jose Carlos Verle; Irish, Brian M

    2012-08-01

    Although coconut (Cocos nucifera L.) is the predominant host for Raoiella indica Hirst (Acari: Tenuipalpidae), false spider mite infestations do occur on bananas and plantains (Musa spp. Colla). Since its introduction, the banana and plantain industries have been negatively impacted to different degrees by R. indica infestation throughout the Caribbean. Genetic resistance in the host and the proximity of natural sources of mite infestation has been suggested as two of the main factors affecting R. indica densities in Musa spp. plantations. Greenhouse experiments were established to try to determine what effect coconut palm proximities and planting densities had on R. indica populations infesting Musa spp. plants. Trials were carried out using potted Musa spp. and coconut palms plants at two different ratios. In addition, fourteen Musa spp. hybrid accessions were evaluated for their susceptibility/resistance to colonization by R. indica populations. Differences were observed for mite population buildup for both the density and germplasm accession evaluations. These results have potential implications on how this important pest can be managed on essential agricultural commodities such as bananas and plantains.

  5. Effect of Hyalomma Ticks (Acari: Ixodidae on Milk Production of Dairy Buffaloes (Bos Bubalus Bubalis of Punjab (Pakistan

    Directory of Open Access Journals (Sweden)

    M.U. Iqbal

    2010-02-01

    Full Text Available The objective of this study was to estimate economic losses in terms of milk production caused by tick infestation in dairy buffaloes (Bos bubalus bubalis of Punjab (Pakistan. To this end, six hundred Nili-Ravi buffaloes infested with Hyalomma ticks (Acari: Ixodidae were selected and divided into two equal groups viz; A & B. The animals of group A were treated with various doses of 5% cypermethrine pour-on (Cipermetriven, Ivan Labs, Spain while those of group B were treated with propylene glycol (Propandiol - (1, 2, Merck as a sham treatment. Average milk production (L and butter fat (% was recorded before and after treatment in order to calculate post-treatment increase in these parameters (if any. An average daily increase of 1.15L in milk yield per animal with 1.31% more fat was observed in acaricide- treated animals. A dose-dependent effect of acaricide was found on the number of ticks as well as milk production and fat. The results provided a baseline data for further research on economic impact of tick nuisance to the smallholder dairy farming systems of Pakistan.

  6. Life history of Neoseiulus californicus (McGregor, 1954) (Acari: Phytoseiidae) fed with castor bean (Ricinus communis L.) pollen in laboratory conditions.

    Science.gov (United States)

    Marafeli, P P; Reis, P R; Silveira, E C da; Souza-Pimentel, G C; de Toledo, M A

    2014-08-01

    The predatory mite, Neoseiulus californicus (McGregor, 1954) (Acari: Phytoseiidae) is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticae Koch, 1836 (Acari: Tetranychidae), is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae)] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm) was 0.2 and the mean generation time (T) was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae.

  7. A Preliminary Investigation on Ticks (Acari: Ixodidae) Infesting Birds in Kızılırmak Delta, Turkey.

    Science.gov (United States)

    Keskin, Adem; Erciyas-Yavuz, Kiraz

    2016-01-01

    Ticks are mandatory blood-feeding ectoparasites of mammals, birds, reptiles, and even amphibians. Turkey has a rich bird fauna and is located on the main migration route for many birds. However, information on ticks infesting birds is very limited. In the present study, we aimed to determine ticks infesting birds in Kızılırmak Delta, Turkey. In 2014 autumn bird migration season, a total of 7,452 birds belonging to 79 species, 52 genera, 35 families, and 14 orders were examined for tick infestation. In total, 287 (234 larvae, 47 nymphs, 6♀) ticks were collected from 54 passerine birds (prevalence = 0.72%) belonging to 12 species. Ticks were identified as Amblyomma sp., Dermacentor marginatus (Sulzer), Haemaphysalis concinna Koch, Haemaphysalis punctata Canestrini and Fanzago, Hyalomma sp., Ixodes frontalis (Panzer), and Ixodes ricinus (L). The most common tick species were I. frontalis (223 larvae, 23 nymphs, 6♀) followed by I. ricinus (3 larvae, 12 nymphs) and H. concinna (4 larvae, 6 nymphs). Based on our results, it can be said that Erithacus rubecula (L.) is the main host of immature I. frontalis, whereas Turdus merula L. is the most important carrier of immature stages of some ticks in Kızılırmak Delta, Turkey. To the best of our knowledge, most of the tick-host associations found in this study have never been documented in the literature.

  8. Seletividade de produtos fitossanitários sobre o ácaro predador Agistemus brasiliensis Matioli, Ueckermann & Oliveira (Acari: Stigmaeidae Selectivity ofthe pesticides tothe predaceous mite Agistemus brasiliensis Matioli,, Ueckermann & Oliveira (Acari: Stigmaeidae

    Directory of Open Access Journals (Sweden)

    Marcos Zatti da Silva

    2009-06-01

    Full Text Available Os ácaros predadores das famílias Phytoseiidae e Stigmaeidae constituem-se nos principais inimigos naturais de Brevipalpus phoenicis (Geijskes em citros. Este ácaro-praga causa sérios prejuízos na produção, devido à transmissão do vírus da leprose dos citros (CiLV. Apesar do grande volume de informações sobre a sensibilidade de ácaros Phytoseiidae a agrotóxicos, praticamente não existem informações sobre o efeito desses compostos em ácaros Stigmaeidae no Brasil. Sendo assim, o trabalho teve por objetivo avaliar o efeito dos principais agrotóxicos utilizados em citros sobre o ácaro predador Agistemus brasiliensis Matioli, Ueckermann & Oliveira (Acari: Stigmaeidae, em condições de laboratório. Arenas de folhas de citros da variedade Pera, contendo 25 fêmeas adultas de A. brasiliensis, foram pulverizadas em torre de Potter. Avaliaram-se as mortalidades dos ácaros 72 horas após a aplicação. O efeito dos produtos na reprodução do acarino e a viabilidade dos ovos também foram avaliados. Quanto à seletividade, conforme proposta da "Organização Internacional para o Controle Biológico" (IOBC, os produtos foram classificados como: classe 1 - inócuo (E99%, calda sulfocálcica, cyhexatin, flufenoxuron, hexythiazox, óxido de fenbutatin, propargite, pyridaben e spirodiclofen. Estudos conduzidos em condições de campo ainda são necessários para se compreender melhor o efeito desses agrotóxicos sobre o ácaro predador.The predaceous mites of the families Phytoseiidae and Stigmaeidae are the most important natural enemies of Brevipalpus phoenicis (Geijskes on citrus. This mite causes serious damages to the yield due to the transmission of Citrus leprosis virus (CiLV. Despite the considerable amount of information on susceptibility of phytoseiids to pesticides, the effect of these compounds is not very known for stigmaeid mites in Brazil. This work was carried out to evaluate the effect of the main pesticides used in

  9. Ocorrência do ácaro fitófago Catarhinus tricholaenae Keifer (Acari: Diptilomiopidae em cultivares de milho Bt Occurrence of the phytophagous mite Catarhinus tricholaenae Keifer (Acari: Diptilomiopidae on Bt corn cultivars

    Directory of Open Access Journals (Sweden)

    Marcos Antônio Matiello Fadini

    2012-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a ocorrência do microácaro-da-face-inferior-das-folhas-de-milho Catarhinus tricholaenae Keifer (Acari: Diptilomiopidae em cultivares transgênicas de milho, contendo as proteínas Cry1F e Cry 1 A(b e milho não Bt. Durante o período de junho de 2010 a janeiro de 2011, foram coletadas, quinzenalmente, cinco amostras aleatórias de quatro folhas em talhões de milho Bt, contendo a proteína Cry 1F e Cry 1 A(b, e de milho não Bt em áreas experimentais da Embrapa Milho e Sorgo, em Sete Lagoas, MG. As amostras de folhas foram vistoriadas por 15 minutos na região da nervura central, em busca de adultos de C. tricholaenae. Foram registrados 2.930 indivíduos de C. tricholaenae, sendo que 1.114 no milho Bt Cry 1F, 753 em Cry 1 A(b e 1063 indivíduos em folhas das cultivares não Bt. As maiores abundâncias populacionais médias ocorreram nos meses de novembro e dezembro. Os fatores estágio fenológico das plantas e precipitação afetaram positivamente a abundância de C. tricholaenae. A abundância média do período de coleta de C. tricholaenae foi reduzida pela cultivar de milho contendo a proteína Cry 1 A(b. Esse é o primeiro registro de ácaros sobre cultivares de milho transgênico no Brasil.The objective of this study was to evaluate the occurrence of "microácaro-da-face-inferior-das-folhas-de-milho" Catarhinus tricholaenae Keifer (Acari: Diptilomiopidae on transgenic cultivars of corn containing proteins Cry1F and Cry 1 A (b and non-Bt corn. During the period from June 2010 to January 2011 were collected, every two weeks, five random samples of four leaves in plots of Bt corn containing the protein Cry 1F and Cry 1 A (b and non-Bt corn in the experimental area of Embrapa Corn and Sorghum, Sete Lagoas, MG. The leaf samples were examined for 15 minutes in the central region of leaf in search of adult C. tricholaenae. We recorded 2930 individuals of C. tricholaenae, 1114 on Bt Cry 1F, 752 on Cry 1 A

  10. Seletividade de agrotóxicos usados na cultura da macieira a Neoseiulus Californicus (McGregor (Acari: Phytoseiidae1 Pesticide selectivity used in apple crops Neoseiulus californicus (McGregor (Acari: Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Geraldine de Andrade Meyer

    2009-06-01

    Full Text Available Objetivou-se avaliar os efeitos secundários dos principais agrotóxicos utilizados em macieira sobre adultos e imaturos de Neoseiulus californicus (McGregor (Acari: Phytoseiidae. Os testes foram conduzidos em laboratório, utilizando as doses dos produtos recomendadas para a cultura e o método de contato e residual com pulverização em superfície de folha. Foram testados tebufenozida, fosmete, metidationa, clorpirifós, abamectina, fenpiroximato, piridabem, captana, mancozebe (duas dosagens e ditianona. Para o cálculo do efeito total (E% sobre os adultos, avaliaram-se a mortalidade, a oviposição e a viabilidade dos ovos, e para os imaturos, somente a mortalidade. Os resultados do E% foram avaliados 96 horas após a pulverização. Os produtos foram classificados quanto ao efeito total (E% de toxicidade proposta pela IOBC/WPRS. Fosmete, tebufenozida e metidationa foram inócuos; abamectina, fenpiroximato, clorpirifós, captana, mancozebe (nas duas dosagens testadas e ditianona foram levemente nocivos, e piridabem foi moderadamente nocivo aos adultos de N. californicus. O fungicida mancozebe, na maior dosagem (320g,i.a./100L, foi o que mais afetou o ácaro predador. Quanto à seletividade dos agrotóxicos aos imaturos, constatouse que abamectina e piridabem foram moderadamente nocivos, e os demais foram inócuos. Nenhum produto foi classificado como nocivo, evidenciando a tolerância de N. californicus a estes agrotóxicos. Estes resultados permitem uma escolha e manejo mais adequado para os agrotóxicos utilizados nos pomares comerciais de macieira, de forma que a presença deste ácaro predador exerça pressão de controle do ácaro-vermelho.The objective of this study was to evaluate the side effects of the main pesticides used in adult and immature Neoseiulus californicus (McGregor (Acari: Phytoseiidae. The tests were carried out in the laboratory by using the contact and residual spraying method on the leaf surface. It was tested

  11. New records of water mites of the family Torrenticolidae (Acari, Hydrachnidia with descriptions of two new species from Nanshih River system in Taiwan and redescription of Torrenticola ussuriensis (Sokolow, 1940 from the Russian Far East

    Directory of Open Access Journals (Sweden)

    Vladimir Pesic

    2011-07-01

    Full Text Available New records of torrenticolid water mites (Acari: Hydrachnidia, Torrenticolidae from Nanshih River, Taiwan, are presented. Two new species are described: Torrenticola nanshihensis and T. taiwanicus; the latter species is compared with T. ussuriensis (Sokolow, 1940, a poorly known species which is re-described based on a new material from the Russian Far East; Monatractides cf. circuloides (Halík, 1930 is reported for the first time for Taiwan.

  12. Cultivars of Codiaeum variegatum (L.) Blume (Euphorbiaceae) show ...

    African Journals Online (AJOL)

    SERVER

    2007-10-18

    Oct 18, 2007 ... times the leaf blade is interrupted along the midrib and become divided into an ... Two-month room temperature air-dried samples of six cultivars of ..... of garden horticulture and landscape design, De Lux ed, Garden City.

  13. Prevalence and Diversity of Tick-Borne Pathogens in Nymphal Ixodes scapularis (Acari: Ixodidae) in Eastern National Parks.

    Science.gov (United States)

    Johnson, Tammi L; Graham, Christine B; Boegler, Karen A; Cherry, Cara C; Maes, Sarah E; Pilgard, Mark A; Hojgaard, Andrias; Buttke, Danielle E; Eisen, Rebecca J

    2016-12-27

    Tick-borne pathogens transmitted by Ixodes scapularis Say (Acari: Ixodidae), also known as the deer tick or blacklegged tick, are increasing in incidence and geographic distribution in the United States. We examined the risk of tick-borne disease exposure in 9 national parks across six Northeastern and Mid-Atlantic States and the District of Columbia in 2014 and 2015. To assess the recreational risk to park visitors, we sampled for ticks along frequently used trails and calculated the density of I. scapularis nymphs (DON) and the density of infected nymphs (DIN). We determined the nymphal infection prevalence of I. scapularis with a suite of tick-borne pathogens including Borrelia burgdorferi, Borrelia miyamotoi, Anaplasma phagocytophilum, and Babesia microti Ixodes scapularis nymphs were found in all national park units; DON ranged from 0.40 to 13.73 nymphs per 100 m(2) Borrelia burgdorferi, the causative agent of Lyme disease, was found at all sites where I. scapularis was documented; DIN with B. burgdorferi ranged from 0.06 to 5.71 nymphs per 100 m(2) Borrelia miyamotoi and A. phagocytophilum were documented at 60% and 70% of the parks, respectively, while Ba. microti occurred at just 20% of the parks. Ixodes scapularis is well established across much of the Northeastern and Mid-Atlantic States, and our results are generally consistent with previous studies conducted near the areas we sampled. Newly established I. scapularis populations were documented in two locations: Washington, D.C. (Rock Creek Park) and Greene County, Virginia (Shenandoah National Park). This research demonstrates the potential risk of tick-borne pathogen exposure in national parks and can be used to educate park visitors about the importance of preventative actions to minimize tick exposure.

  14. Phylogeny and species delineation in European species of the genus Steganacarus (Acari, Oribatida) using mitochondrial and nuclear markers.

    Science.gov (United States)

    Kreipe, Victoria; Corral-Hernández, Elena; Scheu, Stefan; Schaefer, Ina; Maraun, Mark

    2015-06-01

    Species of the genus Steganacarus are soil-living oribatid mites (Acari, Phthiracaridae) with a ptychoid body. The phylogeny and species status of the species of Steganacarus are not resolved, some authors group all ten German species of Steganacarus within the genus Steganacarus whereas others split them into three subgenera, Steganacarus, Tropacarus and Atropacarus. Additionally, two species, S. magnus and T. carinatus, comprise morphotypes of questionable species status. We investigated the phylogeny and species status of ten European Steganacarus species, i.e. S. applicatus, S. herculeanus, S. magnus forma magna, S. magnus forma anomala, S. spinosus, Tropacarus brevipilus, T. carinatus forma carinata, T. carinatus forma pulcherrima, Atropacarus striculus and Rhacaplacarus ortizi. We used two molecular markers, a 251 bp fragment of the nuclear gene 28S rDNA (D3) and a 477 bp fragment of the mitochondrial COI region. The phylogeny based on a combined analysis of D3 and COI separated four subgenera (Steganacarus, Tropacarus and Atropacarus, Rhacaplacarus) indicating that they form monophyletic groups. The COI region separated all ten species of the genus Steganacarus and showed variation within some species often correlating with the geographic origin of the species. Resolution of the more conserved D3 region was limited, indicating that radiation events are rather recent. Overall, our results indicate that both genes alone cannot be used for phylogeny and barcoding since variation is too low in D3 and too high in COI. However, when used in combination these genes provide reliable insight into the phylogeny, radiation and species status of taxa of the genus Steganacarus.

  15. Resistance mechanisms to mitochondrial electron transport inhibitors in a field-collected strain of Tetranychus urticae Koch (Acari: Tetranychidae).

    Science.gov (United States)

    Van Pottelberge, S; Van Leeuwen, T; Nauen, R; Tirry, L

    2009-02-01

    A Belgian field strain (MR-VP) of Tetranychus urticae (Koch) (Acari: Tetranychidae) exhibits different levels of resistance to four frequently used METI (mitochondrial electron transport inhibitor)-acaricides, i.e. tebufenpyrad, fenpyroximate, pyridaben and fenazaquin. Resistance factors for these compounds were 184, 1547, 5971 and 35, respectively. A 23.5-fold increase in 7-ethoxy-4-trifluoromethylcoumarin O-deethylation activity suggested that metabolic resistance through elevated levels of cytochrome P450 dependent monooxygenase-activity is a possible resistance mechanism.However, synergism studies with different metabolic inhibitors revealed some contrasting resistance mechanisms between the METI-acaricides. Tebufenpyrad resistance could only be synergized after pre-treatment with the monooxygenase inhibitor piperonyl butoxide (PBO), whereas pyridaben resistance was strongly synergized both by PBO and the esterase inhibitor S,S,S-tributylphosphorotrithioate (DEF). Resistance levels to fenpyroximate could neither be suppressed by PBO nor by DEF. Although METI-acaricides are structurally related, these findings probably reflect a different role of esterases and mono-oxygenases in metabolic detoxification between these compounds. The overall lack of synergism by diethylmaleate (DEM) suggests that glutathione-S-transferases are not an important factor in resistance to METIs.Reciprocal crosses between susceptible females and resistant males showed no maternal effect, and resistance to METI-acaricides was inherited generally as a dominant trait. Backcrosses with F1 females revealed striking differences in the mode of inheritance. Although resistance to fenpyroximate and pyridaben was under monogenic control, resistance to tebufenpyrad was under control of more than one gene.

  16. Removal of drone brood from Apis mellifera (Hymenoptera: Apidae) colonies to control Varroa destructor (Acari: Varroidae) and retain adult drones.

    Science.gov (United States)

    Wantuch, Holly A; Tarpy, David R

    2009-12-01

    The parasitic mite Varroa destructor Anderson & Trueman (Acari: Varroidae) has plagued European honey bees, Apis mellifera L. (Hymenoptera: Apidae), in the Americas since its introduction in the 1980s. For many years, these mites were sufficiently controlled using synthetic acaricides. Recently, however, beekeepers have experienced increased resistance by mites to chemical pesticides, which are also known to leave residues in hive products such as wax and honey. Thus there has been increased emphasis on nonchemical integrated pest management control tactics for Varroa. Because mites preferentially reproduce in drone brood (pupal males), we developed a treatment strategy focusing on salvaging parasitized drones while removing mites from them. We removed drone brood from colonies in which there was no acaricidal application and banked them in separate "drone-brood receiving" colonies treated with pesticides to kill mites emerging with drones. We tested 20 colonies divided into three groups: 1) negative control (no mite treatment), 2) positive control (treatment with acaricides), and 3) drone-brood removal and placement into drone-brood receiving colonies. We found that drone-brood trapping significantly lowered mite numbers during the early months of the season, eliminating the need for additional control measures in the spring. However, mite levels in the drone-brood removal group increased later in the summer, suggesting that this benefit does not persist throughout the entire season. Our results suggest that this method of drone-brood trapping can be used as an element of an integrated control strategy to control varroa mites, eliminating a large portion of the Varroa population with limited chemical treatments while retaining the benefits of maintaining adult drones in the population.

  17. Laboratory evaluation of a native strain of Beauveria bassiana for controlling Dermanyssus gallinae (De Geer, 1778) (Acari: Dermanyssidae).

    Science.gov (United States)

    Immediato, Davide; Camarda, Antonio; Iatta, Roberta; Puttilli, Maria Rita; Ramos, Rafael Antonio Nascimento; Di Paola, Giancarlo; Giangaspero, Annunziata; Otranto, Domenico; Cafarchia, Claudia

    2015-09-15

    The poultry red mite, Dermanyssus gallinae (De Geer, 1778) (Acari: Dermanyssidae) is one of the most economically important ectoparasites of laying hens worldwide. Chemical control of this mite may result in environmental and food contamination, as well as the development of drug resistance. High virulence of Beauveria bassiana sensu lato strains isolated from naturally infected hosts or from their environment has been demonstrated toward many arthropod species, including ticks. However, a limited number of studies have assessed the use of B. bassiana for the control of D. gallinae s.l. and none of them have employed native strains. This study reports the pathogenicity of a native strain of B. bassiana (CD1123) against nymphs and adults of D. gallinae. Batches of nymph and adult mites (i.e., n=720 for each stage) for treated groups (TGs) were placed on paper soaked with a 0.1% tween 80 suspension of B. bassiana (CIS, 10(5), 10(7) and 10(9) conidia/ml), whilst 240 untreated control mites for each stage (CG) were exposed only to 0.1% tween 80. The mites in TG showed a higher mortality at all stages (p<0.01) when compared to CG, depending on the time of exposure and the conidial concentration. A 100% mortality rate was recorded using a CIS of 10(9) conidia/ml 12 days post infection (DPI) in adults and 14 DPI in nymphs. B. bassiana suspension containing 10(9) conidia/ml was highly virulent towards nymph and adult stages of D. gallinae, therefore representing a possible promising natural product to be used in alternative or in combination to other acaricidal compounds currently used for controlling the red mite.

  18. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA Canis familiaris, a New Host of Ornithodoros (A. puertoricensis Fox, 1947 (Acari: Ixodida in Colombia

    Directory of Open Access Journals (Sweden)

    LUIS E PATERNINA

    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Camp

  19. Overwintering survival and postdiapause fecundity in a population of the Kanzawa spider mite Tetranychus kanzawai (Acari: Tetranychidae) on Orixa japonica (Rutaceae).

    Science.gov (United States)

    Ito, Katsura

    2011-01-01

    In several adult-diapausing insects and mites, long duration of diapause decreases egg production after diapause termination. However, such nonlethal effects are much less studied than overwintering survival. In this study, lethal and nonlethal effects of different periods of diapause were investigated in an adult-diapausing spider mite, Tetranychus kanzawai Kishida (Acari: Tetranychidae), through field experiments. Diapausing females produced in the laboratory were kept in their natural habitat from October or November to the next April, and survival rate and postdiapause fecundity were compared between the months. The survival rate was lower, but not significantly, in the October treatment. Postdiapause fecundity was also not significantly different between the months. These results suggest that the effects of diapause on survival and reproduction are quite small after October, when diapausing mites are increasing in their natural habitat.

  20. Prevalence, mean intensity of infestation and host specificity of Spinturnicidae mites (Acari: Mesostigmata) on bats (Mammalia: Chiroptera) in the Pantanal, Brazil.

    Science.gov (United States)

    Silva, Camila de Lima; Graciolli, Gustavo

    2013-06-01

    Acari ectoparasites were collected from bats during 12 months in the Rio Negro farm (19°34'22″S and 56°14'36″W), Aquidauana, Mato Grosso do Sul. A total of 654 bats belonging to the families Phyllostomidae, Noctilionidae, Molossidae, Vespertilionidae and Emballonuridae were captured. Only 136 bats of nine genera and 11 species were parasitised. Periglischrus iheringi Oudemans was the most abundant mite species, and this prevalence may be related to the low degree of host specificity of this species and due to the broad geographical distribution of its hosts. The greatest mean intensity was found to Periglischrus torrealbai Machado-Allison on Phyllostomus discolor Wagner (Phyllostomidae) and Periglischrus tonatii Herrin and Tipton associated with Lophostoma silviculum d'Orbigny (Phyllostomidae), which also had the highest prevalence of infestation.

  1. Taxonomic value of morphological and morphometrical characters in the immature stages of four species of Kampimodromus Nesbitt (Acari: Phytoseiidae) from Italy and Croatia.

    Science.gov (United States)

    Cargnus, Elena; Zandigiacomo, Pietro

    2014-08-28

    The immature stages of four species of Kampimodromus Nesbitt (Acari: Phytoseiidae) from Italy and Croatia have been studied and identified both at stage and species level. Larval stages of Kampimodromus corylosus Kolodochka and all immature stages of Kampimodromus ericinus Ragusa di Chiara & Tsolakis and Kampimodromus langei Wainstein & Arutunjan are described for the first time. The relative length of the posterior dorsal setae Z4 make the larvae of Kampimodromus aberrans (Oudemans) easy to separate from those of the other three species. Nymphs of each species had similar diagnostics to the adults of the respective species. Ontogeny of the idiosomal and leg setation of the Kampimodromus immatures studied in comparison to the available data from immatures of other phytoseiid species is discussed. The length of seta Z4 in the K. aberrans larva, and the number of setae on leg IV of the deutonymphs of the four Kampimodromus species, are proposed as additional taxonomic traits for Phytoseiidae. 

  2. SELETIVIDADE DE CHLORFENAPYR E FENBUTATIN-OXIDE SOBRE DUAS ESPÉCIES DE ÁCAROS PREDADORES (ACARI: PHYTOSEIIDAE EM CITROS

    Directory of Open Access Journals (Sweden)

    REIS PAULO REBELLES

    2001-01-01

    Full Text Available Com o uso de bioensaios, verificaram-se os efeitos residual de contato, ovicida e de persistência dos produtos chlorfenapyr e fenbutatin-oxide sobre duas espécies de ácaros predadores, Iphiseiodes zuluagai Denmark & Muma e Euseius alatus DeLeon (Acari: Phytoseiidae, associados ao ácaro da leprose-dos-citros Brevipalpus phoenicis (Geijskes (Acari: Tenuipalpidae. O efeito total sobre os adultos foi estudado por meio do método residual de contato com pulverização em superfície de vidro, conforme metodologia da IOBC. O efeito ovicida foi avaliado por meio de pulverização direta sobre os ovos dos ácaros predadores, também em superfície de vidro. A persistência dos produtos foi avaliada em laboratório, em arenas confeccionadas com folhas de laranjeira pulverizadas no campo, aos 0; 5; 15 e 30 dias após a aplicação. Os resultados obtidos mostraram que chlorfenapyr foi nocivo ao I. zuluagai e E. alatus e o fenbutatin-oxide foi levemente nocivo a E. alatus e inócuo a I. zuluagai. Nenhum dos produtos apresentou efeito ovicida. Fenbutatin-oxide apresentou baixa persistência para ambas as espécies de ácaros predadores, e chlorfenapyr, na dosagem de 31,3 ml, foi de baixa persistência, enquanto, na dosagem de 62,5 ml, foi moderadamente persistente. O fenbutatin-oxide apresentou-se inócuo e levemente nocivo aos ácaros predadores I. zuluagai e E. alatus, respectivamente, e de baixa persistência para ambas as espécies

  3. Expression analysis of Drosophila doublesex, transformer-2, intersex, fruitless-like, and vitellogenin homologs in the parahaploid predator Metaseiulus occidentalis (Chelicerata: Acari: Phytoseiidae).

    Science.gov (United States)

    Pomerantz, Aaron F; Hoy, Marjorie A

    2015-01-01

    Characterization and expression analyses are essential to gain insight into sex-determination pathways in members of the Acari. Little is known about sex determination at the molecular level in the western orchard predatory mite Metaseiulus occidentalis (Arthropoda: Chelicerata: Arachnida: Acari: Phytoseiidae), a parahaploid species. In this study, eight genes previously identified as putative homologs to genes involved in the sex-determination pathway in Drosophila melanogaster were evaluated for sex-specific alternative splicing and sex-biased expression using reverse-transcriptase PCR and quantitative real-time PCR techniques, respectively. The homologs evaluated in M. occidentalis included two doublesex-like genes (Moccdsx1 and Moccdsx2), transformer-2 (Mocctra-2), intersex (Moccix), two fruitless-like genes (MoccBTB1 and MoccBTB2), as well as two vitellogenin-like genes (Moccvg1 and Moccvg2). Single transcripts of equal size were detected in males and females for Moccdsx1, Moccdsx2, Mocctra-2, Moccix, and MoccBTB2, suggesting that their pre-mRNAs do not undergo alternative splicing in a sex-specific manner. Three genes, Moccdsx1, Moccdsx2 and MoccBTB2, displayed male-biased expression relative to females. One gene, Moccix, displayed female-biased expression relative to males. Two genes, Mocctra-2 and MoccBTB1, did not display detectable differences in transcript abundance in males and females. Expression of Moccvg1 and Moccvg2 were detected in females only, and transcript levels were up-regulated in mated females relative to unmated females. To our knowledge, this represents the first attempt to elucidate expression patterns of putative sex-determination genes in an acarine. This study is an initial step towards understanding the sex-determination pathway in the parahaploid M. occidentalis.

  4. Identification and characterization of microRNAs by deep-sequencing in Hyalomma anatolicum anatolicum (Acari: Ixodidae) ticks.

    Science.gov (United States)

    Luo, Jin; Liu, Guang-Yuan; Chen, Ze; Ren, Qiao-Yun; Yin, Hong; Luo, Jian-Xun; Wang, Hui

    2015-06-15

    Hyalomma anatolicum anatolicum (H.a. anatolicum) (Acari: Ixodidae) ticks are globally distributed ectoparasites with veterinary and medical importance. These ticks not only weaken animals by sucking their blood but also transmit different species of parasitic protozoans. Multiple factors influence these parasitic infections including miRNAs, which are non-coding, small regulatory RNA molecules essential for the complex life cycle of parasites. To identify and characterize miRNAs in H.a. anatolicum, we developed an integrative approach combining deep sequencing, bioinformatics and real-time PCR analysis. Here we report the use of this approach to identify miRNA expression, family distribution, and nucleotide characteristics, and discovered novel miRNAs in H.a. anatolicum. The result showed that miR-1-3p, miR-275-3p, and miR-92a were expressed abundantly. There was a strong bias on miRNA, family members, and nucleotide compositions at certain positions in H.a. anatolicum miRNA. Uracil was the dominant nucleotide, particularly at positions 1, 6, 16, and 18, which were located approximately at the beginning, middle, and end of conserved miRNAs. Analysis of the conserved miRNAs indicated that miRNAs in H.a. anatolicum were concentrated along three diverse phylogenetic branches of bilaterians, insects and coelomates. Two possible roles for the use of miRNA in H.a. anatolicum could be presumed based on its parasitic life cycle: to maintain a large category of miRNA families of different animals, and/or to preserve stringent conserved seed regions with active changes in other places of miRNAs mainly in the middle and the end regions. These might help the parasite to undergo its complex life style in different hosts and adapt more readily to the host changes. The present study represents the first large scale characterization of H.a. anatolicum miRNAs, which could further the understanding of the complex biology of this zoonotic parasite, as well as initiate miRNA studies

  5. Comparative Efficacy of an Imidacloprid/Flumethrin Collar (Seresto®) and an Oral Afoxolaner Chewable (NexGard®) against Tick (Dermacentor variabilis and Amblyomma americanum) Infestations on Dogs: a Randomised Controlled Trial.

    Science.gov (United States)

    Ohmes, Cameon M; Hostetler, Joe; Davis, Wendell L; Settje, Terry; Everett, William R

    2015-08-01

    This randomised controlled laboratory study demonstrated the residual speed of efficacy of an imidacloprid/flumethrin collar (Seresto(®), Bayer) for the control of ticks (Dermacentor variabilis, Amblyomma americanum) at 6 and 12 hours postinfestation on dogs when compared to oral afoxolaner (NexGard(®), Merial). Dogs were randomised by pre-treatment tick counts: Group 1) imidacloprid 10 % (w/w) / flumethrin 4.5 % (w/w) collar, 2) afoxolaner chewable (dosage 3.1 - 6.2 mg/kg), and 3) non-treated controls. Ticks (50/species/dog) were infested on days 3, 14, 21, and 28; live (attached and non-attached) and dead attached ticks were counted 6 and 12 hours later. Efficacy against live D. variabilis at 6 hours for Group 1 was 95 - 100 % and for Group 2 was 38 - 48 %; efficacy at 12 hours for Group 1 was 97 - 100 % and for Group 2 was 27 - 59 %. Efficacy against A. americanum at 6 hours for Group 1 was 94 - 100 % and for Group 2 was afoxolaner on all challenge days.

  6. Distribution of Ehrlichia chaffeensis (Rickettsiales: Rickettsiaeceae) in Amblyomma americanum in southern Indiana and prevalence of E. chaffeensis--reactive antibodies in white-tailed deer in Indiana and Ohio in 1998.

    Science.gov (United States)

    Irving, R P; Pinger, R R; Vann, C N; Olesen, J B; Steiner, F E

    2000-07-01

    To continue monitoring the prevalence and distribution of Ehrlichia chaffeensis (Rickettsiales: Rickettsiaeceae) in southern Indiana, a total of 498 Amblyomma americanum (L.) ticks (262 adults and 292 nymphs) was collected from five southern Indiana counties during May and June 1998. Ticks were pooled and examined for the presence of E. chaffeensis using nested polymerase chain reaction and primers specific for the 16S rRNA gene of E. chaffeensis. The average minimum infection rate for adult ticks collected in 1998 was 3.8% (ranging from 0 to 7.7% in various counties) as compared with previous average minimum infection rates of 1.6% in 1995 and 4.9% in 1997. None of the pools of A. americanum nymphs tested positive. In addition, blood samples were collected from 325 white-tailed deer taken in Indiana and 327 taken in Ohio in November 1998. Serum samples were tested for the presence of E. chaffeensis-like organisms reactive to antibodies using an indirect immunofluorescence assay (IFA). Antibodies were found in deer from six Indiana counties where infection rates ranged from 42.6 to 66.7% and in four Ohio countries where infection rates ranged from 4.4 to 25%. The results of this study reconfirm that E. chaffeensis is well established in southern Indiana and also provide the first evidence of E. chaffeensis-like organisms infecting white-tailed deer in Ohio, suggesting the need to survey Ohio ticks for the presence of Ehrlichia.

  7. Ocorrência de Ornithonyssus bursa (Berlese, 1888 (Acari: Macronyssidae em filhotes de Megascops choliba (corujinha-do-mato e Pitangus sulphuratus (bem-te-vi, no Rio Grande do Sul, Brasil Ocurrence of Ornithonyssus bursa (Berlese, 1888 (Acari: Macronyssidae on Megascops choliba (tropical screech-owl and Pitangus sulphuratus (great kiskadee nestlings in the Rio Grande do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    Carolina S. Mascarenhas

    2009-12-01

    Full Text Available O Núcleo de Reabilitação da Fauna Silvestre e Centro de Triagem de Animais Silvestres da Universidade Federal de Pelotas - RS atendeu dois filhotes de Megascops choliba (corujinha-do-mato (Strigiformes - Strigidae e dois de Pitangus sulphuratus (bem-te-vi (Passeriformes - Tyrannidae intensamente parasitados por ácaros, em maio de 2005 e dezembro de 2006, respectivamente. Os filhotes e o ninho de P. sulphuratus foram recolhidos na zona urbana da cidade de Pelotas - RS após forte temporal. Os ácaros foram removidos, colocados em álcool 70% e levados ao laboratório de parasitologia para identificação. Os espécimes foram clarificados em lactofenol, montados em meio de Hoyer e identificados como Ornithonyssus bursa (Acari - Macronyssidae. Registra-se Megascops choliba e Pitangus sulphuratus como hospedeiros de Ornithonyssus bursa, no Rio Grande do Sul, Brasil.The Center for Rehabilitation of Wildlife and Center for Selection of Wild Animal of the Federal University of Pelotas has attended two nestlings of Megascops choliba (tropical screech-owl (Strigiformes - Strigidae and two of Pitangus sulphuratus (great kiskadee (Passeriformes - Tyrannidae heavily parasitized by mites, in May 2005 and December 2006, respectively. The nestlings and the nest of P. sulphuratus were collected in the Pelotas urban area after severe storms. The mites were removed, clarified in lactofenol, permanently mounted in Hoyer's medium and identified as Ornithonyssus bursa (Acari - Macronyssidae. Megascops choliba and Pitangus sulphuratus are reported as host of Ornithonyssus bursa in Rio Grande do Sul State, Brazil.

  8. Biological cycle of Tenuipalpus heveae Baker (Acari, Tenuipalpidae on leaflets of three rubber tree clones Ciclo de vida de Tenuipalpus heveae Baker (Acari, Tenuipalpidae em folíolos de três clones de seringueira

    Directory of Open Access Journals (Sweden)

    Reinaldo José Fazzio Feres

    2010-06-01

    Full Text Available Life cycle of Tenuipalpus heveae Baker (Acari, Tenuipalpidae on leaflets from three rubber tree clones. The biological cycle of Tenuipalpus heveae Baker, 1945 (Tenuipalpidae, a potential rubber tree pest mite, was studied by the observation of individuals reared on leaflets of the clones GT 1, PB 235 and RRIM 600, in controlled environmental conditions. Three daily observations were done of 60 eggs on leaflets from each clone in order to verify the development of immature stages and the female oviposition. The fertility life table was constructed based in the collected data. Mites reared on PB 235 had faster rate of development, requiring less time in days, to double its population in number (TD, and had the highest values for egg production, female longevity, net reproductive rate (Ro, intrinsic rate of natural increase (r m and finite rate of increase (λ. Lower reproductive values and the longest time necessary to reach adult stage were recorded for the mites on GT 1. In all studied clones, the deutonymphal phase had the highest viability, while the larval phase had the lowest, highlighted by the survivorship curve that indicated high mortality during this life stage. The clone PB 235 allowed the most suitable conditions for the development of T. heveae, followed by RRIM 600, while GT 1 was the less suitable substratum to rear this mite species.O ciclo de vida de Tenuipalpus heveae Baker, 1945 (Tenuipalpidae, um potencial ácaro-praga da seringueira, foi estudado a partir de indivíduos criados sobre folíolos destacados dos clones GT 1, PB 235 e RRIM 600, em condições controladas. Três observações diárias foram realizadas, acompanhando-se o desenvolvimento de 60 ovos e de sua prole em folíolos de cada um dos clones, para verificação da oviposição das fêmeas e dos estágios de desenvolvimento. A partir dos dados obtidos, foi elaborada uma tabela de vida de fertilidade. Os ácaros criados sobre folíolos de PB 235 apresentaram r

  9. Characterization of the complete mitochondrial genome of the storage mite pest Tyrophagus longior (Gervais) (Acari: Acaridae) and comparative mitogenomic analysis of four acarid mites.

    Science.gov (United States)

    Yang, Banghe; Li, Chaopin

    2016-02-01

    Mites of the genus Tyrophagus are economically important polyphagous pest commonly living on stored products and also responsible for allergic reactions to humans. Complete mitochondrial genomes (mitogenomes) and the gene features therein are widely used as molecular markers in the study of population genetics, phylogenetics as well as molecular evolution. However, scarcity on the sequence data has greatly impeded the studies in these areas pertaining to the Acari (mites and ticks). Information on the Tyrophagus mitogenomes is quite critical for phylogenetic evaluation and molecular evolution of the mitogenomes within Acariformes. Herein, we reported the complete mitogenome of the allergenic acarid storage mite Tyrophagus longior (Astigmata: Acaridae), an important member of stored food pests, and compared with those of other three acarid mites. The complete mitogenome of T. longior was a circular molecule of 13,271 bp. Unexpectedly, only 19 transfer RNA genes (tRNAs) were present, lacking trnF, trnS1 and trnQ. Furthermore, it also contained 13 protein-coding genes (PCGs) and 2 genes for rRNA (rrnS and rrnL) commonly detected in metazoans. The four mitogenomes displayed similar characteristics with respect to the gene content, nucleotide comparison, and codon usages. Yet, the gene order of T. longior was different from that in other Acari. The J-strands of the four mitogenomes possessed high A+T content (67.4-70.0%), and exhibited positive GC-skews and negative AT-skews. Most inferred tRNAs of T. longior were extremely truncated, lacking either a D- or T-arm, as found in other acarid mites. In T. longior mitogenome the A+T-rich region was just 50 bp in length and can be folded as a stable stem-loop structure, whereas in the region some structures of microsatellite-like (AT)n and palindromic sequences was not present. Besides, reconstructing of the phylogenetic relationship based on concatenated amino acid sequences of 13 PCGs supported that monophyly of the family

  10. The dynamics of questing ticks collected for 164 consecutive months off the vegetation of two landscape zones in the Kruger National Park (1988-2002). Part I. Total ticks, Amblyomma hebraeum and Rhipicephalus decoloratus.

    Science.gov (United States)

    Horak, Ivan G; Gallivan, Gordon J; Spickett, Arthur M

    2011-02-23

    Despite a large number of studies on tick biology, there is limited information on long- term changes in tick populations. This study thus aimed to assess the long-term population dynamics of questing ixodid ticks in two landscape zones of the Kruger National Park (KNP). Questing ixodid ticks were collected in the KNP from August 1988 to March 2002 by monthly dragging of the vegetation in three habitats (grassland, woodland and gully) at two sites (Nhlowa Road and Skukuza). Findings pertaining to total tick numbers and Amblyomma hebraeum and Rhipicephalus decoloratus specifically are presented here. Fourteen tick species were collected, as well as four others that could be identified only to generic level. More ticks (211 569 vs 125 810) were collected at Nhlowa Road than at Skukuza. Larvae were the most commonly collected stage of all the major tick species. A. hebraeum was the most commonly collected tick (63.6%) at Nhlowa Road, whereas R. decoloratus accounted for 15.3% of the ticks collected there. At Skukuza, 31.6% and 27.1% of the collected ticks were R. decoloratus and A. hebraeum respectively. Most A. hebraeum larvae were collected in summer and the fewest in winter and early spring, mostly in woodland and least often in grassland habitats. Most R. decoloratus larvae were collected in spring and the fewest in autumn and winter, and were more frequently collected in woodland and grassland than in gullies. The largest collections of most tick species were made during the early 1990 s, while numbers were lowest in the mid-1990 s after a drought during 1991 and 1992 and then increased towards the late 1990 s, followed by a final decrease. The changes in tick numbers over time probably reflect differences in their host communities at the two sites and the effect of climatic conditions on both hosts and free-living ticks. The population dynamics of questing ticks reflect a complex interaction between ticks, their hosts and the environment.

  11. Molecular characterization and evolutionary insights into potential sex-determination genes in the western orchard predatory mite Metaseiulus occidentalis (Chelicerata: Arachnida: Acari: Phytoseiidae).

    Science.gov (United States)

    Pomerantz, Aaron F; Hoy, Marjorie A; Kawahara, Akito Y

    2015-01-01

    Little is known about the process of sex determination at the molecular level in species belonging to the subclass Acari, a taxon of arachnids that contains mites and ticks. The recent sequencing of the transcriptome and genome of the western orchard predatory mite Metaseiulus occidentalis allows investigation of molecular mechanisms underlying the biological processes of sex determination in this predator of phytophagous pest mites. We identified four doublesex-and-mab-3-related transcription factor (dmrt) genes, one transformer-2 gene, one intersex gene, and two fruitless-like genes in M. occidentalis. Phylogenetic analyses were conducted to infer the molecular relationships to sequences from species of arthropods, including insects, crustaceans, acarines, and a centipede, using available genomic data. Comparative analyses revealed high sequence identity within functional domains and confirmed that the architecture for certain sex-determination genes is conserved in arthropods. This study provides a framework for identifying potential target genes that could be implicated in the process of sex determination in M. occidentalis and provides insight into the conservation and change of the molecular components of sex determination in arthropods.

  12. Syringophilid mites (Acari: Syringophilidae) associated with the rails (Aves: Rallidae) and a key to the species of the genus Rafapicobia Skoracki, 2011.

    Science.gov (United States)

    Skoracki, Maciej; Unsoeld, Markus; Skorupski, Maciej; Kavetska, Katarzyna

    2014-07-01

    The fauna of quill mites of the family Syringophilidae Lavoipierre, 1953 (Acari: Prostigmata Cheyletoidea) parasitising birds of the family Rallidae Vigors (Gruiformes) is updated. A new species, Rafapicobia melzeri n. sp. (subfamily Picobiinae), is described from four host species: Rallus aquaticus Linnaeus (type-host) from Germany, Pardirallus sanguinolentus (Swainson) from Chile, Porzana porzana (Linnaeus) from France and P. parva (Scopoli) from Kirghizia. The new species is most similar to R. lepidocolaptesi Skoracki & Solarczyk, 2012 but differs in the absence of agenital plates and the length ratios of setae ag2:g1 and vi:ve:si in females and in the punctate ornament on the hysteronotal and the pygidial shields in males. A key to the species of the genus Rafapicobia is proposed. This is the first record of a representative of the subfamily Picobiinae on gruiform birds. Additionally, new rallid hosts are reported for Charadriphilus ralli Skoracki & Bochkov, 2010 (subfamily Syringophilinae): Gallinula melanops (Vieillot) from Chile, Laterallus melanophaius (Vieillot) from Paraguay, and P. parva (Scopoli) from Kirghizia.

  13. Diversity of Quill Mites of the Family Syringophilidae (Acari: Prostigmata) Parasitizing Owls (Aves: Strigiformes) With Remarks on the Host-Parasite Relationships.

    Science.gov (United States)

    Skoracki, Maciej; Unsoeld, Markus; Marciniak, Natalia; Sikora, Bozena

    2016-07-01

    The quill mite fauna of the family Syringophilidae (Acari: Prostigmata: Cheyletoidea) associated with owls (Aves: Strigiformes) is reviewed. A new genus is proposed, Neobubophilus Skoracki & Unsoeld gen. nov. It differs from closely related Bubophilus (Bubophilus Philips and Norton, 1978) by the absence of leg setae vsII in the both sexes. In addition, four new species are described: (1) Neobubophilus cunicularius Skoracki & Unsoeld sp. nov. from Athene cunicularia (Molina, 1782) (Strigidae) from Paraguay; (2) Neobubophilus atheneus Skoracki & Unsoeld sp. nov. from Athene noctua (Scopoli, 1769) and Athene brama (Temminck, 1821) (Strigidae), both from India; (3) Bubophilus tytonus Skoracki & Unsoeld sp. nov. from Tyto alba affinis (Blyth, 1862) (Tytonidae) from Cameroon, and (4) Megasyringophilus dalmas Skoracki & Unsoeld sp. nov. from Megascops choliba (Vieillot, 1817) (Strigidae) from Venezuela. The following new host species are given: Bubo bubo (Linnaeus, 1758) (Strigidae) from Nepal for Bubophilus ascalaphus (Philips and Norton 1978) and Strix woodfordii (Smith, 1834) (Strigidae) from Tanzania for Bubophilus aluconis (aluconis Nattress and Skoracki 2009). A key for syringophilid genera and species associated with owls is constructed. The host-parasite relationships of syringophilid mites and owls are discussed. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com Version of Record, first published online May 24, 2016 with fixed content and layout in compliance with Art. 8.1.3.2 ICZN.

  14. Acaricidal activity of Annonaceae fractions against Tetranychus tumidus and Tetranychus urticae (Acari: Tetranychidae and the metabolite profile of Duguetia lanceolata (Annonaceae using GC-MS

    Directory of Open Access Journals (Sweden)

    Dejane Santos Alves

    2015-12-01

    Full Text Available Species of the Tetranychus genus feed on plant tissues, which reduces the rate of photosynthesis and can lead to the death of plant tissues. As a result, considerable production losses are caused by these arthropods. Thus, in order to aid in the development of new products for the control of Tetranychus tumidus Banks and Tetranychus urticae Koch (Acari: Tetranychidae, the initial objective of this study was to select Annonaceae derived fractions that were soluble in dichloromethane and have acaricidal activity. Then, an exploratory analysis of the metabolite profile of the most successful fraction was performed by gas chromatography-mass spectrometry (GC-MS. Among the dichloromethane soluble fractions derived from Annona cacans Warm., Annona coriacea Mart., Annona neolaurifolia H. Rainer, Annona sylvatica A.St.-Hil., Duguetia lanceolata A.St.-Hil., Guatteria australis A.St.-Hil., Xylopia brasiliensis Spreng., Xylopia emarginata Mart. and Xylopia sericea A.St.-Hil., only the fraction from D. lanceolata stem bark reduced the survival of T. tumidus females. However, ovicidal activity was not detected when D. lanceolata stem bark was evaluated against T. tumidus eggs. Further, we studied the effect of dichloromethane soluble fractions from D. lanceolata leaves, berry fruits and stem bark on T. urticae, and the stem bark was found to be the most active fraction against T. urticae. The metabolite profile analysis of D. lanceolata stem bark by GC-MS, suggested that the main constituents were 2,4,5-trimethoxystyrene and trans-asarone.

  15. Laboratory evaluation of aromatic essential oils from thirteen plant species as candidate repellents against Leptotrombidium chiggers (Acari: Trombiculidae), the vector of scrub typhus.

    Science.gov (United States)

    Eamsobhana, Praphathip; Yoolek, Adisak; Kongkaew, Wittaya; Lerdthusnee, Kriangkrai; Khlaimanee, Nittaya; Parsartvit, Anchana; Malainual, Nat; Yong, Hoi-Sen

    2009-03-01

    Scrub typhus, a rickettsial disease transmitted by several species of Leptotrombidium chiggers (larvae), is endemic in many areas of Asia. The disease is best prevented by the use of personal protective measures, including repellents. In this study commercially produced aromatic, essential oils of 13 plant species and ethanol (control) were tested in the laboratory for repellency against host-seeking chiggers of Leptotrombidium imphalum Vercammen-Grandjean and Langston (Acari: Trombiculidae). A rapid, simple and economic in vitro test method was used by exposing the chigger for up to 5 min. Repellency was based on relative percentages of chiggers attracted to test and control substances. Four of the 13 essential oils showed promise as effective repellent against L. imphalum chiggers. Syzygium aromaticum (clove) oil exhibited 100% repellency at 5% concentration (dilution with absolute ethanol), whereas Melaleuca alternifolia (tea tree) oil exhibited 100% repellency at 40% concentration. Undiluted oils of Zingiber cassamunar (plai) and Eucalyptus globules (blue gum) exhibited 100% repellency. Of the remaining nine essential oils, only 100% Pelargonium graveolens (geranium) exhibited >50% repellency (viz. 57%). Styrax torkinensis (benzoin) oil did not exhibit any repellency. These findings show that several aromatic, essential oils of plants may be useful as chigger repellent for the prevention of scrub typhus. Syzygium aromaticum oil may be safer and more economical to prevent chigger attacks than commercially available synthetic chemicals, such as DEET that may have harmful side effects.

  16. Dinâmica populacional de Calepitrimerus vitis (Nalepa (Acari: eriophyidae em cultivares de videira na região da campanha do Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Paulo Ricardo Ebert Siqueira

    2013-06-01

    Full Text Available Na Região da Campanha do Rio Grande do Sul, o ácaro-da-ferrugem-da-videira, Calepitrimerus vitis (Nalepa (Acari: Eriophyidae, é encontrado com frequência em vinhedos de cultivares europeias, desde a safra de 2004/2005, causando bronzeamento nas folhas. A dinâmica populacional de C. vitis nas cultivares Chardonnay e Merlot foi avaliada em vinhedo comercial localizado no município de Dom Pedrito, na região da Campanha, durante os anos agrícolas de 2005/2006 e 2006/2007, por meio de amostragem realizada em folhas das posições basal, intermediária e apical de ramos de produção. O pico populacional de C. vitis ocorre entre o final de fevereiro e o início de março, sendo seguido de forte declínio populacional. A infestação variou de intensidade entre as cultivares de acordo com o ano, sendo a cultivar Chardonnay mais infestada no primeiro ano, e Merlot, no segundo. Folhas na posição basal, mediana e apical apresentam níveis similares de infestação. Uma correlação positiva foi encontrada entre o número de C. vitis na face abaxial das folhas e o percentual de folhas com infestação.

  17. Population structure and dynamics of the cassava green mite Mononychellus tanajoa (Bondar and the predator Euseius ho (DeLeon (Acari: Tetranychidae, Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Evila C. Costa

    2012-06-01

    Full Text Available Population structure and dynamics of the cassava green mite Mononychellus tanajoa and the predator Euseius ho (Acari: Tetranychidae, Phytoseiidae. Cassava is attacked by several pests, among which the cassava green mite Mononychellus tanajoa. Predatory mites of the family Phytoseiidae are major natural enemies of pestmites and are naturally found inhabiting cassava plants in the field. We evaluated the temporal variation of the developmental stages of M. tanajoa and the most abundant predatory mite in cassava fields in the study region, the phytoseiid Euseius ho. Densities of all developmental stages of M. tanajoa were low during the rainy season, increasing over the cultivation cycle of cassava and peaking in the dry season. Overall, the larval stage of M. tanajoa presented the lowest densities throughout time. Densities of all developmental stages of E. ho were low and remained constant throughout the cultivation cycle of cassava. The number of eggs, nymphs and adults of M. tanajoa was higher in comparison to the larval stage whereas there were no differences in densities of the stages of E. ho. Densities of all developmental stages of M. tanajoa were negatively correlated with precipitation. Densities of the stages of egg, nymph and adult of M. tanajoa were positively related while the stage of larva was negatively related to temperature. We conclude that it is important to consider the population structure in studies of population dynamics of arthropods as each developmental stage experiences and responds uniquely to the local environment over time.

  18. Incidence and inheritance of resistance to METI-acaricides in European strains of the two-spotted spider mite (Tetranychus urticae) (Acari: Tetranychidae).

    Science.gov (United States)

    Devine, G J; Barber, M; Denholm, I

    2001-05-01

    A strain of Tetranychus urticae (Koch; Acari: Tetranychidae), collected from hops (Humulus humuli L; Cannabaceae) in England with a short history of tebufenpyrad use, exhibited resistance to four METI (mitochondrial electron transport inhibitor)-acaricides; tebufenpyrad, pyridaben, fenazaquin and fenpyroximate. Resistance factors for these compounds in a microimmersion assay were 46, 346, 168 and 77 respectively, and corresponded to those exhibited by a Japanese METI-acaricide-resistant reference strain. Levels of resistance remained stable without further selection, and selection with tebufenpyrad did not increase them. The UK strain was also resistant (c 6-fold) to bifenthrin. Crosses of homozygous, diploid females with hemizygous, haploid males showed that, in the UK strain, METI-acaricide resistance was paternally and maternally inherited, and was an incompletely dominant trait. Another tebufenpyrad-resistant strain from the UK, originating from a chrysanthemum nursery (Chrysanthemum foeniculaceum Giseke; Asteraceae) was collected eight months later at a site c 210 km distant from the first. These are the first published incidences of METI-acaricide resistance in Europe and implications for the future use of these compounds are discussed.

  19. Efficiency of the latex from Euphorbia splendens var. hislopii (N.E. Br. Ursch & Leandri, Euphorbiaceae, in the control of Rhipicephalus (Boophilus sanguineus (Latreille, 1806 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Zeneida T. Pinto

    2011-06-01

    Full Text Available The aim of this study was to evaluate the effect of the latex from Euphorbia splendens var. hislopii (N.E. Br. Ursch & Leandri, Euphorbiaceae, on the eggs and engorged larvae of Rhipicephalus (B. sanguineus (Latreille, 1806 (Acari: Ixodidae. Six aqueous concentrations: 25, 50, 100, 125, 250 and 500 μL/L of the latex of this plant were tested. The control group was tested only with distilled water. The latex of E. splendens var. hislopii presented an LD50 of 18.031 μL/L and LD90 of 84.610 μL/L against the eggs of R. (B. sanguineus. The larvae of all the groups treated with the latex presented a low survival rate of 0% at 25 μL/L, 1% at 50 μL/L, 2% at 100 μL/L, 3% at 125 μL/L, 9% at 250 μL/L, 5% at 500 μL/L when compared with the control group (91%. On day 7 and 14 after the application the latex killed more efficiently the treated groups (25, 50, 100, 125, 250 and 500 μL/L. As from day 21 the latex became less effective for all treatments. Our results clearly show that the aqueous concentration of the latex have a strong effect on tick eggs and larvae suggesting that it could become an important acaricide.

  20. Differences between populations of Spinturnix myoti (Acari: Mesostigmata) in breeding and non-breeding colonies of Myotis myotis (Chiroptera) in central Europe: the effect of roost type.

    Science.gov (United States)

    Postawa, Tomasz; Szubert-Kruszyńska, Agnieszka; Ferenc, Hanna

    2014-12-01

    We studied variations in the abundance of parasitic spinturnicid mites in relation to the gender, age and body condition of bats living in different habitats. Populations of Spinturnix myoti Kolenati, 1856 (Acari: Spinturnicidae), an ectoparasite of the bat Myotis myotis (Borkhausen) (Mammalia: Chiroptera), were investigated in two types of roosts differing in microclimatic conditions: caves (low temperature and high humidity) and attics (high temperature and low humidity). Our data suggest that bats from cave nursery colonies harbour more parasites than those from attic colonies, irrespective of host sex or age. In underground colonies, adult females and their young differ in the mean abundance of parasites, whereas no such differences were found in attic colonies. Non-lactating females from underground roosts and lactating females from attic colonies had similar parasite loads, were lower than those of adult lactating females from caves. A negative correlation between the host body condition index and parasite load was found only in the most infected sex/age group of bats. In spite of significant differences in parasite load, the mean abundance of particular life stages of mites seems to be independent of the type of roost occupied by the host, its sex or age. However, in attic colonies the number of female deutonymphs was twice that of male deutonymphs, whereas in cave colonies the proportions of the sexes were similar. We suggest that the microclimate of the host's roosts may influence ectoparasite abundance through pressure on the sex ratio in the nymphal stages of mites.

  1. Secondary structure prediction for complete rDNA sequences (18S, 5.8S, and 28S rDNA) of Demodex folliculorum, and comparison of divergent domains structures across Acari.

    Science.gov (United States)

    Zhao, Ya-E; Wang, Zheng-Hang; Xu, Yang; Wu, Li-Ping; Hu, Li

    2013-10-01

    According to base pairing, the rRNA folds into corresponding secondary structures, which contain additional phylogenetic information. On the basis of sequencing for complete rDNA sequences (18S, ITS1, 5.8S, ITS2 and 28S rDNA) of Demodex, we predicted the secondary structure of the complete rDNA sequence (18S, 5.8S, and 28S rDNA) of Demodex folliculorum, which was in concordance with that of the main arthropod lineages in past studies. And together with the sequence data from GenBank, we also predicted the secondary structures of divergent domains in SSU rRNA of 51 species and in LSU rRNA of 43 species from four superfamilies in Acari (Cheyletoidea, Tetranychoidea, Analgoidea and Ixodoidea). The multiple alignment among the four superfamilies in Acari showed that, insertions from Tetranychoidea SSU rRNA formed two newly proposed helixes, and helix c3-2b of LSU rRNA was absent in Demodex (Cheyletoidea) taxa. Generally speaking, LSU rRNA presented more remarkable differences than SSU rRNA did, mainly in D2, D3, D5, D7a, D7b, D8 and D10.

  2. Poderá o carrapato transmitir a lepra?: mais quatro amostras de culturas de bacilos acido-alcool resistentes obtidas de carrapatos (2 de "Amblyomma cajennense"e 2 de "Boophilus microplus" infectados em leprosos do Paraná: 3ª nota May leprosy be transmitted by ticks?: third note

    Directory of Open Access Journals (Sweden)

    H. C. de Souza-Araujo

    1942-01-01

    Full Text Available The AA. carried out experiments in the leprosarium São Roque, State of Paraná, South Brazil, to verify if the cattle tick Boophilus microplus could be experimentally infected in lepers, which was true. The AA. Tried also to be ascertained if Boophilus microplus and Amblyomma cajennense could change of hosts during their feedings which was true, both ticks continue feeding, the last species for many days, after being transferred from one to another leper. The junior A. describes in full their experiments and also a dermatites caused by tick bites. The senior A. brought to Rio de Janeiro most of the infected ticks for examination, which revealed a very high positivity. He smeared the sediments of lots of both species of ticks in Loewenstein medium and after a variable periode of incubation at 37° C. he obtained four new samples of cultures of acid-fast organisms, two from Amblyomma cajennense and two from Boophilus microplus. These cultures are being studied and will be inoculated into laboratory animals. The senior A. inoculated new batches of white rats with sediments of many ticks infected in lepers. Various hypotheses of both previous notes upon the subject now are verified facts. The A. is accumulating facts to draw the conclusions in the future. He also suggested the leprosy workers in the interior of the country to cooperate with him in such important studies, specially in the habitat of lepers in the rural zones of various States.

  3. Identification of Ixodide ticks of cattle in and around Hararamaya district, Eastern Ethiopia

    Directory of Open Access Journals (Sweden)

    S.A. Kassa

    2012-08-01

    Full Text Available We conducted a survey to determine the prevalence of Ixodide ticks, their predilection sites and relation to breed, sex, and age group of animals. A total of 560 animals were examined of which 186 (33.21% found infested with one or more ticks. Among the total 1446 ticks collected three generas; Amblyomma, Boophilus, and Rhipicephalus, and five species identified. The relative prevalence of each species was Amblyomma variegatum (38.87%, Amblyomma coherence (8.30%, Boophilus decoloratus (31.54%, Rhipicephalus pulchellus (6.64%, and Rhipicephalus evertsi evertsi (14.66%. A.variegatum and A. coherence shows higher preference to axial, scrotum/ udder, and groin & belly. B. decoloratus species were found prominently on the back & neck. R. evertsi evertsi and R. pulchelus showed high preference to the under tail and peri-anal &vulva regions of the body. The male to female sex ratio of the collected ticks was found 1.96:1, showing higher proportion of male than their counter parts. The prevalence of tick infestation was found significantly higher (P0.05.

  4. Toxicidade diferencial de produtos à base de abamectina ao ácaro Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae em citros Differential toxicity of abamectin based products over Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae mite in citrus

    Directory of Open Access Journals (Sweden)

    Daniel Júnior de Andrade

    2010-03-01

    Full Text Available O ácaro Brevipalpus phoenicis é uma das principais pragas dos citros por ser vetor do "Citrus Leprosis Virus" (CiLV, agente causal da leprose, uma das mais graves doenças da citricultura. Objetivou-se avaliar o efeito tóxico de produtos à base de abamectina sobre o ácaro B. phoenicis. Foram realizados um experimento de ação direta e três de ação residual no Laboratório de Acarologia do Departamento de Proteção de Plantas (Fitossanidade da FCAV - UNESP, Jaboticabal-SP. O delineamento adotado nos bioensaios foi o inteiramente casualizado, onde 10 tratamentos foram repetidos 7 vezes, sendo cada repetição composta por um fruto de laranja. Os tratamentos estudados (mL p.c./100 L de água foram: Acaramik a 20; 30; 40 e 50 mL; Vertimec a 30 e 40 mL; Abamectin Nortox a 30 e 40 mL; Tricofol a 77 mL e uma testemunha sem aplicação. Utilizaram-se frutos com presença de verrugose, que foram lavados e parcialmente parafinados, deixando-se uma área sem parafina, que foi circundada com cola entomológica para contenção dos ácaros. Transferiram-se 20 ácaros adultos B. phoenicis para cada fruto. No bioensaio de ação direta, a transferência foi realizada antes das aplicações e, nos bioensaios de ação residual, aos 5; 10 e 15 dias após a aplicação dos produtos. A aplicação dos produtos sobre os frutos foi realizada em Torre de Potter. Os resultados obtidos nos bioensaios evidenciaram que os melhores tratamentos foram: Tricofol a 77 mL, Acaramik a 40 e 50 mL e Vertimec a 40 mL. De forma geral, os produtos testados podem ser utilizados no controle do ácaro B. phoenicis.The mite Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae is one of the most important pests in Brazil citrus plantation, because it is the virus "Citrus Leprosis Virus" (CiLV vector, one of the most serious citrus plantation diseases. The purpose of this experiment was to evaluate the toxical effect of abamectin in the mite B. phoenicis. It was performed

  5. Efficacy of amitraz-impregnated collars on white-tailed deer (Artiodactyla: Cervidae) in reducing free-living populations of lone star ticks (Acari: Ixodidae).

    Science.gov (United States)

    Pound, J M; Lohmeyer, K H; Davey, R B; Miller, J A; George, J E

    2012-12-01

    Over a 7 yr period, we monitored the effect of a commercially available, amitraz impregnated anti-tick collar in controlling free-living populations of lone star ticks, Amblyomma americanum (L.) when manually fitted around necks of white-tailed deer, Odocoileus virginianus (Zimmermann). Study animals in treatment and control groups were confined in 38.8 ha game-fenced and densely vegetated treatment plots in South Texas. Tick densities during years 1 and 7 served as untreated pre- and posttreatment comparisons and treatments occurred during years 2 through 5. Reductions in tick densities in the treatment plot were compared against tick densities in a control plot having similar vegetation and numbers of untreated deer. During years of treatment, indices of control pressure ranged from 18.2 to 82.6 for nymphs and 16.9-78.7 for adults, and efficacy, expressed as percentage control during the final year of treatment, was 77.2 and 85.0%, respectively, for nymphal and adult ticks. These data show that acaricidal collar treatments provide efficacies very similar to those achieved with the existing ivermectin-medicated bait and '4-Poster' topical treatment technologies to control ticks feeding on wild white-tailed deer.

  6. Management of lone star ticks (Acari: Ixodidae) in recreational areas with acaricide applications, vegetative management, and exclusion of white-tailed deer.

    Science.gov (United States)

    Bloemer, S R; Mount, G A; Morris, T A; Zimmerman, R H; Barnard, D R; Snoddy, E L

    1990-07-01

    A project on management of lone star ticks, Amblyomma americanum (L.), at Land Between the Lakes, a Tennessee Valley Authority recreational area in Kentucky-Tennessee, during 1984-1988, demonstrated the effectiveness and economics of three control technologies. Acaricide applications (chlorpyrifos at 0.28 kg [AI]/ha), vegetative management (mowing and removal of 40% overstory and 90-100% of midstory, understory, and leaf litter), and host management (white-tailed deer exclusion from a 71-ha campground with a single-line fence) provided 75, 70, and 64% mean controls of all life stages of the lone star tick, respectively. Combinations of acaricide applications + vegetative management, acaricide applications + host management, and acaricide applications + vegetative management + host management produced 94, 89, and 96% mean control of all life stages, respectively. The costs of acaricide applications (two per year), vegetative management (two mowings per year), and white-tailed deer exclusion (single-line fence) were $45, $150, and $30/ha/yr, respectively. Results of this project are used to design management strategies that could be considered for use against lone star ticks in recreational areas.

  7. Elenco y biogeografía de los ácaros acuáticos (Acari, Parasitengona, Hydrachnidia de Sudamérica

    Directory of Open Access Journals (Sweden)

    Rosso de Ferradás, B.

    2005-12-01

    Full Text Available Checklist and catalog publications demonstrate a clear connection between basic taxonomy and biodiversity issues. According to some estimates, only 10-30% of all global species have been named. As in other fields, catalogs provide an important source of information concerning species diversity in freshwater ecology.

    South America is a continent dominated by freshwater ecosystems. The tremendous habitat diversity created by this landscape supports a high number of arthropods, including water mites, which belong to the hyperdiverse group Acari. South America has a substantial task ahead in cataloging its biodiversity.

    Much has been published on water mites in South America. In fact, according to Besch, water mites were the most studied with the exception of Europe up until the 1960’s. Most of the collections were conducted by two acarologists (Lundblad and Karl Viets during the 1940’s. Today, the collection, identification and description process of water mites is slower. In the 1980’s, the north-american acarologist D. R. Cook produced two lengthy papers about neotropical water mites in four regions of South America. Recently, several Argentine acarologists have published papers on water mites from diverse habitats and regions in South America.

    The catalog presented here includes information regarding 6 superfamilies, including 23 families in 118 genera of true water mites (Hydrachnidia, Parasitengona, Acari. It also includes the references concerning the species, distribution in various regions of South America and –as far as known– habitat.

    At present, there are 916 species from several authors cataloged in 11 countries in South America. The degree of knowledge varies greatly from country to country, with numerous entries for Brazil and none for French Guiana.

    Las publicaciones de catálogos y listados de especies determinan una clara conexión entre taxonomía básica y temas

  8. Sampling method evaluation and empirical model fitting for count data to estimate densities of Oligonychus perseae (Acari: Tetranychidae) on 'Hass' avocado leaves in southern California.

    Science.gov (United States)

    Lara, Jesús R; Saremi, Naseem T; Castillo, Martin J; Hoddle, Mark S

    2016-04-01

    Oligonychus perseae (Acari: Tetranychidae) is an important foliar spider mite pest of 'Hass' avocados in several commercial production areas of the world. In California (USA), O. perseae densities in orchards can exceed more than 100 mites per leaf and this makes enumerative counting prohibitive for field sampling. In this study, partial enumerative mite counts along half a vein on an avocado leaf, an industry recommended practice known as the "half-vein method", was evaluated for accuracy using four data sets with a combined total of more than 485,913 motile O. perseae counted on 3849 leaves. Sampling simulations indicated that the half-vein method underestimated mite densities in a range of 15-60 %. This problem may adversely affect management of this pest in orchards and potentially compromise the results of field research requiring accurate mite density estimation. To address this limitation, four negative binomial regression models were fit to count data in an attempt to rescue the half-vein method for estimating mite densities. These models were incorporated into sampling plans and evaluated for their ability to estimate mite densities on whole leaves within 30-tree blocks of avocados. Model 3, a revised version of the original half-vein model, showed improvement in providing reliable estimates of O. perseae densities for making assessments of general leaf infestation densities across orchards in southern California. The implications of these results for customizing the revised half-vein method as a potential field sampling tool and for experimental research in avocado production in California are discussed.

  9. Controle de Brevipalpus phoenicis (Geijskes, 1939 E Oligonychus ilicis (McGregor, 1917 (Acari: Tenuipalpidae, Tetranychidae em cafeeiro e o impacto sobre ácaros benéficos: I - abamectin e emamectin Control of Brevipalpus phoenicis (Geijskes, 1939 and Oligonychus ilicis (McGregor, 1917 (Acari: Tenuipalpidae, Tetranychidae in coffee plants and the impact on beneficial mites: I - Abamectin and emamectin

    Directory of Open Access Journals (Sweden)

    Paulo Rebelles Reis

    2004-04-01

    Full Text Available O ácaro Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae é importante em cafeeiro (Coffea spp., por ser o vetor do vírus da mancha-anular, responsável por queda de folhas e má qualidade da bebida do café, e o ácaro-vermelho, Oligonychus ilicis (McGregor, 1917 (Acari: Tetranychidae, por reduzir a área foliar de fotossíntese. Alguns ácaros da família Phytoseiidae são eficientes predadores associados aos ácaros-praga. Com este trabalho teve-se como objetivo estudar o controle dos ácaros-praga e o impacto do abamectin e emamectin sobre fitoseídeos. Em laboratório, foram estudados os efeitos ovicida, tópico, residual, tópico mais residual aos ácaros-praga e a seletividade fisiológica aos fitoseídeos. Em semicampo, foi estudada a persistência dos produtos no controle dos ácaros-praga. O efeito ovicida foi avaliado em ovos no início e fim de incubação; os efeitos residual, tópico e tópico mais residual foram avaliados pela mortalidade de larvas, ninfas e adultos após 48 horas da aplicação, enquanto a persistência foi avaliada pela mortalidade até 30 dias após a pulverização. A seletividade aos ácaros fitoseídeos foi avaliada pelo efeito total às fêmeas adultas, em teste residual em superfície de vidro. Pelos resultados, verificou-se que abamectin e emamectin não possuem ação ovicida, para ambas as espécies de ácaros-praga estudadas. Considerando o efeito tópico mais residual, o abamectin e emamectin foram altamente eficientes no controle de larvas, ninfas e adultos de B. phoenicis; apenas abamectin foi eficiente no controle de O. ilicis. Abamectin foi levemente a moderadamente nocivo e emamectin mostrou-se inócuo a levemente nocivo aos fitoseídeos. Devido à eficiência de controle e seletividade a fitoseídeos, conclui-se que abamectin e emamectin podem ser utilizados em programas de manejo integrado do ácaro B. phoenicis, e abamectin para o manejo de B. phoenicis e O. ilicis em cafeeiro

  10. Alguns ectoparasitas e protozoários em bovinos da República da Guiné-Bissau

    OpenAIRE

    ROSA, FERNANDA; Crespo, Maria Virgínia; Travassos Dias, J. A.

    1998-01-01

    Os autores assinalam a presença de algumas espécies de ixodídeos (Amblyomma variegatum, Boophilus annulatus, B. geigy e Hyalomma sp.) localizados em diferentes regiões do corpo de bovinos autóctones da República da Guiné-Bissau, colhidos entre Novembro de 1990 e Março de 1991. A pesquisa de protozoários, efectuada principalmente em esfregaços de sangue revelou a presença de Anaplasma marginale, Theileria mutans, Babesia bigemina e Sarcocystis sp. Não foram encontradas lesões relacionada...

  11. Arthropod Surveillance Programs: Basic Components, Strategies, and Analysis

    Science.gov (United States)

    2012-01-01

    Amblyomma americanum (Acari: Ix- odidae) in beef cattle forage areas. J. Med. Entomol. 28: 557Ð564. Barrera, R. 2009. SimpliÞed pupal surveys of Aedes...to assess reproduction rates in an area; however, ovitrapsmay be too simplistic formimicking aquatic habitats and do not compete adequately with the... cattle was associated with an in- crease in the biting rate of the primary midge vector Culicoides sonorensis Wirth and Jones. Similarly, an increase in

  12. Spotted fever group rickettsiae in ticks from the Masai Mara region of Kenya.

    Science.gov (United States)

    Macaluso, Kevin R; Davis, Jon; Alam, Uzma; Korman, Amy; Rutherford, Jeremiah S; Rosenberg, Ronald; Azad, Abdu F

    2003-05-01

    We have identified for the first time Rickettsia africae, and the ticks that harbored them, in Kenya. A total of 5,325 ticks were collected from vegetation, livestock, and wild animals during two field trips to southwestern Kenya. Most were immature forms (85.2%) belonging to the genera Amblyomma or Rhipicephalus. The adults also included representatives from the genus Boophilus. Ticks were assessed for rickettsial DNA by a polymerase chain reaction (PCR) using primers for the spotted fever group (SFG)-specific rickettsial outer membrane protein A (rompA) gene, and positive amplicons were sequenced. While none of the immature ticks tested positive by PCR, 15.8% of the adult Amblyomma variegatum and less than 1% of the Rhipicephalus spp. were SFG positive. Sequences of amplified products were identified as R. africae. These findings extend the known range of R. africae.

  13. Eupalopsellidae and Stigmaeidae (Acari: Prostigmata) within citrus orchards in Florida: species distribution, relative and seasonal abundance within trees, associated vines, and ground cover plants.

    Science.gov (United States)

    Childers, Carl C; Ueckermann, Eduard A

    2014-10-01

    Seven citrus orchards on reduced- to no-pesticide spray programs were sampled for predacious mites in the families Eupalopsellidae and Stigmaeidae (Acari: Prostigmata) in central and south central Florida. Inner and outer canopy leaves, fruit, twigs, and trunk scrapings were sampled monthly between August 1994 and January 1996. Open flowers were sampled in March from five of the sites. Two species of eupalopsellid mites (Exothorhis caudata Summers and Saniosulus harteni (van-Dis and Ueckermann)) were identified from 252 specimens collected within citrus tree canopies within the seven citrus orchards of which 249 were E. caudata. Only two E. caudata were collected from ground cover plants within five of the seven orchards. Eight species of Stigmaeidae were identified from 5,637 specimens: Agistemus floridanus Gonzalez, A. terminalis Gonzalez, Eustigmaeus arcuata (Chandhri), E. sp. near arcuata, E. segnis (Koch), Mediostigmaeus citri (Rakha and McCoy), Stigmaeus seminudus Wood, and Zetzellia languida Gonzalez were collected from within citrus tree canopies from seven orchard sites. Agistemus floridanus was the only species in either family that was abundant with 5,483 collected from within citrus tree canopies compared with only 39 from vine or ground cover plants. A total of 431 samples from one or more of 82 vines and ground cover plants were sampled monthly between September 1994 and January 1996 in five of these orchards and one or more eupalopsellids or stigmaeids were collected from 19 of these plants. Richardia brasiliensis (Meg.) Gomez had nine A. floridanus from 5 of 25 samples collected from this plant. Solanum sp. had five A. floridanus from three samples taken. Both eupalopsellid and stigmaeid species numbers represented orchards were on full herbicide programs and ground cover plants were absent. Agistemus floridanus was more abundant in the citrus orchards with on-going or recent herbicide programs compared with orchards having well-developed ground

  14. Phytoseiidae (Acari: Mesostigmata) within citrus orchards in Florida: species distribution, relative and seasonal abundance within trees, associated vines and ground cover plants.

    Science.gov (United States)

    Childers, Carl C; Denmark, Harold A

    2011-08-01

    Seven citrus orchards on reduced- to no-pesticide spray programs were sampled for predacious mites in the family Phytoseiidae (Acari: Mesostigmata) in central and south central Florida. Inner and outer canopy leaves, open flowers, fruit, twigs, and trunk scrapings were sampled monthly between September 1994 and January 1996. Vines and ground cover plants were sampled monthly between September 1994 and January 1996 in five of these orchards. The two remaining orchards were on full herbicide programs and ground cover plants were absent. Thirty-three species of phytoseiid mites were identified from 35,405 specimens collected within citrus tree canopies within the seven citrus orchards, and 8,779 specimens from vines and ground cover plants within five of the seven orchards. The six most abundant phytoseiid species found within citrus tree canopies were: Euseius mesembrinus (Dean) (20,948), Typhlodromalus peregrinus (Muma) (8,628), Iphiseiodes quadripilis (Banks) (2,632), Typhlodromips dentilis (De Leon) (592), Typhlodromina subtropica Muma and Denmark (519), and Galendromus helveolus (Chant) (315). The six most abundant species found on vines or ground cover plants were: T. peregrinus (6,608), E. mesembrinus (788), T. dentilis (451), I. quadripilis (203), T. subtropica (90), and Proprioseiopsis asetus (Chant) (48). The remaining phytoseiids included: Amblyseius aerialis (Muma), A. herbicolus (Chant), A. largoensis (Chant), A. multidentatus (Chant), A. sp. near multidentatus, A. obtusus (Koch), Chelaseius vicinus (Muma), Euseius hibisci Chant, Galendromus gratus (Chant), Metaseiulus mcgregori (Chant), Neoseiulus mumai (Denmark), N. vagus (Denmark), Phytoscutus sexpilis (Muma), Phytoseiulus macropilis (Banks), Proprioseiopsis detritus (Muma), P. dorsatus (Muma), P. macrosetae (Banks), P. rotundus (Muma), P. solens (De Leon), Typhlodromips deleoni (Muma), T. dillus (De Leon), T. dimidiatus (De Leon), T. mastus Denmark and Muma, T. simplicissimus (De Leon), and T. sp

  15. Essential oils of Cupressus funebris, Juniperus communis, and J. chinensis (Cupressaceae) as repellents against ticks (Acari: Ixodidae) and mosquitoes (Diptera: Culicidae) and as toxicants against mosquitoes.

    Science.gov (United States)

    Carroll, John F; Tabanca, Nurhayat; Kramer, Matthew; Elejalde, Natasha M; Wedge, David E; Bernier, Ulrich R; Coy, Monique; Becnel, James J; Demirci, Betul; Başer, Kemal Husnu Can; Zhang, Jian; Zhang, Sui

    2011-12-01

    Juniperus communis leaf oil, J. chinensis wood oil, and Cupressus funebris wood oil (Cupressaceae) from China were analyzed by gas chromatography and gas chromatography-mass spectrometry. We identified 104 compounds, representing 66.8-95.5% of the oils. The major components were: α-pinene (27.0%), α-terpinene (14.0%), and linalool (10.9%) for J. communis; cuparene (11.3%) and δ-cadinene (7.8%) for J. chinensis; and α-cedrene (16.9%), cedrol (7.6%), and β-cedrene (5.7%) for C. funebris. The essential oils of C. funebris, J. chinensis, and J. communis were evaluated for repellency against adult yellow fever mosquitoes, Aedes aegypti (L.), host-seeking nymphs of the lone star tick, Amblyomma americanum (L.), and the blacklegged tick, Ixodes scapularis Say, and for toxicity against Ae. aegypti larvae and adults, all in laboratory bioassays. All the oils were repellent to both species of ticks. The EC(95) values of C. funebris, J. communis, and J. chinensis against A. americanum were 0.426, 0.508, and 0.917 mg oil/cm(2) filter paper, respectively, compared to 0.683 mg deet/cm(2) filter paper. All I. scapularis nymphs were repelled by 0.103 mg oil/cm(2) filter paper of C. funebris oil. At 4 h after application, 0.827 mg oil/cm(2) filter paper, C. funebris and J. chinensis oils repelled ≥80% of A. americanum nymphs. The oils of C. funebris and J. chinensis did not prevent female Ae. aegypti from biting at the highest dosage tested (1.500 mg/cm(2) ). However, the oil of J. communis had a Minimum Effective Dosage (estimate of ED(99) ) for repellency of 0.029 ± 0.018 mg/cm(2) ; this oil was nearly as potent as deet. The oil of J. chinensis showed a mild ability to kill Ae. aegypti larvae, at 80 and 100% at 125 and 250 ppm, respectively.

  16. Primera aproximacion a la Paleoentomología de los yacimientos de la Sierra de Atapuerca (Burgos, España: la fauna subfósil de Oribátidos (Acari, Oribatida

    Directory of Open Access Journals (Sweden)

    Arroyo, J.

    2007-06-01

    Full Text Available The Atapuerca Quaternarian sites are of worldwide interest due to the presence of human remains belonging to the last million years. The oribatid mites (Acari, Oribatida found in several archaeological samples extracted from the Atapuerca Quaternarian deposits, have been analyzed during the 2003 excavation campaign to study the Palaeoentomology of the site. The oribatid mite fauna consists of 7 individuals, 6 of which were obtained from Gran Dolina site (about 300.000 years old and belong to families Cosmochthoniidae, Scheloribatidae, Oribatulidae and Hemileiidae. Most of the taxa were identified to species level. The results obtained were used as a basis to reconstruct the paleo-environments of the site in correspondence with the biological and ecological preferences of the taxa.

    Los yacimientos cuaternarios de la Sierra de Atapuerca ofrecen interés mundial por haber hospedado varias especies de homínidos que vivieron en el último millón de años. En este contexto, durante la campaña de excavaciones de 2003 se realizó un muestreo puntual en algunos de sus yacimientos para obtener los primeros datos de restos de artrópodos que pudieran conservarse en los mismos. En este trabajo se presentan los resultados obtenidos de ácaros subfósiles pertenecientes al suborden de los oribátidos (Acari, Oribatida. Después de procesar los sedimentos, se obtuvieron un total de 7 individuos en el conjunto de los yacimientos muestreados, de los cuales 6 aparecieron en Gran Dolina en un nivel con datación en torno a los 300.000 años. Los ejemplares, identificados en su mayoría a nivel taxonómico de especie, pertenecen a las familias Cosmochthoniidae, Scheloribatidae, Oribatulidae y Hemileiidae. Dado el conocimiento que se dispone de la biología de los taxones encontrados, que pertenecen a géneros y especies presentes en la actualidad, se han realizado inferencias sobre los ambientes pretéritos en que los animales vivieron.

  17. Influence de l'âge de la feuille sur les paramètres biologiques et les populations de l'acarien vert du manioc Mononychellus tanajoa Bondar (Acari: tetranychidae

    Directory of Open Access Journals (Sweden)

    Badegana, AM.

    2002-01-01

    Full Text Available The Effect of Leaf Age on the Cassava Green Mite Mononychellus tanajoa Bondar (Acari: Tetranychidae Biological Parameters and Population Growth Rates. The study of cassava (Manihot esculenta Crantz leaf age effect on Mononychellus tanajoa Bondar biological parameters and population growth rates was studied in laboratory (T= 24-26 °C; RH= 70-90%. The local Dschang cultivar was used and the study concerned the 15, 40, 65, 90 and 115 days old leaves. The results obtained show that the egg incubation duration was the longest (6.4 days and that of the deutonymph stage the shortest one (1.9 days. The hatching rate was very high (98%. There was no significant difference (p= 0.05 between the developmental stages of M. tanajoa reared on the leaves of different ages. On the contrary fecundity whatever it is daily or total was high on young leaves and small on the old ones. The correlation coefficient between the leaf age and the intrinsic rate of increase (rm was -0.896 and that obtained between the net reproduction rate (Ro and the leaf age -0.966. These coefficients are negative and in absolute value near to one; which shows that the more the leaf is old, the more the M. tanajoa population growth is little. The M. tanajoa population growth is therefore fast on young leaves and slow on the old ones.

  18. (4E)-dehydrocitrals [(2E,4E)- and (2Z,4E )-3,7-dimethyl-2,4,6-octatrienals] from acarid mite Histiogaster sp. A096 (Acari: Acaridae).

    Science.gov (United States)

    Hiraoka, H; Mori, N; Nishida, R; Kuwahara, Y

    2001-12-01

    A mixture of two monoterpenes was obtained as the opisthonotal gland secretion from unidentified Histiogaster sp. A096 (Acari: Acaridae), and their structures were elucidated to be (4E)-dehydrocitrals [(2E,4E)- and (2Z,4E)-3,7-dimethyl-2,4,6-octatrienals] by GC/MS, GC/FT-IR, UV and 1H-NMR spectra. Both isomers of (4E)-dehydrocitral prepared by syntheses in 4 steps from 3-methyl-2-butenal with 34.2% yields (based on the ylide) were separated by column chromatography into the (2E,4E)- and (2Z,4E)-3,7-dimethyl-2,4,6-octatrienal. Mass spectra together with GC retention times of the purified natural (4E)-dehydrocitrals were identical with those of synthetic (2E,4E)-3,7-dimethyl-2,4,6-octatrienal and (2Z,4E)-3,7-dimethyl-2,4,6-octatrienal. The geometry at the 2-C position of both synthetic (4E)-dehydrocitrals was confirmed by NOESY analyses. This is the first identification of (4E)-dehydrocitrals from the animal kingdom.

  19. Sequencing for complete rDNA sequences (18S, ITS1, 5.8S, ITS2, and 28S rDNA) of Demodex and phylogenetic analysis of Acari based on 18S and 28S rDNA.

    Science.gov (United States)

    Zhao, Ya-E; Wu, Li-Ping; Hu, Li; Xu, Yang; Wang, Zheng-Hang; Liu, Wen-Yan

    2012-11-01

    Due to the difficulty of DNA extraction for Demodex, few studies dealt with the identification and the phyletic evolution of Demodex at molecular level. In this study, we amplified, sequenced, and analyzed a complete (Demodex folliculorum) and an almost complete (D12 missing) (Demodex brevis) ribosomal DNA (rDNA) sequence and also analyzed the primary sequences of divergent domains in small-subunit ribosomal RNA (rRNA) of 51 species and in large-subunit rRNA of 43 species from four superfamilies in Acari (Cheyletoidea, Tetranychoidea, Analgoidea, and Ixodoidea). The results revealed that 18S rDNA sequence was relatively conserved in rDNA-coding regions and was not evolving as rapidly as 28S rDNA sequence. The evolutionary rates of transcribed spacer regions were much higher than those of the coding regions. The maximum parsimony trees of 18S and 28S rDNA appeared to be almost identical, consistent with their morphological classification. Based on the fact that the resolution capability of sequence length and the divergence of the 13 segments (D1-D6, D7a, D7b, and D8-D12) of 28S rDNA were stronger than that of the nine variable regions (V1-V9) of 18S rDNA, we were able to identify Demodex (Cheyletoidea) by the indels occurring in D2, D6, and D8.

  20. AKUMULASI TIMBAL (Pb DAN STRUKTUR STOMATA DAUN PURING (Codiaeum variegatum Lam. Blume

    Directory of Open Access Journals (Sweden)

    Susi Sulistiana

    2017-07-01

    Full Text Available Tanaman mempunyai kemampuan untuk mengatasi atau mengeliminir pencemaran udara yang terjadi di kota, salah satunya adalah tanaman puring. Stomata adalah salah satu organ tumbuhan yang digunakan untuk berinteraksi dengan lingkungannya. Fungsi utama stomata adalah sebagai tempat pertukaran gas, seperti CO2 yang diperlukan oleh tumbuhan dalam proses fotosintesis. Namun, stomata juga bertindak sebagai salah satu jalur masuknya polutan khususnya polutan yang berasal dari udara. Untuk mempertegas pengaruh akumulasi timbal terhadap daun tanaman puring  secara morfologi yang telah dilakukan oleh Sulistiana dan Setijorini  tahun 2014, perlu dilakukan penelitian lanjutan dengan melakukan pengamatan anatomi daun terutama struktur  stomata daun tanaman puring. Penelitian bertujuan membandingkan struktur stomata  antar kultivar puring dan membuktikan adanya hubungan antara akumulasi timbal (Pb dengan struktur stomata daun dari beberapa kultivar puring. Bahan penelitian yang digunakan adalah daun segar dari 13 kultivar tanaman puring yang ditanam di Perumahan Batan Indah, Kecamatan Kademangan, Tangerang Selatan. Pengamatan struktur stomata daun dilakukan dengan cara pembuatan preparat paradermal Parameter yang diamati dalam penelitian meliputi jumlah stomata, jumlah sel epidermis, panjang stomata, lebar stomata, indeks stomata, dan kerapatan stomata. Hasil yang diperoleh adanya korelasi positif antara kadar Pb dan struktur stomata daun kultivar puring melalui parameter-paramater yang diamati terutama jumlah stomata, lebar stomata, indeks stomata, dan kerapatan stomata.

  1. Host-Parasite Relationship of Ticks (Acari: Ixodidae and Argasidae) and Feral Pigs (Sus scrofa) in the Nhecolândia Region of the Pantanal Wetlands in Mato Grosso do Sul.

    Science.gov (United States)

    Cançado, P H D; Faccini, J L H; Herrera, H M; Tavares, L E R; Mourão, G M; Piranda, E M; Paes, R C S; Ribeiro, C C D U; Borghesan, T C; Piacenti, A K; Kinas, M A; Santos, C C; Ono, T M; Paiva, F

    2013-01-01

    Feral pigs (S. scrofa) were introduced to the Pantanal region around 200 years ago and the population appears to be in expansion. Its eradication is considered to be impossible. The population of feral pigs in the Pantanal wetlands is currently estimated at one million. Two scientific excursions were organized. The first was conducted during the dry season, when 21 feral pigs were captured and the second was during the wet season, when 23 feral pigs were captured. Ticks were collected and the oviposition and hatching process were studied to confirm the biological success of each tick species. Three tick species were found to be feeding on feral pigs: Amblyomma cajennense, A. parvum, and Ornithodoros rostratus. During the dry season, 178 adult A. cajennense were collected, contrasting with 127 A. cajennense specimens in the wet season. This suggests that the seasonality of these ticks in the Brazilian Pantanal wetlands could be different from other regions. The results indicate that A. parvum and A. cajennense are biologically successful parasites in relation to feral pigs. A. cajennense appears to have adapted to this tick-host relationship, as well as the areas where feral pigs are abundant, and could play a role in the amplification of this tick population.

  2. Chlorotic spots on Clerodendrum, a disease caused by a nuclear type of Brevipalpus (Acari:Tenuipalpidae transmitted virus Mancha clorótica do Clerodendrum, uma enfermidade causada por um vírus do tipo nuclear, transmitido pelo ácaro Brevipalpus phoenicis (Acari:Tenuipalpidae

    Directory of Open Access Journals (Sweden)

    Elliot Watanabe Kitajima

    2008-02-01

    Full Text Available Chlorotic spots have been observed in plants of Clerodendrum x speciosum growing in residential gardens and parks in Piracicaba, SP, Brazil. Thin sections of diseased tissues revealed characteristic cytopathic effects of the nuclear type of the Brevipalpus (Acari: Tenuipalpidae mite-transmitted viruses (BTrV. Brevipalpus mites, identified as B. phoenicis, infesting symptomatic C. x speciosum plants transmitted the pathogen to healthy C. x speciosum and to C. thomsonae, Gomphrena globosa, Hibiscus cannabinus, H. coccineus, H. schizopetalus, Salvia leucantha, Spathiphyllum wallasi and Tetragonia expansa causing chlorotic spots on their leaves. Mechanical inoculation using leaf extracts from infected C. x speciosum resulted in chlorotic spots on inoculated C. x speciosum, Chenopodium quinoa, C. amaranticolor, G. globosa, H. cannabinus, H. coccineus and T. expansa leaves. C. amaranticolor and C. quinoa kept at 28 - 30°C became systemically infected. The same cytopathic effects caused by the nuclear type of BTrV were seen in tissues from all infected test plants by electron microscopy. The virus was purified from systemically infected leaves of C. amaranticolor and C. quinoa. A polyclonal antiserum obtained from an immunized rabbit presented a strong reaction with the homologous antigen in ELISA tests. The results suggest that this chlorotic spot disease of C. x speciosum is caused by a new species of the nuclear type of BTrV, tentatively named Clerodendrum chlorotic spot virus (ClCSV.Manchas cloróticas e necróticas foram observadas em folhas de várias plantas de coração-sangrento (Clerodendrum x speciosum cultivadas em parques e jardins em Piracicaba, SP, associadas à infestação pelo ácaro tenuipalpídeo Brevipalpus phoenicis. Exames preliminares de secções de tecido das manchas cloróticas ao microscópio eletrônico revelaram a ocorrência de efeitos citopáticos característicos dos induzidos pelos vírus do tipo nuclear, transmitido

  3. Nouvelle technique d'élevage de l'acarien phyllophage Tetranychus urticae Koch (Acari : Tetranychidae et son application à l'étude de l'efficacité de quelques acaricides sur pomme de terre (Solarium tuberosum L.

    Directory of Open Access Journals (Sweden)

    Badegana, AM.

    2000-01-01

    Full Text Available A New Rearing Technique of Phytophagous Mite Tetranychus urticae Koch (Acari : Tetranychida and its Application in the Study of the Efficacy of some Acaricides on Potato [Solanum tuberosum L.. A 5 cm diameter leaf disc of potato or another host plant (or four on 2.5 cm diameter was used in a Petri dish of 9 cm diameter for the rearing technique. This leaf disc, pierced in its centre, slides along a rustproof pin and floats on a 1 mm thick lamina of demineralized fresh water. Water is a "strong barrier" which confines the tetranychid mites on the leaf disc, even if this one does not corne from a host plant (tetranychid mites deprived of food. This rearing technique was used as a bioassay to test the effectiveness of acaricides (pyrimiphos-methyl, bromopropylate, fenpropathrin, dienochlor on the developmental stages of Tetranychus urticae. The ovicidal activity against the eggs of one, three, seven days old (the eggs incubation duration being 8.1 ±0.15 days was also studied. The results obtained show that bromopropylate, fenpropathrin and dienochlor have an ovicidal activity against the eggs of the different ages, but dienochlor has the highest efficiency (90 % mortality. Pyrimiphos-methyl is only active against the seven-day old eggs and bromopropylate has a high efficiency only on the one-day old eggs. Concerning the other developmental stages such as chrysalis (protochrysalis, deu-tochrysalis, teleiochrysalis and mobile stages (larva, protonymph, deutonymph and adult female, pyrimiphos-methyl has de highest efficiency (90 % mortality ; dienochlor also, except mobile stages. Bromopropylate has no activity against the chrysalis and mobile stages and fenpropathrin has a remarkable repulsive effect.

  4. Evolution journalière du sex-ratio dans une population de Mononychellus tanajoa Bondar (Acari: Tetranychidae en laboratoire, paramètres de la dynamique des populations

    Directory of Open Access Journals (Sweden)

    Badegana, AM.

    2003-01-01

    Full Text Available Sex-ratio Daily Evolution in a Population of Mononychellus tanajoa Bondar (Acari: Tetranychidae in the Laboratory, Population Dynamics Parameters. The sex-ratio (100.males/females of offsprings laid by fertilized female parents of Mononychellus tanajoa Bondar and its daily evolution was studied in the laboratory. The highest sex-ratio value 900 (90.0% male offsprings was obtained on the first day of the oviposition and the lowest value 7.2 (6.7% male offsprings on the 16th day of the oviposition period which lasted 38.1 ± 4.9 days (mean ± standard deviation. From a total number of 118.0 ± 10.9 offsprings, 94.0 ± 10.5 (on the average 79.7% were ''laid'' during the first half of the oviposition period. The results also show that from a total number of 88.0 ± 8.3 female offsprings, 74.0 ± 8.0 (84.1% were ''laid'' during the first half of the oviposition period whereas from a total number of 30.0 ± 2.7 male offsprings, 20.0 ± 2.5 (66.7% were ''laid'' within the same period. The sex-ratio of each fertilized female parent was 31.9 ± 1.7 (24.2% ± 1.0% male offsprings and the sex-ratio within the population was 34.0 ± 0.0 (25.4% ± 0.1% male offsprings. The intrinsic rate of increase, and the rate of multiplication in one generation were 0.1380 and 79.23 respectively.

  5. Sensibilité à Mononychellus tanajoa Bondar (Acari : Tetranychidae de quelques cultivars de manioc (Manihot esculenta Crantz et incidence des attaques sur le rendement, dans la région des hauts plateaux de l'Ouest Cameroun

    Directory of Open Access Journals (Sweden)

    Badegana, AM.

    2001-01-01

    Full Text Available Sensibility to Mononychellus tanajoa Bondar (Acari : Tetranychidae of some Cassava (Manihot esculenta Crantz, Cultivars and Effect of Damage on Yield Loss in the Cameroonian Western High-lands. The study of the sensibility towards the green mite Mononychellus tanajoa Bondar of some cassava (Manihot esculenta Crantz cultivars and the assessment of the effect of damage on the yield losses was carried out in the Western highlands of Cameroon. Four cassava cultivars were used : two local (Dschang and Njombe and two improved varieties (IITA 8017 and IITA 82516. The results obtained showed that the density (mites number/cm2 of leaf area was low during the rainy season and high during the dry season, which means that rains reduce the mite population by washing or lead the mites to death. The highest mean density (3.40 mites/cm2 of leaf area was obtained on the local Njombe cultivar which is consequently the most sensitive. On the contrary, the local Dschang cultivar, with the lowest mite density (1.40 mites/cm2 of leaf area was the most resistant followed by the IITA 8017 cultivar (1.74 mites/cm2. The IITA82516 cultivar had a mean density of2.65 mites/cm2. Yield losses ranged from 36.90 % for IITA 8017 (1.74 mites/cm2 and damages level of 2.75 to 58.70 % for local Dschang (3.40 mites/cm2 and damages level of 3.84. Local Dschang cultivar (1.40 mites/cm2 and damage level of 2.96 and IITA 82516 (2.65 mites/cm2 and damage level of 2.96 had a yield losse of38.10 % and 41.80 %. The results showed that higher the mite density and damage level are, higher is the yield loss, unless the cultivar is tolerant.

  6. In vitro activity of 3β-O-tigloylmelianol from Guarea kunthiana A. Juss (Meliaceae) on oogenesis and ecdysis of the cattle tick Rhipicephalus (Boophilus) microplus (Canestrini) (Acari: Ixodidae).

    Science.gov (United States)

    Barbosa, Carolina da Silva; Borges, Lígia Miranda Ferreira; Louly, Carla Cristina Braz; Rocha, Thiago Lopes; de Sabóia-Morais, Simone Maria Teixeira; Miguita, Carlos Henrique; Garcez, Walmir Silva; Garcez, Fernanda Rodriguez

    2016-05-01

    We evaluated the effects of 3β-O-tigloylmelianol from Guarea kunthiana A. Juss (Meliaceae) on oogenesis, as a larvicide and on ecdysis of the larvae and the nymphs of the cattle tick Rhipicephalus (Boophilus) microplus (Canestrini) (Acari: Ixodidae). On the oogenesis' test, 48 engorged females were divided into three groups, evaluated at 24, 48 and 72 h post-treatment. Half of the females were treated with 0.01% 3β-O-tigloylmelianol diluted in distilled water and 5% dimethyl sulfoxide (DMSO), while the other half (controls) were exposed to distilled water and 5% DMSO. After treatment, the ovaries were weighed in order to measure the gonadosomatic index (GSI) and were also subjected to standard histological technical tests. On the larvicide and ecdysis' tests, 3β-O-tigloylmelianol was tested at concentrations of 0.01, 0.005, 0.0025 and 0.00125%. Compared with the controls, there was a reduction of GSI of approximately 50% on the treated group, which started at 48 h post treatment. Overall, the protolimonoid 3β-O-tigloylmelianol has caused a significant reduction in the number of oocytes. It has also caused alteration of the cytoplasmic and germinal vesicle diameters. Morphological changes, such as vacuolization, chorion irregularity which has modified the oocytes' morphology as well as alterations on the yolk's granules were also observed. The compound was not larvicide, however, interfered in the ecdysis of the larvae and the nymphs. This study shows that the protolimonoid 3β-O-tigloylmelianol from G. kunthiana acts on oogenesis and ecdysis of R. (B.) microplus, but not as larvicide, indicating that it acts on the endocrine system of the tick.

  7. Ticks parasitizing reptiles in the Bahamas.

    Science.gov (United States)

    Durden, L A; Knapp, C R

    2005-09-01

    Two species of reptile ticks, Amblyomma dissimile Koch and Amblyomma torrei Pérez Vigueras (Acari: Ixodidae), are reported from the Bahama Islands for the first time. The widespread neotropical (including the Caribbean and southern Florida) A. dissimile was recovered on Andros Island from three species of reptiles all for the first time: the Andros iguana Cyclura cychlura cychlura Cuvier, the Andros curly tail lizard Leiocephalus carinatus coryi Schmidt, and the Andros boa Epicrates striatus fowleri Sheplan and Schwartz. The iguana tick A. torrei, previously known only from Cuba, Puerto Rico and the Cayman Islands, was recovered in the Exuma Islands from the Exuma iguana Cyclura cychlura figginsi Barbour. Mean numbers of ticks per host were as high as 36.6 on Mangrove Cay, Andros Island, and 25.8 on Pasture Cay in the Exuma Islands.

  8. Tick cell lines for study of Crimean-Congo hemorrhagic fever virus and other arboviruses.

    Science.gov (United States)

    Bell-Sakyi, Lesley; Kohl, Alain; Bente, Dennis A; Fazakerley, John K

    2012-09-01

    Continuous cell lines derived from many of the vectors of tick-borne arboviruses of medical and veterinary importance are now available. Their role as tools in arbovirus research to date is reviewed and their potential application in studies of tick cell responses to virus infection is explored, by comparison with recent progress in understanding mosquito immunity to arbovirus infection. A preliminary study of propagation of the human pathogen Crimean-Congo hemorrhagic fever virus (CCHFV) in tick cell lines is reported; CCHFV replicated in seven cell lines derived from the ticks Hyalomma anatolicum (a known vector), Amblyomma variegatum, Rhipicephalus (Boophilus) decoloratus, Rhipicephalus (Boophilus) microplus, and Ixodes ricinus, but not in three cell lines derived from Rhipicephalus appendiculatus and Ornithodoros moubata. This indicates that tick cell lines can be used to study growth of CCHFV in arthropod cells and that there may be species-specific restriction in permissive CCHFV infection at the cellular level.

  9. Ticks and control methods.

    Science.gov (United States)

    Jongejan, F; Uilenberg, G

    1994-12-01

    Ticks are the most important ectoparasites of livestock in tropical and sub-tropical areas, and are responsible for severe economic losses both through the direct effects of blood sucking and indirectly as vectors of pathogens and toxins. Feeding by large numbers of ticks causes reduction in live weight gain and anaemia among domestic animals, while tick bites also reduce the quality of hides. However, the major losses caused by ticks are due to the ability to transmit protozoan, rickettsial and viral diseases of livestock, which are of great economic importance world-wide. The authors review general aspects of tick biology, the taxonomy, pathogenic effects and vector role of these species, and methods for the control of ticks. The distribution of ticks is continuously changing, as illustrated by the spread of the African tick Amblyomma variegatum in the Caribbean, where a large-scale eradication campaign is now under way.

  10. Identification of rickettsial pathogens in ixodid ticks in northern Senegal.

    Science.gov (United States)

    Sambou, Masse; Faye, Ngor; Bassène, Hubert; Diatta, Georges; Raoult, Didier; Mediannikov, Oleg

    2014-09-01

    The spotted fevers, caused by the Rickettsia bacteria, are a group of emerging diseases that are responsible for significant human morbidity. In Africa, the distribution of different species of Rickettsia in their tick vectors is poorly studied. We have collected 1169 hard ticks from 5 different species in the northern Senegal, close to the Saharan border. In a far northern collection site, corresponding to the Rickettsia africae distribution area, we collected three Amblyomma variegatum ticks infected by R. africae. Rickettsia africae was also identified in a Hyalomma marginatum rufipes tick, which may represent the secondary host for the pathogen. Rickettsia aeschlimannii was identified in H. m. rufipes, Rhipicephalus evertsi evertsi, and Hyalomma impeltatum ticks.

  11. Influence of the biotope on the tick infestation of cattle and on the tick-borne pathogen repertoire of cattle ticks in Ethiopia.

    Directory of Open Access Journals (Sweden)

    Sándor Hornok

    Full Text Available BACKGROUND: The majority of vector-borne infections occur in the tropics, including Africa, but molecular eco-epidemiological studies are seldom reported from these regions. In particular, most previously published data on ticks in Ethiopia focus on species distribution, and only a few molecular studies on the occurrence of tick-borne pathogens or on ecological factors influencing these. The present study was undertaken to evaluate, if ticks collected from cattle in different Ethiopian biotopes harbour (had access to different pathogens. METHODS: In South-Western Ethiopia 1032 hard ticks were removed from cattle grazing in three kinds of tick biotopes. DNA was individually extracted from one specimen of both sexes of each tick species per cattle. These samples were molecularly analysed for the presence of tick-borne pathogens. RESULTS: Amblyomma variegatum was significantly more abundant on mid highland, than on moist highland. Rhipicephalus decoloratus was absent from savannah lowland, where virtually only A. cohaerens was found. In the ticks Coxiella burnetii had the highest prevalence on savannah lowland. PCR positivity to Theileria spp. did not appear to depend on the biotope, but some genotypes were unique to certain tick species. Significantly more A. variegatum specimens were rickettsia-positive, than those of other tick species. The presence of rickettsiae (R. africae appeared to be associated with mid highland in case of A. variegatum and A. cohaerens. The low level of haemoplasma positivity seemed to be equally distributed among the tick species, but was restricted to one biotope type. CONCLUSIONS: The tick biotope, in which cattle are grazed, will influence not only the tick burden of these hosts, but also the spectrum of pathogens in their ticks. Thus, the presence of pathogens with alternative (non-tick-borne transmission routes, with transstadial or with transovarial transmission by ticks appeared to be associated with the biotope

  12. In Vitro effect of the ethanolic extract of Tephrosia Vogelii on Rhipicephalus Sanguineus in Abomey-Calavi

    Directory of Open Access Journals (Sweden)

    Dougnon Tossou Jacques

    2015-04-01

    Full Text Available Objectives: Ticks are vectors of several diseases, of which many are zoonosis transmissible to humans. The use of Tephrosia leafs’ extract as a low cost acaricide is spreading among farmers in central Kenya. Materials and Methods: The present study’s aim is to inventory endogenous control methods against dogs’ ticks among which Rhipicephalus sanguineus, in the Municipality of Abomey-Calavi. From September to October 2013, a survey was made on forty randomly selected breeders and ticks samples were collected on forty dogs. The web platform, www.epicollect.net, was used for the survey. In total, 77.5% (n=40 of examined dogs were infested with ticks Results: Three species of ticks were identified: Rhipicephalus sanguineus, Haemaphysalis leachi, and Amblyomma variegatum. They were found on 77.5%, 17.5%, and 15% of examined dogs, respectively. The numerical abundance of the three species was 87.06%, 11.9%, and 1.03%, respectively. The average number of ticks per animal was 16.83±5.04, 2.3±1.64, and 0.2±0.08 for Rhipicephalus sanguineus, Haemaphysalis leachi, and Amblyomma variegatum, respectively. Farmers used manual diptank (67.5%, plant ash (37.5%, petroleum (12.5%, motor oil (2.50 %, and sea water (7.5% to fight against ticks. Conclusions: The phytochemical screening of the leafy stem’s powder of Tephrosia vogelii revealed the presence of catechol tannins, saponins, sugars, leuco-anthocyanins, polyterpenes, and sterols. A 100% larval mortality was observed at the concentration of 20% the ethanolic extract of the leafy stem of Tephrosia vogelii. The LC50 of this ethanolic extract against Rhipicephalus sanguineus larvae was equal to 2.6%.

  13. A comparative study of the dynamics of Wolbachia infection in different populations of Tetranychus urticae (Acari : Tetranychidae)%共生菌Wolbachia在中国二斑叶螨种群中的扩散规律

    Institute of Scientific and Technical Information of China (English)

    谢蓉蓉; 陈小琳; 孙荆涛; 洪晓月

    2013-01-01

    共生菌Wolbachia在中国二斑叶螨Tetranychus urticae Koch中分布广泛,所有的地理种群中均感染Wolbachia.以二斑叶螨湖南长沙(HN),辽宁兴城(LN)和江苏徐州(JS)3个地理种群为实验材料,经筛选获得100%感染和不感染Wolbachia的品系后,人工设置Wolbachia感染率为50%的品系,通过PCR技术检测二斑叶螨连续世代Wolbachia感染率动态变化,研究Wolbachia在二斑叶螨种群中的扩散规律.结果表明:3个地理种群的垂直传播效率都为100%;HN种群Wolbachia感染率上升速度最快,F7代达到100%感染;LN种群F12达到100%感染;而JS地理种群中Wolbachia感染率速度上升最慢,在F20代达到100%感染,其后感染率均能稳定在100%.LN种群Wolbachia通过诱导胞质不亲和的策略,JS种群的Wolbachia通过提高寄主适合度的策略,而HN种群Wolbachia则通过诱导胞质不亲和与提高寄主适合度两者相结合的策略,最终达到在二斑叶螨中维持感染状态并扩散传播的目的.本研究结果为今后利用Wolbachia的扩散规律控制有害生物及疾病传播提供了基础.%Maternally inherited Wolbachia bacteria are widely distributed in Chinese populations of the two-spotted spider mite Tetranychus urticae Koch (Acari; Tetranychidae). All populations were found to be infected with Wolbachia. Using the Hunan ( HN) , Liaoning ( LN ) and Jiangsu ( JS) populations of T. urticae as experimental subjects, 100% Wolbachia-infected and 100% uninfected spider mite lines were obtained by screening. This study investigated the dynamics of Wolbachia spread in the two-spotted spider mite. Infection frequencies of Wolbachia among the progenies of the artificial populations, initiated with 50% infected and 50% uninfected female adults, were monitored by PCR. The results show 100% maternal transmission in all three populations. The rate of spread was fastest in the HN population in which the infection rate reached 100% by the F7

  14. Molecular Detection of Rickettsia amblyommii in Amblyomma americanum Parasitizing Humans

    Science.gov (United States)

    2010-01-01

    Maeda, K, Markowitz, N, Hawley, RC, Ristic, M, et al. Human infection with Ehrlichia canis , a leukocytic rickettsia. N Eng! J Med 1987; 316:853-856...lone star tick human pathogens Ehrlichia chaffenesis (human monocytic ehrlichiosis [HMEJ) and Ehrlichia ezoingii (E. ezoingii ehrlichiosis [EWE...Paddock, CD, et al. Ehrlichia ewingii, a newly recognized agent of human ehrlichiosis. N Engl J Med 1999; 341:148-155. Burgdorfer, W, Hayes, S

  15. Amblyomma cajennense is an intrastadial biological vector of theileria equi

    Science.gov (United States)

    Background: The apicomplexan hemoprotozoan parasite Theileria equi is one of the etiologic agents causing equine piroplasmosis (EP), a disease of horses and their relatives that are endemic throughout large parts of the world. Prior to 2009 the United States had been considered to be free of this pa...

  16. Tick-borne rickettsiae in Guinea and Liberia.

    Science.gov (United States)

    Mediannikov, Oleg; Diatta, Georges; Zolia, Yah; Balde, Mamadou Cellou; Kohar, Henry; Trape, Jean-François; Raoult, Didier

    2012-02-01

    While the high seroprevalence for the rickettsiae that cause spotted fevers and the multiple pathogenic rickettsiae is known, the data on the distribution of rickettsial diseases in Africa are often incomplete. We collected ticks from domestic or wild animals (generally a source of bushmeat) that were in contact with humans in 2 neighboring countries of tropical West Africa, Guinea and Liberia. In total, 382 ticks representing 6 species were collected in Liberia and 655 ticks representing 7 species were collected in Guinea. We found rickettsiae in 9 different species of ticks from both countries. Rickettsia africae was found in 93-100% of Amblyomma variegatum, in 14-93% of Rhipicephalus (B.) geigyi, Rh. (B.) annulatus, and Rh. (B.) decoloratus, and in several Hyalomma marginatum rufipes and Haemaphysalis paraleachi. A genetic variant of R. africae was found in Amblyomma compressum. R. massiliae was found in 10/61 (16%) of Rh. senegalensis ticks and in 2% of Haemaphysalis paraleachi ticks collected from dogs. We identified a new rickettsia in one of 44 (2%) Ixodes muniensis collected from a dog in Liberia. As this rickettsia is not yet isolated, we propose the provisional name "Candidatus Rickettsia liberiensis" (for the West African country where the host tick was collected).

  17. Wassermilben (Acari: Hydrovolziidae et Hydrachnellae) aus Algerien

    NARCIS (Netherlands)

    Bader, Carl

    1989-01-01

    In the material collected from wells, hyporheic waters, and springs in western Algeria seven species of watermites have been found. Three of these are new to science: Acherontacarus tuberculalus nov. spec., Neumania (s. str.) algeriensis nov. spec., and the representative of a new genus Neoacheronta

  18. Astigmatid mites (Acari: Sarcoptiformes) of forensic interest.

    Science.gov (United States)

    Oconnor, Barry M

    2009-10-01

    This paper reviews the occurrence of mites of the infraorder Astigmata in situations involving the legal system, particularly in the area of medicocriminal entomology. Species in the families Acaridae, Lardoglyphidae and Histiostomatidae are encountered in stored food products and in vertebrate carrion, including human remains. Some of these species are incidentals, whereas others are obligate necrophages. Phoretic associations between these mites and insects allows for rapid dispersal and colonization of such patchy resources.

  19. Wassermilben (Acari: Hydrovolziidae et Hydrachnellae) aus Algerien

    NARCIS (Netherlands)

    Bader, Carl

    1989-01-01

    In the material collected from wells, hyporheic waters, and springs in western Algeria seven species of watermites have been found. Three of these are new to science: Acherontacarus tuberculalus nov. spec., Neumania (s. str.) algeriensis nov. spec., and the representative of a new genus

  20. New data regarding distribution of cattle ticks in the south-western Indian Ocean islands.

    Science.gov (United States)

    Stachurski, Frédéric; Tortosa, Pablo; Rahajarison, Patrick; Jacquet, Stéphanie; Yssouf, Amina; Huber, Karine

    2013-09-09

    Recent studies have produced new insight into the origin and distribution of some cattle ticks in the south-western Indian Ocean islands. Rhipicephalus appendiculatus, introduced from Tanzania in 2002, is now well established on Grande Comore but has not yet reached the other islands of the archipelago (Mohéli, Anjouan and Mayotte). Only one of the two clades identified in Africa has settled so far. Amblyomma variegatum, which was not supposed to be able to persist in the Antananarivo region (1300 m) nor in other Malagasy regions of high altitude without regular introductions of ticks by infested cattle, is now endemic as a general rule up to 1600 m although other regions of lower altitude (1400 m) are still free of the tick. This species remains confined in a small area of the west coast on La Reunion Island. On the contrary, Hyalomma dromedarii could not settle on Madagascar where it was introduced in 2008 and Rhipicephalus evertsi evertsi is not yet present in Grande Comore despite regular introductions by infested cattle from Tanzania. A phylogeographic approach has been carried out at an intra-specific level for A. variegatum. This study has led to the identification of two main lineages, one covering all species distribution and one restricted to East Africa and the Indian Ocean area. These two lineages are in sympatry in Madagascar where a high genetic diversity has been described, whereas a lower genetic diversity is observed on other islands. These results seem to agree with the historical data concerning the introduction of the tick in the Indian Ocean area.

  1. The Gulf Coast tick: a review of the life history, ecology, distribution, and emergence as an arthropod of medical and veterinary importance.

    Science.gov (United States)

    Teel, P D; Ketchum, H R; Mock, D E; Wright, R E; Strey, O F

    2010-09-01

    The Gulf Coast tick, Amblyomma maculatum Koch (Acari: Ixodidae), is a unique univoltine ectoparasite of seven vertebrate host classes in the Western Hemisphere that is increasingly recognized as a pest of livestock and wildlife, a vector of pathogens to humans and canines, and a putative vector of Ehrlichia ruminantium, the causal agent of heartwater, a fatal foreign animal disease of ruminants resident in the Caribbean. This review assembles current and historical literature encompassing the biology, ecology, and zoogeography of this tick and provides new assessments of changes in cyclical population distribution, habitat associations, host utilization, seasonal phenology, and life history. These assessments are pertinent to the emergence of A. maculatum as a vector of veterinary and medical importance, and its pest management on livestock and other animals.

  2. Caracterização de um vírus baciliforme isolado de Solanum violaefolium transmitido pelos ácaros Brevipalpus phoenicis e Brevipalpus obovatus (Acari: Tenuipalpidae Characterization of a bacilliform virus isolated from Solanum violaefolium transmitted by the tenuipalpid mites Brevipalpus phoenicis and Brevipalpus obovatus

    Directory of Open Access Journals (Sweden)

    Paulo de Tarso Oliveira Ferreira

    2007-09-01

    Full Text Available Solano-violeta (Solanum violaefolium é uma planta ornamental rasteira usada para cobrir solos de áreas sombreadas. Um vírus que induz manchas anelares nas folhas desta planta, tentativamente designado Solanum violaefolium ringspot virus - SvRSV, transmitido pelo ácaro Brevipalpus phoenicis (Acari: Tenuipalpidae foi encontrado em Piracicaba, SP. Trata-se de um vírus baciliforme que se assemelha a outros vírus do tipo citoplasmático transmitidos por Brevipalpus sp. Este trabalho teve como objetivo relatar propriedades biológicas e estabelecer uma caracterização molecular parcial do SvRSV. O vírus pode ser transmitido mecanicamente a várias outras espécies botânicas, causando lesões localizadas. Entre as espécies avaliadas, Datura stramonium mostrou-se a melhor hospedeira experimental. Observou-se também a manifestação de sintomas nestas plantas após infestação das mesmas por B. obovatus previamente alimentado em lesões de SvRSV, confirmando esta outra espécie de ácaro como vetor do vírus. Suas propriedades físicas in vitro foram: temperatura de inativação 40-45 ºC; ponto final de diluição 10-3-10-4; longevidade in vitro 12 dias. Em secções ultrafinas, as partículas do SvRSV mostraram-se levemente mais delgadas e mais longas que as de outros vírus do mesmo grupo. A partir do dsRNA do SvRSV foi construída uma biblioteca de cDNA e foram identificadas duas possíveis regiões codificadoras das proteínas de movimento e replicase viral. Baseado nestas regiões foram desenhados "primers" para amplificação do RNA do SvRSV por RT-PCR. Sondas baseadas nas seqüências obtidas hibridizaram com ss- e dsRNA de D. stramonium infectadas pelo vírus. Ensaios preliminares de RT-PCR e hibridização não resultaram em reação com o vírus da leprose dos citros, tipo citoplasmático (CiLV-C.Solanum violaefolium is an ornamental plant, with prostrate, trailing growth habit and is cultivated in shaded areas. A virus that causes

  3. Pode Euseius alatus DeLeon (Acari: Phytoseiidae) predar Aceria guerreronis Keifer (Acari: Eriophyidae) em coqueiro?

    OpenAIRE

    MELO, José W da S; DOMINGOS, Cleiton A; GONDIM JR, Manoel G C; de Moraes, Gilberto J.

    2009-01-01

    Ácaros do gênero Euseius são geralmente considerados especialistas na alimentação de pólen. Euseius alatus DeLeon é uma das seis espécies de ácaros fitoseídeos mais comumente encontrados em plantas de coqueiro no Nordeste do Brasil, associado com Aceria guerreronis Keifer. Apesar de a morfologia de E. alatus não favorecer a exploração da área meristemática do fruto habitada por A. guerreronis, o predador pode ter algum papel no controle do eriofídeo durante o processo de dispersão. O objetivo...

  4. Predatory behaviors of Neoseiulus californicus and Galendromus helveolus (Acari: Phytoseiidae) attacking Oligonychus perseae (Acari: Tetranychidae).

    Science.gov (United States)

    Takano-Lee, M; Hoddle, Mark

    2002-01-01

    Predatory behaviors of Neosieulus californicus (McGregor) and Galendromus helveolus (Chant) attacking Oligonychus perseae Tuttle, Baker and Abbatiello on avocado leaves were videotaped and analyzed. Behaviors were recorded for "fresh" predators that were used perseae only after invading webbed nests. Conversely. fresh and cold stored N. californicus employed three different modes of predatory attack: (1) intercepting and attacking migrant O. perseae outside of web nests: (2) attacking prey through nest webbing; or (3) invading and attacking O. perseae inside nests. Predatory efficacy of both N. californicus and G. helveolus was reduced following cold storage. as both species engaged in certain predatory behaviors less frequently in comparison to predators that were not stored at low temperatures. Our observed results for N. californicus and G. helveolus attacking O. perseae are interpreted in relation to the chaetotaxy hypothesis, which proposes that phytoseiid invasion efficiency and propensity of webbed nests is facilitated by dorsal setal lengths.

  5. Gastrointestinal parasites and ectoparasites of Bradypus variegatus and Choloepus hoffmanni sloths in captivity from Costa Rica.

    Science.gov (United States)

    Sibaja-Morales, Karen D; de Oliveira, Jaqueline B; Jiménez Rocha, Ana E; Hernández Gamboa, Jorge; Prendas Gamboa, Jorge; Arroyo Murillo, Francisco; Sandí, Janet; Nuñez, Yessenia; Baldi, Mario

    2009-03-01

    Sloths may serve as host to a wide range of parasites. However, there is little information available on the types of parasites that affect Costa Rica's sloth population. During a 1-yr period, 65 specimens of Costa Rican sloth species (Choloepus hoffmanni; n = 56) and Bradypus variegates; n = 9) from a local zoo were sampled. Fecal samples were evaluated using two different diagnostic techniques, Sheather's flotation and sedimentation. Concurrently, these sloths were examined for ectoparasites. Gastrointestinal parasites were found in 14 sloths (21.5%), from which 13 animals were C. hoffmanni and one was B. variegatus. Gastrointestinal parasites were recognized as Coccidia 71.4% (10/14), Cestoda 21.4% (3/14), and Spiruroidea 7.1% (1/14). Coccidia and cestodes were seen in C. hoffmanni, and spirurids were identified in B. variegatus. Among 27 sloths examined, only six had dermal problems (five C. hoffmanni and two B. variegatus). Ectoparasites recovered were Sarcoptes scabiei (Acari, Sarcoptidae) mites and Amblyomma varium (Acari, Ixodidae) ticks. This is the first time that cestode strobilae and nematode eggs are reported in sloth feces and that Monezia benedeni and L. leptocephalus were found in captive sloths.

  6. Transcription analysis of the major antigenic protein 1 multigene family of three in vitro-cultured Ehrlichia ruminantium isolates.

    Science.gov (United States)

    Bekker, Cornelis P J; Postigo, Milagros; Taoufik, Amar; Bell-Sakyi, Lesley; Ferraz, Conchita; Martinez, Dominique; Jongejan, Frans

    2005-07-01

    Ehrlichia ruminantium, an obligate intracellular bacterium transmitted by ticks of the genus Amblyomma, causes heartwater disease in ruminants. The gene coding for the major antigenic protein MAP1 is part of a multigene family consisting of a cluster containing 16 paralogs. In the search for differentially regulated genes between E. ruminantium grown in endothelial and tick cell lines that could be used in vaccine development and to determine if differences in the map1 gene cluster exist between different isolates of E. ruminantium, we analyzed the map1 gene cluster of the Senegal and Gardel isolates of E. ruminantium. Both isolates contained the same number of genes, and the same organization as found in the genome sequence of the Welgevonden isolate (H. Van Heerden, N. E. Collins, K. A. Brayton, C. Rademeyer, and B. A. Allsopp, Gene 330:159-168, 2004). However, comparison of two subpopulations of the Gardel isolate maintained in different laboratories demonstrated that recombination between map1-3 and map1-2 had occurred in one subpopulation with deletion of one entire gene. Reverse transcription-PCR on E. ruminantium derived mRNA from infected cells using gene-specific primers revealed that all 16 map1 paralogs were transcribed in endothelial cells. In one vector (Amblyomma variegatum) and several nonvector tick cell lines infected with E. ruminantium, transcripts were found for between 4 and 11 paralogs. In all these cases the transcript for the map1-1 gene was detected and was predominant. Our results indicate that the map1 gene cluster is relatively conserved but can be subject to recombination, and differences in the transcription of map1 multigenes in host and vector cell environments exist.

  7. Identification of novel Coxiella burnetii genotypes from Ethiopian ticks.

    Directory of Open Access Journals (Sweden)

    Kinga M Sulyok

    Full Text Available BACKGROUND: Coxiella burnetii, the etiologic agent of Q fever, is a highly infectious zoonotic bacterium. Genetic information about the strains of this worldwide distributed agent circulating on the African continent is limited. The aim of the present study was the genetic characterization of C. burnetii DNA samples detected in ticks collected from Ethiopian cattle and their comparison with other genotypes found previously in other parts of the world. METHODOLOGY/PRINCIPAL FINDINGS: A total of 296 tick samples were screened by real-time PCR targeting the IS1111 region of C. burnetii genome and from the 32 positive samples, 8 cases with sufficient C. burnetii DNA load (Amblyomma cohaerens, n = 6; A. variegatum, n = 2 were characterized by multispacer sequence typing (MST and multiple-locus variable-number tandem repeat analysis (MLVA. One novel sequence type (ST, the proposed ST52, was identified by MST. The MLVA-6 discriminated the proposed ST52 into two newly identified MLVA genotypes: type 24 or AH was detected in both Amblyomma species while type 26 or AI was found only in A. cohaerens. CONCLUSIONS/SIGNIFICANCE: Both the MST and MLVA genotypes of the present work are closely related to previously described genotypes found primarily in cattle samples from different parts of the globe. This finding is congruent with the source hosts of the analyzed Ethiopian ticks, as these were also collected from cattle. The present study provides genotype information of C. burnetii from this seldom studied East-African region as well as further evidence for the presumed host-specific adaptation of this agent.

  8. Seleções para resistência e suscetibilidade, detecção e monitoramento da resistência de Tetranychus urticae ao acaricida clorfenapir Selections for resistance and susceptibility, detection and monitoring of resistance to the acaricide chlorfenapyr in Tetranychus urticae koch (Acari: Tetranychidae

    Directory of Open Access Journals (Sweden)

    Mário Eidi Sato

    2007-01-01

    Full Text Available Problemas com resistência de ácaro-rajado, Tetranychus urticae Koch (Acari: Tetranychidae, a acaricidas têm sido registrados em diversos países, inclusive no Brasil. O estudo teve como objetivo caracterizar a resistência de T. urticae ao acaricida clorfenapir e avaliar a freqüência de resistência a esse composto em áreas comerciais de seis culturas no Estado de São Paulo. Seleções para resistência e suscetibilidade a clorfenapir foram realizadas em laboratório, utilizando-se uma população de T. urticae coletada em 2002 de um cultivo comercial de crisântemo em Holambra (SP. Após seis seleções para resistência e cinco seleções para suscetibilidade, foram obtidas as linhagens suscetível (S e resistente (R de T. urticae a clorfenapir. A razão de resistência (CL50 R/ CL50 S obtida alcançou valores de 571 vezes. Estabeleceu-se uma concentração discriminatória de 37,4 mg L-1 de ingrediente ativo (i.a. para o monitoramento da resistência de T. urticae a clorfenapir. O monitoramento foi realizado coletando-se 21 populações de ácaros em áreas comerciais de diferentes culturas (mamão, morango, feijão, tomate, crisântemo, rosa, em vários municípios do Estado de São Paulo. Arenas confeccionadas com folha de feijão foram infestadas com ácaros T. urticae e pulverizadas com clorfenapir, na sua concentração discriminatória, em torre de Potter. Os resultados indicaram grande variabilidade entre as populações com relação à suscetibilidade a clorfenapir. Foram observadas populações com freqüências de resistência entre 0,0 e 65,4%. As maiores freqüências de resistência foram observadas para populações coletadas de crisântemo em Holambra (SP.Problems associated with acaricide resistance in Tetranychus urticae Koch have been recorded in several countries including Brazil. The objective of this study was to characterize the resistance of T. urticae to the acaricide chlorfenapyr and to evaluate the resistance

  9. 二斑叶螨两种群中Wolbachia诱导的胞质不亲和作用的影响因子比较研究%A comparative study of factors influencing the expression of Wolbachiainduced cytoplasmic incompatibility in two populations of the two-spotted spider mite, Tetranychus urticae Koch ( Acari: Tetranychidae)

    Institute of Scientific and Technical Information of China (English)

    陆明红; 谢蓉蓉; 赵臻君; 于明志; 薛晓峰; 洪晓月

    2011-01-01

    The cytoplasmic incompatibility (CI) is the most common effect of Wolbachia on the reproduction of its arthropod hosts, and the expression of CI differs greatly among different populations. Using the Jiangsu (JS) and Liaoning (LN) populations of the two-spotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae) , as experimental materials, 100% infected and uninfected Wolbachia lines were obtained by screening. The present study tried to evaluate some factors influencing the expression of CI in the spider mite by crossing experiment and Real-time quantitative PCR. These factors include age of host, temperature, host genes and Wolbachia density. The 1, 3, 5, 7-day-old virgin males were used to investigate the influence of host age on Wolbachia-induced CI. The results showed no effect of age on CI, suggesting that host age does not reduce the sperm modification induced by Wolbachia. The effect of temperatures (20℃, 25℃ and 30℃ ) on the CI induced by Wolbachia was also checked. Neither high nor low temperatures influenced the expression of CI. Wolbachia density in males of the JS population, as measured by quantitative PCR using the wsp (surface protein of Wolbachia) gene, was significantly higher than that in the LN population. In addition, in both the JS and LN populations, Wolbachia density increased with the age of male hosts. Wolbachia density also showed no effect on CI. We estimated the variability of CI expression between the JS and LN population of T. Urticae was due to the interaction between Wolbachia and host genotypes. The results might provide foundation for understanding the mechanisms of reproductive manipulation induced by Wolbachia.%Wolbachia诱导胞质不亲和(cytoplasmic incompatibility,CI)是对寄主的生殖调控中最常见的一种方式,在不同种群中CI表达的差异较大.以二斑叶螨Tetranychus urticae辽宁兴城(LN)和江苏徐州(JS)两个地理种群为实验材料,经筛选获得100%感染Wolbachia和不感

  10. Amblyomma imitator: a novel vector for Rickettsia rickettsii in Mexico and South Texas

    OpenAIRE

    Oliveira, Karla Andrade de

    2010-01-01

    Rickettsioses, diseases of worldwide importance, are caused by small, gramnegative, obligately intracellular bacteria that are transmitted to humans via ticks, fleas, mites or lice. The genus Rickettsia has been classically divided into two groups, the typhus group (TG) and the spotted fever group (SFG). In the United States and Mexico, transmission of Rocky Mountain spotted fever (RMSF) has been attributed to ticks of the genera Dermacentor (D. variabilis and D. andersoni), Rhipicephalus (R...

  11. Mating success of two geographically distinct populations of Gulf Coast ticks, Amblyomma maculatum Koch.

    Science.gov (United States)

    Ketchum, H R; Teel, P D; Strey, O F; Longnecker, M T

    2006-08-31

    Gulf Coast ticks collected from Refugio Co., TX and Osage Co., KS are reproductively compatible despite differences in genetic haplotypes, geographic separation and seasonal phenologies. Two heifers per mating combination (TX males x TX females, KS males x KS females, TX males x KS females, KS males x TX females) were each infested with 360 pairs of Gulf Coast ticks. Only mean pre-oviposition and mean egg conversion efficiency index for the Texas male-Kansas female mating were significantly different (p<0.05) from other mating treatments. These females began oviposition 1-day later and used 4% less body mass toward egg production when compared to site-specific matings. However, the overall trend in reproductive performance of reciprocal tick matings was slightly lower than that of site-specific matings. There appear to be no pre-zygotic barriers to mating among Gulf Coast ticks from these Texas and Kansas populations.

  12. Evaluation of Animal and Plant Pathogens as Terrorism and Warfare Agents, Vectors and Pests

    Science.gov (United States)

    2001-09-01

    Acari Arachnida Hyalomma Anatolicumn Anatolicumn Dermacentor andersoni Acari Arachnida Dermacentor varabilis Amblyimma Cajennese Rhipicephalus sanguineus...Mansonia spp. Diptera Insecta Culex spp. Culiseta spp. Pediculus humanus Anopluraa Insect Ixodides Dermacentor spp. Acari Arachnida Rhipicephalus spp

  13. Three eriophyoid mite species (Acari: Eriophyoidea: Eriophyidae) from Iran.

    Science.gov (United States)

    Xue, Xiao-Feng; Sadeghi, Hussein; Honarmand, Arash

    2016-01-01

    Three mite species of the family Eriophyidae from Iran are described and illustrated. They are: Tegolophus marrubiumer sp. nov. on Marrubium vulgare L. (Lamiaceae); Phyllocoptes sp. cf. balasi Farkas, 1962 on Sanguisorba minor Scop. subsp. minor (Rosaceae) and Aceria fasciculifolis sp. nov. on Astragalus fasciculifolius Boiss. (Fabaceae). Both new species described herein are vagrants on their respective host plants.

  14. Nieuwe vondsten van watermijten in Nederland (Acari: Hydrachnidia)

    NARCIS (Netherlands)

    Smit, H.; Hoek, van den T.H.; Wiggers, R.

    2006-01-01

    Sinds de publicatie van de atlas van de Nederlandse watermijten in 2000 is de interesse voor watermijten sterk toegenomen. Er worden regelmatig nieuwe en zeldzame soorten gevonden en de kennis over biotoopvoorkeuren en trends wordt steeds verder uitgebreid. In dit artikel worden enkele bijzondere ni

  15. Checklist of the Oribatid Mites of the Netherlands (Acari: Oribatida)

    NARCIS (Netherlands)

    Siepel, H.; Zaitsev, A.; Berg, M.

    2009-01-01

    More than fifty years ago Van der Hammen published the last checklist of oribatid mites (or moss mites) for the Netherlands. Since then the species number has almost doubled to 318 species, of which 100 are presented here for the first time. Brief data on occurence and nomenclature are provided for

  16. Some mossmites new for the Netherlands (Acari: Oribatida)

    NARCIS (Netherlands)

    Siepel, H.; Dimmers, W.J.

    2010-01-01

    Bestudering van materiaal uit enkele Alterra projecten leverde negen soorten mosmijten op die nog niet waren opgenomen in de recent gepubliceerde Nederlandse naamlijst. Het totaal aantal soorten voor Nederland komt hiermee op 327.

  17. Listado de oribátidos (Acari, Oribatida de Túnez

    Directory of Open Access Journals (Sweden)

    Subías, L. S.

    2015-12-01

    Full Text Available The oribatid mites of several Tunisian soil samples were studied. 113 species were obtained, 95 of which are recorded for the first time from Tunisia. A systematic check-list with the 136 species known up to now is included, and their geographical distribution is given. Most of them, 77 (56%, have a typical Mediterranean distribution and 16 are recorded for the first time from North Africa.Se han estudiado los ácaros oribátidos de una serie de muestras de suelo de Túnez y se han identificado 113 especies, 95 de las cuales se citan por primera vez en Túnez. Se ha elaborado un listado sistemático en el que se incluyen las 136 especies conocidas hasta el momento y su distribución geográfica. La mayoría, 77 (56 %, presentan características típicamente mediterráneas, y 16 se citan por primera vez en el norte de África.

  18. Oribatid mites from the Vohimana Reserve, Madagascar (Acari: Oribatida, II

    Directory of Open Access Journals (Sweden)

    Mahunka, S.

    2009-11-01

    Full Text Available Further studies on the oribatid species collected from the Vohimana Reserve (Madagascar are presented. Altogether 13 species are listed, of them two represent new genera (Rugocepheus gen. nov. and Madabelba gen. nov., furthermore seven species are new to science. The other six species were earlier mentioned from different regions of the island, they are however little known.

  19. Hypopi (Acari: Hypoderatidae) of the wood stork (Aves: Ciconiiformes: Ciconiidae)

    Science.gov (United States)

    Pence, Danny B.; Thomas, N.J.

    1995-01-01

    A new species is described and additional host records are presented for 2 other species of deutonymphs of the family Hypoderatidae from the subcutaneous adipose tissues of the wood stork, Mycteria americana L. Phalacrodectes (Phalacrodectes) mycteria n. sp. appears to share affinities with species from both pelicaniform and ciconiiform hosts, but it most closely resembles P. (P.) punctatissimus (Černý) Pence & Courtney from pelicans in idiosomal chaetotaxy, cutdcular sclerotization, and posteriorly divergent, widely separated genital openings. The new species differs from this and other species of the genus by its small size, the degree of separation of the genital openings with papillae, no secondary sclerotization in the perigenital area or surrounding the genital openings, and the long filiform setae s and w on genu III. There was a mixed infection of Neottialges kutzeri Fain and N. mycteriae Pence in all of 7 wood storks examined from Florida and Georgia; P. (P) mycteria was found in 4 of these hosts. This is the 7th species described as a deutonymph in the genus Phalacrodectes. The apparent close affinity of P. (P.) mycteria with P. (P.) punctatissimus and allied species from pelicaniform versus ciconiiform birds appears to be inconsistent with the established host-parasite relationships based on classical avian taxonomic relationships. However, this apparent affinity may be more reflective of the close relationships between the families of pelicans, ibises and spoonbills, and storks as recently proposed by DNA-DNA hybridization studies.

  20. Vectorial role of some dermanyssoid mites (Acari, Mesostigmata, Dermanyssoidea

    Directory of Open Access Journals (Sweden)

    Valiente Moro C.

    2005-06-01

    Full Text Available Among transmissible diseases, vectorial diseases represent a major problem for public health. In the group of acarina, while ticks are the most commonly implicated vectors, other arthropods and notably Dermanyssoidea are also involved in the transmission of pathogenic agents. Since the role of this superfamily is at present largely unknown, we have reviewed the vectorial role of these mites in the appearance, survival and propagation of pathogens. Various authors have shown that Dermanyssoidea are implicated in the transmission of both bacteria (Salmonella, Spirocheta, Rickettsia or Pasteurella and viruses (equine encephalitis viruses, West Nile virus, Fowl pox virus, the virus causing Newcastle disease and tick borne encephalitis viruses or hantaviruses. Finally, some authors have also shown their role in the transmission of some protozoa and filaria. As the vectorial character of such mites has been more clearly demonstrated (Dermanyssus gallinae, Ornithonyssus bacoti and Allodermanyssus sanguineus, it would be interesting to continue studies to better understand the role of this superfamily in the epidemiology of certain zoonoses.

  1. Development of Dermanyssus gallinae (Acari: Dermanyssidae) at different temperatures.

    Science.gov (United States)

    Tucci, E C; Prado, A P; Araújo, R P

    2008-08-01

    The development, viability, and life cycle parameters of Dermanyssus gallinae at five different temperatures (15, 20, 25, 30 and 35 degrees C), and at relative humidity 70-85% were evaluated. Life cycle duration was 690.75 h (28 days) at 15 degrees C, 263.12h (11 days) at 20 degrees C, 164.63 h (7 days) at 25 degrees C, 140.69 h (6 days) at 30 degrees C and 172.04 h (7 days) at 35 degrees C. The optimal development temperature for D. gallinae was 30 degrees C, with the greatest survival in all stages and the shortest development time. High mortality at 35 degrees C indicated that this temperature had adverse effects on development of D. gallinae, and that in field conditions D. gallinae populations may decrease or even disappear due to the negative impact of high temperature on development. There were no significant differences in the pre-oviposition period among the four temperatures 20-35 degrees C, indicating that temperature did not affect this part of the life cycle.

  2. Thermal requirements of Dermanyssus gallinae (De Geer, 1778 (Acari: Dermanyssidae

    Directory of Open Access Journals (Sweden)

    Edna Clara Tucci

    2008-06-01

    Full Text Available The thermal requirements for development of Dermanyssus gallinae were studied under laboratory conditions at 15, 20, 25, 30 and 35°C, a 12h photoperiod and 60-85% RH. The thermal requirements for D. gallinae were as follows. Preoviposition: base temperature 3.4ºC, thermal constant (k 562.85 degree-hours, determination coefficient (R² 0.59, regression equation: Y= -0.006035 + 0.001777 x. Egg: base temperature 10.60ºC, thermal constant (k 689.65 degree-hours, determination coefficient (R² 0.94, regression equation: Y= -0.015367 + 0.001450 x. Larva: base temperature 9.82ºC, thermal constant (k 464.91 degree-hours, determination coefficient R² 0.87, regression equation: Y= -0.021123+0.002151 x. Protonymph: base temperature 10.17ºC, thermal constant (k 504.49 degree-hours, determination coefficient (R² 0.90, regression equation: Y= -0.020152 + 0.001982 x. Deutonymph: base temperature 11.80ºC, thermal constant (k 501.11 degree-hours, determination coefficient (R² 0.99, regression equation: Y= -0.023555 + 0.001996 x. The results obtained showed that 15 to 42 generations of Dermanyssus gallinae may occur during the year in the State of São Paulo, as estimated based on isotherm charts. Dermanyssus gallinae may develop continually in the State of São Paulo, with a population decrease in the winter. There were differences between the developmental stages of D. gallinae in relation to thermal requirements.Experimentos de laboratório foram realizados visando estimar as exigências térmicas de Dermanyssus gallinae. Para isso, o desenvolvimento do ácaro foi estudado em condições de laboratório usando-se câmaras climatizadas reguladas a 15, 20, 25, 30 e 35°C, fotofase de 12h e UR de 6085%. As exigências térmicas determinadas para D. gallinae foram: Pré-oviposição: temperatura base de 3,4 ºC, constante térmica (k igual a 562,85 graus-hora, coeficiente de determinação (R² igual a 0,59, equação de regressão: Y= -0,006035 + 0,001777 x. Ovo. Temperatura base de 10,60 ºC, constante térmica (k igual a 689,65 graus-hora, coeficiente de determinação (R² igual a 0,94, equação de regressão: Y= -0,015367 + 0,001450 x. Larva. Temperatura base 9,82 ºC, constante térmica (k igual a 464,91 graus-hora, R² igual a 0,87, equação de regressão: Y= -0,021123+0,002151x. Protoninfa. Temperatura de 10,17 ºC, constante térmica (k igual a 504,49 graus-hora, coeficiente de determinação (R² igual a 0,90, equação de regressão: Y= -0,020152 + 0,001982 x. Deutoninfa. Temperatura de 11,80 ºC, constante (k térmica igual a 501,11 graus-hora, coeficiente de determinação (R² igual a 0,99, equação de regressão: Y= -0,023555 + 0,001996 x. Os resultados obtidos permitem concluir que no Estado de São Paulo podem ocorrem de 15 a 42 gerações/ano de D. gallinae, em estimativa baseada em isotermas. Dermanyssus gallinae pode se desenvolver continuamente no Estado de São Paulo, com diminuição da população no inverno. Existem diferenças entre os estágios de desenvolvimento de D. gallinae com relação às exigências térmicas.

  3. Thermal requirements of Dermanyssus gallinae (De Geer, 1778) (Acari: Dermanyssidae).

    Science.gov (United States)

    Tucci, Edna Clara; do Prado, Angelo P; de Araújo, Raquel Pires

    2008-01-01

    The thermal requirements for development of Dermanyssus gallinae were studied under laboratory conditions at 15, 20, 25, 30 and 35 degrees C, a 12h photoperiod and 60-85% RH. The thermal requirements for D. gallinae were as follows. Preoviposition: base temperature 3.4 degrees C, thermal constant (k) 562.85 degree-hours, determination coefficient (R(2)) 0.59, regression equation: Y= -0.006035 + 0.001777x. Egg: base temperature 10.60 degrees C, thermal constant (k) 689.65 degree-hours, determination coefficient (R(2)) 0.94, regression equation: Y= -0.015367 + 0.001450x. Larva: base temperature 9.82 degrees C, thermal constant (k) 464.91 degree-hours, determination coefficient (R(2)) 0.87, regression equation: Y= -0.021123 + 0.002151x. Protonymph: base temperature 10.17 degrees C, thermal constant (k) 504.49 degree-hours, determination coefficient (R(2)) 0.90, regression equation: Y= -0.020152 + 0.001982x. Deutonymph: base temperature 11.80 degrees C, thermal constant (k) 501.11 degree-hours, determination coefficient (R(2)) 0.99, regression equation: Y= -0.023555 + 0.001996x. The results obtained showed that 15 to 42 generations of Dermanyssus gallinae may occur during the year in the State of São Paulo, as estimated based on isotherm charts. Dermanyssus gallinae may develop continually in the State of São Paulo, with a population decrease in the winter. There were differences between the developmental stages of D. gallinae in relation to thermal requirements.

  4. A revision of the Pheroliodidae, fam. n. (Acari: Oribatei

    Directory of Open Access Journals (Sweden)

    Adilson D. Paschoal

    1986-01-01

    Full Text Available The new family Pheroliodidae, herei nproposed, includes the following genera and species Pheroliodes Grandjean (in whose synonymy Pedrocortesia Hammer is placed, with the species: casa-branquensis, sp. n. (Brazil, São Paulo, Casa Branca, pellitus, sp. n. (Brazil, São Paulo, Piracicaba, nemoricultricis, sp. n. (Brazil, São Paulo, Piracicaba, wehnekei (Willmann (Guatemala, Venezuela, roblensis Covarrubias (Chile, mirabilis (Hammer, n. comb. (Argentina: Pedrocortesia elegans Hammer, P. intermedia Hammer, both from Peru, P. fissurata Balogh & Mahunka and P. inaequalis Balogh & Mahunka, both from Mongolia, P. franzi Balogh (Chad, P. africana Balogh (Kenya, P. vermicularis Balogh (New Guinea and P. sculptrata Aoki (Corea are considered incertae sedis; Lopholiodes, gen. n., includes the species micropunctinatum, sp. n., the type-species (Brazil, São Paulo, Anhumas and macropunctinatum, sp. n. (Brazil, São Paulo, Piracicaba: Octoliodes, gen n., includes the species leuteomarginatus (Hammer, n. comb., the type-species (New ealand and rotoruensis (Hammer, n. comb. (New Zealand: and Licnoliodes Grandjean, with the species: andrei Grandjean, type-species (Spain and Algeria, adminensis Grandjean, type-species (Spain and Algeria, adminensis Grandjean (Maroc, Algeria, Spain and apunctatus Mahunka (Greece.A nova família aqui descrita, Pheroliodidae, inclui os seguintes gêneros e espécies: Pheroliodes Grandjean (em cuja sinonímia vai incluído Pedrocortesia Hammer, com as seguintes espécies: casa-branquensis, sp. n. (Brasil, São Paulo, Casa Branca, pellitus, sp. n. (Brasil, São Paulo, Piracicaba, nemoricultricis, sp. n. (Brasil, São Paulo, Piracicaba, wehnekei (Willmann (Guatemala, Venezuela, roblensis Covarrubias (Chile, mirabilis (Hammer, n. comb. (Argentina: Pedrocortesia elegans Hammer, P. intermedia Hammer, ambas do Peru, P. fissurata Balogh & Mahunka (Mongólia, inaequalis Balogh & Mahunka (Mongólia, franzi Balogh (Chad, P. africana Balogh (Quênia, P. vermicularis Balogh (Nova Guiné e P. sculptrata Aoki (Coréia são consideradas incertae sedis: Lopholiodes, gen. n., inclui as espécies mícropunctatum, sp. n., espécie-tipo (Brasil, São Paulo, Anhumas e macropunctinatum. sp. n. (Brasil, São Paulo, Piracicaba: Octoliodes, gen. n., inclui as espécies luteomarginatus (Hammer, n. comb., a espécie-tipo (Nova elân da e rotoruensis (Hammer, n. comb. (Nova Zelândia: e Licnoliodes Grandjean, com as espécies: andrei Grandjean, espécie-tipo (Espanha e Argélia, adminensis Grandjean (Marrocos, Argélia, Espanha e apunctatus Mahunka (Grécia.

  5. Widespread Rickettsia spp. Infections in Ticks (Acari: Ixodoidea) in Taiwan.

    Science.gov (United States)

    Kuo, Chi-Chien; Shu, Pei-Yun; Mu, Jung-Jung; Lee, Pei-Lung; Wu, Yin-Wen; Chung, Chien-Kung; Wang, Hsi-Chieh

    2015-09-01

    Ticks are second to mosquitoes as the most important disease vectors, and recent decades have witnessed the emergence of many novel tick-borne rickettsial diseases, but systematic surveys of ticks and tick-borne rickettsioses are generally lacking in Asia. We collected and identified ticks from small mammal hosts between 2006 and 2010 in different parts of Taiwan. Rickettsia spp. infections in ticks were identified by targeting ompB and gltA genes with nested polymerase chain reaction. In total, 2,732 ticks were collected from 1,356 small mammals. Rhipicephalus haemaphysaloides Supino (51.8% of total ticks), Haemaphysalis bandicota Hoogstraal & Kohls (28.0%), and Ixodes granulatus Supino (20.0%) were the most common tick species, and Rattus losea Swinhoe (44.7% of total ticks) and Bandicota indica Bechstein (39.9%) were the primary hosts. The average Rickettsia infective rate in 329 assayed ticks was 31.9% and eight Rickettsia spp. or closely related species were identified. This study shows that rickettsiae-infected ticks are widespread in Taiwan, with a high diversity of Rickettsia spp. circulating in the ticks. Because notifiable rickettsial diseases in Taiwan only include mite-borne scrub typhus and flea-borne murine typhus, more studies are warranted for a better understanding of the real extent of human risks to rickettsioses in Taiwan.

  6. Die Euphthiracaridae Jacot, 1930, und Ihre Gattungen (Acari, Oribatei)

    NARCIS (Netherlands)

    Märkel, K.

    1964-01-01

    INHALT Einleitung.................... 4 Über den Körperbau der Euphthiracaridae........... 8 Die Gattungen der Euphthiracaridae............ 18 Oribotritia Jacot, 1924b................ 18 O. berlesei (Michael, 1898).............. 19 Indotritia Jacot, 1929................. 24 I. krakatauensis consimil

  7. Redefinition of the genus Triophtydeus Thor, 1932 (Acari: Actinedida)

    NARCIS (Netherlands)

    André, H.M.

    1985-01-01

    The genus Triophtydeus Thor, 1932 is redefined from the study of the type-species, T. triophthalmus (Oudemans, 1929). The genus Metatriophtydeus André, 1980 is a junior synonym of Triophtydeus. Species belonging or likely to belong to the genus Triophtydeus are listed and generic and specific

  8. Zetorchestes-Arten aus Neuguinea und Japan (Acari: Oribatida: Zetorchestidae)

    NARCIS (Netherlands)

    Krisper, G.

    1987-01-01

    A redescription of Zetorchestes saltator Oudemans, 1915 is given. In addition to that, two new Zetorchestes-species from New Guinea (Z. novaguineanus spec. nov., Z. vanderhammeni spec. nov.) and one new species from Japan (Z. aokii spec. nov.) are described in this paper. These four and some other s

  9. New species of water mites from the Comoros (Acari: Hydrachnidia)

    NARCIS (Netherlands)

    Smit, H.; Pesic, V.; Mary-Sasal, N.

    2009-01-01

    Three new species are described from the Comoros, an archipelago in the Indian Ocean: Teratothyasides scutulatus Smit & Pesic n. sp., Platymamersopsis comoros Smit & Pesic n. sp. and Atractides comorosensis Smit & Pesic n. sp. One species is reported new for the fauna of the Comoros, i.e. Monatracti

  10. Origins of asexuality in Bryobia mites (Acari: Tetranychidae

    Directory of Open Access Journals (Sweden)

    Menken Steph BJ

    2008-05-01

    Full Text Available Abstract Background Obligate asexual reproduction is rare in the animal kingdom. Generally, asexuals are considered evolutionary dead ends that are unable to radiate. The phytophagous mite genus Bryobia contains a large number of asexual species. In this study, we investigate the origin and evolution of asexuality using samples from 111 populations in Europe, South Africa and the United States, belonging to eleven Bryobia species. We also examine intraspecific clonal diversity for one species, B. kissophila, by genotyping individuals from 61 different populations. Knowledge on the origin of asexuality and on clonal diversity can contribute to our understanding of the paradox of sex. Results The majority (94% of 111 sampled populations reproduces asexually. Analysis of part of nuclear 28S rDNA shows that these asexuals do not form a monophyletic clade. Analysis of the mitochondrial COI region shows that intraspecific variation is extensive (up to 8.8%. Within B. kissophila, distinct clades are found, which are absent at the nuclear 28S rDNA level. Moreover, paraphyletic patterns are found at the mitochondrial DNA. Conclusion Asexuality is widespread in the genus Bryobia, signifying that some animal taxa do contain a high number of asexuals. We argue that asexuality originated multiple times within Bryobia. Wolbachia bacteria cause asexuality in at least two Bryobia species and may have infected different species independently. The high intraspecific clonal diversity and the patterns of paraphyly at the mitochondrial DNA in B. kissophila might be explained by a high mutation fixation rate and past hybridization events. Reproductive parasites like Wolbachia and Cardinium might influence these processes. We discuss the role these bacteria could play in the evolutionary success of asexual species.

  11. Can Euseius alatus DeLeon (Acari: Phytoseiidae) prey on Aceria guerreronis Keifer (Acari: Eriophyidae) in coconut palm?; Pode Euseius alatus DeLeon (Acari: Phytoseiidae) predar Aceria guerreronis Keifer (Acari: Eriophyidae) em coqueiro?

    Energy Technology Data Exchange (ETDEWEB)

    Melo, Jose W. da S.; Domingos, Cleiton A.; Gondim Junior, Manoel G.C. [Universidade Federal Rural de Pernambuco (UFRPE), Recife, PE (Brazil). Dept. de Agronomia. Area de Fitossanidade]. E-mail: mguedes@depa.ufrpe.br; Moraes, Gilberto J. de [Universidade de Sao Paulo (USP), Piracicaba, SP (Brazil). Escola Superior de Agricultura Luiz de Queiroz (ESALQ). Dept. de Entomologia, Fitopatologia e Zoologia Agricola]. E-mail: gjmoraes@carpa.ciagri.usp.br

    2009-01-15

    Mites of the genus Euseius are generally considered specialist as pollen feeders. Euseius alatus DeLeon is one of the six species of phytoseiid mites most commonly found on coconut plants in northeast Brazil associated with Aceria guerreronis Keifer. Although the morphology of E. alatus does not favor the exploitation of the meristematic area of the fruit inhabited by A. guerreronis, the predator may have some role in the control of this eriophyid during the dispersion process. The objective of this work was to evaluate the development and reproduction of E. alatus on the following diets: A. guerreronis, Ricinus communis pollen (Euphorbiaceae), and Tetranychus urticae Koch (Tetranychidae) + R. communis pollen + honey solution 10%. Euseius alatus developed slightly faster and had slightly higher oviposition rate when feeding on the diet composed of T. urticae + pollen + honey. However, life table parameters were very similar on all diets, suggesting that E. alatus may contribute in reducing the population of A. guerreronis in the field. (author)

  12. Phytoseiid mites (Acari: Phytoseiidae) from Patagonia and Tierra del Fuego.

    Science.gov (United States)

    Ferragut, Francisco; Navia, Denise

    2015-07-28

    Predatory phytoseiid mites have been intensively studied and surveyed in the last decades because of their economic importance as biocontrol agents of agricultural pests. However, many regions of the world remain unexplored and the diversity of the family worldwide is still fragmentary. Up to date no phytoseiid species have been collected in the southernmost part of the Earth down to latitude 45º S. In this study Phytoseiidae were sampled from native vegetation in southern Argentina and Chile in the regions of Patagonia and Tierra del Fuego Island. Thirteen species were collected, five of which were previously described and eight, Chileseius australis n. sp., Neoseiulus mapuche n. sp., Typhlodromips valdivianus n. sp., T. fissuratus n. sp., Amblyseius grandiporus n. sp., A. caliginosus n. sp., Typhlodromus (Anthoseius) anomalos n. sp. and Metaseiulus parabrevicollis n. sp. are proposed as new to science and are described and diagnosed.

  13. Oribátidos (Acari, Oribatei de Fuerteventura (islas Canarias

    Directory of Open Access Journals (Sweden)

    Pérez-Iñigo, C.

    1995-12-01

    Full Text Available The oribatid fauna from Fuerteventura (Canary Islands is studied for the first time; 86 species are recorded, from which 18 are new to the Science and two are new subspecies. Two new genera are erected: Passalobates n. gen. (Family Passalozetidae and Fuerteventuria n. gen. (Family Protoribatidae. Two species belonging to Ethiopic genera are described: Scutoverticosus insperatus n. sp. and Ethiovertex elisae n. sp. These genera contained until now the type species only.

    Se estudian por primera vez los ácaros oribátidos de Fuerteventura, y se citan 86 especies de las que 18 son nuevas para la Ciencia y dos son nuevas subespecies, y se establecen dos géneros nuevos: Passalobates n. gen. (Familia Passalozetidae y Fuerteventuria n. gen. (Familia Protoribatidae. Se describen dos especies de géneros etiópicos: Scutoverticosus insperatus n. sp. y Ethiovertex elisae n. sp., géneros que, hasta ahora, solo contaban con la especie tipo.

  14. Artengliederung und Verbreitung der Gattung Zetorchestes in Europa (Acari, Oribatida)

    NARCIS (Netherlands)

    Krisper, G.

    1987-01-01

    This paper gives a description of Zetorchestes grandjeani spec. nov.; it is identical with those animals which are called "l'espèce de Pise" by Grandjean (1951). Ζ. grandjeani differs from Ζ. flabrarius Grandjean, 1951 and from Z. falzonii Coggi, 1898 in showing a reduction of hairs in the posterior

  15. Relative humidity and activity patterns of Ixodes scapularis (Acari: Ixodidae)

    Science.gov (United States)

    Berger, K.A.; Ginsberg, Howard S.; Gonzalez, L.; Mather, T.N.

    2014-01-01

    Laboratory studies have shown clear relationships between relative humidity (RH) and the activity and survival of Ixodes scapularis Say (blacklegged tick). However, field studies have produced conflicting results. We examined this relationship using weekly tick count totals and hourly RH observations at three field sites, stratified by latitude, within the state of Rhode Island. Records of nymphal tick abundance were compared with several RH-related variables (e.g., RH at time of sampling and mean weekly daytime RH). In total, 825 nymphs were sampled in 2009, a year of greater precipitation, with a weighted average leaf litter RH recorded at time of sampling of 85.22%. Alternatively, 649 nymphs were collected in 2010, a year of relatively low precipitation, and a weighted average RH recorded at time of sampling was 75.51%. Negative binomial regression analysis of tick count totals identified cumulative hours <82% RH threshold as a significant factor observed in both years (2009: P = 0.0037; 2010: P < 0.0001). Mean weekly daytime RH did not significantly predict tick activity in either year. However, mean weekly daytime RH recorded with 1-wk lag before sample date was a significant variable (P = 0.0016) in 2010. These results suggest a lag effect between moisture availability and patterns of tick activity and abundance. Differences in the relative importance of each RH variable between years may have been due to abnormally wet summer conditions in 2009.

  16. A supplementary description of Brevipalpus californicus (Acari: Trombidiformes: Tenuipalpidae

    Directory of Open Access Journals (Sweden)

    Mohammad Raissi Ardali

    2015-10-01

    Full Text Available The false spider mite Brevipalpus californicus from the family Tenuipalpidae was collected from Caucasian alnus, White willow, Persian raspberry and a wild Chrysanthemum bush in Mazandaran province. This species is reported as a new record to the false spider mites-fauna of Iran here. Reviewing literatures revealed that it was briefly described in the original paper without any measures. So, a completed description is presented based on the Iranian specimens and different body segments are drawn for B. californicus. In addition, the above plants are new host records for B. californicus.

  17. New records of the tribe Bryobiini berlsese (Acari: Tetranychidae: Bryobiinae) from Serbia, with notes about associated predators (Acari: Phytoseiidae)

    OpenAIRE

    Mladenović K.; Stojnić B.; Vidović B.; Radulović Z.

    2013-01-01

    This paper gives an overview of the present knowledge and some new faunistic and zoogeographic data of the insufficiently researched tribe Bryobiini in Serbia. In Serbia, this group of mites is represented by eight species, including four species new to Serbian fauna: Bryobia angustisetis Jakobashvili, B. lagodechiana Reck, B. ulmophila Reck and B. vasiljevi Reck. New data on host plant species and families have also been obtained - two new host plant species for B. angustisetis, two ho...

  18. Primer registro de Ixodes cookei (Acari: Ixodidae) para México First record of Ixodes cookei (Acari: Ixodidae) in Mexico

    OpenAIRE

    2007-01-01

    En este estudio se aportan los primeros datos de la garrapata Ixodes cookei Packard, 1869 en México. Un macho, 7 larvas y 15 ninfas se recolectaron en los estados de Nuevo León y Veracruz. Además, se registra al cacomixtle Bassariscus astutus como un nuevo huésped.The presence of Ixodes cookei Packard, 1869 is documented for the first time in Mexico, based on one male, 7 larvae and 15 nymphs collected in Veracruz and Nuevo Leon. Additionally, cacomixtle (Bassariscus astutus) is presented as a...

  19. Primer registro de Ixodes cookei (Acari: Ixodidae para México First record of Ixodes cookei (Acari: Ixodidae in Mexico

    Directory of Open Access Journals (Sweden)

    Griselda Montiel-Parra

    2007-06-01

    Full Text Available En este estudio se aportan los primeros datos de la garrapata Ixodes cookei Packard, 1869 en México. Un macho, 7 larvas y 15 ninfas se recolectaron en los estados de Nuevo León y Veracruz. Además, se registra al cacomixtle Bassariscus astutus como un nuevo huésped.The presence of Ixodes cookei Packard, 1869 is documented for the first time in Mexico, based on one male, 7 larvae and 15 nymphs collected in Veracruz and Nuevo Leon. Additionally, cacomixtle (Bassariscus astutus is presented as a new host record.

  20. Ocorrência de Brevipalpus phoenicis (Geijskes (Acari, Tenuipalpidae, Tetranychus urticae (Koch (Acari, Tetranychidae e Polyphagotarsonemus latus (Banks (Acari, Tarsonemidae sobre folhas de Ipomoea cairica (Linnaeus Sweet (Solanales, Convolvulaceae Occurrence of Brevipalpus phoenicis (Geijskes (Acari, Tenuipalpidae, Tetranychus urticae (Koch (Acari, Tetranychidae and Polyphagotarsonemus latus (Banks (Acari, Tarsonemidae on leaves of I. cairica (Linnaeus Sweet (Solanales, Convolvulaceae

    Directory of Open Access Journals (Sweden)

    Ozana M. de A. Maia

    2006-09-01

    Full Text Available A ocorrência de três espécies acarinas fitófagas é relatada pela primeira vez sobre folhas de Ipomoea cairica. As espécies Brevipalpus phoenicis (Geijskes, Tetranychus urticae (Koch e Polyphagotarsonemus latus (Banks, foram coletadas sobre folhas de I. cairica nas imediações da Universidade Federal do Paraná, Curitiba, Paraná, Brasil, em 20 de janeiro de 2005.The first occurrence of three phytophagus mites on Ipomoea cairica, is reported. The species Brevipalpus phoenicis (Geijskes, Tetranychus urticae (Koch and Polyphagotarsonemus latus (Banks were caught on leaves of I. cairica, around Universidade Federal do Paraná, Curitiba, Paraná, Brazil, in January 20th, 2005.

  1. Selection assisted by a BoLA-DR/DQ haplotype against susceptibility to bovine dermatophilosis

    Directory of Open Access Journals (Sweden)

    Maillard Jean-Charles

    2003-06-01

    Full Text Available Abstract Bovine dermatophilosis is a severe skin infection of tropical ruminants inducing a severe loss in productivity and a 15% mortality rate. This disease is caused by the actinomycete bacterium Dermatophilus congolensis associated with the tick Amblyomma variegatum. Currently there are no prospects for a vaccine, and acaricide or antibiotic control is hampered by the development of chemoresistance. Animal breeders have observed that dermatophilosis susceptibility seems to be determined genetically, and we previously identified a BoLA-DRB3-DQB class II haplotype marker for high (R2 = 0.96 susceptibility to the disease. With this marker, we developed a successful eugenic selection procedure for zebu Brahman cattle in Martinique (FWI. Over a period of five years, a marked reduction in disease prevalence, from 0.76 to 0.02 was achieved, and this low level has been maintained over the last two years. The selection procedure, based on a genetic marker system targeting the highly polymorphic BoLA locus, eliminates only those individuals which are at the highest risk of contracting the disease. In the present work, we discuss the properties of this system, including the "heterozygote advantage" and the "frequency dependence" theories, and examine their involvement in the biological mechanisms at the host/pathogen interface. We speculate on the exact role of the MHC molecules in the control of the disease, how the natural selection pressure imposed by the pathogens selectively maintains MHC diversity, and how our results can be practically applied for integrated control of dermatophilosis in developing countries.

  2. Directory of Open Access Journals (Sweden)

    Fredrick M. Kivaria

    2012-09-01

    Full Text Available A cross-sectional study was conducted between September and October 2010 in five states of South Sudan that were selected on the basis of the perceived risk of tick-borne diseases. The purpose was to investigate epidemiological parameters of tick-borne diseases in South Sudan and their uses in future control strategies. A total of 805 calves were assessed by clinical, microscopic and serological examination and tick counts. The indirect Enzyme-Linked Immuno-Sorbent Assay (ELISA was used to detect antibodies to Theileria parva, Theileria mutans, Anaplasma marginale and Babesian bigemina. Sero-conversion risks for T. parva and T. mutans were 27.3% and 31.3% respectively, whilst the risk was 57.6% and 52.8% for A. marginale and B. bigemina, respectively. Major tick species identified include Rhipicephalus appendiculatus, Rhipicephalus decoloratus, Rhipicephalus microplus, Amblyomma variegatum, and Rhipicephalus evertsi. There was great variation (P ≤ 0.001 in the number of all these ticks, both between herds in a state and between calves in an individual herd. The low and intermediate sero-conversion risks observed in the study states suggest that immunisation against East Coast fever (ECF is justified. Fortunately, three major genotypes that were identified by applying Polymerase Chain Reaction Restriction Fragment Length Polymorphism (PCRRFLP analysis on the p104 to the blood samples and T. parva Muguga, matched very well with T. parva Kiambu 5 and T. parva Muguga; therefore the Muguga cocktail can be used for the immunisation of cattle in South Sudan. However, prospective studies are required to develop optimal control measures for tick-borne diseases under different ecological and husbandry practices in South Sudan.

  3. Innovative approach for transcriptomic analysis of obligate intracellular pathogen: selective capture of transcribed sequences of Ehrlichia ruminantium

    Directory of Open Access Journals (Sweden)

    Lefrançois Thierry

    2009-12-01

    Full Text Available Abstract Background Whole genome transcriptomic analysis is a powerful approach to elucidate the molecular mechanisms controlling the pathogenesis of obligate intracellular bacteria. However, the major hurdle resides in the low quantity of prokaryotic mRNAs extracted from host cells. Our model Ehrlichia ruminantium (ER, the causative agent of heartwater, is transmitted by tick Amblyomma variegatum. This bacterium affects wild and domestic ruminants and is present in Sub-Saharan Africa and the Caribbean islands. Because of its strictly intracellular location, which constitutes a limitation for its extensive study, the molecular mechanisms involved in its pathogenicity are still poorly understood. Results We successfully adapted the SCOTS method (Selective Capture of Transcribed Sequences on the model Rickettsiales ER to capture mRNAs. Southern Blots and RT-PCR revealed an enrichment of ER's cDNAs and a diminution of ribosomal contaminants after three rounds of capture. qRT-PCR and whole-genome ER microarrays hybridizations demonstrated that SCOTS method introduced only a limited bias on gene expression. Indeed, we confirmed the differential gene expression between poorly and highly expressed genes before and after SCOTS captures. The comparative gene expression obtained from ER microarrays data, on samples before and after SCOTS at 96 hpi was significantly correlated (R2 = 0.7. Moreover, SCOTS method is crucial for microarrays analysis of ER, especially for early time points post-infection. There was low detection of transcripts for untreated samples whereas 24% and 70.7% were revealed for SCOTS samples at 24 and 96 hpi respectively. Conclusions We conclude that this SCOTS method has a key importance for the transcriptomic analysis of ER and can be potentially used for other Rickettsiales. This study constitutes the first step for further gene expression analyses that will lead to a better understanding of both ER pathogenicity and the adaptation

  4. Spotted fever group Rickettsia in Amblyomma dubitatum tick from the urban area of Campo Grande, Mato Grosso do Sul, Brazil.

    Science.gov (United States)

    Matias, Jaqueline; Garcia, Marcos Valério; Cunha, Rodrigo Casquero; Aguirre, André de Abreu Rangel; Barros, Jacqueline Cavalvante; Csordas, Bárbara Guimarães; Andreotti, Renato

    2015-03-01

    Rickettsia infection of each tick was evaluated by the hemolymph test and polymerase chain reaction (PCR) targeting gltA and ompA genes. All hemolymph tests were negative and PCR of one A. dubitatum detected both Rickettsia genes. Sequence of ompA exhibited a 99% identity with Rickettsia parkeri and R. africae and a 98% identity with R. sibirica. Rickettsia of the spotted fever group in A. dubitatum is described for the first time in an urban area within the municipality of Campo Grande in the state of Mato Grosso do Sul (MS), Brazil. This finding reinforces the importance of more detailed studies to determine the role of A. dubitatum in the transmission of spotted fever agents.

  5. Suppression of Amblyomma americanum (Ixodida: Ixodidae) for Short-Term Field Operations Utilizing Cypermethrin and Lambda-Cyhalothrin

    Science.gov (United States)

    2014-05-01

    two grids (42 by 42 m) were established that contained a mix of open grasses and dense brush . Each grid was evenly divided into 49 plots,witheachplot...the label rate of one tablet in 1.9 liters of water, delivering 15 mg a.i./m2. Hand pump compression sprayers were used to apply the acaricides...developments in invertebrate repellents. ACS Symposium Series, American Chemical Society, Wash - ington, DC. Table 1. Host-seeking A. americanum abundance

  6. Nuevos registros de ácaros oribátidos (Acari: Oribatida para la Argentina New records of oribatid mites (Acari: Oribatida for Argentina

    Directory of Open Access Journals (Sweden)

    Cecilia Accattoli

    2010-12-01

    Full Text Available Esta publicación constituye un aporte al conocimiento del elenco oribatológico en suelos de Argentina, basado en relevamientos realizados en un parque urbano de la ciudad de La Plata, Buenos Aires. Se informan dos nuevas citas de géneros, una de subgénero y siete de especies para el país. Además, cinco de las especies halladas serían nuevas para la ciencia. Se incorporan ocho géneros y siete especies a las registradas para la Provincia de Buenos Aires.This paper is a contribution to the knowledge of assemblages of oribatid mites in soils of Argentina. The study is based on samples from an urban forest in the city of La Plata, Buenos Aires. New records for the country are provided for two genera, one subgenus and seven species. Furthermore, five of the species found are possibly new to science. Eight genera and seven species are incorporated to the record of the Buenos Aires province.

  7. Selection of Entomopathogenic Fungi to Control Varroa destructor (Acari: Varroidae Selección de Hongos Entomopatógenos para el Control de Varroa destructor (Acari: Varroidae

    Directory of Open Access Journals (Sweden)

    Marta Rodríguez

    2009-12-01

    Full Text Available The aim of this work was select entomopathogenic fungi tolerant to temperatures inside the brood area of honey bees (Apis mellifera for to control Varroa destructor. For this purpose, 50 Beauveria bassiana (Balsamo Vuillemin and 48 Metarhizium anisopliae (Metschn. Sorokin isolates were evaluated at 30 and 35 ºC. For each isolate, colony discs of 5 mm with mycelium were placed in the center of a Petri dish with Sabouraud dextrose agar (SDA medium. The dishes were incubated at 30 and 35 °C, without light. Radial growth of each colony was measured daily. All the B. bassiana and M. anisopliae isolates presented a lineal growth rate at a temperature of 30 ºC. However, at 35 ºC, most of the isolates did not grow, except three B. bassiana and 14 M. anisopliae isolates (P El objetivo de este trabajo fue seleccionar hongos entomopatógenos tolerantes a las temperaturas del nido de cría de las abejas (Apis mellifera, para ser utilizados en el control de Varroa destructor. Se evaluaron 50 aislamientos de Beauveria bassiana (Balsamo Vuillemin y 48 de Metarhizium anisopliae (Metschn. Sorokin a temperaturas de 30 y 35 ºC. Discos de agar de 5 mm de diámetro con micelio de colonias de cada aislamiento, se depositaron en el centro de placas Petri con medio agar Sabouraud dextrosa (ASD. Las placas fueron incubadas a 30 y 35 °C y oscuridad y diariamente se midió el radio de cada colonia. Todos los aislamientos de B. bassiana y M. anisopliae var. anisopliae presentaron una tendencia lineal a través del tiempo a temperaturas de incubación de 30 °C. A 35 °C la mayoría de los aislamientos no crecieron, excepto tres aislamientos de B. bassiana y 14 de M. anisopliae (p < 0,001. Estos aislamientos fueron seleccionados para realizar pruebas de patogenicidad sobre V. destructor, aplicando una suspensión de 10(7 conidias mL-1. El aislamiento más efectivo fue Qu-M845 de M. anisopliae (p = 0,0033, produjo una mortalidad de 85%. La capacidad patogénica de este aislamiento en V. destructor y su tolerancia a las condiciones ambientales a las que sería expuesto, permite considerar esta cepa como una alternativa de control para esta plaga.

  8. Larvicidal potencial of Sapindus saponaria (Sapindaceae against Rhipicephalus sanguineus (Latreille, 1806 (Acari: Ixodidae Potencial larvicida de Sapindus saponaria (Sapindaceae sobre Rhipicephalus sanguineus (Latreille, 1806 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    F.F. Fernandes

    2007-02-01

    Full Text Available The larvicidal potential of the crude ethanolic extracts (CEE of the stem peel of Sapindus saponaria was evaluated against Rhipicephalus sanguineus. Lethal concentrations (LC, were calculated by preparing CEE solutions at different concentrations in distilled water. Larvae fasted for 14-21 days were utilized in the bioassays, after incubation of engorged females collected from infested environments frequented by dogs in several neighborhoods of Goiânia, GO. Bioassays were performed in a specially constructed biological chamber for testing botanical acaricides, acclimatized to 27±1ºC, RH>80%. The larvae were counted on filter paper envelopes impregnated with the solutions or distilled water and larval mortality observed after 48h. S. saponaria showed good larvicidal activity (LC50 and LC99 of 1994 and 3922ppm, respectively and the results demonstrated its potential as a botanical acaricide and an alternative control measure for R. sanguineus.Avaliou-se a potencialidade larvicida do extrato-bruto etanólico (EBE da casca do caule de Sapindus saponaria sobre Rhipicephalus sanguineus. Para o cálculo das concentrações letais (CL foram preparadas soluções com diferentes concentrações do EBE dissolvido em água destilada. Foram utilizadas larvas em jejum com 14 a 21 dias, obtidas pela incubação de teleóginas, coletadas em ambientes infestados, freqüentados por cães de vários bairros de Goiânia. Os bioensaios foram realizados em uma câmara biológica para testes com acaricidas botânicos, climatizada a 27±1ºC e UR>80%. As larvas foram contidas em envelopes de papel filtro impregnados com as soluções (grupo teste ou com água destilada (grupo-controle e a mortalidade larval foi observada após 48h. S. saponaria demonstrou atividade larvicida satisfatória (CL50 e CL99 respectivamente de 1994 e 3922ppm e os resultados demonstraram seu potencial como acaricida botânico e medida alternativa para o controle de R. sanguineus.

  9. A gallery of the key characters to ease identification of Dermanyssus gallinae (Acari: Gamasida: Dermanyssidae and allow differentiation from Ornithonyssus sylviarum (Acari: Gamasida: Macronyssidae

    Directory of Open Access Journals (Sweden)

    Di Palma Antonella

    2012-05-01

    Full Text Available Abstract Background Dermanyssus gallinae (poultry red mite is a major threat for the poultry industry and is of significant interest for public health. Identification of D. gallinae can be difficult for scientists not familiar with mite morphology and terminology especially when trying to use identification keys. Moreover, this species may easily be confused with another dermanyssoid mite, Ornithonyssus sylviarum (northern fowl mite, which often shares the same hosts and environment. Methods Specimens of D. gallinae were collected at poultry farms in the Puglia and performed for light and scanning electron microscopy observations, identification and micrographs. Moreover specimens of O. sylviarum were collected separately macerated and mounted on slides for light microscopy observations, identification and pictures. Results The micrographs used in this study, based on LM and SEM observations, highlight the following important identifying characters of D. gallinae: the prominent shoulders of the dorsal shield and the jagged edges of the shield reticulations, the position of setae j1, s1 and the epigynal pores, and the presence on tibia IV pl of one seta. Additional micrographs highlighting the shape of the dorsal (abruptly narrowed posteriorly and epigynal (narrowly rounded posteriorly shields and the chelicera (elongate, with distinct digits of O. sylviarum enable its differentiation from D.gallinae. Conclusion The photographic support provided here (both LM and SEM pictures can be considered a practical tool for scientists who are not well acquainted with the morphology of D.gallinae, and who are involved with classical and molecular systematics, veterinary and human health aspects of poultry red mites.

  10. Sobre el género Neocalonyx (Acari: Prostigmata: Hydryphantidae en las Yungas About the genus Neocalonyx (Acari: Prostigmata: Hydryphantidae in the Yungas

    Directory of Open Access Journals (Sweden)

    Beatriz Rosso de Ferradás

    2007-12-01

    Full Text Available Se tratan aquí dos especies conocidas del género Neocalonyx y se describe una nueva especie, N. diaguita sp. nov. de la provincia de Jujuy (Argentina. Se discuten los caracteres considerados en los tres subgéneros y los cuatro grupos de especies, reconocidos en uno de ellos.Two known species of Neocalonyx genus are dealt with in this paper, and one new species, N. diaguita sp. nov. from Jujuy province in Argentina is described.The characters considered in the three subgenera and the four species groups of one of them are discussed.

  11. Efeitos do nim sobre tetranychus urticae Koch (Acari: Tetranychidae e os predadores Phytoseiulus macropilis (Banks e Neoseiulus californicus (Mcgregor (Acari: Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Daniele Cristine Hoffmann Schlesener

    2013-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a eficiência de controle e os efeitos adversos de dois produtos à base de nim Azamax® (Azadiractina A/B 12g/L e Neemseto® (Azadiractina A/B, Nimbina e Salanina 2,389 g/L sobre o ácaro-rajado Tetranychus urticae e os predadores Phytoseiulus macropilis e Neoseiulus californicus em laboratório. Para o ácaro-rajado, foram consideradas as variáveis mortalidade, fecundidade, efeito ovicida e persistência biológica, enquanto para os fitoseídeos consideraram-se mortalidade e fecundidade. A mortalidade máxima observada para o ácaro-rajado foi de 89,7% e 91,5% para Azamax® e Neemseto®, respectivamente, na concentração de 0,5% após a reaplicação do produto no sétimo dia. Também foram observados efeitos adversos sobre a fecundidade e a viabilidade dos ovos quando tratados com os produtos comerciais (p.c.. A persistência biológica dos produtos foi de aproximadamente três dias após a pulverização. As formulações apresentaram seletividade em relação aos fitoseídeos, porém causaram redução da fecundidade dos mesmos.

  12. Hidracáridos (Acari, Hydrachnidia de la cuenca Andina del río Beni, Bolivia Hydracarids (Acari, Hydrachnidia from the Andean basin of Beni river, Bolivia

    Directory of Open Access Journals (Sweden)

    Beatriz Rosso de Ferradás

    2004-09-01

    Full Text Available Water mites from Andean part of the Bolivian Amazonian rivers were examined. A new species is described, Limnesia aymara. New records and redescription are made for Hygrobatella multiacetabulata Cook,1980, Atractides brasiliensis (Lundblad, 1937 and Krendowskia convexa (Ribaga, 1902. A new subgenus Schwoerbelobatella for hygrobatelids poliacetabulated is proposed and characterized. Ecological characteristics of the river area sampled and ecological preferences of the analyzed species are discussed.

  13. Life table parameters and capture success ratio studies of Typhlodromips swirskii (Acari: Phytoseiidae) to the factitious prey Suidasia medanensis (Acari: Suidasidae).

    Science.gov (United States)

    Midthassel, Audun; Leather, Simon R; Baxter, Ian H

    2013-09-01

    The predatory mite Typhlodromips swirskii (Athias-Henriot) is commonly used to suppress pest populations of thrips and whitefly in commercial greenhouses. Many generalist phytoseiid mites can be reared on astigmatid factitious prey. This study investigated the life table parameters of T. swirskii to the astigmatid mite Suidasia medanensis (Oudemans) and the capture success ratio of T. swirskii to different life stages of the prey. Juvenile development time and survival was 5.01 ± 0.10 days and 93 %, respectively. The intrinsic (r m ) and finite (λ) rates of increase were 0.222 and 1.249, respectively, with average oviposition rate of 1.71 ± 0.07 eggs/female/day. The capture success ratio of T. swirskii to S. medanensis was: eggs > freeze killed adults > nymphs > live adults. Typhlodromips swirskii was concluded to exhibit good population growth rates with S. medanensis as prey and, a prey population with predominance of eggs and nymphs to be advantageous to the predator due to an unidentified defence mechanism of adult prey.

  14. Suscetibilidade de Oligonychus yothersi (Acari: Tetranychidae ao fungo Beauveria bassiana Susceptibility of Oligonychus yothersi (Acari: Tetranychidae to the fungus Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Renato Cassol de Oliveira

    2002-03-01

    Full Text Available A cultura da erva-mate (Ilex paraguariensis é uma importante atividade econômica no Sul do Brasil. Com o aumento de consumo nos anos oitenta, cresceram também as áreas de monocultura, gerando condições favoráveis para o aumento populacional de insetos e ácaros fitófagos, entre eles o ácaro vermelho Oligonychus yothersi. Este estudo avaliou a suscetibilidade do ácaro vermelho O. yothersi a vários isolados do fungo Beauveria bassiana. O experimento foi conduzido em Cascavel, PR. Discos foliares de erva-mate (2,2 cm² foram previamente infestados com 20 fêmeas adultas. Alíquotas de 1 mL de cada suspensão de conídios dos diferentes isolados de B. bassiana, ajustadas na concentração de 1,0x10(8 conídios mL-1 foram pulverizadas, separadamente, sobre um conjunto de 5 discos. Os discos foliares foram mantidos flutuando em água destilada, em caixas plásticas (3 cm de diâmetro, sob condições controladas. Diariamente, os ácaros mortos foram transferidos para câmara úmida, para confirmação de mortalidade causada pelo fungo. A mortalidade total variou entre 77 e 98% (6 dias após a aplicação, não permitindo diferenciar os isolados quanto à virulência (P>0,05. Já a mortalidade confirmada variou entre 19 e 75%, permitindo diferenciá-los (PThe Paraguay tea (Ilex paraguariensis crop is an important economical activity in Southern Brazil. With the increase of tea consumption in the 80s, the number of monoculture crops also increased, creating favorable conditions for the development of phytophagous insect and mite populations, such as the red mite Oligonychus yothersi. The objective of this study was to evaluate the susceptibility of the red mite O. yothersi to the several strains of the Beauveria bassiana fungus. The experiments were carried out in Cascavel, PR, Brazil. Leaf disks of Paraguay tea (2.2 cm² were previously infested with 20 adult females. Five disks were inoculated with 1 mL of each conidial suspension of B. bassiana strains (1x10(8 conidia per mL. Disks were kept afloat on distilled water in plastic boxes (3 cm diameter, under controlled conditions. Dead mites were transferred to a humid chamber on a daily basis to confirm the mortalities rate by the fungus. All the strains were pathogenic, with total mortality varying from 77 to 98%, 6 days after application. It was not possible to differentiate virulence levels between strains (P<0.05 by total mortality. However, confirmed mortality varied from 19 to 75%, 8 days after application, allowing for a differentiation in virulence levels between strains (P<0.05. This study concluded that the O. yothersi red mite is susceptible, at different levels, to B. bassiana tested strains.

  15. Two new oribatid mites from the Republic of Rwanda. Plasmobates zarae sp. n. (Acari, Plasmobatidae) and Basilobelba spasmenosi sp. n. (Acari, Basilobelbidae)

    Science.gov (United States)

    Fernandez, Nestor; Theron, Pieter

    2016-01-01

    Abstract Two new species of oribatid mites, Plasmobates zarae sp. n. and Basilobelba spasmenosi sp. n. are described from the Republic of Rwanda. They can easily be differentiated from other species by a number of characters. Plasmobates zarae sp. n. is differentiated the following characters. four types of particular cerotegumental layers. Integument slightly foveate to smooth on prodorsum; foveate on notogaster; ventral region rugose to smooth.Large rostral setae inserted on protuberance, whip-shaped, with longitudinal pucker; interlamellar setae rod-shaped with triangular scales; interlamellar setae small. Medial band on prodorsum extending to anterior of central part, but not reaching rostrum. Bothridium horn-shaped; opening basally incised with rectilinear wall, internal bothridial rings dentate. Sensillus whip-like, with minute triangular scales. Variably distributed circumgastric macropores. Opisthosomal gland apophysis flat, triangular in lateral view and cylindrical in posterolateral view. Six pairs of notogastral setae, all situated posterior to opisthosomal gland level. Aggenital setae not detected; three pairs of adanal setae; two pairs of anal setae present. Nymphal scalps simple without anterior tuft or filaments, with dentate peripheral ridge. Larval scalp shaped like Chinese hat. Basilobelba spasmenosi sp. n. is characterized by the combination of the following characters: Cerotegument: thick basal layer with amorphous coat and cavities of different sizes, as well as structures resembling small cauliflowers. Setation: simple: notogastral, epimeral, genital, anal; simple long, basally barbate: le, ro setae; simple, whip-shaped: ex setae; medium length, sharpened tip with thorns on surface: in setae, leg setae; Flabellate: setae situated in ventral neotrichous zone. Thorn-like barbs and more or less parallel longitudinal grooves present on body surface of le, ro, in and leg setae. Prodorsum: rostrum finger-shaped, relative sizes of setae: le > ro > in > ex. Prodorsal cuticular surface smooth with shallow transversal furrow and two oblique furrows determining two triangular structures. Large humpbacked CSO situated anterior to and in medial line with in setal insertion, dorsal bothridial opening. Notogaster swollen, hemispheric; nine pairs of minute setae, only h1, h2, h3 easily identifiable, cuticular wart and dimple clearly visible. Humeral apophysis with longitudinal furrow dorsally. Elongate chelicera with cha, chb setae, behind them a series of scales directed dorsoventrally. Epimeral setation 3-1-3-3, adanal-aggenital neotrichy with between 8-10 setae. Nymphal scalps with very particular bean-shaped structure on either side of the decoupage zone, surrounding horn-like structure. Scalps with cuticular polyhedral reticulate to ovoid structure, often forming a cavity, either completely perforated or with a thin cuticular layer resembling an interior membrane. PMID:27408588

  16. Fitoseídeos (Acari: Phytoseiidae associados a cafezais e fragmentos florestais vizinhos Phytoseiids (Acari: Phytoseiidae associated to coffee plantations and adjacent forest fragments

    Directory of Open Access Journals (Sweden)

    Ester Azevedo Silva

    2010-10-01

    Full Text Available Existem poucas informações sobre a fauna de ácaros predadores (Phytoseiidae em ambientes naturais brasileiros adjacentes a agroecossistemas cafeeiros (Coffea spp. ou sobre a influência que essa vegetação exerce como reservatório de ácaros predadores. Neste estudo, objetivou-se avaliar a diversidade destes organismos em cafeeiros e fragmentos florestais adjacentes. Coletaram-se amostras das espécies Calyptranthes clusiifolia (Miq. O. Berg (Myrtaceae, Esenbeckia febrifuga (A. St.-Hil. A. Juss. ex Mart. (Rutaceae, Metrodorea stipularis Mart. (Rutaceae e Allophylus semidentatus (Miq. Radlk. (Sapindaceae, em oito fragmentos florestais, de 5 a 51 ha, e cafezais adjacentes, nos meses de junho (final período chuvoso e outubro (final período seco nos anos 2004 e 2005, na região Sul do Estado de Minas Gerais. Ácaros foram extraídos das folhas, utilizando o método de lavagem e, em seguida, montados em lâminas de microscopia em meio de Hoyer, para identificação específica. No total foram identificados 2.348 fitoseídeos, sendo 2.090 nos fragmentos florestais e 258 espécimes nos cafezais adjacentes, pertencentes a 38 espécies. Servindo-se de análise faunística, a espécie Iphiseiodes zuluagai Denmark & Muma, 1972 apresentou os melhores índices no agroecossistema cafeeiro, sendo muito frequente e constante nas épocas estudadas. Nos fragmentos florestais Amblyseius herbicolus Chant, 1959, Iphiseiodes affs. neonobilis Denmark & Muma, 1978, Leonseius regularis DeLeon, 1965 e Euseius alatus DeLeon, 1966 foram dominantes, muito abundantes, muito frequentes e constantes nas épocas estudadas. Podemos concluir que a vegetação nativa abriga ácaros predadores, inimigos naturais de ácaros-praga, que ocorrem na cultura cafeeira, possibilitando o desenvolvimento de programas de manejo ecológico com áreas de vegetação natural e agroecossistemas cafeeiros adjacentes.There is little information about the fauna of predatory mites (Phytoseiidae in Brazilian natural environments, adjacent to coffee agroecosystems (Coffea spp., or about the influence exerted by neighbor vegetation as a reservoir of predatory mites. The objective of this study was to evaluate the diversity of these organisms in coffee plantations and adjacent forest fragments. Samples of the species Calyptranthes clusiifolia (Miq. O. Berg (Myrtaceae, Esenbeckia febrifuga (A. St.-Hil. A. Juss. ex Mart., Metrodorea stipularis Mart. (Rutaceae and Allophylus semidentatus (Miq. Radlk. (Sapindaceae were collected in eight forest fragments, from 5 to 51ha, adjacent to coffee plantations, in June (end of the rainy season and October (end of the dry season in the years of 2004 and 2005, in the Southern region of State of Minas Gerais. Leaf mites were extracted using the wash method, mounted in microscopy slides with Hoyer's medium for identification. A total of 2.348 phytoseiids was collected, being 2.090 in the forest fragments and 258 in adjacent coffee plantations, belonging to 38 species. According to fauna analysis, Iphiseiodes zuluaguai Denmark & Muma, the year of 1972 presented the best indexes in the coffee agroecosystem, being very frequent and constant in those periods. In the forest fragments, Amblyseius herbicolus Chant, 1959, Iphiseiodes affs. neonobilis Denmark & Muma, 1978, Leonseius regularis DeLeon, 1965 and Euseius alatus DeLeon, 1966 were dominant, very abundant, very frequent and constant in those periods. One may conclude that the native vegetation shelters predator mite, natural enemies of mite-pests that still occur in coffee culture, making possible ecological management program development involving areas of natural vegetation and adjacent coffee agroecosystems.

  17. Nuevas citas de ácaros oribátidos (Acari: Oribatida para la Argentina New records of oribatids (Acari: Oribatida for Argentina

    Directory of Open Access Journals (Sweden)

    Ana Salazar Martínez

    2006-12-01

    Full Text Available En la presente nota se citan, por primera vez para la Argentina , cuatro especies de ácaros oribátidos: Epilohmannia pallida americana Balogh & Mahunka, 1981, Protoribates (Triangius praeoccupatus (Pérez-Iñigo & Baggio, 1980, Scheloribates curvialatus Hammer, 1961 y Galumna innexa Pérez-Iñigo & Baggio, 1986. Los ejemplares fueron hallados en muestras de suelo recolectadas en La Plata , Provincia de Buenos Aires (34º 54'S, 57º 55´ W, en ambientes sometidos a intervención antrópica: bosques urbanos, huertas orgánicas y pastizales.Four species of oribatid mites are recorded from Argentina for the first time: Epilohmannia pallida americana Balogh & Mahunka, 1981, Protoribates (Triangius praeoccupatus (Pérez-Iñigo & Baggio, 1980, Scheloribates curvialatus Hammer, 1961 and Galumna innexa Pérez-Iñigo & Baggio, 1986. The specimens were collected in soil samples in La Plata , Buenos Aires Province (34º 54' S, 57º 55´ W in sites exposed to different degrees of human intervention: urban forest, organic orchards and pastures.

  18. Rhipicephalus sanguineus (Acari: Ixodidae, the brown dog tick, parasitizing humans in Brazil Rhipicephalus sanguineus (Acari: Ixodidae, o carrapato vermelho do cão, parasitando humanos no Brasil

    Directory of Open Access Journals (Sweden)

    Filipe Dantas-Torres

    2006-02-01

    Full Text Available The objective of this paper is to describe four cases of human parasitism by Rhipicephalus sanguineus (Latrielle in Brazil. During an investigation regarding the species of ectoparasites of domestic dogs from the metropolitan region of Recife, Pernambuco state, four dog owners were found to be parasitized by ticks. The ticks were collected from these individuals and their dogs. All the ticks were identified as Rhipicephalus sanguineus . These are, to our knowledge, the first four cases of human parasitism by this tick species in Brazil. The possible implications of this finding are discussed here.O objetivo deste artigo é descrever quatro casos de parasitismo humano por Rhipicephalus sanguineus (Latrielle no Brasil. Durante uma investigação sobre as espécies de ectoparasitas de cães domésticos provenientes da Região Metropolitana de Recife, Pernambuco, quatro proprietários de cães foram encontrados parasitados por carrapatos. Foram coletados carrapatos dos indivíduos e de seus cães. Todos os carrapatos foram identificados como Rhipicephalus sanguineus, sendo, portanto, descritos os primeiros quatro casos de parasitismo humano por esta espécie de carrapato, no Brasil. Neste trabalho, são discutidas as possíveis implicações epidemiológicas deste achado.

  19. Distribuição espacial e plano de amostragem de Calacarus heveae (Acari em seringueira Spatial distribution and sampling plan for Calacarus heveae (Acari on rubber trees

    Directory of Open Access Journals (Sweden)

    Noeli Juarez Ferla

    2007-12-01

    Full Text Available Calacarus heveae Feres, 1992 é um eriofídeo descrito de espécimes coletados em plantas de seringueira (Hevea brasiliensis, Euphorbiaceae na região noroeste do Estado de São Paulo. Esse ácaro prefere a face adaxial dos folíolos e pode causar a perda do brilho, amarelecimento, bronzeamento dessa região e a subseqüente queda prematura das folhas. O objetivo deste trabalho foi analisar a distribuição de C. heveae em seringueira, selecionar a unidade de amostragem mais representativa e desenvolver um plano de amostragem para o estudo de sua flutuação populacional. O trabalho foi conduzido com os clones PB 260 e IAN 873, respectivamente nos municípios de Itiquira e de Pontes e Lacerda, ambos no Mato Grosso. Em Itiquira, diferenças significativas foram observadas em quatro ocasiões em relação ao número médio de ácaros por folha nos diferentes estratos das plantas. Nas amostragens realizadas em Pontes e Lacerda, nenhuma diferença significativa foi encontrada entre os estratos em relação àquele parâmetro. Apenas em Itiquira, em uma ocasião de amostragem, foi verificada diferença entre os três estratos, em relação à proporção de folhas infestadas. Nenhuma diferença significativa foi verificada em relação ao número médio de ácaros por folha e proporção de folhas infestadas por C. heveae a diferentes distâncias da periferia da copa. Calacarus heveae exibe distribuição agregada no campo. Para estimar a densidade de C. heveae, um plano numérico e um plano binomial de amostragem foram desenvolvidos.Calacarus heveae Feres, 1992 (Eriophyidae is a mite described from specimens collected on rubber tree (Hevea brasiliensis, Euphorbiaceae in the northwest region of the state of São Paulo. This mite prefers the adaxial face of the folioles which it can turn dry, yellowish and brownish; it can also cause leaf fall. The aim of this work was to analyze the distribution of C. heveae on rubber trees, to select the most representative sampling unit and to develop a sampling plan to determine the populational fluctuation. This study was conducted with clones PB 260 and IAN 873, in Itiquira and Pontes e Lacerda, respectively, both in the state of Mato Grosso. In Itiquira, significant differences were observed in four occasions in relation to the average number of mites per leaf in the different plant strata. In the samplings carried out in Pontes e Lacerda, no significant differences were observed between strata in relation to that parameter. Only in Itiquira, in one occasion, a significant difference between strata was verified in relation to the proportion of infested leaves. No significant differences were verified in relation to the average number of mites per leaf and proportion of leaves infested by C. heveae at different depths in the canopy. Calacarus heveae exhibits aggregated distribution in the field. To estimate the density of C. heveae, numeric and sampling plans were developed.

  20. Prevalence of equine Piroplasmosis and its association with tick infestation in the State of São Paulo, Brazil Prevalência da Piroplasmose equina e sua associação com infestação por carrapatos no Estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Claudia E. Kerber

    2009-12-01

    Full Text Available Serum samples were collected from 582 horses from 40 stud farms in the State of São Paulo and tick (Acari: Ixodidae infestations were evaluated on them. Serum samples were subjected to the complement fixation test (CFT and a competitive inhibition ELISA (cELISA for Babesia caballi and Theileria equi. Logistic regression analyses were performed to construct multivariate models that could explain the dependent variable (horses positive for B. caballi or T. equi as a function of the independent variables (presence or abundance of each one of the tick species found on the farms. A higher overall prevalence of B. caballi (54.1% than of T. equi (21.6% was found by the two tests. The ticks Dermacentor nitens Neumann, 1897, Amblyomma cajennense (Fabricius, 1787 and Rhipicephalus (Boophilus microplus (Canestrini, 1887 were present on horses on 38 (95%, 20 (50%, and 4 (10% farms, respectively. Infestations by D. nitens were statistically associated with B. caballi-positive horses on the farms by either the CFT or cELISA. Infestations by A. cajennense were statistically associated with T. equi-positive horses on the farms by either CFT or cELISA.Amostras de soro sanguineo foram coletadas de 582 equinos de 40 haras no estado de São Paulo, onde as infestações por carrapatos foram avaliadas nos animais. Os soros foram testados por reação de fixação do complemento (RFC e ELISA competitivo por inibição (cELISA com antígenos de Babesia caballi e Theileria equi. Análises de regressão logística foram realizadas para construir modelos multivariados que pudessem explicar as variáveis dependentes (equinos positivos para B. caballi ou T. equi em função de variáveis independentes (presença e abundância de cada uma das espécies de carrapatos encontradas nos equinos dos haras. Em geral, os dois testes sorológicos indicaram uma prevalência maior para B. caballi (54,1% do que para T. equi (21,6%. Os carrapatos Dermacentor nitens Neumann, 1897