WorldWideScience

Sample records for amblyomma acari ixodidae

  1. Life Cycle of Amblyomma romitii (Acari: Ixodidae) Under Laboratory Conditions.

    Science.gov (United States)

    Landulfo, G A; Luz, H R; Sampaio, J S; Faccini, J L H; Barros-Battesti, D M

    2016-01-01

    The life cycle of Amblyomma romitii Tonelli-Rondelli, 1939 is reported for the first time, using rabbits (Oryctolagus cuniculus) for larvae and capybara (Hydrochoerus hydrochaeris) for nymphs and adults, as experimental hosts. Developmental periods of free-living stages were observed in an incubator at 27 ± 1°C, 80 ± 10% relative humidity (RH), and 24-h darkness. The life cycle of A. romitii in the laboratory could be completed in an average period of 216.4 d. The overall sex ratio (M:F) was 1:1.4. The results showed that rabbits are quite suitable as experimental hosts for the larval stages of A. romitii, while capybaras are suitable experimental hosts for nymphs and adults. PMID:26487244

  2. Amblyomma hadanii n. sp. (Acari: Ixodidae), a tick from northwestern Argentina previously confused with Amblyomma coelebs Neumann, 1899.

    Science.gov (United States)

    Nava, Santiago; Mastropaolo, Mariano; Mangold, Atilio J; Martins, Thiago F; Venzal, José M; Guglielmone, Alberto A

    2014-07-01

    All stages of Amblyomma hadanii n. sp. (Acari: Ixodidae) are described from northwestern Argentina. The diagnostic characters for males are a combination of the pattern of scutal ornamentation, basis capituli dorsally rectangular with cornua, coxa I with two subequal spurs (the internal wider, the external longer), coxae II-III with a single spur, coxa IV with a single spur not reaching level of anus, ventral plates irregular in shape (larger and sometimes with a small incision on festoons 4, 5 and 6) and hypostome spatulate with dental formula 3/3 in 7-8 rows. The diagnostic characters for the females are a combination of scutal ornamentation, postero-lateral margins of scutum slightly convex, coxa I with two subequal spurs (the internal wider, the external longer), basis capituli dorsally rectangular, porose areas rounded, genital aperture U-shaped, and hypostome spatulate with dental formula 3/3 in 7-8 rows. Diagnosis of nymphs can be performed by a combination of basis capituli rectangular, scutum with large punctations in the lateral fields and small punctations in the central field, and cervical groove short and ending as a small shallow depression at the eye level. Larvae are diagnosed by the shape of basis capituli, scutum with with posterior margin slightly convex, and legs with coxa I with 2 triangular spur (the external longer than the internal), and with coxae II and III each with 1 triangular spur. The hosts recorded for this new tick species are Tapirus terrestris (Linnaeus), horse, cattle, dog and humans. Analyses of a 410 bp fragment of the mitochondrial 16S rRNA gene and the complete sequence of the nuclear 18S rRNA gene supported the description of A. hadanii as a new species. PMID:24935128

  3. Some avian and mammalian hosts of Amblyomma hebraeum and Amblyomma marmoreum (Acari: Ixodidae).

    Science.gov (United States)

    Horak, I G; MacIvor, K M; Petney, T N; De Vos, V

    1987-09-01

    Large numbers of birds, wild mammals and domestic stock from a variety of localities within the Republic of South Africa were examined for infestation with the ixodid ticks Amblyomma hebraeum and Amblyomma marmoreum. Every warthog (Phacochoerus aethiopicus), Burchell's zebra (Equus burchelli), impala (Aepyceros melampus) and kudu (Tragelaphus strepsiceros) from the Kruger National Park in the north-eastern Transvaal Lowveld was infested with A. hebraeum. In the eastern Cape Province every helmeted guinea fowl (Numida meleagris), scrub hare (Lepus saxatilis) and kudu from the Andries Vosloo Kudu Reserve; all but 1 of the 22 domestic cattle examined on the farm "Bucklands"; and all Angora goats plus nearly all Boer goats examined on the farm "Brakhill" were infested with this tick. Most animals examined appeared to be good hosts of the immature stages, and the larger the host species the greater the chances of it harbouring large numbers of adult ticks. The largest animals examined, such as eland, buffalo, giraffe and rhinoceros, harboured very large numbers of adult A. hebraeum. No adult A. marmoreum was recovered from any host. However, 50% or more of helmeted guinea fowl and kudu from the Andries Vosloo Kudu Reserve; helmeted guinea fowl, scrub hares and eland (Taurotragus oryx) from the Mountain Zebra National Park; helmeted guinea fowl, kudu, domestic sheep, goats and cattle on the farm "Bucklands", and caracal (Felis caracal) from the Cradock and Southwell areas of the eastern Cape Province were infested with immature A. marmoreum. In the Bontebok National Park in the south-western Cape Province more than 35% of scrub hares, vaal ribbok (Pelea capreolus) and bontebok (Damaliscus dorcas dorcas) were infested with immature ticks. PMID:3329327

  4. Brazilian distribution of Amblyomma varium Koch, 1844 (Acari: Ixodidae, a common parasite of sloths (Mammalia: Xenarthra

    Directory of Open Access Journals (Sweden)

    Sandro Marques

    2002-12-01

    Full Text Available Amblyomma varium, commonly known in Brazil as the "carrapato-gigante-da-preguiça" (sloth's giant tick is found from southern Central America to Argentina. The present study adds information on the geographical distribution of A. varium, as well as on their hosts, based on material deposited in the main Brazilian collections and on the available literature. Eighty-two vials, containing 191 adult specimens, deposited in five Acari collections between 1930 and 2001, were examined. These vials included data on the host and collection localities. The biology of A. varium is unknown. However it is known that, during the adult stage, the tick presents a high host specificity and is found almost exclusively on the sloths Bradypus tridactylus, B. variegatus, B.torquatus (Bradypodidae, Choloepus hoffmanni and C. didactylus (Megalonychidae. Based on the material examined, the states of Rondônia, Amazonas, Bahia and Alagoas are newly assigned to geographic distribution of A. varium in Brazil.

  5. Experimental infestation with the immatures of Amblyomma dissimile Koch, 1844 (Acari: Ixodidae on Tropidurus torquatus (Lacertilia: Iguanidae and Oryctolagus cuniculus Infestação experimental com as fases imaturas de Amblyomma dissimile Koch, 1844 (Acari: Ixodidae em Tropidurus torquatus (Lacertilia: Iguanidae e Oryctolagus cuniculus

    Directory of Open Access Journals (Sweden)

    L.H.T. Freitas

    2004-02-01

    Full Text Available Larvas provenientes de duas fêmeas de Amblyomma dissimile Koch, 1844 (Acari: Ixodidae, naturalmente ingurgitadas em uma iguana (Iguana iguana e provenientes do Estado do Mato Grosso, foram utilizadas na infestação experimental de lagartos da espécie Tropidurus torquatus e coelhos domésticos. As larvas alimentadas em ambos os hospedeiros realizaram ecdise para ninfas. As ninfas apenas ingurgitaram no lagarto e mudaram para machos e fêmeas. Este é o primeiro registro do parasitismo de larvas e ninfas de A. dissimile em T. torquatus e de larvas em coelhos.

  6. Nuevos hospedadores para las garrapatas Amblyomma tigrinum y Rhipicephalus sanguineus (Acari: Ixodidae en Chile New hosts for the ticks Amblyomma tigrinum and Rhipicephalus sanguineus (Acari: Ixodidae in Chile

    Directory of Open Access Journals (Sweden)

    D González-Acuña

    2006-01-01

    Full Text Available Se registran, por primera vez en Chile, ninfas de garrapata café del perro (Rhipicephalus sanguineus parasitando dos ejemplares de cabras (Capra hircus y adultos (un macho y una hembra gravida de la garrapata de listas blancas (Amblyomma tigrinum parasitando a un bovino (Bos taurus. La importancia de los presentes reportes, hechos en la provincia de Ñuble, son discutidos.For the first time in Chile, cases of nymphs of the brown dog tick (Rhipicephalus sanguineus being found on two goats (Capra hircus, and adult (one male and a gravid female white stripped ticks (Amblyomma tigrinum being found on cattle (Bos taurus have been reported. The aim of this review is to discuss the importance of these findings.

  7. Inhibition of the classical pathway of the complement system by saliva of Amblyomma cajennense (Acari: Ixodidae).

    Science.gov (United States)

    Franco, Paula F; Silva, Naylene C S; Fazito do Vale, Vladimir; Abreu, Jéssica F; Santos, Vânia C; Gontijo, Nelder F; Valenzuela, Jesus G; Pereira, Marcos H; Sant'Anna, Mauricio R V; Gomes, Alessandra P S; Araujo, Ricardo N

    2016-05-01

    Inhibition of the complement system during and after haematophagy is of utmost importance for tick success in feeding and tick development. The role of such inhibition is to minimise damage to the intestinal epithelium as well as avoiding inflammation and opsonisation of salivary molecules at the bite site. Despite its importance, the salivary anti-complement activity has been characterised only in species belonging to the Ixodes ricinus complex which saliva is able to inhibit the alternative and lectin pathways. Little is known about this activity in other species of the Ixodidae family. Thus, the aim of this study was to describe the inhibition of the classical pathway of the complement system by the saliva of Amblyomma cajennense at different stages of the haematophagy. The A. cajennense saliva and salivary gland extract (SGE) were able to inhibit the complement classical pathway through haemolytic assays with higher activity observed when saliva was used. The anti-complement activity is present in the salivary glands of starving females and also in females throughout the whole feeding process, with significant higher activity soon after tick detachment. The SGE activity from both females fed on mice or horses had no significant correlation (p > 0.05) with tick body weight. The pH found in the intestinal lumen of A. cajennense was 8.04 ± 0.08 and haemolytic assays performed at pH 8.0 showed activation of the classical pathway similarly to what occurs at pH 7.4. Consequently, inhibition could be necessary to protect the tick enterocytes. Indeed, the inhibition observed by SGE was higher in pH 8.0 in comparison to pH 7.4 reinforcing the role of saliva in protecting the intestinal cells. Further studies should be carried out in order to identify the inhibitor molecule and characterise its inhibition mechanism. PMID:26948715

  8. Nuevos hospedadores para las garrapatas Amblyomma tigrinum y Rhipicephalus sanguineus (Acari: Ixodidae) en Chile New hosts for the ticks Amblyomma tigrinum and Rhipicephalus sanguineus (Acari: Ixodidae) in Chile

    OpenAIRE

    González-Acuña, D.; Valenzuela, G; Moreno, L.; K Ardiles; A Guglielmone

    2006-01-01

    Se registran, por primera vez en Chile, ninfas de garrapata café del perro (Rhipicephalus sanguineus) parasitando dos ejemplares de cabras (Capra hircus) y adultos (un macho y una hembra gravida) de la garrapata de listas blancas (Amblyomma tigrinum) parasitando a un bovino (Bos taurus). La importancia de los presentes reportes, hechos en la provincia de Ñuble, son discutidos.For the first time in Chile, cases of nymphs of the brown dog tick (Rhipicephalus sanguineus) being found on two goats...

  9. Rabbits (Oryctolagus cuniculus as experimental hosts for Amblyomma dubitatum Neumann (Acari: Ixodidae Coelhos (Oryctolagus cuniculus como hospedeiros experimentais de Amblyomma dubitatum Neumann (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    J. L.H. Faccini

    2006-12-01

    Full Text Available O ciclo biológico do Amblyomma dubitatum, que se alimentava experimentalmente em coelhos domésticos, foi avaliado em condições laboratoriais e comparado com dados recentemente obtidos de infestações experimentais em capivaras (Hydrochaeris hydrochaeris, hospedeiros naturais para essa espécie. Os coelhos foram considerados hospedeiros experimentais adequados para larvas e ninfas porque quatro dos cinco parâmetros avaliados (número de carrapatos que ingurgitaram, período de alimentação, percentagem de carrapatos que realizaram muda e período de pré-muda foram semelhantes aos resultados obtidos com capivaras. As percentagens diárias de desprendimento e de muda das larvas e ninfas confirmam os coelhos como hospedeiros experimentais adequados para esses estágios de A. dubitatum. Os resultados do experimento indicam que os coelhos são hospedeiros inadequados para os adultos.

  10. Nymphs of the genus Amblyomma (Acari: Ixodidae) of Brazil: descriptions, redescriptions, and identification key.

    Science.gov (United States)

    Martins, Thiago F; Onofrio, Valeria C; Barros-Battesti, Darci M; Labruna, Marcelo B

    2010-06-01

    Together with the larval stage, the nymphal stage of ticks of the genus Amblyomma are the most aggressive ticks for humans entering areas inhabited by wildlife and some domestic animals in Brazil. However, due to the absence of morphological descriptions of the nymphal stage of most Brazilian Amblyomma species, plus the lack of an identification key, little or nothing is known about the life history of Amblyomma spp. nymphs in the country. In the present study, morphological description of the nymphal stage, illustrating important external characters through scanning electron microscopy, is provided for nymphs of 15 Amblyomma species that occur in Brazil, for which the nymphal stage had never been described: A. aureolatum, A. auricularium, A. calcaratum, A. coelebs, A. fuscum, A. humerale, A. incisum, A. latepunctatum, A. naponense, A. nodosum, A. ovale, A. pacae, A. pseudoconcolor, A. scalpturatum, A. varium. In addition, the nymphal stage of 12 Amblyomma species, which had been previously described, are redescribed: A. brasiliense, A. cajennense, A. dissimile, A. dubitatum, A. longirostre, A. oblongoguttatum, A. parkeri, A. parvum, A. romitii, A. rotundatum, A. tigrinum, A. triste. The descriptions and redescriptions totalized 27 species. Only 2 species (A. geayi, A. goeldii) out of the 29 Amblyomma species established in Brazil are not included in the present study. A dichotomous identification key is included to support taxonomic identification of the nymphal stage of 27 Amblyomma species established in Brazil. PMID:21771514

  11. Amblyomma mixtum Koch, 1844 (Acari: Ixodidae): First record confirmation in Colombia using morphological and molecular analyses.

    Science.gov (United States)

    Rivera-Páez, Fredy A; Labruna, Marcelo B; Martins, Thiago F; Sampieri, Bruno Rodrigues; Camargo-Mathias, Maria I

    2016-07-01

    Up to some years ago, the taxon Amblyomma cajennense represented a single tick species in the New World, from southern United States to northern Argentina. Recent studies, based on genetic, reproductive and morphological data reorganized this taxon into a complex of the following 6 valid species: A. cajennense sensu stricto, Amblyomma mixtum, Amblyomma sculptum, Amblyomma interandinum, Amblyomma tonelliae, and Amblyomma patinoi. According to this classification, the A. cajennense complex is currently represented in Colombia by only one species, A. patinoi. Because the Colombian land is surrounded by confirmed records of A. mixtum in Panama and Ecuador, and by A. cajennense s.s. in Venezuela and the Brazilian Amazon, it is possible that these two species could also occur in Colombia. This study aimed to determine the occurrence of ticks of the A. cajennense complex in the Orinoquía region of Colombia. A total of 246 adult ticks of the Amblyomma genus were collected in three sampled regions: 71 females and 110 males in Arauca (Arauca Department), 27 females and 20 males in Nunchía (Casanare Department), and 10 females and 8 males in Yopal (Casanare Department). Based on morphological and molecular analyses, these ticks were identified as A. mixtum. Molecular analyses consisted of DNA sequences of two molecular markers, the nuclear second internal transcribed spacer (ITS2) and the mitochondrial cytochrome c oxidase subunit I gene (COI). The presence of A. mixtum in Colombia is of medical relevance, since this species is incriminated as a vector of Rickettsia rickettsii in Central America.

  12. A first record of Amblyomma dissimile (Acari: Ixodidae) parasitizing the lizard Ameiva ameiva (Teiidae) in Brazil.

    Science.gov (United States)

    Lopes, Suzana Gomes; Andrade, Gilda Vasconcellos de; Costa-Júnior, Lívio Martins

    2010-01-01

    A non-engorged adult female Amblyomma dissimile and two Amblyomma sp. larvae were found parasitizing the lizard Ameiva ameiva in the municipality of Chapadinha, State of Maranhão. This is the first record in the state of Maranhão and fills a gap in the distribution of A. dissimile in Brazil. The lizard A. ameiva represents a new host for A. dissimile, and also the first record of this tick species infesting lizards of the family Teiidae in Brazil. PMID:21184707

  13. Rickettsia parkeri Transmission to Amblyomma americanum by Cofeeding with Amblyomma maculatum (Acari: Ixodidae) and Potential for Spillover.

    Science.gov (United States)

    Wright, Chelsea L; Sonenshine, Daniel E; Gaff, Holly D; Hynes, Wayne L

    2015-09-01

    Amblyomma americanum (L.) is a human-biting ixodid tick distributed throughout much of the southeastern United States. Rickettsia parkeri is a member of the spotted fever group rickettsiae and causes a febrile illness in humans commonly referred to as "Tidewater spotted fever" or "R. parkeri rickettsiosis." Although the Gulf Coast tick, Amblyomma maculatum Koch, is the primary vector of R. parkeri, a small proportion of A. americanum have also been shown to harbor R. parkeri. The purpose of this investigation was to determine whether R. parkeri is spilling over into A. americanum in eastern Virginia and also to determine through laboratory experiments, whether A. americanum can acquire R. parkeri by cofeeding alongside infected ticks. Of 317 wild-caught, flat adult A. americanum tested from 29 counties and independent cities in coastal Virginia, a single female A. americanum was positive for R. parkeri, suggesting that R. parkeri is spilling over into this species, but at very low rates (Rickettsia amblyommii, however, were less likely to acquire R. parkeri, suggesting that infection with R. amblyommii may prevent R. parkeri from establishing infection in A. americanum.

  14. Dynamics of cell and tissue genesis in the male reproductive system of ticks (Acari: Ixodidae) Amblyomma cajennense [corrected] (Fabricius, 1787) and Amblyomma aureolatum (Pallas, 1772): a comparative analysis.

    Science.gov (United States)

    Sampieri, Bruno Rodrigues; Labruna, Marcelo Bahia; Bueno, Odair Correa; Camargo-Mathias, Maria Izabel

    2014-04-01

    Ticks are classified into three families: Argasidae, Ixodidae, and Nutalliellidae. The taxonomy and phylogeny within Ixodidae are still discussed by the specialists, thus requiring further studies. Amblyomma cajennese and Amblyomma aureolatum (Brazil) belong to two species complexes known as "cajennese" and "ovale", respectively, and are directly related to the transmission of the Brazilian spotted fever. This confirms the medical and veterinary significance of these species, as well as the need for further morphological studies that will bring a better understanding of their taxonomy, phylogeny, and control. In this context, the present study aimed to characterize the morphology of the male reproductive system of A. cajennese and A. aureolatum when unfed and after 4 days of feeding, thereby seeking to: (a) distinguish the two species or "complexes", and (b) study an internal system which has the potential to be targeted by acaricides. Therefore, males from both species (unfed and after 4 days of feeding) were cold-anesthetized, dissected, and had their reproductive systems removed for histological analysis. The results showed that the morphology of the male reproductive system is generally similar between both species, like in other Ixodidae ticks, exhibiting a multilobed accessory gland complex related to seminal fluid secretion, a pair of vasa deferentia and a pair of testes housing germ cells (spermatocytes) in different stages. The main differences were found in the development of the accessory gland complex cells and germ cells, showing that the maturation of the male reproductive system starts later in A. aureolatum, when compared to A. cajennese. However, during the blood meal, A. aureolatum development is increased, thus making germ cell maturation and gland complex activity higher than in A. cajennese. This study shows the differences in the development of the male reproductive systems of both species, while providing information that can assist in the

  15. Effects of gamma radiation on spermatogenesis and fertility of male Amblyomma americanum (Acari: Ixodidae)

    International Nuclear Information System (INIS)

    Amblyomma americanum males were treated with 0.5, 1, 2, 3, 4, 8, and 16 krad of gamma radiation. Testes of ticks treated with 2, 3, 4, 8, and 16 krad were smaller than those of ticks irradiated at lower levels and controls. No recognizable alteration in timing of spermatogenesis was noted among the different radiation groups, but severe breakdown and depletion of germinal cells was noted at 4, 8, and 16 krad. Percent hatch of larvae from crosses of irradiated males and untreated females decreased with increasing radiation level. No hatch was observed from eggs of females mated to males treated at 2 krad or higher

  16. Amblyomma dissimi le (Acari: Ixodidae) PARÁSITO DE Boa constrictor EN COLOMBIA

    OpenAIRE

    Carrascal, Juan; Oviedo, Teresa; Monsalve, Santiago; Torres, Ana

    2009-01-01

    Objetivo. Describir algunas garrapatas encontradas en dos ejemplares de Boa constrictor, llevados al Centro de Atención y Valoración de Fauna Silvestre en Montería, Córdoba, Colombia. Materiales y métodos. Se recolectaron 37 garrapatas provenientes de dos individuos adultos de Boa constrictor, los parásitos fueron conservados en alcohol al 70% y posteriormente identificados mediante diversas claves taxonómicas. Resultados. Todas las garrapatas fueron identificadas como Amblyomma dissimile, d...

  17. Amblyomma dissimile (Acari: Ixodidae) PARÁSITO DE Boa constrictor EN COLOMBIA

    OpenAIRE

    Ana Torres M; Santiago Monsalve B; Teresa Oviedo S; Juan Carrascal V

    2009-01-01

    Objetivo. Describir algunas garrapatas encontradas en dos ejemplares de Boa constrictor, llevados al Centro de Atención y Valoración de Fauna Silvestre en Montería, Córdoba, Colombia. Materiales y métodos. Se recolectaron 37 garrapatas provenientes de dos individuos adultos de Boa constrictor, los parásitos fueron conservados en alcohol al 70% y posteriormente identificados mediante diversas claves taxonómicas. Resultados. Todas las garrapatas fueron identificadas como Amblyomma dissimile, de...

  18. Amblyomma yucumense n. sp. (Acari: Ixodidae), a Parasite of Wild Mammals in Southern Brazil.

    Science.gov (United States)

    Krawczak, Felipe S; Martins, Thiago F; Oliveira, Caroline S; Binder, Lina C; Costa, Francisco B; Nunes, Pablo H; Gregori, Fábio; Labruna, Marcelo B

    2015-01-01

    During 2013-2014, adult ticks were collected on the vegetation and subadult ticks were collected from small mammals [Didelphis aurita Wied-Neuwied, Sooretamys angouya (Fischer), Euryoryzomys russatus (Wagner), Akodon montensis Thomas, Oxymycterus judex Thomas] in an Atlantic rainforest reserve in southern Brazil. Analyses of the external morphology of the adult ticks revealed that they represent a new species, Amblyomma yucumense n. sp. Partial 16S rRNA sequences generated from males, females, and nymphs were identical to each other and closest (95% identity) to corresponding sequences of Amblyomma dubitatum Neumann. A. yucumense is morphologically and genetically closest related to A. dubitatum. Dorsally, male of these species can be separated by major longitudinal pale orange stripes associated with a pseudoscutum indicated by a pale stripe in A. yucumense, in contrast to pale creamy longitudinal stripes and absence of pseudoscutum in A. dubitatum. Ventrally, male coxal I spurs are separated by a space narrower than external spur width in A. yucumense, and wider than external spur width in A. dubitatum. Females of the two species can be separated by coxal I spurs, longer in A. yucumense than in A. dubitatum. In addition, the adult capitulum and ventral idiosoma of A. yucumense are generally dark brown colored, while A. dubitatum is yellowish or light brown colored. The nymph of A. yucumense differs from A. dubitatum by the scutal cervical groove length, slightly shorter in the former species. Currently, A. yucumense is restricted to southern Brazil. PMID:26336277

  19. Amblyomma dissimile (Acari: Ixodidae PARÁSITO DE Boa constrictor EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    Ana Torres M

    2009-08-01

    Full Text Available Objetivo. Describir algunas garrapatas encontradas en dos ejemplares de Boa constrictor, llevados al Centro de Atención y Valoración de Fauna Silvestre en Montería, Córdoba, Colombia. Materiales y métodos. Se recolectaron 37 garrapatas provenientes de dos individuos adultos de Boa constrictor, los parásitos fueron conservados en alcohol al 70% y posteriormente identificados mediante diversas claves taxonómicas. Resultados. Todas las garrapatas fueron identificadas como Amblyomma dissimile, de las cuales, 9 fueron hembras, 24 machos y 4 ninfas. Conclusiones. La identificación de ectoparásitos en especies de Boa c. constrictor contribuye a mantener adecuadamente esta especie en cautiverio y provee datos para establecer medidas profilácticas y tratamiento, igualmente, ayuda en el conocimiento de los agentes parasitarios de la fauna silvestre.

  20. Infestations of the bont tick Amblyomma hebraeum (Acari: Ixodidae) on different breeds of cattle in Zimbabwe.

    Science.gov (United States)

    Norval, R A; Sutherst, R W; Kerr, J D

    1996-10-01

    Infestations of adults and nymphs of Amblyomma hebraeum were counted on Brahman (Br), Brahman x Simmental (BS), Sanga (Sa) and Hereford (He) steers exposed to infested pastures at Mbizi in southern Zimbabwe in 1986-1987. Herefords were always the most heavily infested, while the Sanga tended to carry the fewest ticks with the Brahman and Brahman x Simmental groups being in between. The ratios of the engorged females on the four breeds were 2.3:1.4:1.4:1.0 for He:Br:BS:Sa. The ratios of the standard nymphs were 2.2:1.4:1.7:1.0 for He:Br:BS:Sa. The results confirm earlier observations in Africa and support the view that there are genetic differences between breeds in the expression of resistance to this tick species. PMID:8952073

  1. Infestations of the bont tick Amblyomma hebraeum (Acari: Ixodidae) on different breeds of cattle in Zimbabwe.

    Science.gov (United States)

    Norval, R A; Sutherst, R W; Kerr, J D

    1996-10-01

    Infestations of adults and nymphs of Amblyomma hebraeum were counted on Brahman (Br), Brahman x Simmental (BS), Sanga (Sa) and Hereford (He) steers exposed to infested pastures at Mbizi in southern Zimbabwe in 1986-1987. Herefords were always the most heavily infested, while the Sanga tended to carry the fewest ticks with the Brahman and Brahman x Simmental groups being in between. The ratios of the engorged females on the four breeds were 2.3:1.4:1.4:1.0 for He:Br:BS:Sa. The ratios of the standard nymphs were 2.2:1.4:1.7:1.0 for He:Br:BS:Sa. The results confirm earlier observations in Africa and support the view that there are genetic differences between breeds in the expression of resistance to this tick species.

  2. Amblyomma cajennense (Acari: Ixodidae) tick populations susceptible or resistant to acaricides in the Mexican Tropics.

    Science.gov (United States)

    Alonso-Díaz, M A; Fernández-Salas, A; Martínez-Ibáñez, F; Osorio-Miranda, J

    2013-10-18

    The objectives of the present study were: (i) to identify the frequency of cattle farms with a cohabitation of Amblyomma cajennense and Rhipicephalus microplus, (ii) to determine the status of susceptibility or resistance to acaricides used in Veracruz, Mexico, on A. cajennense populations and (iii) to identify factors associated with A. cajennense resistant to acaricides. Fifty farms were visited to determine the presence of ticks (A. cajennense and R. microplus) and to collect engorged A. cajennense individuals. From these, 24 A. cajennense populations were evaluated in resistance bioassays using discriminating doses of acaricides. The acaricides tested were organophosphates (chlorpiriphos, coumaphos and diazinon), pyrethroids (flumethrin, deltamethrin and cypermethrin), amidines (amitraz) and fipronil (a broad spectrum N-phenylpyrazole insecticide). A. cajennense infesting bovines were identified in 86% (43/50) of the farms visited, and 100% of the farms sampled (43/43) had cohabitation between R. microplus and A. cajennense. Of the farm owners or managers surveyed, 87.5% could not distinguish the morphological difference between tick genera. Populations of A. cajennense were 100%, 91.7% and 12.5% resistant to diazinon, coumaphos and chlorpyriphos (organophosphates), respectively, and 12.5% to amitraz, as were those susceptible to flumethrin and fipronil. In conclusions, populations of A. cajennense showed a high frequency of resistance to the organophosphates tested and to amitraz. Factors associated with the resistance to acaricides in A. cajennense were not identified. PMID:23827041

  3. Analyses of hemolymph from Amblyomma cajennense (Acari: ixodidae) using neutron activation analysis (NAA)

    Energy Technology Data Exchange (ETDEWEB)

    Simons, Simone M.; Oliveira, Daniella G.L.; Chudzinski-Tavassi, Ana M., E-mail: daniellaoliveira@butantan.gov.b, E-mail: amchudzinki@butantan.gov.b [Instituto Butantan, Sao Paulo, SP (Brazil); Zamboni, Cibele B., E-mail: czamboni@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Instrumental neutron activation analysis technique (INAA) was applied to determine the elemental composition of hemolymph from Amblyomma cajennense tick. This biological material came from Butantan Institute (Sao Paulo city, Brazil) and it was investigated using the IEA-R1 nuclear reactor (4MW, pool type) at IPEN/CNEN-SP - Brazil. The concentration values for: Br (0.0032 {+-} 0.0005gL{sup -1}), Ca (0.104 {+-} 0.029gL{sup -1}), Cl (4.41 {+-} 0.25gL{sup -1}), I (76 {+-} 27{mu}gL{sup -1}), K (0.38 {+-} 0.09gL{sup -1}), Mg (0.038 {+-} 0.011gL{sup -1}), Na (4.30 {+-} 0.26gL{sup -1}) and S (1.35 {+-} 0.37gL{sup -1}) were determined for the first time. These data were compared with the concentration values established for Americanum and Anatolicum Excavatum tick species to clarify the ion balance in this biological material (hemolymph). This comparison suggests that Na concentration, majority in these species, has a similar behavior. These data also contribute to the understanding of hemolymph composition complementing its characterization as well as for the understanding of several physiological processes, especially those related to salivary secretion. (author)

  4. Biology of Amblyomma aureolatum (Pallas, 1772 (Acari: Ixodidae on some laboratory hosts in Brazil

    Directory of Open Access Journals (Sweden)

    Daniel Sobreira Rodrigues

    2002-09-01

    Full Text Available The ixodid Amblyomma aureolatum is suspected to play a role in the epidemiology of wild life-cycle hemoparasites, which frequently infect dogs in rural and hunting areas in Brazil. Little is known about its bionomics. The objective of the present study was to evaluate some bionomic aspects of A. aureolatum ticks in Brazil. One engorged female, collected from a dog (Canis familiaris in São Sebastião das Águas Claras, State of Minas Gerais, was used to establish a colony in the laboratory. Subsequently its parasitic stage progeny were fed on domestic dogs and laboratory animals. The free-living stages were incubated at 27ºC ± 2°C and minimum 70% relative humidity in a BOD incubator. The egg incubation period ranged from 31 to 34 days; the parasitic period of larvae ranged from 4 to 6 days and ecdysis to nymphs occurred from day 19 up to day 22. The parasitic period of nymphs ranged from 5 to 8 days and the period of ecdysis to adults from 31 to 33 days. The parasitic period of adults ranged from 11 to 15 days, the pre-oviposition period from 6 to 12 days, and the oviposition period from 9 to 38 days. The total duration of the life cycle ranged from 116 to 168 days.

  5. Ehrlichia chaffeensis (Rickettsiales: Ehrlichieae) infection in Amblyomma americanum (Acari: Ixodidae) at Aberdeen Proving Ground, Maryland.

    Science.gov (United States)

    Stromdahl, E Y; Randolph, M P; O'Brien, J J; Gutierrez, A G

    2000-05-01

    Human monocytic ehrlichiosis (HME) is a sometimes fatal, emerging tick-borne disease caused by the bacterium Ehrlichia chaffeensis. It is frequently misdiagnosed because its symptoms mimic those of the flu. Current evidence indicates that Amblyomma americanum (L.), the lone star tick, is the major vector of HME. To determine if E. chaffeensis is present in ticks at Aberdeen Proving Ground, MD, questing A. americanum ticks were collected from 33 sites. Nucleic acid was extracted from 34 adult and 81 nymphal pools. Sequences diagnostic for E. chaffeensis from three different loci (16S rRNA, 120-kDa protein, and a variable-length polymerase chain reaction [PCR] target, or VLPT) were targeted for amplification by the PCR. Fifty-two percent of the collection sites yielded pools infected with E. chaffeensis, confirming the presence and widespread distribution of E. chaffeensis at Aberdeen Proving Ground. Analysis with the both the 120-kDa protein primers and the VLPT primers showed that genetic variance exists. A novel combination of variance for the two loci was detected in two tick pools. The pathogenic implications of genetic variation in E. chaffeensis are as yet unknown.

  6. Factors affecting patterns of Amblyomma triste (Acari: Ixodidae) parasitism in a rodent host.

    Science.gov (United States)

    Colombo, Valeria C; Nava, Santiago; Antoniazzi, Leandro R; Monje, Lucas D; Racca, Andrea L; Guglielmone, Alberto A; Beldomenico, Pablo M

    2015-07-30

    Here we offer a multivariable analysis that explores associations of different factors (i.e., environmental, host parameters, presence of other ectoparasites) with the interaction of Amblyomma triste immature stages and one of its main hosts in Argentina, the rodent Akodon azarae. Monthly and for two years, we captured and sampled rodents at 16 points located at 4 different sites in the Parana River Delta region. The analyses were conducted with Generalized Linear Mixed Models with a negative binomial response (counts of larvae or nymphs). The independent variables assessed were: (a) environmental: trapping year, season, presence of cattle; type of vegetation (natural grassland or implanted forest); rodent abundance; (b) host parameters: body length; sex; body condition; blood cell counts; natural antibody titres; and (c) co-infestation with other ectoparasites: other stage of A. triste; Ixodes loricatus; lice; mites; and fleas. Two-way interaction terms deemed a priori as relevant were also included in the analysis. Larvae were affected by all environmental variables assessed and by the presence of other ectoparasites (lice, fleas and other tick species). Host factors significantly associated with larval count were sex and levels of natural antibodies. Nymphs were associated with season, presence of cattle, body condition, body length and with burdens of I. loricatus. In most cases, the direction and magnitude of the associations were context-dependent (many interaction terms were significant). The findings of greater significance and implications of our study are two. Firstly, as burdens of A. triste larvae and nymphs were greater where cattle were present, and larval tick burdens were higher in implanted forests, silvopastoral practices developing in the region may affect the population dynamics of A. triste, and consequently the eco-epidemiology of Rickettsia parkeri. Secondly, strong associations and numerous interactions with other ectoparasites suggest that

  7. Amblyomma parvum Aragão, 1908 (Acari: Ixodidae): Phylogeography and systematic considerations.

    Science.gov (United States)

    Lado, Paula; Nava, Santiago; Labruna, Marcelo B; Szabo, Matias P J; Durden, Lance A; Bermudez, Sergio; Montagna, Matteo; Sánchez Quirós, Ana C; Beati, Lorenza

    2016-07-01

    The geographical distribution of Amblyomma parvum Aragão 1908 in the New World is disjunct, with two main clusters separated from each other by the Amazon basin. The main objectives of this study were to further investigate the systematic relationships within A. parvum, to determine whether or not populations from different geographical areas might represent cryptic species, and to reconstruct the phylogeographical evolutionary history of the species. The genetic diversity of A. parvum collected throughout its distributional range was analyzed by using 6 molecular markers: 5 mitochondrial [the small and the large ribosomal subunits 12rDNA and 16SrDNA, the cytochrome oxidase I (COI) and II (COII) and the control region or d-loop (DL)], and one nuclear (ITS2, Inter transcribed spacer 2). Phylogenetic trees were inferred by using maximum parsimony and Bayesian analyses. In addition, node dating was attempted for the main lineages identified phylogenetically. Although mitochondrial and nuclear topologies were not totally congruent, they all identified at least two main supported clusters, a Central American lineage, and a Brazilian-Argentinian lineage. Clade support and divergence values strongly suggest that the two lineages correspond to different taxonomic entities. Node dating placed the split between the Central American and the Brazilian-Argentinian lineages at approximately 5.8-4.9 Mya, just after the progressive replacement of the dry areas that occupied the northern part of South America by the Amazon Basin in the early-mid Miocene. This event might be the cause of fragmentation and putative speciation within the ancestral relatively xerophilic A. parvum population. PMID:27062445

  8. Acaricidal properties of vetiver essential oil from Chrysopogon zizanioides (Poaceae) against the tick species Amblyomma cajennense and Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Campos, Roseane Nunes de Santana; Nascimento Lima, Cecília Beatriz; Passos Oliveira, Alexandre; Albano Araújo, Ana Paula; Fitzgerald Blank, Arie; Barreto Alves, Péricles; Nascimento Lima, Rafaely; Albano Araújo, Vinícius; Santana, Alisson Silva; Bacci, Leandro

    2015-09-15

    Ticks are arthropods widely distributed in tropical and subtropical regions, which can transmit infectious agents also responsible for zoonoses. Excessive use of conventional acaricides has resulted in the onset of drug resistance by these parasites, thus the need to use alternative methods for their control. This study evaluated the acaricidal activities of Chrysopogon zizanioides (vetiver) essential oils containing different zizanoic and khuzimol (high and low acidity) acid concentrations on Amblyomma cajennense and Rhipicephalus microplus (Acari: Ixodidae). To this aims, toxicity tests of different concentrations of examined essential oils were conducted on adult females and larval stages. Results showed that the essential oils of C. zizanioides with high and low acidity reduced oviposition of females, eggs hatch and larval survival, being more effective than some commercial products widely used to control these ectoparasites. These results indicate that the C. zizanoides essential oils are promising candidates as acaricidal agents and represent also an add value to vetiver oil with high acidity, which is commercially undervalued in the cosmetic industry. PMID:26359641

  9. Acaricidal properties of vetiver essential oil from Chrysopogon zizanioides (Poaceae) against the tick species Amblyomma cajennense and Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Campos, Roseane Nunes de Santana; Nascimento Lima, Cecília Beatriz; Passos Oliveira, Alexandre; Albano Araújo, Ana Paula; Fitzgerald Blank, Arie; Barreto Alves, Péricles; Nascimento Lima, Rafaely; Albano Araújo, Vinícius; Santana, Alisson Silva; Bacci, Leandro

    2015-09-15

    Ticks are arthropods widely distributed in tropical and subtropical regions, which can transmit infectious agents also responsible for zoonoses. Excessive use of conventional acaricides has resulted in the onset of drug resistance by these parasites, thus the need to use alternative methods for their control. This study evaluated the acaricidal activities of Chrysopogon zizanioides (vetiver) essential oils containing different zizanoic and khuzimol (high and low acidity) acid concentrations on Amblyomma cajennense and Rhipicephalus microplus (Acari: Ixodidae). To this aims, toxicity tests of different concentrations of examined essential oils were conducted on adult females and larval stages. Results showed that the essential oils of C. zizanioides with high and low acidity reduced oviposition of females, eggs hatch and larval survival, being more effective than some commercial products widely used to control these ectoparasites. These results indicate that the C. zizanoides essential oils are promising candidates as acaricidal agents and represent also an add value to vetiver oil with high acidity, which is commercially undervalued in the cosmetic industry.

  10. Suppression of host-seeking Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae) nymphs after dual applications of plant-derived acaricides in New Jersey.

    Science.gov (United States)

    Jordan, Robert A; Dolan, Marc C; Piesman, Joseph; Schulze, Terry L

    2011-04-01

    We evaluated the ability of dual applications of natural, plant-derived acaricides to suppress nymphal Ixodes scapularis Say and Amblyomma americanum (L.) (Acari: Ixodidae) in a Lyme disease endemic area of New Jersey. An aqueous formulation of 2% nootkatone provided >90% control of I. scapularis through 7 d. Control declined to 80.9% at 14 d, and a second application was made that provided >95% control through the remaining 4 wk of the nymphal season. Nootkatone provided >90% control of A. americanum through 35 d postapplication. Applications of 2% carvacrol and EcoTrol T&O resulted in rapid knockdown of both tick species, but control declined significantly to 76.7 and 73.7%, respectively, after 14 d when a second application was made that extended control of both tick species to between 86.2 and 94.8% at 21 d. Subsequently, control declined steadily in all plots by 42 d postapplication except for I. scapularis in carvacrol-treated plots, where levels of control >90% were observed through 35 d. Of the three compounds tested, 2% nootkatone provided the most consistent results, with 96.5 and 91.9% control of I. scapularis and A. americanum through 42 and 35 d, respectively. The ability of plant-derived natural products to quickly suppress and maintain significant control of populations of these medically important ticks may represent a future alternative to the use of conventional synthetic acaricides. In addition, the demonstrated efficacy of properly-timed backpack sprayer application may enable homeowner access to these minimal-risk acaricides. PMID:21510219

  11. First records of the ticks Amblyomma calcaratum and A. pacae (Acari: Ixodidae) parasitizing mammals of Mexico Primeros registros de las garrapatas Amblyomma calcaratum y A. pacae (Acari: Ixodidae) parasitando mamíferos de México

    OpenAIRE

    Carmen Guzmán-Cornejo; Tila M. Pérez; Santiago Nava; Alberto A. Guglielmone

    2006-01-01

    Based on study of ticks deposited in the Colección Nacional de Ácaros, Instituto de Biología, Universidad Nacional Autónoma de México, we report the first records in Mexico for two species of Amblyomma: Amblyomma calcaratum ex Tamandua mexicana, and Amblyomma pacae ex Tapirus bairdii. These new records increase the number of species recorded for the genus Amblyomma in Mexico to 26.Basado en la revisión de garrapatas depositadas en la Colección Nacional de Ácaros, Instituto de Biología, Univer...

  12. Acaricidal activity of the essential oils from Eucalyptus citriodora and Cymbopogon nardus on larvae of Amblyomma cajennense (Acari: Ixodidae) and Anocentor nitens (Acari: Ixodidae).

    Science.gov (United States)

    Clemente, Mateus Aparecido; de Oliveira Monteiro, Caio Márcio; Scoralik, Márcio Goldner; Gomes, Fernando Teixeira; de Azevedo Prata, Márcia Cristina; Daemon, Erik

    2010-09-01

    The present study evaluated the acaricidal activity of essential oils from Eucalyptus citriodora and Cymbopogon nardus on non-engorged larvae of Amblyomma cajennense and Anocentor nitens. In order to carry out the study, six groups were formed, each concentration being a treatment (6.25%, 12.5%, 25%, and 50%, respectively) and also with the creation of a control group (distilled water) and a positive control (Deltametrine). For each treatment, approximately 100 larvae of these ticks were placed onto filter papers (2 x 2 cm) impregnated with the concentrations used to test. Next, the envelopes were closed bearing inside the filter paper with measurements of 6 x 6 cm. For each group, six repetitions were performed, and after 24 h live and dead larvae were counted. This procedure was carried out for two essential oils on the two species of ticks. For A. cajennense, the acaricide efficacy of E. citriodora oil was of 10.8%, 35.3%, 34.5%, and 53.1%, whereas the efficacy of C. nardus was of 0.0%, 0.0%, 0.0%, and 61.1% at concentrations of 6.25%, 12.5%, 25.0%, and 50.0%, respectively. In relation to A. nitens, the acaricide efficacy of E. citriodora oil was of 20.1%, 84.5%, 89.2%, and 100.0%, whereas the efficacy of C. nardus was of 0.0%, 90.8%, 100.0%, and 100.0% at concentrations of 6.25%, 12.5%, 25.0%, and 50.0%, respectively. The results indicate that the essential oils tested showed a promising acaricidal activity mainly on A. nitens larvae. PMID:20640444

  13. Garrapatas (Acari: Ixodidae) asociadas a perros en diferentes ambientes de la provincia de Corrientes, Argentina Ticks (Acari: Ixodidae) of dogs in different environments of the Corrientes Province, Argentina

    OpenAIRE

    V.N. Debárbora; E.B. Oscherov; A.A. Guglielmone; Nava, S.

    2011-01-01

    Se estudiaron las garrapatas (Acari: Ixodidae) de perros en ambientes urbanos, periurbanos y rurales de la provincia de Corrientes por medio de colecciones mensuales durante un año en siete sitios diferentes. De los 138 perros examinados, en 87 (63,04%) se determinaron tres especies de garrapatas: Amblyomma tigrinum (n=35), Amblyomma ovale (n=2) y Rhipicephalus sanguineus sensu lato (n=523). Las mayores prevalencias para A. tigrinum y R. sanguineus s.l. fueron halladas en ambientes rurales. E...

  14. First records of the ticks Amblyomma calcaratum and A. pacae (Acari: Ixodidae parasitizing mammals of Mexico Primeros registros de las garrapatas Amblyomma calcaratum y A. pacae (Acari: Ixodidae parasitando mamíferos de México

    Directory of Open Access Journals (Sweden)

    Carmen Guzmán-Cornejo

    2006-06-01

    Full Text Available Based on study of ticks deposited in the Colección Nacional de Ácaros, Instituto de Biología, Universidad Nacional Autónoma de México, we report the first records in Mexico for two species of Amblyomma: Amblyomma calcaratum ex Tamandua mexicana, and Amblyomma pacae ex Tapirus bairdii. These new records increase the number of species recorded for the genus Amblyomma in Mexico to 26.Basado en la revisión de garrapatas depositadas en la Colección Nacional de Ácaros, Instituto de Biología, Universidad Nacional Autónoma de México, establecemos los primeros registros en México para 2 especies del género Amblyomma: Amblyomma calcaratum ex Tamandua mexicana y Amblyomma pacae ex Tapirus bairdii. Estos nuevos registros incrementan a 26 el número de especies del género Amblyomma distribuidas en México.

  15. A first record of Amblyomma dissimile (Acari: Ixodidae) parasitizing the lizard Ameiva ameiva (Teiidae) in Brazil Primeiro registro de Amblyomma dissimile (Acari: Ixodidae) parasitando o lagarto Ameiva ameiva (Teiidae) no Brasil

    OpenAIRE

    Suzana Gomes Lopes; Gilda Vasconcellos de Andrade; Lívio Martins Costa-Júnior

    2010-01-01

    A non-engorged adult female Amblyomma dissimile and two Amblyomma sp. larvae were found parasitizing the lizard Ameiva ameiva in the municipality of Chapadinha, State of Maranhão. This is the first record in the state of Maranhão and fills a gap in the distribution of A. dissimile in Brazil. The lizard A. ameiva represents a new host for A. dissimile, and also the first record of this tick species infesting lizards of the family Teiidae in Brazil.Uma fêmea adulta não ingurgitada de Amblyomma ...

  16. Parasitismo em humano por Amblyomma sp (Acari: Ixodidae, na cidade de Recife, estado de Pernambuco Parasitism by Amblyomma sp (Acari: Ixodidae in humans in the city of Recife, state of Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Rafael Antonio do Nascimento Ramos

    2010-10-01

    Full Text Available INTRODUÇÃO: Os ixodídeos pertencentes ao gênero Amblyomma são encontrados no Brasil, sendo de grande importância em Saúde Pública por representarem risco na transmissão de patógenos. MÉTODOS: Este trabalho relata um caso de parasitismo em humano por Amblyomma sp, ocorrido na Cidade de Recife, Pernambuco. RESULTADOS: O parasitismo foi observado em uma senhora onde os ectoparasitos encontravam-se fixados em suas pernas e pés. CONCLUSÕES: Este tipo de achado é incomum e constitui o primeiro relato do parasitismo em humano por Amblyomma sp, no Estado de Pernambuco.INTRODUCTION: The Amblyomma genus is widely distribution in Brazil and is important regarding the public health risk represented by the transmission of pathogens. METHODS: This paper reports a case of parasitism in humans by Amblyomma sp that occurred in the City of Recife, State of Pernambuco. RESULTS: Parasitism was observed in a woman where the ticks were attached to her legs and feet. CONCLUSIONS: This finding is unusual and is the first report of parasitism in humans by Amblyomma sp in State of Pernambuco.

  17. Evaluation of DEET and eight essential oils for repellency against nymphs of the lone star tick, Amblyomma americanum (Acari: Ixodidae)

    Science.gov (United States)

    Eight commercially available essential oils (oregano, clove, thyme, vetiver, sandalwood, cinnamon, cedarwood, and peppermint) were evaluated for repellency against host-seeking nymphs of the lone star tick, Amblyomma americanum. Concentration- repellency response was established using the vertical ...

  18. A first record of Amblyomma dissimile (Acari: Ixodidae parasitizing the lizard Ameiva ameiva (Teiidae in Brazil Primeiro registro de Amblyomma dissimile (Acari: Ixodidae parasitando o lagarto Ameiva ameiva (Teiidae no Brasil

    Directory of Open Access Journals (Sweden)

    Suzana Gomes Lopes

    2010-12-01

    Full Text Available A non-engorged adult female Amblyomma dissimile and two Amblyomma sp. larvae were found parasitizing the lizard Ameiva ameiva in the municipality of Chapadinha, State of Maranhão. This is the first record in the state of Maranhão and fills a gap in the distribution of A. dissimile in Brazil. The lizard A. ameiva represents a new host for A. dissimile, and also the first record of this tick species infesting lizards of the family Teiidae in Brazil.Uma fêmea adulta não ingurgitada de Amblyomma dissimile e duas larvas de Amblyomma sp. foram encontradas parasitando o lagarto Ameiva ameiva no município de Chapadinha, Estado do Maranhão. Além de representar um novo registro para o Estado do Maranhão, esse trabalho preenche uma lacuna de distribuição geográfica de A. dissimile no país. O lagarto A. ameiva representa um novo hospedeiro para A. dissimile, sendo também o primeiro registro dessa espécie de carrapato infestando lagartos da família Teiidae no Brasil.

  19. Susceptibility of Four Tick Species Amblyomma americanum, Dermacentor variabilis, Ixodes scapularis, and Rhipicephalus sanguineus (Acari: Ixodidae) to Nootkatone

    Science.gov (United States)

    The essential oil nootkatone has shown acaricidal activity on ticks. The toxicity of nootkatone was determined in laboratory assays using a vial coating technique against unfed nymphs of four Ixodid ticks: Amblyomma americanum L., Dermacentor variabilis (Say), Ixodes scapularis Say, and Rhipicepha...

  20. The chemosensory appendage proteome of Amblyomma americanum (Acari: Ixodidae) reveals putative odorant-binding and other chemoreception-related proteins

    Science.gov (United States)

    Proteomic analyses were done on 2 chemosensory appendages of the lone star tick, Amblyomma americanum. Proteins in the fore tarsi, which contain the olfactory Haller's organ, and in the palps, that include gustatory sensilla, were compared with proteins in the third tarsi. Also, male and female tick...

  1. New host records for Amblyomma rotundatum (Acari: Ixodidae) from Grussaí restinga, Rio de Janeiro, Brazil Novos registros de hospedeiros para Amblyomma rotundatum (Acari: Ixodidae) da restinga de Grussaí, Rio de Janeiro, Brasil

    OpenAIRE

    Lúcio André Viana; Gisele Regina Winck; Marlon Almeida-Santos; Felipe Bottona da Silva Telles; Gilberto Salles Gazêta; Carlos Frederico Duarte Rocha

    2012-01-01

    Amblyomma rotundatum Koch is a parthenogenetic tick usually associated with reptiles and amphibians. However, relatively few studies on occurrences of ticks in wild reptile populations in Brazil have been produced. The aim of this study was to analyze the presence of ticks associated with reptile species in the Grussaí restinga, in the municipality of São João da Barra, state of Rio de Janeiro, Brazil. Between December 2010 and January 2011, 131 individuals belonging to nine species of reptil...

  2. Detection of Rickettsia bellii and Rickettsia amblyommii in Amblyomma longirostre (Acari: Ixodidae) from Bahia state, Northeast Brazil.

    Science.gov (United States)

    McIntosh, Douglas; Bezerra, Rodrigo Alves; Luz, Hermes Ribeiro; Faccini, João Luiz Horacio; Gaiotto, Fernanda Amato; Giné, Gastón Andrés Fernandez; Albuquerque, George Rego

    2015-01-01

    Studies investigating rickettsial infections in ticks parasitizing wild animals in the Northeast region of Brazil have been confined to the detection of Rickettsia amblyommii in immature stages of Amblyomma longirostre collected from birds in the state of Bahia, and in immatures and females of Amblyomma auricularium collected from the striped hog-nosed skunk (Conepatus semistriatus) and armadillos (Euphractus sexcinctus) in the state of Pernambuco. The current study extends the distribution of R. amblyommii (strain Aranha), which was detected in A. longirostre collected from the thin-spined porcupine Chaetomys subspinosus and the hairy dwarf porcupine Coendou insidiosus. In addition, we report the first detection of Rickettsia bellii in adults of A. longirostre collected from C. insidiosus in the state of Bahia.

  3. Repellent efficacy of formic acid and the abdominal secretion of carpenter ants (Hymenoptera: Formicidae) against Amblyomma ticks (Acari: Ixodidae).

    Science.gov (United States)

    Falótico, Tiago; Labruna, Marcelo B; Verderane, Michele P; De Resende, Briseida D; Izar, Patrícia; Ottoni, Eduardo B

    2007-07-01

    Formic acid is a substance produced by some ants for defense, trail marking, and recruitment. Some animals are known to rub ants or other arthropods on parts of their plumage or fur to anoint themselves with released substances. A recent study with a semifree-ranging group of capuchin monkeys, Cebus apella L., in the Tietê Ecological Park, Sao Paulo, Brazil, an area of occurrence of the tick species Amblyomma cajennense (F.), revealed that "anting" with carpenter ants, Camponotus rufipes F. (Hymenoptera: Formicidae), occurs frequently, especially during the A. cajennense subadult season. Based on these observations, we tested the repellent effect of the formic acid and the ants themselves against A. cajennense and Amblyomma incisum Neumann nymphs, and Amblyomma parcum Aragdo adult ticks in the laboratory. The results revealed a significant repellent effect of formic acid and ant secretion, and a significant duration of the repellent effect. The results suggest that the anting behavior of capuchin monkeys, and other vertebrates, may be related with repellence of ticks and other ectoparasites. PMID:17695031

  4. Repellent efficacy of formic acid and the abdominal secretion of carpenter ants (Hymenoptera: Formicidae) against Amblyomma ticks (Acari: Ixodidae).

    Science.gov (United States)

    Falótico, Tiago; Labruna, Marcelo B; Verderane, Michele P; De Resende, Briseida D; Izar, Patrícia; Ottoni, Eduardo B

    2007-07-01

    Formic acid is a substance produced by some ants for defense, trail marking, and recruitment. Some animals are known to rub ants or other arthropods on parts of their plumage or fur to anoint themselves with released substances. A recent study with a semifree-ranging group of capuchin monkeys, Cebus apella L., in the Tietê Ecological Park, Sao Paulo, Brazil, an area of occurrence of the tick species Amblyomma cajennense (F.), revealed that "anting" with carpenter ants, Camponotus rufipes F. (Hymenoptera: Formicidae), occurs frequently, especially during the A. cajennense subadult season. Based on these observations, we tested the repellent effect of the formic acid and the ants themselves against A. cajennense and Amblyomma incisum Neumann nymphs, and Amblyomma parcum Aragdo adult ticks in the laboratory. The results revealed a significant repellent effect of formic acid and ant secretion, and a significant duration of the repellent effect. The results suggest that the anting behavior of capuchin monkeys, and other vertebrates, may be related with repellence of ticks and other ectoparasites.

  5. Morphological description of Amblyomma brasiliense Aragão, 1908 (Acari: Ixodidae larvae and nymphs Descrição morfológica de larvas e ninfas de Amblyomma brasiliense Aragão, 1908 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Gustavo Seron Sanches

    2009-09-01

    Full Text Available The immature stages of Neotropical ticks are poorly known and in many cases have not been described. This work presents a morphological description of Amblyomma brasiliense larvae (F1 and a redescription of nymphs (F1. A. brasiliense is reported as one of the most aggressive ticks to humans in Brazil. Immature ticks obtained from a laboratory colony initiated from adult specimens collected in the Parque Estadual Intervales (24º 18' S and 48º 24' W, São Paulo, Brazil, were analyzed under scanning electron microscope, and also under light and stereoscopic microscopes. A. brasiliense larvae present basis capituli rectangular; short palpi; rounded idiosoma; coxa I with two spurs, the external one being longer than the internal one; and coxae II and III each with one short spur. Nymphs present basis capituli rectangular with a sharp pointed cornua; oval idiosoma with scutum reaching coxa III; coxa I with two evident spurs, the external one being longer than the internal one; coxae II-III each with one short spur; and coxa IV with a very short spur and chitinous tubercles on internal surface of posterior border of idiosoma. These morphological features, in association with chaetotaxy and porotaxy, should make possible the identification of immature Amblyomma ticks.Os estágios imaturos dos carrapatos Neotropicais são pouco conhecidos e, em muitos casos, não estão descritos. Este trabalho apresenta uma descrição morfológica das larvas (F1 e redescrição das ninfas (F1 do carrapato Amblyomma brasiliense, relatado como um dos ixodídeos mais agressivos ao homem no Brasil. Para este fim, carrapatos imaturos de uma colônia iniciada com espécimes adultos do Parque Estadual de Intervales, São Paulo, Brasil foram analisados sob microscopia eletrônica de varredura, microscopia de luz e lupa estereoscópica. Observou-se que larvas têm a base do capítulo retangular, palpos curtos e idiossoma arredondado, coxa I com dois espinhos, sendo o externo

  6. Taxonomic key to nymphs of the genus Amblyomma (Acari: Ixodidae) in Argentina, with description and redescription of the nymphal stage of four Amblyomma species.

    Science.gov (United States)

    Martins, Thiago F; Labruna, Marcelo B; Mangold, Atilio J; Cafrune, M Mercedes; Guglielmone, Alberto A; Nava, Santiago

    2014-10-01

    In the present study, we provide morphological descriptions of the nymph of Amblyomma parvitarsum, A. tonelliae, and redescriptions of A. argentinae and A. sculptum. A taxonomic key, with relevant morphological characters illustrated by scanning electron micrographs, is provided for nymphs of the 24 species of the genus Amblyomma occurring in Argentina. Species included are A. argentinae, A. aureolatum, A. auricularium, A. boeroi, A. brasiliense, A. calcaratum, A. coelebs, A. dissimile, A. dubitatum, A. incisum, A. longirostre, A. neumanni, A. nodosum, A. ovale, A. parvitarsum, A. parvum, A. pseudoconcolor, A. pseudoparvum, A. rotundatum, A. sculptum, A. tigrinum, A. tonelliae, A. triste and A. varium. Principal morphological characters used for discrimination among species are presence/absence of auriculae, cornua and festoons with tubercles, size and shape of spurs of coxa I, margin and punctations of scutum, shape of basis capituli and length of cervical grooves. The geographical distribution of each tick species included in this work is presented and the importance of an accurate determination to species level of the Amblyomma nymphs to make epidemiological inferences is also discussed. PMID:25113984

  7. Primer registro de infestación en un reptil por larvas de Amblyomma parvitarsum (Acari: Ixodidae en Argentina

    Directory of Open Access Journals (Sweden)

    Gabriel Natalio Castillo

    2015-05-01

    Full Text Available Amblyomma parvitarsum es una garrapata endémica del Altiplano Andino de Argentina, Bolivia, Chile y Perú. En la provincia de San Juan adultos de esta garrapata fueron encontrados en el Parque Nacional San Guillermo sobre Vicugna vicugna. En Argentina también existen citas de adultos de A. parvitarsum sobre bovinos, ovinos y el ñandú . El primer caso de parasitismo de larvas de A. parvitarsum en Liolaemus fue realizado en Chile. El presente trabajo menciona por primera vez para Argentina la presencia de larvas de A. parvitarsum parasitando al lagarto Liolaemus eleodori.

  8. Description of the larva of Amblyomma calcaratum Neumann, 1899 (Acari: Ixodidae) by light and scanning electron microscopy.

    Science.gov (United States)

    Barbieri, Fábio S; Brito, Luciana G; Labruna, Marcelo B; Barros-Battesti, Darci M; Camargo, Luis Marcelo A; Famadas, Kátia M

    2013-12-01

    The larval stage of Amblyomma calcaratum Neumann is described using optical and scanning electron microscopy. Unfed larvae were obtained from a colony of A. calcaratum originating from engorged females collected on Tamandua tetradactyla in the Jaraguá Mountain (23°40'S, 45°44'W), São Paulo County, Brazil. Eleven larvae were prepared and mounted on slides and observed under a light microscope equipped with a drawing tube. Three specimens were prepared for SEM. Several morphological characters are described, including the chaetotaxy of the idiosoma, palpi, and Haller's organ, as well as morphological features of the idiosoma, gnathosoma, and legs of A. calcaratum larvae. In addition, topographical and numerical patterns of integumentary structures on the larval idiosoma are described using a recently proposed nomenclature. On the idiosoma, setaes, lyrifissures, small glands, and large wax glands were found. These structures were observed isolated or associated over the entire idiosoma, except on the scutum, which lacks large wax glands. The topographical and numerical patterns of integumentary structures of the A. calcaratum larva showed only minor differences when compared with patterns of other Amblyomma larvae; however, a few key features can be used to differentiate A. calcaratum from other members of this genus. PMID:24169118

  9. New host records for Amblyomma rotundatum (Acari: Ixodidae from Grussaí restinga, Rio de Janeiro, Brazil Novos registros de hospedeiros para Amblyomma rotundatum (Acari: Ixodidae da restinga de Grussaí, Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Lúcio André Viana

    2012-09-01

    Full Text Available Amblyomma rotundatum Koch is a parthenogenetic tick usually associated with reptiles and amphibians. However, relatively few studies on occurrences of ticks in wild reptile populations in Brazil have been produced. The aim of this study was to analyze the presence of ticks associated with reptile species in the Grussaí restinga, in the municipality of São João da Barra, state of Rio de Janeiro, Brazil. Between December 2010 and January 2011, 131 individuals belonging to nine species of reptiles of the order Squamata were sampled: the lizards Tropidurus torquatus (n = 51, Hemidactylus mabouia (n = 25, Mabuya agilis (n = 30, Mabuya macrorhyncha (n = 6, Cnemidophorus littoralis (n = 5 and Ameiva ameiva (n = 10; and the snakes Philodryas olfersii (n = 2, Oxyrhopus rhombifer (n = 1 and Micrurus corallinus (n = 1. The only tick species found to be associated with any of the reptiles sampled was A. rotundatum. One adult female was detected on one individual of the lizard A. ameiva, one nymph on one individual of the lizard T. torquatus and four nymphs on one individual of the snake P. olfersii. This study is the first record of parasitism of A. rotundatum involving the reptiles T. torquatus and P. olfersii as hosts. Our results suggest that in the Grussaí restinga habitat, A. rotundatum may use different species of reptiles to complete its life cycle.Amblyomma rotundatum Koch é um carrapato partenogenético geralmente associado a répteis e anfíbios. Entretanto existem relativamente poucos estudos sobre a ocorrência de carrapatos em populações silvestres de répteis no Brasil. O objetivo deste estudo foi analisar a presença de carrapatos associados às espécies de répteis em uma comunidade na restinga de Grussaí, município de São João da Barra, Estado do Rio de Janeiro, Brasil. Foram amostradas, entre os meses de dezembro de 2010 e janeiro de 2011, 131 indivíduos pertencentes a nove espécies de répteis da ordem Squamata: lagartos

  10. Host Specificity of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae with Comments on the Drop-off Rhythm

    Directory of Open Access Journals (Sweden)

    Cristina Marques Lisbôa Lopes

    1998-05-01

    Full Text Available The parasitic specificity of larval, nymph and adult Amblyomma cajennense on six different host species: Oryctolagus cuniculus, Rattus norvegicus, Gallus gallus domesticus, Anas platyrhynchus, Coturnix coturnix and Streptopelia decorata is described. In terms of the numbers of larvae and nymphs recovered, O. cuniculus was the best host species. The modal day for drop-off of larvae and nymphs was day three for the mammal hosts, but variable in the birds. We conclude that adult A. cajennense have a strong degree of specificity due to the fact that the tick failed to complete its life cycle on any of the evaluated hosts. The immature stages, on the other hand, showed a low level of specificity, most especially in the larval stage, indicating the existence of secondary hosts which probably serve as dispersers in the wild. The results also indicated a variable drop-off rhythm for larvae and nymphs in two periods, diurnal (6-18 hr and nocturnal (18-6 hr, which differed depending upon the host.

  11. Evaluation of DEET and eight essential oils for repellency against nymphs of the lone star tick, Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Meng, Hao; Li, Andrew Y; Costa Junior, Livio M; Castro-Arellano, Ivan; Liu, Jingze

    2016-02-01

    DEET and Eight commercially available essential oils (oregano, clove, thyme, vetiver, sandalwood, cinnamon, cedarwood, and peppermint) were evaluated for repellency against host-seeking nymphs of the lone star tick, Amblyomma americanum. Concentration-repellency response was established using the vertical paper bioassay technique for each essential oil and compared with that of N,N-diethyl-3-methyl benzamide (DEET), a standard repellent compound present in many commercial repellent formulations. The effective concentration of DEET that repels 50% of ticks (EC50) was estimated at 0.02 mg/cm(2), while EC50s of the essential oils fall between 0.113 and 0.297 mg/cm(2). Based on EC50 estimates, oregano essential oil was the most effective among all essential oils tested, followed by clove, thyme, vetiver, sandalwood, cinnamon, cedarwood, and peppermint oils. None of the tested essential oils demonstrated a level of tick repellency found with DEET. Results from this study illustrated the challenge in search for more effective natural tick repellents. PMID:26590930

  12. New host records for Amblyomma rotundatum (Acari: Ixodidae) from Grussaí restinga, Rio de Janeiro, Brazil.

    Science.gov (United States)

    Viana, Lúcio André; Winck, Gisele Regina; Almeida-Santos, Marlon; Telles, Felipe Bottona da Silva; Gazêta, Gilberto Salles; Rocha, Carlos Frederico Duarte

    2012-01-01

    Amblyomma rotundatum Koch is a parthenogenetic tick usually associated with reptiles and amphibians. However, relatively few studies on occurrences of ticks in wild reptile populations in Brazil have been produced. The aim of this study was to analyze the presence of ticks associated with reptile species in the Grussaí restinga, in the municipality of São João da Barra, state of Rio de Janeiro, Brazil. Between December 2010 and January 2011, 131 individuals belonging to nine species of reptiles of the order Squamata were sampled: the lizards Tropidurus torquatus (n = 51), Hemidactylus mabouia (n = 25), Mabuya agilis (n = 30), Mabuya macrorhyncha (n = 6), Cnemidophorus littoralis (n = 5) and Ameiva ameiva (n = 10); and the snakes Philodryas olfersii (n = 2), Oxyrhopus rhombifer (n = 1) and Micrurus corallinus (n = 1). The only tick species found to be associated with any of the reptiles sampled was A. rotundatum. One adult female was detected on one individual of the lizard A. ameiva, one nymph on one individual of the lizard T. torquatus and four nymphs on one individual of the snake P. olfersii. This study is the first record of parasitism of A. rotundatum involving the reptiles T. torquatus and P. olfersii as hosts. Our results suggest that in the Grussaí restinga habitat, A. rotundatum may use different species of reptiles to complete its life cycle. PMID:23070450

  13. Biases associated with several sampling methods used to estimate abundance of Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Schulze, T L; Jordan, R A; Hung, R W

    1997-11-01

    Several tick sampling methods were evaluated for ixodes scapularis Say and Amblyomma americanum (I.) in oak-dominated mixed hard-wood, pitch pine-dominated, and mixed hardwood and pine forests in coastal New Jersey. Walking surveys were more efficient for collecting I. scapularis adults than dragging by a factor of > 2:1. In contrast, drag sampling yielded nearly twice as many A. americanum adults compared with walking surveys. I. scapularis subadults were rarely collected during walking surveys. A. americanum nymphs were collected from drags approximately 3:1 over walking surveys. Twice as many A. americanum larvae were obtained from drags compared with walking surveys. All developmental stages of A. americanum responded positively to carbon dioxide. Pitfall traps and leaf litter samples collected very few ticks. Tick distribution among habitats varied significantly with the sampling method chosen, and the relative ranking of sites with respect to tick abundance varied depending on the stage of tick sampled. Failure to recognize the biases in these commonly used sampling techniques can potentially lead to incorrect conclusions that can have significant adverse public health consequences. PMID:9439115

  14. Notes on parasitism by Amblyomma humerale (Acari: Ixodidae) in the state of Rondônia, western Amazon, Brazil.

    Science.gov (United States)

    Labruna, Marcelo B; Camargo, Luís Marcelo A; Terrassini, Flávio A; Schumaker, Teresinha T S; Camargo, Erney P

    2002-11-01

    The tick Amblyomma humerale Koch is endemic to South America. All host records refer to the adult stage parasitizing tortoises, mostly yellow-footed tortoise, Geochelone denticulata (L.), and red-footed tortoise, Geochelone carbonaria (Spix). The current study reports the presence of A. humerale in the state of Rondônia, Brazil. A total of 215 adult ticks (201 males, 14 females) was collected from six G denticulata in an Indian reserve and nine Geochelone sp. in rural Monte Negro County, giving an overall mean infestation of 14.3 +/- 12.0 (range: 2-44) ticks per tortoise. Male ticks always outnumbered females on the host and nine tortoises had only male ticks. Male ticks were mostly attached in clusters on the ventral sides of the carapace near the anterior and posterior margins, and more rarely on the outer margin of the plastron. All females were found attached to the tortoise skin, at different sites such as head, neck, shoulders or legs. Male ticks were rarely observed attached to the body skin. Seven engorged nymphs collected on small vertebrates from Monte Negro County molted to adults of A. humerale. This included one nymph each on the seven-colored lizard, Plica plica (L), green tree climber, Plica umbra (L.), and wide-foraging lizard, Kentropyx calcarata Spix,three nymphs on the common opossum, Didelphis marsupialis L., and one nymph on the silky anteater, Cyclopes didactylus L. These constitute the first host records for the immature stages of the tick A. humerale. PMID:12495177

  15. Amblyomma rotundatum (Koch, 1844 (Acari: Ixodidae two-host life-cycle on Viperidae snakes Ciclo dioxênico em Amblyomma rotundatum (Koch, 1844 (Acari: Ixodidaeparasitando serpentes da família Viperidae

    Directory of Open Access Journals (Sweden)

    Daniel Sobreira Rodrigues

    2010-09-01

    Full Text Available Amblyomma rotundatum is an ixodid tick that infests ectothermic animals and reproduces exclusively by parthenogenesis. This tick has been frequently reported to infest reptiles and amphibians, under natural conditions and sometimes in captivity. It was described in Brazil and several other countries of South, Central and North America. Although many studies have reported aspects of its biology, none of them has used regularly either ophidian as hosts, or controlled temperature, humidity and luminosity for parasitic stages. The objective of this experiment was to study the life cycle of A. rotundatum feeding on Viperidae snakes under room controlled conditions at 27 ± 1 ºC temperature, 85 ± 10% relative humidity and 12:12 hours photoperiod for parasitic stages, and under B.O.D incubator conditions at 27 ± 1 ºC temperature, 85 ± 10% relative humidity and scotophase for non-parasitic stages. The total duration of the life cycle ranged from 56 to 163 days (mean of 105 days. Two-host life cycle was observed for most of the ixodid population studied.Amblyomma rotundatum é um carrapato da família Ixodidae, parasito de animais pecilotérmicos, e que se reproduz exclusivamente por partenogênese. Este carrapato é frequentemente relatado infestando répteis e anfíbios em condições naturais e, às vezes, em animais de cativeiro. Ele já foi relatado no Brasil e em vários outros países das Américas do Sul, Central e do Norte. Embora muitos estudos sobre sua biologia tenham sido publicados, nunca foram utilizados ofídios como hospedeiros e, tão pouco, foram realizados ensaios com os estádios parasitários sob condições controladas de temperatura, umidade e iluminação. O objetivo deste experimento foi estudar o ciclo biológico de A. rotundatum se alimentando em serpentes da família Viperidae sob condições ambientais controladas a 27 ± 1 ºC de temperatura, 85 ± 10% de umidade relativa do ar e 12:12 horas de fotoperíodo para est

  16. Estudo comparativo do aspecto da hemolinfa de algumas espécies de carrapatos (Acari, Ixodidae: descrição da variação hemocitária de adultos de Amblyomma cajennense (Fabricius Koch Comparative study of the hemolymph aspect from a few ticks species (Acari, Ixodidae: description of the hemocyte variation of adults of Amblyomma cajennense (Fabricius Koch

    Directory of Open Access Journals (Sweden)

    Maria Elisa Carneiro

    2002-07-01

    Full Text Available The hemocyte composition of adults of Amblyomma cajennense (Fabricius, 1787 Koch, 1844 adults consisted of three basic cellular types: prahemocyte I (PR I, plasmatocyte (PL and spherulocyte (ES II. Among the ixodids observed (A. cajennense; A. dissimile Koch, 1844; Rhipicephalus sanguineus Latreille, 1806; Anocentor nitens (Neumann, 1897 Schulze, 1937; Boophilus microplus Canestrini, 1887 and Haemaphysalis sp. only A. cajennense was different in the adult hemolymph colour. It changed from amber to deep blue as the ixodid age advanced. This fact could be associated with the presence of hemocyanin in the hemolymph and points out the need to develop further investigations about the Ixodidae hemolymph pratein composition as well as the function of all the types found in it. This information could aid the studies on ticks control.

  17. Ticks (Acari: Ixodidae) infesting birds in an Atlantic rain forest region of Brazil.

    Science.gov (United States)

    Ogrzewalska, Maria; Pacheco, Richard C; Uezu, Alexandre; Richtzenhain, Leonardo J; Ferreira, Fernando; Labruna, Marcelo B

    2009-09-01

    Brazil has the third richest bird diversity of the world; however, there are few data concerning ticks (Acari: Ixodidae) parazitizing birds. The aim of the study was to report tick infestations on wild birds from an Atlantic rain forest region of Brazil. During 2 yr, ticks were collected from birds and from the environment in 12 forest sites. A total of 1,725 birds were captured representing 80 species from 24 families. In total, 223 (13%) birds were found infested by immature stages of Amblyomma ticks: 1,800 larvae and 539 nymphs. The prevalence of ticks was higher among birds from the families Thamnophilidae, Conopophagidae, and Momotidae. The most common tick parasitizing birds was Amblyomma nodosum Koch. Other tick species, Amblyomma coelebs Neumann, Amblyomma cajennense (F.), Amblyomma ovale Koch, Amblyomma longirostre (Koch), Amblyomma calcaratum Neumann, and Amblyomma naponense (Packard), were found sporadically. Among free-living ticks collected in the environment, A. cajennense was the most common, followed by A. coelebs, A. naponense, Amblyomma brasilense Aragão, and Hemaphysalis juxtakochi Cooley. PMID:19769058

  18. Controle estratégico de Amblyomma cajennense (Fabricius, 1787 (acari: xodidae em eqüinos, Minas Gerais, Brasil - Parte I Strategic control of Amblyomma cajennense (Fabricius, 1787 (acari: ixodidae on horses, Minas Gerais, Brazil - Part I

    Directory of Open Access Journals (Sweden)

    Arildo P. Da Cunha

    2007-12-01

    Full Text Available Objetivou-se verificar a eficiência de um programa de controle estratégico de Amblyomma cajennense em eqüinos sob condições de campo. Os tratamentos carrapaticidas foram realizados a cada sete dias e divididos em dois módulos: o primeiro com início em abril e término em maio de 2004 (oito banhos e o segundo com início e término em julho de 2004 (cinco banhos, visando atingir as larvas e ninfas do carrapato. Empregou-se a base química piretróide - cipermetrina 0,015%, para banhar os eqüinos. Após o programa de controle houve uma redução de 44,85% da carga parasitária de adultos do carrapato no período de outubro de 2004 a março 2005, e de 59,74%, em fevereiro e março de 2005. Os resultados demonstraram a efetividade do controle estratégico. No entanto, consideram-se importantes fatores operacionais e de gerenciamento que podem interferir na aplicação prática desta tecnologia.The aim of this study was to verify the efficiency of a strategic control program of Amblyomma cajennense in horses under field conditions. Acaricide treatments were applied at seven days intervals and divided in two series, the first one beginning in April 2004 (eight treatments, and the second one beginning in July 2004 (five treatments, aiming to control larvae and nymphs of the tick. A pyrethroid chemical base cypermethrin 0.015% was used for spraying the horses. There was a reduction of 44.85% in the adults infestetion of the tick in the period of October 2004 to March 2005, and 59.74%, in February and March 2005. Results showed the effectiveness of the strategic control. Important administrative and operational procedures can interfere with the practical application of this technology, and should be considered.

  19. Efficacy of amitraz collars on white-tailed deer, Odocoileus virginianus (Zimmerman) (Artiodactyla: Cervidae) against free-living populations of Lone Star Ticks, Amblyomma americanum (L.) (Acari: Ixodidae)

    Science.gov (United States)

    Collars containing the acaricide amitraz were fitted around necks of white-tailed deer, Odocoileus virginianus (Zimmermann) confined in a 38.8 ha deer-fenced, densely vegetated plot in south Texas to determine efficacy in controlling free-living populations of lone star ticks, Amblyomma americanum (...

  20. High prevalence of "Candidatus Rickettsia andeanae" and apparent exclusion of Rickettsia parkeri in adult Amblyomma maculatum (Acari: Ixodidae) from Kansas and Oklahoma.

    Science.gov (United States)

    Paddock, Christopher D; Denison, Amy M; Dryden, Michael W; Noden, Bruce H; Lash, R Ryan; Abdelghani, Sarah S; Evans, Anna E; Kelly, Aubree R; Hecht, Joy A; Karpathy, Sandor E; Ganta, Roman R; Little, Susan E

    2015-04-01

    Amblyomma maculatum (the Gulf Coast tick), an aggressive, human-biting, Nearctic and Neotropical tick, is the principal vector of Rickettsia parkeri in the United States. This pathogenic spotted fever group Rickettsia species has been identified in 8-52% of questing adult Gulf Coast ticks in the southeastern United States. To our knowledge, R. parkeri has not been reported previously from adult specimens of A. maculatum collected in Kansas or Oklahoma. A total of 216 adult A. maculatum ticks were collected from 18 counties in Kansas and Oklahoma during 2011-2014 and evaluated by molecular methods for evidence of infection with R. parkeri. No infections with this agent were identified; however, 47% of 94 ticks collected from Kansas and 73% of 122 ticks from Oklahoma were infected with "Candidatus Rickettsia andeanae" a spotted fever group Rickettsia species of undetermined pathogenicity. These preliminary data suggest that "Ca. R. andeanae" is well-adapted to survival in populations of A. maculatum in Kansas and Oklahoma, and that its ubiquity in Gulf Coast ticks in these states may effectively exclude R. parkeri from their shared arthropod host, which could diminish markedly or preclude entirely the occurrence of R. parkeri rickettsiosis in this region of the United States. PMID:25773931

  1. High prevalence of "Candidatus Rickettsia andeanae" and apparent exclusion of Rickettsia parkeri in adult Amblyomma maculatum (Acari: Ixodidae) from Kansas and Oklahoma.

    Science.gov (United States)

    Paddock, Christopher D; Denison, Amy M; Dryden, Michael W; Noden, Bruce H; Lash, R Ryan; Abdelghani, Sarah S; Evans, Anna E; Kelly, Aubree R; Hecht, Joy A; Karpathy, Sandor E; Ganta, Roman R; Little, Susan E

    2015-04-01

    Amblyomma maculatum (the Gulf Coast tick), an aggressive, human-biting, Nearctic and Neotropical tick, is the principal vector of Rickettsia parkeri in the United States. This pathogenic spotted fever group Rickettsia species has been identified in 8-52% of questing adult Gulf Coast ticks in the southeastern United States. To our knowledge, R. parkeri has not been reported previously from adult specimens of A. maculatum collected in Kansas or Oklahoma. A total of 216 adult A. maculatum ticks were collected from 18 counties in Kansas and Oklahoma during 2011-2014 and evaluated by molecular methods for evidence of infection with R. parkeri. No infections with this agent were identified; however, 47% of 94 ticks collected from Kansas and 73% of 122 ticks from Oklahoma were infected with "Candidatus Rickettsia andeanae" a spotted fever group Rickettsia species of undetermined pathogenicity. These preliminary data suggest that "Ca. R. andeanae" is well-adapted to survival in populations of A. maculatum in Kansas and Oklahoma, and that its ubiquity in Gulf Coast ticks in these states may effectively exclude R. parkeri from their shared arthropod host, which could diminish markedly or preclude entirely the occurrence of R. parkeri rickettsiosis in this region of the United States.

  2. A Dynamic Population Model to Investigate Effects of Climate and Climate-Independent Factors on the Lifecycle of Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Ludwig, Antoinette; Ginsberg, Howard S; Hickling, Graham J; Ogden, Nicholas H

    2016-01-01

    The lone star tick, Amblyomma americanum, is a disease vector of significance for human and animal health throughout much of the eastern United States. To model the potential effects of climate change on this tick, a better understanding is needed of the relative roles of temperature-dependent and temperature-independent (day-length-dependent behavioral or morphogenetic diapause) processes acting on the tick lifecycle. In this study, we explored the roles of these processes by simulating seasonal activity patterns using models with site-specific temperature and day-length-dependent processes. We first modeled the transitions from engorged larvae to feeding nymphs, engorged nymphs to feeding adults, and engorged adult females to feeding larvae. The simulated seasonal patterns were compared against field observations at three locations in United States. Simulations suggested that 1) during the larva-to-nymph transition, some larvae undergo no diapause while others undergo morphogenetic diapause of engorged larvae; 2) molted adults undergo behavioral diapause during the transition from nymph-to-adult; and 3) there is no diapause during the adult-to-larva transition. A model constructed to simulate the full lifecycle of A. americanum successfully predicted observed tick activity at the three U.S. study locations. Some differences between observed and simulated seasonality patterns were observed, however, identifying the need for research to refine some model parameters. In simulations run using temperature data for Montreal, deterministic die-out of A. americanum populations did not occur, suggesting the possibility that current climate in parts of southern Canada is suitable for survival and reproduction of this tick.

  3. A dynamic population model to investigate effects of climate and climate-independent factors on the lifecycle of the tick Amblyomma americanum (Acari: Ixodidae)

    Science.gov (United States)

    Ludwig, Antoinette; Ginsberg, Howard; Hickling, Graham J.; Ogden, Nicholas H.

    2015-01-01

    The lone star tick, Amblyomma americanum, is a disease vector of significance for human and animal health throughout much of the eastern United States. To model the potential effects of climate change on this tick, a better understanding is needed of the relative roles of temperature-dependent and temperature-independent (day-length-dependent behavioral or morphogenetic diapause) processes acting on the tick lifecycle. In this study, we explored the roles of these processes by simulating seasonal activity patterns using models with site-specific temperature and day-length-dependent processes. We first modeled the transitions from engorged larvae to feeding nymphs, engorged nymphs to feeding adults, and engorged adult females to feeding larvae. The simulated seasonal patterns were compared against field observations at three locations in United States. Simulations suggested that 1) during the larva-to-nymph transition, some larvae undergo no diapause while others undergo morphogenetic diapause of engorged larvae; 2) molted adults undergo behavioral diapause during the transition from nymph-to-adult; and 3) there is no diapause during the adult-to-larva transition. A model constructed to simulate the full lifecycle of A. americanum successfully predicted observed tick activity at the three U.S. study locations. Some differences between observed and simulated seasonality patterns were observed, however, identifying the need for research to refine some model parameters. In simulations run using temperature data for Montreal, deterministic die-out of A. americanum populations did not occur, suggesting the possibility that current climate in parts of southern Canada is suitable for survival and reproduction of this tick.

  4. Susceptibility of four tick species, Amblyomma americanum, Dermacentor variabilis, Ixodes scapularis, and Rhipicephalus sanguineus (Acari: Ixodidae), to nootkatone from essential oil of grapefruit.

    Science.gov (United States)

    Flor-Weiler, Lina B; Behle, Robert W; Stafford, Kirby C

    2011-03-01

    Toxicity of nootkatone was determined in laboratory assays against unfed nymphs of Amblyomma americanum L., Dermacentor variabilis (Say), Ixodes scapularis Say, and Rhipicephalus sanguineus Latreille. We determined the 50% lethal concentration (LC50) and 90% lethal concentration (LC90) of nootkatone by recording tick mortality 24 h after exposure in treated glass vials. Nymphs were susceptible to nootkatone with LC50 values of 0.352, 0.233, 0.169, and 0.197 microg/cm2, and LC90 values of 1.001, 0.644, 0.549, and 0.485 microg/cm2 for A. americanum, D. variabilis, I. scapularis, and R. sanguineus, respectively. The LC50 value for R. sanquineus was not significantly different from D. variabilis or I. scapularis. Other LC50 comparisons were significantly different. The LC90 for A. americanum was higher when compared with the three other tick species, which were not significantly different. Because nootkatone is volatile, we measured the amount of nootkatone recovered from duplicate-treated vials before tick exposure and from vials after tick exposure. Nootkatone recovered from vials before exposure ranged from 82 to 112% of the expected amounts. The nootkatone recovered after the 24-h exposure period ranged from 89% from vials coated with higher concentrations of nootkatone, down to 29% from vials coated with low nootkatone concentrations. Determination of the nootkatone residue after vial coating demonstrated loss of the active compound while verifying the levels of tick exposure. Toxicity of low concentrations of nootkatone to the active questing stage of ticks reported in this study provides a reference point for future formulation research to exploit nootkatone as a safe and environment-friendly tick control. PMID:21485368

  5. Comparison of flagging, walking, trapping, and collecting from hosts as sampling methods for northern deer ticks, Ixodes dammini, and lone-star ticks, Amblyomma americanum (Acari:Ixodidae).

    Science.gov (United States)

    Ginsberg, H S; Ewing, C P

    1989-09-01

    Ticks were sampled by flagging, collecting from the investigator's clothing (walking samples), trapping with dry-ice bait, and collecting from mammal hosts on Fire Island, NY, U.S.A. The habitat distribution of adult deer ticks, Ixodes dammini, was the same in simultaneous collections from the investigator's clothing and from muslin flags. Walking and flagging samples can both be biased by differences between investigators, so the same person should do comparative samples whenever possible. Walking samples probably give a more accurate estimate than flagging samples of the human risk of encountering ticks. However, ticks (such as immature I. dammini) that seek hosts in leaf litter and ground-level vegetation are poorly sampled by walking collections. These ticks can be sampled by flagging at ground level. Dry-ice-baited tick-traps caught far more lone-star ticks, Amblyomma americanum, than deer ticks, even in areas where deer ticks predominated in flagging samples. In comparisons of tick mobility in the lab, nymphal A. americanum were more mobile than nymphal I. dammini in 84% of the trials. Therefore, the trapping bias may result from increased trap encounter due to more rapid movement by A. americanum, although greater attraction to carbon dioxide may also play a role. Tick traps are useful for intraspecific between-habitat comparisons. Early in their seasonal activity period, larval I. dammini were better represented in collections from mouse hosts than in flagging samples. Apparently, sampling from favored hosts can detect ticks at low population levels, but often cannot be used to get accurate estimates of pathogen prevalence in questing ticks. PMID:2806016

  6. Garrapatas (Acari: Ixodidae asociadas a perros en diferentes ambientes de la provincia de Corrientes, Argentina Ticks (Acari: Ixodidae of dogs in different environments of the Corrientes Province, Argentina

    Directory of Open Access Journals (Sweden)

    V.N. Debárbora

    2011-06-01

    Full Text Available Se estudiaron las garrapatas (Acari: Ixodidae de perros en ambientes urbanos, periurbanos y rurales de la provincia de Corrientes por medio de colecciones mensuales durante un año en siete sitios diferentes. De los 138 perros examinados, en 87 (63,04% se determinaron tres especies de garrapatas: Amblyomma tigrinum (n=35, Amblyomma ovale (n=2 y Rhipicephalus sanguineus sensu lato (n=523. Las mayores prevalencias para A. tigrinum y R. sanguineus s.l. fueron halladas en ambientes rurales. Especímenes de R. sanguineus s.l. fueron detectados a lo largo de todo el año, con picos de abundancia en primavera y verano, A. tigrinum fue encontrada en otoño, invierno y primavera con un pico en esta última estación, mientras que A. ovale fue colectada sólo en primavera. Rhipicephalus sanguineus s.l. y A. tigrinum fueron halladas en todos los ambientes muestreados, pero el primer taxón fue siempre el más abundante. Teniendo en cuenta que las especies del complejo R. sanguineus son potenciales vectores de microorganismos patógenos para los perros y humanos, y debido a la alta prevalencia registrada en este estudio, queda en evidencia la relevancia de aplicar métodos para su control en las áreas incluidas en este estudio.Ticks (Acari: Ixodidae of dogs in urban, peri-urban and rural areas from the Corrientes Province, Argentina, were studied. They were monthly collected during one year at 7 different sites. A total of 138 dogs were examined, and 87 (63.04% of them were infested; and three species were determined: Amblyomma tigrinum (n=35, Amblyomma ovale (n=2 and Rhipicephalus sanguineus sensu lato (n=523. Both A. tigrinum and R. sanguineus s.l. had the highest prevalence in rural areas. Specimens of R. sanguineus s.l. were collected in the four seasons, but the peaks of abundance were detected in spring and summer. Amblyomma tigrinum was found in autumn, winter and spring, with the peak of abundance in spring, and the two specimens of A. ovale were

  7. Monitoring of resistance or susceptibility of adults and larvae of Amblyomma cajennense (Acari: Ixodidae) to synthetic acaricides in Goiás, Brazil.

    Science.gov (United States)

    Freitas, Edméia de Paula e Souza; Zapata, Marco Túlio Antônio Garcia; Fernandes, Fernando de Freitas

    2011-02-01

    Amblyomma cajennense or the Cayenne tick is a three-host ixodid tick species of low parasitic specificity that is the principal vector of Brazilian spotted fever. The primary objective of this study was to evaluate the possible development of resistance by adult specimens of A. cajennense to deltamethrin, a synthetic pyrethroid insecticide and the principal miticide/acaricide commercially available in the region. The second objective was to monitor the susceptibility and/or resistance of larvae of this species to 12 synthetic acaricide formulations selected from the principal pesticides available in Goiás for the control of ticks. Unfed male and female adult specimens of A. cajennense were collected from leaves of bushes along a nature trail in the municipality of Caldas Novas, Goiás, Brazil. They were submitted to immersion in the highest recommended dose of deltamethrin and subsequently, were placed in contact with filter paper impregnated with the substance. The toxicological effects caused by the insecticide were observed every 6 h over a 36 h period. To obtain larvae, engorged females of A. cajennense were collected from naturally infested horses that had been free of acaricidal residue for at least 45 days, in farms situated in five different municipalities in the state (Caldas Novas, Hidrolândia, Goiás, Terezópolis and Goiânia). The larvae were exposed to different concentrations of 12 commercially available acaricidal formulations using the larval packet test (LPT) method. The control groups were treated with distilled water alone. The bioassays were performed in quadruplicate at a temperature of 27 °C, relative air humidity > 80% and 12 h light/dark cycles. The mean percentage of mortality MX was 72.6% in the adult specimens after 24 h of exposure to the dose of deltamethrin recommended by the manufacturer, characterizing a status of resistance. MX of 82, 89, 89.6 and 90% of the larvae were obtained, respectively, for deltamethrin, cypermethrin

  8. La presencia de Ixodes luciae en el noroeste argentino y nuevos huéspedes para Ixodes pararicinus y algunas especies de Amblyomma (Acari: Ixodidae Presence of Ixodes luciae in Argentina northwest and new hosts for Ixodes pararicinus and some species of Amblyomma (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Analía G. Autino

    2006-07-01

    Full Text Available El análisis de una colección de garrapatas de mamíferos del noroeste argentino, depositados en la Colección de Anexos de la Colección Mamíferos Lillo (CML de la Universidad Nacional de Tucumán, permitió ampliar el área de distribución de Ixodes luciae Sénevet, a las provincias de Salta y Tucumán e incrementar su rango de huéspedes al roedor sigmodontino Calomys callosus (Rengger y a los marsupiales de la familia Didelphidae Micoureus constantiae (Thomas, Thylamys cinderella Thomas y Thylamys venustus (Thomas. Se registró a C . callosus y Oligoryzomys destructor (Tschudi como nuevos huéspedes de Ixodes pararicinus Keirans & Clifford, y a los Carnivora Lycalopex gymnocercus (Fischer y Oncifelis geoffroyi (d´Orbigny & Gervais como nuevos huéspedes de Amblyomma neumanni Ribaga y Amblyomma parvum Aragão, respectivamente. Adicionalmente, se observó la infestación de Lutreolina crassicaudata (Desmarest (Didelphidae por I. luciae y la presencia de Amblyomma tigrinum Koch, sobre L. gymnocercus . Ninfas de Amblyomma sp . se obtuvieron de Akodon Meyen (Sigmodontinae.The analysis of a tick collection of mammals from northwestern Argentina deposited in the Annexes (ACML of Colección Mamíferos Lillo (CML National University of Tucumán, amplified the distribution of Ixodes luciae Sénevet, to Salta and Tucumán provinces and increased the host range to the sigmodontinae rodent Calomys callosus (Rengger and the Didelphidae Micoureus constantiae (Thomas, Thylamys cinderella Thomas and Thylamys venustus (Thomas. Calomys callosus and Oligoryzomys destructor (Tschudi were registered as new hosts of Ixodes pararicinus Keirans & Clifford, and the Carnivora Lycalopex gymnocercus (Fischer and Oncifelis geoffroyi (d´Orbigny & Gervais as new hosts of Amblyomma neumanni Ribaga, and Amblyomma parvum Aragão, respectively . Lutreolina crassicaudata (Desmarest (Didelphidae was also found infested with I. luciae while Amblyomma tigrinum Koch was

  9. Ação in vitro dos fungos Beauveria bassiana (Bals Vuill e Metarhizium anisopliae (Metsch Sorok sobre ninfas e adultos de Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae In vitro action of the fungi Beauveria bassiana (Bals Vuill and Metarhizium anisopliae (Metsch Sorok on ninphs and adults of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    R.C.S. Reis

    2001-10-01

    Full Text Available O trabalho teve por objetivo verificar a mortalidade in vitro de ninfas e adultos de Amblyomma cajennense frente à ação de isolados dos fungos Beauveria bassiana e Metarhizium anisopliae. Foram avaliados três isolados de M. anisopliae (959, 319 e E9 e dois de B. bassiana (986 e 747. As suspensões de conídios foram preparadas a partir de fungos produzidos em meio de arroz, e cada bioensaio foi constituído de quatro tratamentos nas concentrações 10(5, 10(6, 10(7, 10(8 conídios/ml e um grupo-controle. A análise constou da observação do percentual de mortalidade, 15 dias após o tratamento ou após a ecdise de adultos. Foram observadas diferenças significativas entre os tratamentos quanto à mortalidade para todos os isolados e todos os instares. Nos grupos tratados houve aumento considerável na mortalidade à medida que se aumentava a concentração de conídios na suspensão. Conclui-se que todos os isolados testados causaram mortalidade em testes in vitro sobre esses estádios evolutivos, sugerindo o controle do A. cajennense pela ação desses fungos.This work aimed at the evaluation of the in vitro susceptibility of Amblyomma cajennense nimphs and adults to isolates of Beauveria bassiana and Metarhizium anisopliae fungi. Three isolates of M. anisopliae (959, 319 e E9 and two of B. bassiana (986 e 747 were used. Conidia suspensions were made from fungi grown up in a rice culture medium and each test consisted of four treated groups (10(5, 10(6, 10(7, 10(8 conidia/ ml plus a control group. Viability of individuals was assessed 15 days after treatment or after adult ecdisis. Significative differences were found for all treatments and for all stages studied. A large reduction in the viability of ticks was observed, and this effect increased as conidia concentration raised. Based upon the results obtained, it can be concluded that all isolates tested presented an in vitro lethality for the biological stages of A. cajennense evaluated

  10. Life cycle of female ticks of Amblyomma cooperi Nuttal & Warburton, 1908 (Acari: Ixodidae under laboratory conditions Ciclo biológico de fêmeas do carrapato Amblyomma cooperi Nuttal & Warburton, 1908 (Acari:Ixodidae sob condições de laboratório

    Directory of Open Access Journals (Sweden)

    A.T.S. Almeida

    2001-06-01

    Full Text Available The biological cycle of female ticks of Amblyomma cooperi was studied under controlled conditions. The study has begun with two engorged females collected in a naturally infested wild capybara. The larvae originated from the oviposition of these two females were used for collecting young adults through artificial infestations in rabbits. The female parasitic and free living phases were evaluated using artificial infestation of ticks in a capybara. The average body weight of females was 958.2± 175.6mg, the average pre-egg laying period was 8.5± 1.4 days, the reproductive efficiency index was 59.5± 4.2 and the nutritional efficiency index was 77.3± 4.8. The incubation and eclosion periods were 41.9 and 5.9 days, respectively, and the rate of eclosion was 64%. These figures were obtained under high relative humidity conditions which were necessary for the success of the egg incubation process of this species. The preliminary data obtained with the artificial infestation in rabbits raises the possibility of this and other domestic species be used as an epidemiologic link between the domestic and the wild environment with the potential exposure of human populations to A. cooperi and to the maculosa fever agent.O ciclo biológico de Amblyomma cooperi foi estudado sob condições de laboratório. O estudo iniciou-se com duas fêmeas ingurgitadas coletadas de uma capivara selvagem naturalmente infestada. As larvas provenientes da postura foram utilizadas para obtenção de adultos, por meio de infestação artificial em coelhos. As fases parasitária e de vida livre das fêmeas foram avaliadas utilizando-se infestação artificial em capivara. A média de peso corporal foi de 958,2± 175,6mg, a média do período de pré-postura de 8,5± 1,4 dias e dos índices de eficiência reprodutiva e nutricional de 59,5± 4,2 e 77,3± 4,6, respectivamente. Os períodos de incubação e eclosão foram de 41,9 e 5,9 dias, respectivamente. A taxa de eclosão foi

  11. Avaliação de parâmetros clínicos e hematológicos de eqüinos submetidos a um programa de controle estratégico de Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae Evaluation of clinical and hematological parameters of equines submitted to a strategic control program of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    A.P. Cunha

    2008-02-01

    Full Text Available Estudaram-se aspectos clínicos e hematológicos em eqüinos submetidos a um programa de controle estratégico de A. cajennense. Os tratamentos carrapaticidas foram realizados a cada sete dias e divididos em dois módulos, o primeiro com início em abril de 2004, e o segundo com início em julho do mesmo ano, utilizando-se a base química piretróide - cipermetrina na concentração de 0,015%. Além do acompanhamento clínico dos animais, foram realizados hemogramas completos antes e após o programa. As dosagens bioquímicas de bilirrubinas, gama-glutamiltransferase (GGT, aspartato aminotransferase (AST, creatina kinase (CK, proteína total, albumina e globulinas, foram realizadas antes, durante e ao final do programa. Os resultados demonstraram que houve uma melhora no quadro hematológico dos animais após o programa de controle. Os tratamentos carrapaticidas, na forma em foram aplicados, não provocaram alterações desfavoráveis nos parâmetros clínicos e hematológicos dos eqüinos. Tais informações podem ser consideradas na busca de alternativas viáveis e seguras para o controle dessa espécie de carrapato.Clinical and hematological parameters were studied in equines submitted to a strategic control program of Amblyomma cajennense. The acaricide treatments were carried to each seven days and divided in two batteries, the first one began in April 2004 and the second in July 2004. A pyrethroid chemical base - 0.015% cypermethrin was used. Clinical examinations of the animals and complete hemograms were carried before and after the control program of the tick. Seric dosages of bilirrubins, gamma-glutamiltransferase (GGT, aspartate aminotransferase (AST, creatin kinase (CK, total protein, albumin, and globulins, were carried before and throughout the experiment. The results showed an improvement in the hematological parameters of the animals after the end of control program. The acaricide treatments did not cause undesirable alterations

  12. Carrapatos do gênero amblyomma (acari: ixodidae e suas relações com os hospedeiros em área endêmica para febre maculosa no Estado de São Paulo Ticks of genus Amblyomma (Acari: Ixodidae and their relationship with hosts in endemic area for spotted fever in the state of São Paulo

    Directory of Open Access Journals (Sweden)

    Carlos Alberto Perez

    2008-12-01

    Full Text Available Foram avaliadas 7 espécies da mastofauna e 36 da avifauna quanto à prevalência e intensidade de infestação por carrapatos na ESALQ/USP, no Município de Piracicaba, SP. Analisaram-se 52 indivíduos da mastofauna e 158 da avifauna, parasitados por 12418 carrapatos. Os exemplares adultos (N= 7343 foram encontrados em parasitismo nas capivaras enquanto que os imaturos foram, na maioria, coletados de pequenos mamíferos e aves. Os principais hospedeiros para as formas imaturas, em ordem decrescente, foram gambás (69,1%, capivaras (24,4% e urubus (3,7%. Entre a avifauna, o urubu apresentou o maior número de carrapatos com 69,9%, seguido por indivíduos das famílias Thamnophilidae e Turdidae. Os carrapatos adultos encontrados em capivaras foram A. cajennense (80,8% e A. dubitatum (19,2%. Ambas as espécies foram também coletadas em gambás, correspondendo a 72,4% e 27,6%, respectivamente. Pela facilidade de captura e atratividade de Amblyomma spp. o gambá pode ser usado como bioindicador de infestação em locais endêmicos para febre maculosa. Considerando os índices de parasitismo e prevalência bem como de abundância de carrapatos, susceptibilidade dos hospedeiros, proliferação e susceptibilidade para infecção por R. rickettsi, capivaras e gambás são potenciais hospedeiros amplificadores desse microrganismo no Campus da ESALQ, enquanto eqüídeos, urubus e gatos atuam como hospedeiros secundários.Seven species of mammals and 36 of birds were investigated to determine the tick prevalence and intensity of infestation. The study was conducted at the Esalq/USP in Piracicaba municipality, State of São Paulo. It was collected 52 mammals and 158 birds parasitized by 12,418 ticks. Adult ticks (N= 7,343 were found on capybaras, while the immature were mainly collected on small mammals and birds. The main hosts for immatures in descending order were opossums (69.1%, capybara (24.4% and black vultures (3.7%. Among the avifauna, the black

  13. Teratological Nymphal Ixodes scapularis (Acari: Ixodidae) From Wisconsin.

    Science.gov (United States)

    Larson, Scott R; Paskewitz, Susan M

    2016-03-01

    Abnormalities of physiological development (teratological forms) in ticks are rare. The occurrence of gigantism, dwarfism, gynandromorphs, missing legs, extra legs, and asymmetries is most often reported from lab-reared specimens, but has been observed in field-collected specimens. All morphologically anomalous ticks (besides gynandromorphy) described to date are from species other than Ixodes scapularis Say (Acari: Ixodidae). Here we describe four teratological I. scapularis nymphs collected while dragging vegetation in Wisconsin in 2015, including two asymmetrical ticks, one with a missing leg, and one with an extra leg. PMID:26681790

  14. Ticks (Acari: Ixodida: Argasidae, Ixodidae infesting humans in Northwestern Córdoba province, Argentina Garrapatas infestando humanos en el noroeste de la provincia de Córdoba, Argentina

    Directory of Open Access Journals (Sweden)

    Nava Santiago

    2006-06-01

    Full Text Available Ticks infesting humans were collected from September 2004 to August 2005 in Northwestern Córdoba in an area with a southern limit in the locality of Dean Funes (30°25´S 64°20´W and San José de las Salinas (30°00´S 64°37´W in the North. The collections consisted in ticks found attached on man obtained from three sources: 1 specimens fixed on two workers during two successive days per month of field work in the northern part of the area which belongs to Western Chaco district of the phytogeographical Chaco domain, 2 ticks attached to a man working in a farm close to Dean Funes in the Chaco Serrano district of the Chaco domain and, 3 ticks collected from a collaborator visiting daily a suburban property with dogsin the vicinities of Dean Funes. Most ticks collected were larvae, nymphs and adults of Amblyomma neumanni from the Chaco Serrano district where a nymph of Otobius megnini was also found on man. Adults of Amblyomma parvum and Amblyomma tigrinum were detected feeding on humans in the Western Chaco district and in the property close to Dean Funes, respectively. Amblyomma neumanni was absent on man from December to April while most specimens of A. parvum and A. tigrinum were collected during summer. Their role as potential vector of ticktransmitted diseases in the area is unknown.Se recolectaron garrapatas (Acari: Ixodida: Argasidae, Ixodidae infestando humanos entre septiembre de 2004 y agosto de 2005 en un área del noroeste de Córdoba cuyo límite al sur es la localidad Deán Funes (30º25´S 64°20´W y el límite al norte es la localidad de San José de las Salinas (30°00´S 64°37´W. Las colecciones consistieron en garrapatas fijadas a humanos obtenidas de tres fuentes: 1 garrapatas fijadas sobre dos trabajadores durante dos días sucesivos por mes de trabajo de campo en la parte norte del área, la cual pertenece al distrito chaqueño occidental del dominio fitogeográfico del Chaco, 2 garrapatas fijadas a un trabajador en

  15. Ticks (Acari: Ixodida) on wild carnivores in Brazil.

    Science.gov (United States)

    Labruna, Marcelo B; Jorge, Rodrigo S P; Sana, Dênis A; Jácomo, Anah Tereza A; Kashivakura, Cyntia K; Furtado, Mariana M; Ferro, Claudia; Perez, Samuel A; Silveira, Leandro; Santos, Tarcísio S; Marques, Samuel R; Morato, Ronaldo G; Nava, Alessandra; Adania, Cristina H; Teixeira, Rodrigo H F; Gomes, Albério A B; Conforti, Valéria A; Azevedo, Fernando C C; Prada, Cristiana S; Silva, Jean C R; Batista, Adriana F; Marvulo, Maria Fernanda V; Morato, Rose L G; Alho, Cleber J R; Pinter, Adriano; Ferreira, Patrícia M; Ferreira, Fernado; Barros-Battesti, Darci M

    2005-01-01

    The present study reports field data of ticks infesting wild carnivores captured from July 1998 to September 2004 in Brazil. Additional data were obtained from one tick collection and from previous published data of ticks on carnivores in Brazil. During field work, a total of 3437 ticks were collected from 89 Cerdocyon thous (crab-eating fox), 58 Chrysocyon brachyurus (maned wolf), 30 Puma concolor (puma), 26 Panthera onca (jaguar), 12 Procyon cancrivorus (crab-eating raccoon), 4 Speothos venaticus (bush dog), 6 Pseudalopex vetulus (hoary fox), 6 Nasua nasua (coati), 6 Leopardus pardalis (ocelot), 2 Leopardus tigrinus (oncilla), 1 Leopardus wiedii (margay), 1 Herpailurus yagouaroundi (jaguarundi), 1 Oncifelis colocolo (pampas cat), 1 Eira barbara (tayara), 1 Galictis vittata (grison), 1 Lontra longicaudis (neotropical otter), and 1 Potus flavus (kinkajou). Data obtained from the Acari Collection IBSP included a total of 381 tick specimens collected on 13 C. thous, 8 C. brachyurus, 3 P. concolor, 10 P. onca, 3 P. cancrivorus, 4 N. nasua, 1 L. pardalis, 1 L. wiedii, 4 H. yagouaroundi, 1 Galictis cuja (lesser grison), and 1 L. longicaudis. The only tick-infested carnivore species previously reported in Brazil, for which we do not present any field data are Pseudalopex gymnocercus (pampas fox), Conepatus chinga (Molina's hog-nosed skunk), and Conepatus semistriatus (striped hog-nosed skunk). We report the first tick records in Brazil on two Felidae species (O. colocolo, H. yagouaroundi), two Canidae species (P. vetulus, S. venaticus), one Procyonidae species (P. flavus) and one Mustelidae (E. barbara). Tick infestation remains unreported for 5 of the 26 Carnivora species native in Brazil: Oncifelis geoffroyi (Geoffroy's cat), Atelocynus microtis (short-eared dog), Pteronura brasiliensis (giant otter), Mustela africana (Amazon weasel), and Bassaricyon gabbii (olingo). Our field data comprise 16 tick species represented by the genera Amblyomma (12 species), Ixodes (1

  16. Reassessment of the taxonomic status of Amblyomma cajennense () with the description of three new species, Amblyomma tonelliae n. sp., Amblyomma interandinum n. sp. and Amblyomma patinoi n. sp., and reinstatement of Amblyomma mixtum, and Amblyomma sculptum (Ixodida: Ixodidae).

    Science.gov (United States)

    Nava, Santiago; Beati, Lorenza; Labruna, Marcelo B; Cáceres, Abraham G; Mangold, Atilio J; Guglielmone, Alberto A

    2014-04-01

    A reassessment of the taxonomic status of Amblyomma cajennense based on the morphological analyses of ticks from the whole distribution area of the species resulted in the redescription of A. cajennense, the validation of 2 species which had been reduced to synonymy in the past, Amblyomma mixtum and Amblyomma sculptum, and the description and definition of 3 new species, Amblyomma tonelliae n. sp., Amblyomma interandinum n. sp., and Amblyomma patinoi n. sp. This study provides descriptions and redescriptions, scanning electron microscopic and stereomicroscopic images, updated synonymies, information on geographical distributions, and host associations for each of the 6 species. Amblyomma cajennense s.s. is found in the Amazonian region of South America, A. interandinum is reported from the northern part of the Inter-Andean valley of Peru, A. mixtum is present from Texas (U.S.A.) to western Ecuador, A. patinoi occurs in the Eastern Cordillera of Colombia, A. tonelliae is associated with the dry areas of the Chaco region which spans from central-northern Argentina to Bolivia and Paraguay, whereas A. sculptum is distributed from the humid areas of northern Argentina, to the contiguous regions of Bolivia and Paraguay and the coastal and central-western states of Brazil. PMID:24556273

  17. The ticks (Acari: Ixodida: Argasidae, Ixodidae) of Paraguay.

    Science.gov (United States)

    Nava, S; Lareschi, M; Rebollo, C; Benítez Usher, C; Beati, L; Robbins, R G; Durden, L A; Mangold, A J; Guglielmone, A A

    2007-04-01

    The ticks reported in Paraguay, which are here reviewed, can be categorized as 'endemic or established' (Argas persicus or a sibling species, Ornithodoros hasei, O. rostratus, O. rudis, O. talaje/O. puertoricensis, Amblyomma aureolatum, Am. auricularium, Am. brasiliense, Am. cajennense, Am. calcaratum, Am. coelebs, Am. dissimile, Am. dubitatum, Am. incisum, Am. longirostre, Am. nodosum, Am. ovale, Am. pacae, Am. parvum, Am. pseudoconcolor, Am. rotundatum, Am. scutatum, Am. tigrinum, Am. triste, Dermacentor nitens, Haemaphysalis juxtakochi, H. leporispalustris, Ixodes loricatus, Rhipicephalus microplus, and Rh. sanguineus), 'probably endemic or established' (Ar. miniatus, Ar. monachus, Am. argentinae, Am. humerale, Am. naponense, Am. oblongoguttatum, Am. pseudoparvum, I. aragaoi/I. pararicinus, I. auritulus, I. luciae), or 'erroneously reported from Paraguay' (O. coriaceus, Am. americanum and Am. maculatum). Most Paraguayan tick collections have been made in the Chaco phyto-geographical domain, in the central part of the country. Argas persicus or a related species, Am. cajennense, D. nitens, Rh. microplus and Rh. sanguineus are important parasites of domestic animals. Ornithodoros rudis, Am. aureolatum, Am. brasiliense, Am. cajennense, Am. coelebs, Am. incisum, Am. ovale and Am. tigrinum have all been collected from humans. In terms of public health, the collections of Am. cajennense and Am. triste from humans may be particularly significant, as these species are potential vectors of Rickettsia rickettsii and Ri. parkeri, respectively.

  18. Experimental use of two standard tick collection methods to evaluate the relative effectiveness of several plant-derived and synthetic repellents against Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae).

    Science.gov (United States)

    Schulze, Terry L; Jordan, Robert A; Dolan, Marc C

    2011-12-01

    We used two standard tick collection methods to test the relative effectiveness of two natural product compounds (nootkatone and carvacrol, classified as an eremophilene sesquiterpene and a monoterpene, respectively, that are derived from botanical sources) with commercially-available plant-derived (EcoSMART Organic Insect Repellent, comprised of plant essential oils) and permethrin-based (Repel Permanone) repellents against Ixodes scapularis Say and Amblyomma americanum (L.). Cloth drags were equally effective in sampling both species of host-seeking nymphs, whereas CO, traps attracted primarily A. americanum. All four repellents performed well on drags, with nootkatone and Permanone Repel (100% repelled through 14 d) slightly more effective than carvacrol and EcoSMART (90.7% and 97.7% repelled at 14 d, respectively) at repelling I. scapularis nymphs. Although the same trend in percent repellency was noted in the CO2 trap trial against both A. americanum nymphs and adults, EcoSMART outperformed Permanone in repelling A. Americanum nymphs after 14 d in the drag trial. Generally, the effectiveness of all repellents tested declined over time. The use of tick drags and CO2 traps was rapid, inexpensive, and easy to use in determining the relative effectiveness of repellents in the field. PMID:22299371

  19. Biological parameters of larvae, nymphs, and engorged females of Amblyomma cajennense (Fabricius, 1787 (Acari: Ixodidae obtained from artificial and successive infestations on Oryctolagus cuniculus (Linnaeus, 1758 (Lagomorpha: Ochotonidae Parâmetros biológicos de larvas, ninfas e fêmeas ingurgitadas de Amblyomma cajennense (Fabricius, 1787 (Acari:Ixodidae obtidas de infestações artificiais e sucessivas em Oryctolagus cuniculus (Lagomorpha:Ochotonidae

    Directory of Open Access Journals (Sweden)

    C.M.V. Freitas

    2009-10-01

    Full Text Available The development of acquired resistance to Amblyomma cajennense ticks was evaluated. A total of 18 rabbits were uniformly distributed into three groups named GL, GN, and GA that were submitted to three consecutive infestations with, respectively, larvae, nymphs, and adults of A. cajennense. After the infestations, the parasitic and reproductive parameters of recovered instars were evaluated. A significant reduction of recovery rates of inoculated ticks was observed only after the third infestation of animals in groups GL and GN (PAvaliou-se o desenvolvimento de resistência adquirida frente ao parasitismo por Amblyomma cajennense. Para tanto, 18 coelhos foram uniformemente distribuídos em três grupos denominados GL, GN e GA e submetidos a três infestações consecutivas por, respectivamente, larvas, ninfas ou adultos de A. cajennense. Após a infestação, estudaram-se os parâmetros parasitários e reprodutivos dos exemplares recuperados. Apenas a partir da terceira infestação dos animais dos grupos GL e GN, pôde-se observar uma queda significativa na taxa de recuperação dos ixodídeos inoculados (P<0,01. O dia modal de queda das larvas e ninfas recuperadas aumentou com o decorrer das infestações. As ninfas ingurgitadas recuperadas apresentaram uma redução significativa (P<0,01 no peso médio corporal entre a primeira e terceira infestação. Observou-se uma queda significativa na taxa média de recuperação das fêmeas ingurgitadas somente na terceira infestação (P<0,01. Todavia, a partir da segunda infestação observou-se nas teleóginas recuperadas, uma redução significativa no peso corporal, peso da postura e eclodibilidade das larvas (P<0,05. Os dados sugerem a ocorrência de resistência em coelhos à infestação por A. cajennense que foi mais evidente contra o estádio adulto.

  20. Molecular analysis of Boophilus spp. (Acari: Ixodidae) tick strains.

    Science.gov (United States)

    Fuente, J; García-García, J C; González, D M; Izquierdo, G; Ochagavia, M E

    2000-10-01

    Boophilus spp. (Acari: Ixodidae) parasitize cattle and other farm and wild animals in tropical and subtropical regions of the world. Ticks belonging to the genus Boophilus have undergone evolutionary processes associated with habitat adaptation following biogeographical separation, resulting in strains with marked morphological differences. We have characterized at the molecular level B. microplus strains from Latin America and Australia, employing sequences derived from the bm86 coding region, an intron located within the bm86 gene, and DNA short tandem repeats (STR). A B. annulatus strain was employed for comparison. The results indicated that variation within the bm86 coding region is higher between B. microplus strains than between some B. microplus strains and B. annulatus. The sequence of the intron was not informative for phylogenetic analysis, varying among individuals of the same strain. Two STRs were identified in B. microplus (STRs BmM1 and BmM2) and one in B. annulatus (STR Ba1). Southern hybridization experiments with STRs BmM1 and BmM2 as a probe revealed the prevalence of dispersed moderately repeated DNA in the genome of B. microplus. The analysis of polymorphism at STR locus BmM1 evidenced differences within and between populations of B. microplus. These results support at the molecular level the existing differences between B. microplus strains and suggest tools to characterize these populations. PMID:10962158

  1. Rhipicephalus sanguineus (ACARI: IXODIDAE) BITING A HUMAN BEING IN PORTOALEGRE CITY, RIO GRANDE DO SUL, BRAZIL

    Science.gov (United States)

    MENTZ, Márcia Bohrer; TROMBKA, Marcelo; da SILVA, Guilherme Liberato; SILVA, Carlos Eugênio

    2016-01-01

    We report the finding of a female brown dog tick, Rhipicephalus sanguineus (Acari: Ixodidae) on the scalp of a male patient in Porto Alegre, Rio Grande do Sul, Brazil. Human parasitism by this tick is rare and has seldomly been reported in the literature, despite its recognized importance since it can act as a vector of Rickettsia rickettsii, the agent of spotted fever. PMID:27074329

  2. Association patterns of ticks (Acari: Ixodida: Ixodidae, Argasidae) of small mammals in Cerrado fragments, western Brazil.

    Science.gov (United States)

    Sponchiado, Jonas; Melo, Geruza L; Martins, Thiago F; Krawczak, Felipe S; Labruna, Marcelo B; Cáceres, Nilton C

    2015-03-01

    The present study describes ticks associated with small mammals and analyzes the aggregation patterns according to seasonal and host variations in the Cerrado biome, central-western Brazil. Small mammals were systematically captured in 54 woodland fragments from February 2012 to July 2013. A total of 1,040 animals belonging to eight marsupial and 12 rodent species were captured; 265 animals were parasitized by eight tick species (in decreasing order of abundance): Ornithodoros mimon, Amblyomma coelebs, Amblyomma sculptum, Amblyomma ovale, Amblyomma parvum, Amblyomma dubitatum, Amblyomma parkeri, and Ixodes amarali. With few exceptions, collected ticks were larvae and nymphs. Among the more abundant animals, the marsupial Didelphis albiventris showed the highest tick prevalence (84.4 %), mean abundance (19.2), mean intensity (22.8), richness of ticks species (n = 7), and total abundance of ticks (n = 2,457). Amblyomma sculptum and O. mimon were the most generalist species, collected on four host species. Fifteen new tick-host associations are reported for the first time. Most ticks showed higher prevalence and mean intensity in the dry season, regardless of host species. Overall, tick prevalence and mean intensity of infestation were significantly associated with host gender. Finally, the importance of the large number of records of the argasid O. mimon is discussed. PMID:25633262

  3. A sustained release gel formulation of doramectin for control of lone star ticks (Acari: Ixodidae) and horn flies (Diptera: Muscidae) on cattle.

    Science.gov (United States)

    Lohmeyer, K H; Miller, J A; Pound, J M; Klavons, J A

    2009-04-01

    A gel formulation formed by incorporating technical doramectin into a 10% hydroxypropyl methylcellulose aqueous solution was used to subcutaneously inject steers at varying dosages. Doramectin serum concentration of steers receiving 600 microg (AI)/kg body weight declined from 21.9 ppb at 0.5 wk to below detectable at 8 wk postinjection. The 1,200 microg (AI)/kg injection resulted in serum concentrations of 29.1 ppb at 0.5 wk and declined to 0.5 ppb at 8 wk postinjection. Both the 600 and 1,200 microg (AI)/kg injections provided 100% inhibition of index of fecundity (IF) in adult lone star ticks, Amblyomma americanum L. (Acari: Ixodidae) through week 8, after which inhibition declined to 79.4 and 45.3%, respectively, during the 12th week posttreatment. For steers treated at 600 microg (AI)/kg, mortality of adult horn flies, Hematobia irritans L. (Diptera: Muscidae), declined from 16.9% during week 2 to 3.1% during week 7 postinjection. The blood from steers treated at 1,200 microg (AI)/kg resulted in a similar decline in mortality of blood fed adult horn flies from 29.4% during week 1 to 4.0% during week 7. The 600 microg (AI)/kg treatment provided complete control of larval horn flies in the manure for 9 wk, whereas the 1,200 microg (AI)/kg injection gave complete control for 14 wk posttreatment. The doramectin gel formulation provided long-lasting delivery of doramectin to cattle and extended control of lone star ticks and larval horn flies. Such a simple and inexpensive formulation could be useful in tick eradication programs by reducing the frequency of gathering cattle. PMID:19449664

  4. Ixodid Ticks (Acari, Ixodidae in Urban Landscapes. A review

    Directory of Open Access Journals (Sweden)

    Akimov I. А.

    2016-04-01

    Full Text Available This study presents the results of content analysis of published works on ixodid ticks in urban conditions in order to determine the species diversity, the vectors of research interests at various stages. Information about ticks in the cities up to the 1980s is incidental, to the point of exclusive, after this point there is targeted research in urban landscapes. There are 106 or 15 % of hard ticks of the world fauna registered in the urban territory, 26 species or 3.7 % being the most abundant. Of the urban hard tick species, 23 (88.5 % can attack humans, and 12 species are the most adapted to the urban landscape: Ixodes ricinus, I. persulcatus, Dermacentor reticulatus, D. marginatus, I. pavlovskyi, I. scapularis (dammini, Amblyomma cajennense, Haemaphysalis longicornis, I. hexagonus, Hyalomma marginatum, Am. americanum, and Rhipicephalus sanguineus. It was determined that the most likely causes of the growing number of publications on ixodids urban landscapes are: global accelerating urbanization, the development of recreational areas, the development of green tourism, the growth of the prestige of outdoor recreation, the creation of new, especially of the landscape parks and a tendency to preserve the native landscape in the cities, a significant increase in the density of populations of common species of hard ticks adapted to living in urban environment. The vectors of further work in urban landscapes will be directed to exact planning of monitoring studies of ixodids and associated tick-borne infections.

  5. Flagging versus dragging as sampling methods for nymphal Ixodes scapularis (Acari: Ixodidae)

    Science.gov (United States)

    Rulison, Eric L.; Kuczaj, Isis; Pang, Genevieve; Hickling, Graham J.; Tsao, Jean I.; Ginsberg, Howard S.

    2013-01-01

    The nymphal stage of the blacklegged tick, Ixodes scapularis (Acari: Ixodidae), is responsible for most transmission of Borrelia burgdorferi, the etiologic agent of Lyme disease, to humans in North America. From 2010 to fall of 2012, we compared two commonly used techniques, flagging and dragging, as sampling methods for nymphal I. scapularis at three sites, each with multiple sampling arrays (grids), in the eastern and central United States. Flagging and dragging collected comparable numbers of nymphs, with no consistent differences between methods. Dragging collected more nymphs than flagging in some samples, but these differences were not consistent among sites or sampling years. The ratio of nymphs collected by flagging vs dragging was not significantly related to shrub density, so habitat type did not have a strong effect on the relative efficacy of these methods. Therefore, although dragging collected more ticks in a few cases, the numbers collected by each method were so variable that neither technique had a clear advantage for sampling nymphal I. scapularis.

  6. New records for Amblyomma sculptum (Ixodidae) on non-passerine birds in Brazil.

    Science.gov (United States)

    Luz, Hermes Ribeiro; Faccini, João Luiz Horacio; Landulfo, Gabriel Alves; Costa Neto, Sócrates Fraga; Famadas, Kátia Maria

    2016-01-01

    The aim of this paper was to provide new records of Amblyomma sculptum on two species of terricolous birds in two areas of the Cerrado (savannah- like) bioma: two specimens of Cariama cristata were captured in the state of Goiás and one specimen ofCrax fasciolata was captured in the state of Minas Gerais. One of the C. cristata was parasitized by 15 larvae, six nymphs, one male and two females whereas the C. fasciolata was parasitized by seven larvae and eight nymphs. This paper presents a new locality for occurrence of parasitism A. sculptum in C. cristata and a new host for C fasciolata.

  7. New records for Amblyomma sculptum (Ixodidae on non-passerine birds in Brazil

    Directory of Open Access Journals (Sweden)

    Hermes Ribeiro Luz

    2016-03-01

    Full Text Available Abstract The aim of this paper was to provide new records of Amblyomma sculptum on two species of terricolous birds in two areas of the Cerrado (savannah- like bioma: two specimens of Cariama cristata were captured in the state of Goiás and one specimen ofCrax fasciolata was captured in the state of Minas Gerais. One of the C. cristata was parasitized by 15 larvae, six nymphs, one male and two females whereas the C. fasciolata was parasitized by seven larvae and eight nymphs. This paper presents a new locality for occurrence of parasitism A. sculptum in C. cristata and a new host for C fasciolata.

  8. New records for Amblyomma sculptum (Ixodidae) on non-passerine birds in Brazil.

    Science.gov (United States)

    Luz, Hermes Ribeiro; Faccini, João Luiz Horacio; Landulfo, Gabriel Alves; Costa Neto, Sócrates Fraga; Famadas, Kátia Maria

    2016-03-01

    The aim of this paper was to provide new records of Amblyomma sculptum on two species of terricolous birds in two areas of the Cerrado (savannah- like) bioma: two specimens of Cariama cristata were captured in the state of Goiás and one specimen ofCrax fasciolata was captured in the state of Minas Gerais. One of the C. cristata was parasitized by 15 larvae, six nymphs, one male and two females whereas the C. fasciolata was parasitized by seven larvae and eight nymphs. This paper presents a new locality for occurrence of parasitism A. sculptum in C. cristata and a new host for C fasciolata. PMID:27007247

  9. Description of a new argasid tick (Acari: Ixodida) from bat caves in Brazilian Amazon.

    Science.gov (United States)

    Nava, Santiago; Venzal, Jose M; Terassini, Flavio A; Mangold, Atilio J; Camargo, Luis Marcelo A; Labruna, Marcelo B

    2010-12-01

    Nothoaspis amazoniensis n. sp. (Acari: Ixodida: Argasidae) is described from adult and immature ticks (nymph II, nymph I, larva) collected from bat caves in the Brazilian Amazon. Also, 16S rDNA sequences are provided. The diagnostic characters for adults are the presence of false shield or nothoaspis, an anteriorly projecting hood covering the capitulum, a medial extension of palpal article I (flaps), genital plate extending from coxa I to IV, absence of 2 setae on the internal margin of the flaps, a minute hypostome without denticles, presence of a central pore in the base of hypostome, and a reticulate surface pattern on the posterior half of the nothoaspis in males. The nymph II stage is characterized by a hood that is small in relation to the capitulum, short coxal setae, palpal flaps lacking setae on the internal margin, long hypostome, pointed with dentition 4/4 apically, and the anterior half of the body is covered by a cell-like configuration. Nymph I stage is characterized by a hood, small in relation to the capitulum, dorsum of the body covered by a cell-like configuration, venter integument covered by a cell-like configuration, and hypostome dentition 4/4 with apices that are "V"-shaped. Diagnostic characters of the larvae are the number and size of dorsal setae, and the shape of scutum and hypostome. The new species appears to have a life cycle with a larva that feeds on bats, a non-feeding nymphal stage (nymph I), a feeding nymphal stage (nymph II), and adults that probably represent non-feeding stages. PMID:21158616

  10. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA

    Directory of Open Access Journals (Sweden)

    BEJARANO EDUAR E. E.

    2009-04-01

    Full Text Available

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.

    Palabras clave

  11. Progress in the eradication of Amblyomma variegatum Fabricius, 1794 (Ixodoidea, Ixodidae) from the Caribbean

    International Nuclear Information System (INIS)

    Amblyomma variegatum, commonly known as the tropical Bont tick, was introduced from West Africa to the islands of Guadeloupe and Antigua in the 19th century. The tick spread only to two other islands in the French West Indies during the following 70 to 80 years. Since the mid-1970s, however, it became widely distributed in the eastern Caribbean islands. There is now increasing evidence that migratory birds, especially the cattle egret, Bubulcus ibis Linnaeus (Ciconiformes: Ardeie) disseminated larvae and nymphs, as the egret itself has been spreading to new islands over the last 20 years (Corn et al. 1993, Barre et al. 1995). Subsequently, the tropical Bont tick, through its association with the bacterial skin disease known as dermatophilosis, caused the loss of large numbers of animals. On Nevis, for example, cattle numbers were decimated from 5,000 to 500 in less than 10 years. Elimination of this tick and its associated diseases could help to alleviate the deficit in animal protein in the region which imports about US$100 million worth of livestock products per annum. Risk analysis, feasibility and cost-benefit studies were carried out to assess the importance of these problems (Alderink and McCauley 1988, Gersabeck 1994). The US Department of Agriculture estimated potential losses of US$762 million annually if the tick and its associated diseases became established in mainland countries. These studies led to the formulation of the Caribbean Amblyomma Programme in the late 1980s (Barre and Garris 1989, CARICOM/FAO/IICA 1995, Wilson 1996). During the early 1990s, potential donors were concerned about the proposed tick control strategy whereby government veterinary teams would be responsible for treatment of all livestock. Based on practical experience in the region, it was considered particularly unrealistic for teams to treat 600 - 1,000 animals per day under the current livestock management practices. An alternative, or complementary, method proposed the use of

  12. Efficacy of granular deltamethrin against Ixodes scapularis and Amblyomma americanum (Acari: Ixodidade) nymphs.

    Science.gov (United States)

    Schulze, T L; Jordan, R A; Hung, R W; Taylor, R C; Markowski, D; Chomsky, M S

    2001-03-01

    A single barrier application of granular deltamethrin to the woodland edges of a forested residential community in late spring significantly reduced the abundance of Ixodes scapularis Say nymphs. The application also suppressed the population of Amblyomma americanum (L.) nymphs, which recently became established in the study area. The efficacy of deltamethrin is compared with other commonly used acaricides.

  13. Rickettsial infection in ticks (Acari: Ixodidae) of wild animals in midwestern Brazil.

    Science.gov (United States)

    Witter, Rute; Martins, Thiago F; Campos, Artur K; Melo, Andréia L T; Corrêa, Sandra H R; Morgado, Thaís O; Wolf, Rafael W; May-Júnior, Joares A; Sinkoc, Afonso L; Strüssmann, Christine; Aguiar, Daniel M; Rossi, Rogério V; Semedo, Thiago B F; Campos, Zilca; Desbiez, Arnaud L J; Labruna, Marcelo B; Pacheco, Richard C

    2016-04-01

    Ticks collected in the last two decades from free-living and captive wild animals from 28 municipalities of the Brazilian state of Mato Grosso were identified and tested using molecular methods for the presence of rickettsial agents. A total of 4467 ticks (229 larvae, 1676 nymphs, 1565 males, 997 females) representing 27 ixodid species were collected from 235 species of amphibians, reptiles, birds, and mammals from three different ecoregions (Pantanal, Cerrado, and Amazonia). The species Amblyomma parkeri, Amblyomma romitii, Amblyomma varium and Ixodes luciae are reported for the first time in the state of Mato Grosso. Amongst 538 ticks tested by molecular methods for rickettsial infection, we detected 'Candidatus Rickettsia amblyommii' infecting Amblyomma cajennense sensu stricto and Amblyomma coelebs, Rickettsia sp. strain Atlantic rainforest infecting Amblyomma ovale, Rickettsia sp. strain NOD infecting Amblyomma nodosum, and 'Candidatus Rickettsia andeanae' infecting Amblyomma sculptum. Our results represent an impressive expansion of knowledge on tick fauna and rickettsiae and are essential for understanding the ecology of ticks and tick-borne diseases in the Neotropical region, particularly in midwestern Brazil. PMID:26775021

  14. Diagnosis of amitraz resistance in Brazilian populations of Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) with larval immersion test.

    Science.gov (United States)

    Mendes, Elisa Cimitan; Mendes, Márcia Cristina; Sato, Mário Eidi

    2013-11-01

    Among the ectoparasites of cattle, Rhipicephalus (Boophilus) microplus (Canestrini) (Acari: Ixodidae) remains a major cause of economic losses to livestock. The chemical control with acaricides is still the most efficient method available to control ticks. The aims of this study were to diagnose resistance to amitraz in 16 tick populations from the States of São Paulo (14) and Paraná (2), using the larval immersion technique (LIT), and evaluate the effect of synergists [piperonyl butoxide (PBO), diethyl maleate (DEM), triphenyl phosphate (TPP)] on amitraz resistant and susceptible strains of cattle tick. Most of the evaluated populations (68.7 %) showed to be resistant to amitraz, with resistance ratios ranging from 2.14 to 132. The results suggest that the test procedure by LIT is sensitive and adequate for detection and monitoring of amitraz resistance in cattle tick. No synergistic effect was observed for the synergists PBO, DEM and TPP, on the amitraz resistant (Poa) strain of cattle tick, indicating that increased detoxification metabolism was not involved in this resistance. PMID:23620418

  15. Garrapatas (Acari: Ixodidae en perros de la ciudad de Concepción, Chile Ticks (Acari: Ixodidae on dogs in Concepción city, Chile

    Directory of Open Access Journals (Sweden)

    L. MUÑOZ

    2002-01-01

    Full Text Available Con la finalidad de determinar las especies de garrapatas que parasitan a los perros de la ciudad de Concepción, se extrajeron 137 garrapatas desde perros de ocho clínicas veterinarias de cuatro comunas de la ciudad de Concepción. Los ejemplares encontradas fueron observados mediante lupa estereoscópica y algunos fotografiados a microscopio electrónico. Como resultados se obtuvo que el 38.7% correspondían a Amblyomma tigrinum adultos y el 61.3% a Rhipicephalus sanguineus adultos e inmadurosA total of 137 specimens of ticks were collected in eight veterinary clinics in Concepcion city to determine the ticks-species present on dogs. The specimens were analyzed with the aid of a stereomicroscope and SEM pictures were taken. From the total, 38.7% were adults of Amblyomma tigrinum and 61.3% adults and inmatures of Rhipicephalus sanguineus

  16. Bacteria of the genus Rickettsia in ticks (Acari: Ixodidae) collected from birds in Costa Rica.

    Science.gov (United States)

    Ogrzewalska, Maria; Literák, Ivan; Capek, Miroslav; Sychra, Oldřich; Calderón, Víctor Álvarez; Rodríguez, Bernardo Calvo; Prudencio, Carlos; Martins, Thiago F; Labruna, Marcelo B

    2015-06-01

    The aim of this study was to document the presence of Rickettsia spp. in ticks parasitizing wild birds in Costa Rica. Birds were trapped at seven locations in Costa Rica during 2004, 2009, and 2010; then visually examined for the presence of ticks. Ticks were identified, and part of them was tested individually for the presence of Rickettsia spp. by polymerase chain reaction (PCR) using primers targeting fragments of the rickettsial genes gltA and ompA. PCR products were DNA-sequenced and analyzed in BLAST to determine similarities with previously reported rickettsial agents. A total of 1878 birds were examined, from which 163 birds (9%) were infested with 388 ticks of the genera Amblyomma and Ixodes. The following Amblyomma (in decreasing order of abundance) were found in immature stages (larvae and nymphs): Amblyomma longirostre, Amblyomma calcaratum, Amblyomma coelebs, Amblyomma sabanerae, Amblyomma varium, Amblyomma maculatum, and Amblyomma ovale. Ixodes ticks were represented by Ixodes minor and two unclassified species, designated here as Ixodes sp. genotype I, and Ixodes sp. genotype II. Twelve of 24 tested A. longirostre ticks were found to be infected with 'Candidatus Rickettsia amblyommii', and 2 of 4 A. sabanerae were found to be infected with Rickettsia bellii. Eight of 10 larval Ixodes minor were infected with an endosymbiont (a novel Rickettsia sp. agent) genetically related to the Ixodes scapularis endosymbiont. No rickettsial DNA was found in A. calcaratum, A. coelebs, A. maculatum, A. ovale, A. varium, Ixodes sp. I, and Ixodes sp. II. We report the occurrence of I. minor in Costa Rica for the first time and a number of new bird host-tick associations. Moreover, 'Candidatus R. amblyommii' and R. bellii were found in A. longirostre and A. sabanerae, respectively, in Costa Rica for the first time.

  17. Environmentally associated ticks (Acari: Ixodidae in Campo Grande, Mato Grosso do Sul, Brazil Carrapatos (Acari: Ixodidae associados com o ambiente em Campo Grande, Mato Grosso do Sul, Brasil

    Directory of Open Access Journals (Sweden)

    Marcos Valério Garcia

    2013-03-01

    Full Text Available Herein, we report tick species found on wild and domestic animals and in the environment during a one-year sampling period at the Brazilian Farming Research Company beef cattle unit (Embrapa Beef Cattle, which is located within the urban area of Campo Grande, Mato Grosso do Sul, Brazil. From 55 wild hosts including six different species (Nasua nasua, Cebus spp., Cerdocyon thous, Myrmecophaga tridactyla, Tamandua tetradactyla and Dasyprocta aguti, 323 ticks were collected. Amblyomma ovale ticks were found solely on coatis, and Amblyomma nodosum was identified solely on anteaters. No ticks were found on capuchin monkeys. However, Amblyomma cajennense was found on all parasitized host species with the exception of capuchin monkeys. Giant anteaters displayed the highest infestation abundance, with a mean of 53 ticks∕animal. Environmental sampling yielded 166 adult A. cajennense ticks. The tick species found on domestic animals (Rhipicephalus (Boophilus microplus, R. sanguineus, Dermacentor nitens and A. cajennense were those typically found on these hosts in Brazil. The most prevalent tick species, A. cajennense, was found on both wild and domestic animals and was also prevalent in the environment. Thus, this tick species is the primary vector that allows pathogens to bridge wild and domestic animals in the Cerrado.Neste trabalho são descritas as espécies de carrapatos de animais selvagens e domésticos e do ambiente coletados por um ano na EMBRAPA Gado de Corte localizado na área urbana de Campo Grande, Mato Grosso do Sul, Brasil. Dos 55 hospedeiros selvagens de seis espécies diferentes (Nasua nasua, Cebus spp., Cerdocyon thous, Myrmecophaga tridactyla, Tamandua tetradactyla e Dasyprocta aguti foram coletados 323 carrapatos. Amblyomma ovale foi encontrado apenas em quatis e Amblyomma nodosum apenas sobre tamanduás. Nenhum carrapato foi encontrado sobre macacos-prego. Por outro lado, Amblyomma cajennense foi encontrado em todos os hospedeiros

  18. Garrapatas (Acari: Ixodidae) en perros de la ciudad de Concepción, Chile Ticks (Acari: Ixodidae) on dogs in Concepción city, Chile

    OpenAIRE

    Muñoz., L.; M. E. CASANUEVA

    2002-01-01

    Con la finalidad de determinar las especies de garrapatas que parasitan a los perros de la ciudad de Concepción, se extrajeron 137 garrapatas desde perros de ocho clínicas veterinarias de cuatro comunas de la ciudad de Concepción. Los ejemplares encontradas fueron observados mediante lupa estereoscópica y algunos fotografiados a microscopio electrónico. Como resultados se obtuvo que el 38.7% correspondían a Amblyomma tigrinum adultos y el 61.3% a Rhipicephalus sanguineus adultos e inmadurosA ...

  19. Canis familiaris, UN NUEVO HOSPEDERO DE Ornithodoros (A. puertoricensis FOX, 1947 (ACARI: IXODIDA EN COLOMBIA Canis familiaris, a New Host of Ornithodoros (A. puertoricensis Fox, 1947 (Acari: Ixodida in Colombia

    Directory of Open Access Journals (Sweden)

    LUIS E PATERNINA

    Full Text Available Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de garrapatas que parasitan perros en tres poblaciones del área rural del Caribe colombiano. Durante los meses de agosto y diciembre del año 2006 se realizó búsqueda activa de garrapatas sobre caninos domésticos de las localidades de El Campín, Sabanas del Potrero y Escobar Arriba, departamento de Sucre. Las garrapatas recolectadas fueron almacenadas en viales con etanol al 70% e identificadas empleando claves morfológicas de referencia para cada familia. Para la determinación de especie en la familia Argasidae se realizaron estimaciones morfométricas de estructuras externas. Se recolectaron 420 garrapatas a partir de 50 caninos infestados, de un total de 134 perros examinados, que corresponde a una tasa de infestación del 37,3%. Las garrapatas fueron identificadas como Rhipicephalus sanguineus, Rhipicephalus (Boophilus microplus y Amblyomma ovale pertenecientes a la familia Ixodidae, y Ornithodoros (Alectorobius puertoricensis de la familia Argasidae. La especie predominante fue R. sanguineus (92,1% en los estados de larva, ninfa y adulto, seguida por larvas de O. puertoricensis, que fueron halladas en menor número sobre caninos de las tres localidades. Se registra, por primera vez en América, el parasitismo de O. puertoricensis sobre caninos domésticos y se confirma su presencia en Colombia.Ticks are very important from the biomedical point of view, by their hematophagic activity and their role in the transmission of pathogenic microorganisms to man and animals. The main goal of this work was to establish the tick species parasiting dogs in three rural localities of the Colombian Caribbean. From August to December 2006, an active search of ticks on dogs was carried out in the localities of El Camp

  20. Evaluation of four bed bug traps for surveillances of brown dog ticks (Acari: Ixodidae)

    Science.gov (United States)

    The brown dog tick can be a serious residential pest due to its unique ability, among ticks, to complete its lifecycle indoors. A single engorged and fertilized female tick can oviposit around 4,000 eggs, allowing indoor establishment to be rapid and easy to miss in early-stage infestations. Acari...

  1. Ticks (Acari: Ixodidae) associated with wildlife and vegetation of Haller park along the Kenyan coastline.

    Science.gov (United States)

    Wanzala, W; Okanga, S

    2006-09-01

    This artcile describes the results obtained from a tick survey conducted in Haller park along the Kenyan coastline. The survey aimed at evaluating tick-host associations, assessing tick population density, and providing baseline information for planning future tick control and management in the park. Ticks (2,968) were collected by handpicking from eight species of wildlife and by dragging in 14 selected sites within the park. A considerable proportion of ticks were also collected from leaves, stems, and bark of most dominant trees, namely, Casuarina equisetifolia L. (Forst. and Forst.), Cocos nucifera L., Adansonia digitata L., Musa paradisiaca L., and Azadiracta indica Adr. Juss. Dragging was conducted in sites predominantly occupied by Cynodon dactylon L. (Pers.), Cenchrus ciliaris L., Stenotaphrum dimidiatum L. (Kuntze.) Brongn., and Brachiaria xantholeuca Hack. Ex Schinz Stapf. and Loudetia kagerensis K. Schum. Hutch. Eight tick species were identified, and the collection included Rhipicephalus pravus Dönitz 1910, Rhipicephalus pulchellus Gerstäcker 1873, Hyalomma marginatum rufipes Koch 1844, Amblyomma gemma Dönitz 1910, Amblyomma hebraeum Koch 1844, Amblyomma sparsum Neumann 1899, Amblyomma nuttalli Dönitz 1909, and Boophilus decoloratus Koch 1844. Given that the identified tick species are known to parasitize humans as well as livestock, there exist risks of emergence of zoonotic infections mediated by tick vectors. In the recreational environment of Haller park, where tick vectors share habitats with hosts, there is a need to develop sustainable and effective tick control and management strategies to minimize economic losses that tick infestation may cause.

  2. First description of the nymph and larva of Dermacentor compactus Neumann, 1901 (Acari: Ixodidae), parasites of squirrels (Rodentia: Sciuridae) in southeast Asia.

    Science.gov (United States)

    Apanaskevich, Dmitry A

    2016-05-01

    Recent reexamination of collection lots stored in the United States National Tick Collection revealed adult specimens of Dermacentor compactus Neumann, 1901 (Acari: Ixodidae) reared from field-collected nymphs, which allowed us to associate field-collected unidentified nymphs and larvae with this species. Nymphs of D. compactus can be easily distinguished from those of other congeneric species by the shape of the scutum and spiracular plate, the hypostome dentition, and the size of the spurs on the coxae. Larvae of this species can be distinguished by the shape and sculpture of the scutum, the shape of basis capituli, the absence of auriculae, and the size of the spurs on coxae II and III. Both nymphs and larvae feed mostly on various species of squirrels (Rodentia: Sciuridae). Considerably fewer nymphs and larvae were found on murid rodents (Rodentia: Muridae), domestic dogs (Carnivora: Canidae), and a snake (Squamata: Colubridae). PMID:27095664

  3. Laboratory Study on Biological Control of Ticks (Acari: Ixodidae by Entomopathogenic Indigenous Fungi (Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    M Abdigoudarzi

    2009-12-01

    Full Text Available Background: Chemical control method using different acaricides as spray, dipping solution or pour-on is routinely used for controlling ticks. Biological control agents are favorable due to their safety for animals and environment. Entomopathogenic fungi such as Beauveria bassiana are well known for controlling ticks. In this study, two Iranian indigenous strains of B. bassiana (B. bassiana 5197 and B. bassiana Evin were selected and grown on specific me­dia. The pathogenic effects of these strains were evaluated on adult stages of two Iranian Ixodidae members (H. anatolicum anatolicum Koch 1844, and H. marginatum Koch 1844 by dipping method.Methods: Two Iranian strains of Beauveria bassiana (Beauveria bassiana 5197 and Beauveria bassiana Evin were selected and were grown successfully on specific media. The pathogenic effects of these strains were evaluated on adult stages of Iranian Ixodidae members such as, Hyalomma anatolicum anatolicum and H. marginatum by dipping method (these ticks were grown up at laboratory conditions during 2002 up to 2003 and still it is continued .Results: There was no effect of strain 5197 on mortality or fecundity rates for ticks. There was acute phase sign of paralysis in test group after dipping ticks in suspension made from Evin strain of B. bassiana. In addition, the test groups were totally died after four months, but the control groups survived for six months.Conclusion: High concentration of fungal spores is needed for inducing fungal infection. Additional study using different strains and fungi on Iranian ticks is proposed. 

  4. [Interrelatio of acari Ixodidae and hosts of Edentata of the Serra da Canastra, Minas Gerais, Brazil].

    Science.gov (United States)

    Botelho, J R; Linardi, P M; da Encarnação, C D

    1989-01-01

    We received for examination a small colection of ticks captured in the National Park of the Serra da Canastra (MG), between 1979 and 1980. The authors demonstrated the existence of a broad co-accomodation of Amblyomma pseudoconcolor on Edentata of the family Dasypodidae, being Dasypodini the tribe more adjusted to this infestation. In conformity to the Figs 1 and 2, Dasypodini are probably the real hosts of A. pseudoconcolor and also the oldest hosts. For the first time, A. pseudoconcolor is also recorded on Cabassous tatouay, C. unicinctus, Priodontes maximus and Euphractus sexcincuts. Also for the first time A. pseudoconcolor and Amblyomma calcaratum were recorded in the State of Minas Gerais. The ectoparasites are deposited in the "Departamento de Parasitologia da Universidade Federal de Minas Gerais, Brasil".

  5. Ticks (Acari: Ixodidae on wild animals from the Porto-Primavera Hydroelectric power station area, Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo B Labruna

    2002-12-01

    Full Text Available From June 2000 to June 2001, a total of 741 ticks were collected from 51 free-living wild animals captured at the Porto-Primavera Hydroelectric power station area, located alongside an approximately 180 km course of the Paraná river, between the states of São Paulo and Mato Grosso do Sul, comprising 9 species of 3 genera: Ambly-omma (7 species, Boophilus (1 and Anocentor (1. A total of 421 immature Amblyomma ticks were reared in laboratory until the adult stage, allowing identification of the species. A. cajennense was the most frequent tick species (mostly immature stages collected on 9 host species: Myrmecophaga tridactyla, Tamandua tetradactyla,Cerdocyon thous, Puma concolor,Tayassu tajacu, Mazama gouazoubira,Hydrochaeris hydrochaeris,Alouatta caraya, Cebus apella. Other tick species were less common, generally restricted to certain host taxa.

  6. Identification and characterization of microRNAs by deep-sequencing in Hyalomma anatolicum anatolicum (Acari: Ixodidae) ticks.

    Science.gov (United States)

    Luo, Jin; Liu, Guang-Yuan; Chen, Ze; Ren, Qiao-Yun; Yin, Hong; Luo, Jian-Xun; Wang, Hui

    2015-06-15

    Hyalomma anatolicum anatolicum (H.a. anatolicum) (Acari: Ixodidae) ticks are globally distributed ectoparasites with veterinary and medical importance. These ticks not only weaken animals by sucking their blood but also transmit different species of parasitic protozoans. Multiple factors influence these parasitic infections including miRNAs, which are non-coding, small regulatory RNA molecules essential for the complex life cycle of parasites. To identify and characterize miRNAs in H.a. anatolicum, we developed an integrative approach combining deep sequencing, bioinformatics and real-time PCR analysis. Here we report the use of this approach to identify miRNA expression, family distribution, and nucleotide characteristics, and discovered novel miRNAs in H.a. anatolicum. The result showed that miR-1-3p, miR-275-3p, and miR-92a were expressed abundantly. There was a strong bias on miRNA, family members, and nucleotide compositions at certain positions in H.a. anatolicum miRNA. Uracil was the dominant nucleotide, particularly at positions 1, 6, 16, and 18, which were located approximately at the beginning, middle, and end of conserved miRNAs. Analysis of the conserved miRNAs indicated that miRNAs in H.a. anatolicum were concentrated along three diverse phylogenetic branches of bilaterians, insects and coelomates. Two possible roles for the use of miRNA in H.a. anatolicum could be presumed based on its parasitic life cycle: to maintain a large category of miRNA families of different animals, and/or to preserve stringent conserved seed regions with active changes in other places of miRNAs mainly in the middle and the end regions. These might help the parasite to undergo its complex life style in different hosts and adapt more readily to the host changes. The present study represents the first large scale characterization of H.a. anatolicum miRNAs, which could further the understanding of the complex biology of this zoonotic parasite, as well as initiate miRNA studies

  7. Molecular Detection of Rickettsia Species Within Ticks (Acari: Ixodidae) Collected from Arkansas United States.

    Science.gov (United States)

    Trout Fryxell, R T; Steelman, C D; Szalanski, A L; Billingsley, P M; Williamson, P C

    2015-05-01

    Rocky Mountain spotted fever (RMSF), caused by the etiological agent Rickettsia rickettsii, is the most severe and frequently reported rickettsial illness in the United States, and is commonly diagnosed throughout the southeast. With the discoveries of Rickettsia parkeri and other spotted fever group rickettsiae (SFGR) in ticks, it remains inconclusive if the cases reported as RMSF are truly caused by R. rickettsii or other SFGR. Arkansas reports one of the highest incidence rates of RMSF in the country; consequently, to identify the rickettsiae in Arkansas, 1,731 ticks, 250 white-tailed deer, and 189 canines were screened by polymerase chain reaction (PCR) for the rickettsial genes gltA, rompB, and ompA. None of the white-tailed deer were positive, while two of the canines (1.1%) and 502 (29.0%) of the ticks were PCR positive. Five different tick species were PCR positive: 244 (37%) Amblyomma americanum L., 130 (38%) Ixodes scapularis Say, 65 (39%) Amblyomma maculatum (Koch), 30 (9%) Rhipicephalus sanguineus Latreille, 7 (4%) Dermacentor variabilis Say, and 26 (44%) unidentified Amblyomma ticks. None of the sequenced products were homologous to R. rickettsii. The most common Rickettsia via rompB amplification was Rickettsia montanensis and nonpathogenic Candidatus Rickettsia amblyommii, whereas with ompA amplification the most common Rickettsia was Ca. R. amblyommii. Many tick specimens collected in northwest Arkansas were PCR positive and these were commonly A. americanum harboring Ca. R. amblyommii, a currently nonpathogenic Rickettsia. Data reported here indicate that pathogenic R. rickettsii was absent from these ticks and suggest by extension that other SFGR are likely the causative agents for Arkansas diagnosed RMSF cases.

  8. Preliminary survey of ticks (Acari : Ixodidae on cattle in northern Sudan

    Directory of Open Access Journals (Sweden)

    D.A. Salih

    2004-11-01

    Full Text Available In a cross sectional survey conducted during the period June 2001 to July 2002, the geographical distribution of ticks on cattle in the Sudan was determined. Seventeen locations were surveyed from Northern, Central, Eastern, Western, Blue Nile and White Nile Provinces. Total body collections of ticks were made from 20 cattle at each location. Four tick genera and 11 species were identified. The tick species collected included Amblyomma lepidum, Amblyomma variegatum, Boophilus decoloratus, Hyalomma anatolicum anatolicum, Hyalomma dromedarii, Hyalomma impeltatum, Hyalomma marginatum rufipes, Hyalomma truncatum, Rhipicephalus evertsi evertsi, Rhipicephalus sanguineus group and Rhipicephalus simus simus. Major ecological changes have occurred due to extensive animal movement, deforestation, desertification and establishment of large mechanized agricultural schemes. These factors have certainly affected the distribution of ticks and tick-borne diseases in the Sudan. The absence of A. variegatum and A. lepidum in northern Sudan was not surprising, since these tick species are known to survive in humid areas and not in the desert and semi-desert areas of northern Sudan. The absence of B. annulatus in northern and central Sudan is in accordance with the finding that this tick species is restricted to the southern parts of the central Sudan. The presence of H. anatolicum anatolicum in Um Benin in relatively high abundance is an interesting finding. The present finding may indicate that the southern limit of this species has changed and moved southwards to latitude 13o N. It is concluded that major changes in tick distribution have taken place in the Sudan

  9. Preliminary survey of ticks (Acari: Ixodidae) parasitizing wild turkeys (Aves: Phasianidae) in eastern Kansas.

    Science.gov (United States)

    Mock, D E; Applegate, R D; Fox, L B

    2001-01-01

    During the spring and fall turkey hunting seasons of 1999, hunters and Kansas Department of Wildlife and Parks field personnel examined wild turkeys, Meleagris gallopavo L., for ticks and submitted them to us for identification. From springtime hunting, we received 113 ticks from 12 turkeys killed in nine counties, all in the eastern one-third of Kansas. Collectors reported examining three additional wild turkeys on which no ticks were found. All ticks were nymphal lone star ticks, Amblyomma americanum (L.). Of 11 wild turkeys examined in seven counties during October, one was parasitized by 30 A. americanum larvae. Data from this study and accounts from the published literature suggest that parasitism of wild turkeys by immature lone star ticks is commonplace wherever this host and ectoparasite are sympatric. Our study suggests that M. gallopavo may be an important host that supports lone star tick populations.

  10. Ticks (Acari: Ixodidae) collected from small and medium-sized Kansas mammals.

    Science.gov (United States)

    Brillhart, D B; Fox, L B; Upton, S J

    1994-05-01

    Seven species of hard-bodied ticks were collected from 20 species of small and medium-sized mammals in Kansas; Amblyomma americanum L., Dermacentor variabilis (Say), Haemaphysalis leporispalustris (Packard), Ixodes cookei Packard, I. kingi Bishopp, I. sculptus Neumann, and I. texanus Banks. Dermacentor variabilis was found statewide, A. americanum only in the eastern one-third of the state, and the Ixodes spp. and H. leporispalustris were widely scattered. The most common tick found was D. variabilis, both by itself and in association with other ticks. Mammals that ticks were collected from included Canis latrans Say, Cynomys ludovicianus ludovicianus (Ord), Didelphis virginianus Kerr, Geomys bursarius (Shaw), Lynx rufus (Schreber), Marmota monax bunkeri Black, Mephitis mephitis (Schreber), Microtus ochrogaster (Wagner), Mus musculus L., Peromyscus leucopus (Rafinesque), P. maniculatus (Wagner), Procyon lotor hirtus Nelson and Goldman, Reithrodontomys megalotis (Baird), Sciurus niger rufiventer Geoffroy, Sigmodon hispidus texianus (Audubon and Bachman), Sylvilagus floridanus (J. A. Allen), Taxidea taxus taxus (Schreber), and Vulpes velox velox (Say). PMID:8057327

  11. Hard ticks (Acari: Ixodidae) of livestock in Nicaragua, with notes about distribution.

    Science.gov (United States)

    Düttmann, Christiane; Flores, Byron; Kadoch Z, Nathaniel; Bermúdez C, Sergio

    2016-09-01

    We document the species of ticks that parasitize livestock in Nicaragua. The study was based on tick collection on cattle and horses from 437 farms in nine departments. Of 4841 animals examined (4481 cows and 360 horses), 3299 were parasitized, which represent 68 % of the bovines and 67 % of the equines in study: 59 cows and 25 horses were parasitized by more than one species. In addition, 280 specimens of the entomological museum in León were examined. The ticks found on cattle were Rhipicephalus microplus (75.2 % of the ticks collected), Amblyomma mixtum (20.8 %), A. parvum (2.6 %), A. tenellum (0.7 %), A. maculatum (0.7 %). While the ticks collected from the horses were: Dermacentor nitens (41.5 %), A. mixtum (31.7 %), R. microplus (13.8 %), A. parvum (6.5 %), A. tenellum (3.3 %), D. dissimilis (2.4 %) and A. maculatum (0.8 %). PMID:27392740

  12. The Evolving Medical and Veterinary Importance of the Gulf Coast tick (Acari: Ixodidae).

    Science.gov (United States)

    Paddock, Christopher D; Goddard, Jerome

    2015-03-01

    Amblyomma maculatum Koch (the Gulf Coast tick) is a three-host, ixodid tick that is distributed throughout much of the southeastern and south-central United States, as well as several countries throughout Central and South America. A considerable amount of scientific literature followed the original description of A. maculatum in 1844; nonetheless, the Gulf Coast tick was not recognized as a vector of any known pathogen of animals or humans for >150 years. It is now identified as the principal vector of Hepatozoon americanum, the agent responsible for American canine hepatozoonosis, and Rickettsia parkeri, the cause of an emerging, eschar-associated spotted fever group rickettsiosis identified throughout much of the Western Hemisphere. Coincident with these discoveries has been recognition that the geographical distribution of A. maculatum in the United States is far more extensive than described 70 yr ago, supporting the idea that range and abundance of certain tick species, particularly those with diverse host preferences, are not fixed in time or space, and may change over relatively short intervals. Renewed interest in the Gulf Coast tick reinforces the notion that the perceived importance of a particular tick species to human or animal health can be relatively fluid, and may shift dramatically with changes in the distribution and abundance of the arthropod, its vertebrate hosts, or the microbial agents that transit among these organisms. PMID:26336308

  13. Ticks (Acari: Ixodidae) on swifts (Apodiformes: Apodidae) in Minas Gerais, southeastern Brazil.

    Science.gov (United States)

    Tolesano-Pascoli, Graziela; Garcia, Frederico Innecco; Gomes, Carla Raphaela Gonzaga; Diniz, Kátia Cristina; Onofrio, Valeria Castilho; Venzal, José Manuel; Szabó, Matias Pablo Juan

    2014-10-01

    Brazil harbors five species of Cypseloidinae swifts. Those from Streptoprocne and Cypseloides genera have a very distinct ecology. They shelter at night and build nests in moist cliffs by waterfalls. Information about tick infestation of these birds is virtually non-existent and restricted to the description of a new species, Ixodes paranaensis, in Streptoprocne biscutata in Paraná State and another record of this species in Streptoprocne zonaris in Minas Gerais State. We herein report tick infestation of swifts at eight waterfalls in the Cerrado biome of Minas Gerais State, southeastern Brazil. Swifts were captured during six campaigns from November 2008 to April 2013. Overall, 584 swifts were captured (527 C. senex, four C. fumigatus and 53 S. zonaris). Four birds were tick infested (prevalence of 0.7 %). Three individuals of C. senex hosted one tick each; a nymph of I. paranaensis, a female of I. paranaensis and a nymph of Amblyomma cajennense. One S. zonaris hosted an I. paranaensis nymph and an Ornithodoros sp. larva (Argasidae). PMID:24696361

  14. Elemol and Amyris Oil Repel the Ticks Ixodes scapularis and Amblyomma americanum (Acari: Ixodidae) in Laboratory Bioassays

    Science.gov (United States)

    The essential oil from Amyris balsamifera (Rutaceae) and elemol, a principal constituent of the essential oil of Osage orange, Maclura pomifera (Moraceae) were evaluated in in vitro and in vivo laboratory bioassays for repellent activity against host-seeking nymphs of the blacklegged tick, Ixodes sc...

  15. Ecology of the interaction between Ixodes loricatus (Acari: Ixodidae) and Akodon azarae (Rodentia: Criceridae).

    Science.gov (United States)

    Colombo, Valeria C; Nava, Santiago; Antoniazzi, Leandro R; Monje, Lucas D; Racca, Andrea L; Guglielmone, Alberto A; Beldomenico, Pablo M

    2015-10-01

    The present study explores associations of different factors (i.e. host parameters, presence of other ectoparasites and [mainly biotic] environmental factors) with burdens of Ixodes loricatus immature stages in one of its main hosts in Argentina, the rodent Akodon azarae. For 2 years, rodents were trapped and sampled monthly at 16 points located in four different sites in the Parana River Delta region. Data were analysed with generalized linear mixed models with a negative binomial response (counts of larvae or nymphs). The independent variables assessed were (a) environmental: trapping year, presence of cattle, type of vegetation, rodent abundance; (b) host parameters: body length, sex, body condition, blood cell counts, natural antibody titers and (c) co-infestation with other ectoparasites. Two-way interaction terms deemed a priori as relevant were also included in the analysis. Most of the associations investigated were found significant, but in general, the direction and magnitude of the associations were context-dependent. An exception was the presence of cattle, which was consistently negatively associated with both larvae and nymphs independently of all other variables considered and had the strongest effect on tick burdens. Mites, fleas and Amblyomma triste were also significantly associated (mostly positively) with larval and nymph burdens, and in many cases, they influenced associations with environmental or host factors. Our findings strongly support that raising cattle may have a substantial impact on the dynamics of I. loricatus and that interactions within the ectoparasite community may be an important-but generally ignored-driver of tick dynamics.

  16. Resistance status of ticks (Acari; Ixodidae) to amitraz and cypermethrin acaricides in Isoka District, Zambia.

    Science.gov (United States)

    Muyobela, Jackson; Nkunika, Philip Obed Yobe; Mwase, Enala Tembo

    2015-12-01

    This study was designed to obtain data on the farmer's approach to tick control and to determine whether Rhipicephalus appendiculatus Neuman, Amblyomma variegatum (Fabricius), and Rhipicephalus (Boophilus) microplus (Canestrini) were resistant to amitraz and cypermethrin acaricides, in Isoka District, Zambia. Prevailing tick control practices were documented by administering a semi-structured questionnaire to 80 randomly selected smallholder livestock farmers from four agricultural camps (Longwe, Kantenshya, Kapililonga, and Ndeke) in Isoka District. Modified larval packet test (LPT) bioassay experiments were used to determine the resistance status of the common tick species against amitraz and cypermethrin acaricides. Fifty percent of respondents practiced chemical tick control with amitraz (27 %) and cypermethrin (23 %) being the acaricides in use, and were applied with knapsack sprayers. Less than 3 l of spray wash per animal was used which was considerably lower than the recommended delivery rate of 10 l of spray wash per animal. No significant susceptibility change to amitraz at 95 % confidence level was observed in R. appendiculatus and A. variegatum against amitraz. However, a significant change in the susceptibility of R. (Bo.) microplus tested with amitraz was detected at 95 % confidence. The test population had a lower susceptibility (LD50 0.014 %; LD90 0.023 %) than the reference population (LD50 0.013 %; LD90 0.020 %). The results indicated that resistance to amitraz was developing in R. (Bo.) microplus. For cypermethrin, no significant susceptibility change at 95 % confidence was observed in any of the three species and thus resistance to this chemical was not observed.

  17. Resistance status of ticks (Acari; Ixodidae) to amitraz and cypermethrin acaricides in Isoka District, Zambia.

    Science.gov (United States)

    Muyobela, Jackson; Nkunika, Philip Obed Yobe; Mwase, Enala Tembo

    2015-12-01

    This study was designed to obtain data on the farmer's approach to tick control and to determine whether Rhipicephalus appendiculatus Neuman, Amblyomma variegatum (Fabricius), and Rhipicephalus (Boophilus) microplus (Canestrini) were resistant to amitraz and cypermethrin acaricides, in Isoka District, Zambia. Prevailing tick control practices were documented by administering a semi-structured questionnaire to 80 randomly selected smallholder livestock farmers from four agricultural camps (Longwe, Kantenshya, Kapililonga, and Ndeke) in Isoka District. Modified larval packet test (LPT) bioassay experiments were used to determine the resistance status of the common tick species against amitraz and cypermethrin acaricides. Fifty percent of respondents practiced chemical tick control with amitraz (27 %) and cypermethrin (23 %) being the acaricides in use, and were applied with knapsack sprayers. Less than 3 l of spray wash per animal was used which was considerably lower than the recommended delivery rate of 10 l of spray wash per animal. No significant susceptibility change to amitraz at 95 % confidence level was observed in R. appendiculatus and A. variegatum against amitraz. However, a significant change in the susceptibility of R. (Bo.) microplus tested with amitraz was detected at 95 % confidence. The test population had a lower susceptibility (LD50 0.014 %; LD90 0.023 %) than the reference population (LD50 0.013 %; LD90 0.020 %). The results indicated that resistance to amitraz was developing in R. (Bo.) microplus. For cypermethrin, no significant susceptibility change at 95 % confidence was observed in any of the three species and thus resistance to this chemical was not observed. PMID:26310511

  18. Repellency of oils of lemon eucalyptus, geranium, and lavender and the mosquito repellent MyggA natural to Ixodes ricinus (Acari: Ixodidae) in the laboratory and field.

    Science.gov (United States)

    Jaenson, Thomas G T; Garboui, Samira; Palsson, Katinka

    2006-07-01

    MyggA Natural (Bioglan, Lund, Sweden) is a commercially available repellent against blood-feeding arthropods. It contains 30% of lemon-scented eucalyptus, Corymbia citriodora (Hook.) K. D. Hill & L. A. S. Johnson (Myrtaceae), oil with a minimum of 50% p-menthane-3,8-diol. MyggA Natural also contains small amounts of the essential oils of lavender, Lavandula angustifolia Mill. (Lamiaceae), and geranium, Pelargonium graveolens L'Her. (Geraniaceae). In laboratory bioassays, MyggA Natural and C. citriodora oil exhibited 100% repellency against host-seeking nymphs of Ixodes ricinus (L.) (Acari: Ixodidae). Lavender oil and geranium oil, when diluted to 1% in 1,2-propanediol, had weak repellent activities on I. ricinus nymphs, but when diluted to 30% in 1,2-propanediol had 100% repellencies. 1,2-Propanediol (100%) had no significant repellent activity in comparison with that of the control. In field tests in tick-infested areas in central Sweden, tick repellency of MyggA Natural and C. citriodora oil was tested by the blanket-dragging technique for 4 d during a 6-d period. The repellencies (74 and 85%, respectively) on day 1 are similar (89%) to that of blankets treated in a similar manner with 19% diethyl-methyl-benzamide, based on previous work. Repellencies declined significantly from day 1 to day 6 (74 to 45% for MyggA Natural; 85 to 42% for C. citriodora oil). PMID:16892632

  19. Ocorrência de Amblyomma fuscum Neumann, 1899 e Amblyomma humerale Koch, 1844 (Acari: Ixodidae em Bufo arenalis no estado de São Paulo, Brasil Occurence of Amblyomma fuscum Neumann, 1899 and Amblyomma humerale Koch, 1844 (Acari: Ixodidae in Bufo arenalis in the state of São Paulo, Brazil

    Directory of Open Access Journals (Sweden)

    Afonso Lodovico Sinkoc

    1997-06-01

    Full Text Available O objetivo deste trabalho é relatar a ocorrência do parasitismo monoespecífico de A. fuscum NEUMANN, 1899 e A. humerale KOCH, 1844 em sapos (Bufo arenalis no Município de Rosana, Estado de São Paulo, Brasil. Este relato caracteriza um novo hospedeiro e uma nova localização geográfica para estas duas espécies de carrapatos.The objective of this work is to describe the occurence of the monoespecific parasitism of A. fuscum NEUMANN, 1899 and A. humerale KOCH, 1844 in toads (Bufo arenalis from the County of Rosana, State of São Paulo, Brazil. This is the description of a new host and new geographic site for those two species.

  20. Relationship between habitat type, fire frequency, and Amblyomma americanum populations in east-central Alabama.

    Science.gov (United States)

    Willis, Damien; Carter, Robert; Murdock, Chris; Blair, Benjie

    2012-12-01

    Ticks were collected from 20 sites in the Calhoun, Cherokee, and Cleburne Counties in east-central Alabama areas to determine the relationship between plant physiognomy, environmental variables, and tick populations. Sites investigated included various burning regimes, wildland-urban-interface (WUI), a college campus, and an unmanaged area. Amblyomma americanum (L.) (Acari: Ixodidae) dominated the tick population while Ixodes scapularis Say was not encountered. There were complex differences in tick populations among site conditions. After prescribed burning, the tick population size was small but was larger in subsequent 2- and 5-year post-burn sites. An increase in Odocoileus virginianus foraging in recently burned sites is likely responsible for this phenomenon. WUI areas had the largest tick populations likely due to Odocoileus virginianus activity in an area that provides cover, forage, and a connection to a wildlife refuge. It is possible that the likelihood of humans coming in contact with ticks and tick-borne diseases is greater in WUI areas than in unbroken contiguous forest. A. americanum showed a positive correlation with percent cover of grass and leaf litter mass and a negative relationship with pine sapling density. Variables expected to be strongly correlated with A. americanum populations such as soil moisture, canopy closure, and tree density were found to have weak correlations. PMID:23181862

  1. Molecular Phylogeny of a tick, Ixodes granulatus (Acari: Ixodidae) based on cytochrome oxidase subunit I (COI) marker

    Science.gov (United States)

    Lah, Ernieenor Faraliana Che; Yaakop, Salmah; Ahamad, Mariana; George, Ernna; Nor, Shukor Md

    2014-09-01

    Identification of a local species of tick, Ixodes granulatus from the family Ixodidae is essential because it has potential to be vector for spotted fever group (SFG) rickettsia and tick thypus. The aim of this study is to portray the relationships among several populations of I. granulatus collected from different species of animal hosts and localities in Peninsular Malaysia. Polymerase Chain Reaction was conducted by amplifying mitochondrial DNA marker, namely cytochrome oxidase subunit I (COI) sequences from 15 individual ticks that attached to five different hosts caught from three different localities. Confirmation of the species identity was accomplished using BLAST program. Neighbor-joining (NJ) and Maximum Parsimony (MP) tree based on COI sequences were constructed by using PAUP 4.0b10 to identify the relationship among species. The result of this study showed a high genetic heterogeneity between I. granulatus and other species of the same genus (7.2-23.7%). Furthermore, a low intraspecific variation was observed among the species of I. granulatus collected from different localities (0-3.7%). This study produced the first establishment of molecular marker for clarifying genetic species variation and diversity of local I. granulatus tick which contribute to the control of tick-borne infections.

  2. A Preliminary Investigation on Ticks (Acari: Ixodidae) Infesting Birds in Kızılırmak Delta, Turkey.

    Science.gov (United States)

    Keskin, Adem; Erciyas-Yavuz, Kiraz

    2016-01-01

    Ticks are mandatory blood-feeding ectoparasites of mammals, birds, reptiles, and even amphibians. Turkey has a rich bird fauna and is located on the main migration route for many birds. However, information on ticks infesting birds is very limited. In the present study, we aimed to determine ticks infesting birds in Kızılırmak Delta, Turkey. In 2014 autumn bird migration season, a total of 7,452 birds belonging to 79 species, 52 genera, 35 families, and 14 orders were examined for tick infestation. In total, 287 (234 larvae, 47 nymphs, 6♀) ticks were collected from 54 passerine birds (prevalence = 0.72%) belonging to 12 species. Ticks were identified as Amblyomma sp., Dermacentor marginatus (Sulzer), Haemaphysalis concinna Koch, Haemaphysalis punctata Canestrini and Fanzago, Hyalomma sp., Ixodes frontalis (Panzer), and Ixodes ricinus (L). The most common tick species were I. frontalis (223 larvae, 23 nymphs, 6♀) followed by I. ricinus (3 larvae, 12 nymphs) and H. concinna (4 larvae, 6 nymphs). Based on our results, it can be said that Erithacus rubecula (L.) is the main host of immature I. frontalis, whereas Turdus merula L. is the most important carrier of immature stages of some ticks in Kızılırmak Delta, Turkey. To the best of our knowledge, most of the tick-host associations found in this study have never been documented in the literature.

  3. A comparison of the performance of regression models of Amblyomma americanum (L.) (Ixodidae) using life cycle or landscape data from administrative divisions.

    Science.gov (United States)

    Estrada-Peña, Agustín; de la Fuente, José; Cabezas-Cruz, Alejandro

    2016-06-01

    The distribution of Amblyomma americanum (L.) in the continental United States has been modelled using the reported distribution in counties as "established" (six or more ticks or two or more life stages were recorded during a specified time period), "reported" (fewer than six ticks of a single life stage were recorded), or "absent" (neither of the above categories were met) and a set of environmental and biotic explanatory variables. Categorical (vegetation, climate, and habitat suitability for the main host of the tick) or continuous variables (raw data on temperature, vegetation, and habitat fragmentation), as well as the processes of the tick's life cycle, were tested to build models using multiple logistic regression. The best results were obtained when the life cycle processes were used as descriptors of regressions. Better models derived from life cycle processes were obtained after inclusion of habitat suitability for the white tailed deer (the main host of the tick) and landscape fragmentation. Using this approach, 86% of "absent" and 83% of "established" counties were classified correctly, but all "reported" counties were erroneously classified. Modelling life cycle processes with descriptions of host abundance and habitat fragmentation produced the best outcome when coordinates were missing. When only standard categorical descriptors of climate or vegetation were included in models, results produced poor outcomes. Models were improved with remotely sensed information on temperature and vegetation but produced high rates of misclassification for 14% of "absent", 37% of "established", and 100% of "reported" counties. Modelling produced poor results in the absence of point distributions (coordinates). Therefore, "reported" counties cannot be handled adequately by modelling procedures, probably because this category does not reflect the true status of the tick distribution. We conclude that standard categorical classifications of the distribution of an

  4. Repellency to ticks (Acari: Ixodidae) of extracts of Nigella sativa (Ranunculaceae) and the anti-inflammatory DogsBestFriend™.

    Science.gov (United States)

    Carroll, J F; Babish, J G; Pacioretty, L M; Kramer, M

    2016-09-01

    Motivated by observations that the canine anti-inflammatory cream DogsBestFriend™ (DBF) appeared to deter flies, mosquitoes, and ticks from treated animals, repellent efficacy bioassays using four species of ticks were conducted with three extracts of Nigella sativa L. (Ranunculaceae), a constituent of DBF. The DBF cream was tested against nymphs of lone star tick, Amblyomma americanum (L.). In vertical filter paper assays, the three extracts applied at 0.413 mg extract/cm(2) filter paper repelled 96.7-100 % of brown dog tick, Rhipicephalus sanguineus (Latreille) nymphs, whereas, at the same rate, only one extract repelled >90 % A. americanum nymphs. Adult (mixed sexes) American dog ticks, Dermacentor variabilis (Say), required a higher concentration to be repelled effectively; two extracts, applied at 0.827 mg extract/cm(2) filter paper, repelled ≥90 % of the D. variabilis. In contrast, all extracts applied at much lower concentration (0.206 mg extract/cm(2) filter paper) repelled 100 % adult blacklegged ticks, Ixodes scapularis Say (only females tested). Of the two more repellent extracts, one lost most of its activity against A. americanum nymphs in repelled 66.7 % of the nymphs at 192 h after application. At 0.206 mg extract/cm(2) filter paper, one extract was as repellent as deet against A. americanum nymphs. In a vertical bioassay in which nylon organdy was substituted for filter paper, DBF, at the rates of 1.67 and 0.835 mg cream/cm(2), repelled 76.7 and 30.0 % A. americanum nymphs, respectively. These findings indicate that when applied appropriately DBF should afford some protection to canines against tick bites. PMID:27394440

  5. Survey of ticks (Acari: Ixodidae) and their rickettsia in an Atlantic rain forest reserve in the State of São Paulo, Brazil.

    Science.gov (United States)

    Sabatini, Guilherme S; Pinter, Adriano; Nieri-Bastos, Fernanda A; Marcili, Arlei; Labruna, Marcelo B

    2010-09-01

    The current study investigated the occurrence of ticks and their rickettsiae in the Serra do Mar State Park, which encompasses one of the largest Atlantic rain forest reserves of Brazil. From July 2008 to June 2009, a total of 2439 ticks (2,196 free living and 243 collected on hosts) was collected, encompassing the following 13 species: Amblyomma aureolatum (Pallas), Amblyomma brasiliense AragAo, Amblyomma dubitatum Neumann, Amblyomma fuscum Neumann, Amblyomma incisum Neumann, Amblyomma longirostre (Koch), Amblyomma naponense (Packard), Amblyomma nodosum Neumann, Amblyomma ovale Koch, Haemaphysalis juxtakochi Cooley, Ixodes aragaoi Fonseca, Ixodes loricatus Neumann, and Rhipicephalus sanguineus (Latreille). Ticks were submitted to polymerase chain reaction assays targeting portions of the rickettsial genes gltA and ompA. Polymerase chain reaction products were DNA sequenced and compared with corresponding sequences available in GenBank. Rickettsia bellii, a rickettsia of unknown pathogenicity, was detected in one A. aureolatum, one A. ovale, and three A. incisum specimens. At least 8.8% (3/34) of the free-living A. ovale ticks, 13.6% (8/59) of the A. ovale ticks collected from dogs, and 1.9% (1/54) of the R. sanguineus (Latreille) ticks were found to be infected by Rickettsia sp strain Atlantic rain forest, a novel strain that has been shown to cause an eschar-associated spotted fever in the state of Sho Paulo. Our results suggest that A. ovale is the vector of Rickettsia sp strain Atlantic rain forest in the state of São Paulo. PMID:20939390

  6. Neuronal projections from the Haller's organ and palp sensilla to the synganglion of Amblyomma americanum

    Science.gov (United States)

    The present study was conducted to elucidate the neuronal pathways between peripheral olfactory and taste sensilla and the synganglion in an Ixodidae tick species. The tarsus of the front legs (olfactory nerves) and the fourth palpal segment (gustatory nerves) of unfed Amblyomma americanum males and...

  7. In vitro activity of 3β-O-tigloylmelianol from Guarea kunthiana A. Juss (Meliaceae) on oogenesis and ecdysis of the cattle tick Rhipicephalus (Boophilus) microplus (Canestrini) (Acari: Ixodidae).

    Science.gov (United States)

    Barbosa, Carolina da Silva; Borges, Lígia Miranda Ferreira; Louly, Carla Cristina Braz; Rocha, Thiago Lopes; de Sabóia-Morais, Simone Maria Teixeira; Miguita, Carlos Henrique; Garcez, Walmir Silva; Garcez, Fernanda Rodriguez

    2016-05-01

    We evaluated the effects of 3β-O-tigloylmelianol from Guarea kunthiana A. Juss (Meliaceae) on oogenesis, as a larvicide and on ecdysis of the larvae and the nymphs of the cattle tick Rhipicephalus (Boophilus) microplus (Canestrini) (Acari: Ixodidae). On the oogenesis' test, 48 engorged females were divided into three groups, evaluated at 24, 48 and 72 h post-treatment. Half of the females were treated with 0.01% 3β-O-tigloylmelianol diluted in distilled water and 5% dimethyl sulfoxide (DMSO), while the other half (controls) were exposed to distilled water and 5% DMSO. After treatment, the ovaries were weighed in order to measure the gonadosomatic index (GSI) and were also subjected to standard histological technical tests. On the larvicide and ecdysis' tests, 3β-O-tigloylmelianol was tested at concentrations of 0.01, 0.005, 0.0025 and 0.00125%. Compared with the controls, there was a reduction of GSI of approximately 50% on the treated group, which started at 48 h post treatment. Overall, the protolimonoid 3β-O-tigloylmelianol has caused a significant reduction in the number of oocytes. It has also caused alteration of the cytoplasmic and germinal vesicle diameters. Morphological changes, such as vacuolization, chorion irregularity which has modified the oocytes' morphology as well as alterations on the yolk's granules were also observed. The compound was not larvicide, however, interfered in the ecdysis of the larvae and the nymphs. This study shows that the protolimonoid 3β-O-tigloylmelianol from G. kunthiana acts on oogenesis and ecdysis of R. (B.) microplus, but not as larvicide, indicating that it acts on the endocrine system of the tick.

  8. Detection of protozoans Babesia microti and [i]Toxoplasma gondii[/i] and their co-existence in ticks (Acari: Ixodida collected in Tarnogórski district (Upper Silesia, Poland

    Directory of Open Access Journals (Sweden)

    Marek Asman

    2015-02-01

    Full Text Available [b]Introduction[/b]. Ticks (Acari: Ixodida are vectors of many pathogens i. a: [i]Babesia microti [/i][Bm] and [i]Toxoplasma gondii[/i] [Tg]. In Poland, Ixodes ricinus [Ir] is the main vector of both pathogens. This tick species and pathogens transmitted by them are a significant threat to human and animal health. objectives of the study. Detection of the protozoans Bm and Tg in ticks collected in the Tarnogórski district area. [b]Material and methods[/b]. The ticks were collected from vegetation and pets in the spring period of their activity on the territory of the Tarnogórski district. The parasites were preserved in 70% ethanol. DNA was isolated by ammonia method. Bm was detected by nested-PCR using specific primers for the 18S rRNA sequence. To detect the Tg a commercial kit was used. The PCR products were separated on 2% ethidium bromide stained agarose gels and visualised under UV light. [b]Results[/b]. It was showed that all collected ticks belonged to the species Ir. Bm was detected in 50.87% and Tg in 64.91% of all examined ticks. Co-existence of these both protozoans in 36.84% of total examined ticks was noted. [b]Conclusions[/b]. The study showed a high risk of exposure to Bm and Tg in the studied area. Ticks Ir play an important role in the transmission of Bm in this region. Demonstrating a high percentage of ticks collected from animals infected with Tg may indicate their important role in the transmission of this pathogen, but it requires a further studies.

  9. Diversity of ticks (Acari: Ixodidae) infesting cheetahs (Acinoyx jubatus) at three breeding centres in South Africa and activity patterns of questing ticks.

    Science.gov (United States)

    Golezardy, Habib; Oosthuizen, Marinda C; Penzhorn, Barend L

    2016-07-01

    Ticks were collected from 191 cheetahs at three breeding centres in North West and Limpopo Provinces, South Africa. Haemaphysalis elliptica, a common tick of large felids, was the most abundant species collected, while Amblyomma hebraeum and Rhipicephalus simus occurred in lower numbers. In addition to these three species, drag-sampling of the vegetation revealed the presence of Amblyomma marmoreum, Rhipicephalus (B.) decoloratus and Rhipicephalus zambeziensis. The presence of free-ranging antelopes, murid rodents and tortoises at the breeding centres probably contributed to the availability of immature tick stages on the vegetation. Diurnal and seasonal questing patterns of ixodid ticks were investigated at monthly intervals at the largest cheetah-breeding centre. Questing ticks were most abundant on the vegetation during the warm summer months. Most questing H. elliptica larvae and nymphs were collected from the vegetation in the early morning and late afternoon and fewest during the middle of the day. PMID:27020735

  10. First description of the immature stages and redescription of the adults of Cosmiomma hippopotamensis (Acari: Ixodidae) with notes on its bionomics.

    Science.gov (United States)

    Apanaskevich, Dmitry A; Walker, Jane B; Heyne, Heloise; Bezuidenhout, J Dürr; Horak, Ivan G

    2013-07-01

    Cosmiomma hippopotamensis (Denny, 1843) is one of the most unusual, beautiful, and rare tick species known to the world. All stages of this species possess a unique morphology, on the one hand making them easy to identify, while on the other they exhibit similarities to certain species of Amblyomma Koch, 1844, Dermacentor Koch, 1844, and Hyalomma Koch, 1844. Adults of C. hippopotamensis have been collected on only two occasions from their hosts, namely Hippopotamus amphibius L. and Diceros bicornis (L.), and have been recorded from only a few widely separated localities in East and southern Africa. Here, the larva and nymph are described and illustrated for the first time, while the male and female are illustrated and redescribed. Data on hosts, geographic distribution, and life cycle of C. hippopotamensis are also provided. PMID:23926768

  11. Management of lone star ticks (Acari: Ixodidae) in recreational areas with acaricide applications, vegetative management, and exclusion of white-tailed deer.

    Science.gov (United States)

    Bloemer, S R; Mount, G A; Morris, T A; Zimmerman, R H; Barnard, D R; Snoddy, E L

    1990-07-01

    A project on management of lone star ticks, Amblyomma americanum (L.), at Land Between the Lakes, a Tennessee Valley Authority recreational area in Kentucky-Tennessee, during 1984-1988, demonstrated the effectiveness and economics of three control technologies. Acaricide applications (chlorpyrifos at 0.28 kg [AI]/ha), vegetative management (mowing and removal of 40% overstory and 90-100% of midstory, understory, and leaf litter), and host management (white-tailed deer exclusion from a 71-ha campground with a single-line fence) provided 75, 70, and 64% mean controls of all life stages of the lone star tick, respectively. Combinations of acaricide applications + vegetative management, acaricide applications + host management, and acaricide applications + vegetative management + host management produced 94, 89, and 96% mean control of all life stages, respectively. The costs of acaricide applications (two per year), vegetative management (two mowings per year), and white-tailed deer exclusion (single-line fence) were $45, $150, and $30/ha/yr, respectively. Results of this project are used to design management strategies that could be considered for use against lone star ticks in recreational areas.

  12. Toxicity of neem seed oil (Azadiracta indica) against the larvae of amblyomma variegatum a three-host tick in cattle.

    Science.gov (United States)

    Ndumu, P A; George, J B; Choudhury, M K

    1999-09-01

    The in vitro toxicity of neem seed oil (Azadiracta indica, family: Meliaceae, 'Dogon yaro' in Hausa -language) was tested against the larvae of a three-host tick, Amblyomma variegatum (family: Ixodidae or hard tick) parasitic to cattle commonly found in Nigeria. Undiluted neem oil (100% concentration) was found to kill all (100% mortality) the larvae after 48 h. The toxicity was concentration and time dependent. PMID:10479769

  13. Analysis of Amblyomma sculptum haplotypes in an area endemic for Brazilian spotted fever.

    Science.gov (United States)

    Bitencourth, K; Voloch, C M; Serra-Freire, N M; Machado-Ferreira, E; Amorim, M; Gazêta, G S

    2016-09-01

    Amblyomma sculptum (Ixodida: Ixodidae) Berlese, 1888, a member of the Amblyomma cajennense complex, is the major vector of Brazilian spotted fever (BSF) in southeastern Brazil. In this study, the genetic diversity of A. sculptum populations in the state of Rio de Janeiro (RJ), Brazil, was investigated because genetic variability in tick populations may be related to vector competence. Samples of A. sculptum from 19 municipalities in 7 regions of RJ were subjected to DNA extraction, amplification and sequencing of D-loop, cytochrome oxidase II and 12S rDNA mitochondrial genes. These sequences were used to map the genetic diversity of this tick. Amblyomma sculptum populations are genetically diverse in RJ, especially in the South Centre and Highland regions. Few unique haplotypes were observed in all populations, and the majority of genetic variation found was among ticks within each population. Phylogenetic reconstruction reinforced the assumption that all the haplotypes identified in RJ belong to A. sculptum. However, some RJ haplotypes are closer to A. sculptum from Argentina than to A. sculptum from elsewhere in Brazil. In RJ, A. sculptum has high genetic diversity, although little genetic differentiation. Observations also indicated a high level of gene flow among the studied populations and no evidence of population structure according to region in RJ. PMID:27120044

  14. Expression of bovine genes associated with local and systemic immune response to infestation with the Lone Star tick, Amblyomma americanum.

    Science.gov (United States)

    Brannan, Jaime L; Riggs, Penny K; Olafson, Pia U; Ivanov, Ivan; Holman, Patricia J

    2014-10-01

    The Lone Star tick, Amblyomma americanum Linnaeus 1758 (Acari; Ixodidae), causes considerable production losses to the southern U.S. cattle industry due to reduced weight, infertility, secondary infections at bite wound sites, damaged hides, and potentially death, as these ticks tend to infest livestock in large numbers. Increasing environmental concerns, along with the potential for chemical residue in food products, have led to more emphasis on alternative tick control strategies, such as selective breeding practices and anti-tick vaccines. To enable progress toward these goals, a better understanding of bovine host immune mechanisms elicited by ticks is needed. In this study, 7 calves were phenotyped as susceptible, moderately resistant, or highly resistant to adult A. americanum ticks. Tick bite-site biopsies and blood leukocytes were collected at multiple time points throughout 3 successive tick infestations. Gene expression at tick bite-site biopsies was assessed by microarray analysis over 3 time points for each phenotype group. Quantitative reverse transcriptase-PCR expression analysis evaluated 11 candidate genes in tick bite-site biopsies, and 6 in blood leukocytes. Regression curve estimates calculated from the expression values generated by qRT-PCR in tick bite-sites identified correlations between several candidate genes. Increased expression of IGHG1, IL6, IL1α, and IL1RN in bovine tick bite-site biopsies suggests that Th2 differentiation may be important for the local bovine response to A. americanum ticks. Strong correlations in expression for IL1α and IL1β, for IL1α and IL1RN, and for IL1α and TLR4 were found in biopsies from the tick-resistant phenotypes. The up-regulation of IL12 and IL23 in blood leukocytes from Lone Star tick-infested calves of all phenotypes suggests a possible systemic recruitment of memory T cells. This study provides novel insight concerning the bovine immune response to Lone Star ticks and a basis for future

  15. Ixodidas brasileiros e de alguns paizes limitrophes

    Directory of Open Access Journals (Sweden)

    Henrique de Beaurepaire Aragão

    1936-01-01

    Full Text Available The knowledge of the Ixodidae becomes every day, more and more important owing to the fact of the increasing number of diseases of man and animals they can transmit. In Brasil besides transmitting treponemosis, piroplasmosis and anaplasmosis to several domestic animals, the ticks are also responsible fo the transmission of the brazilian rocky mountain spotted fever (A. cajennense and Amblyomma striatum and they can also harbour the virus of the yellow fever and even to transmit it in laboratory experiments (A. cajennense, O. rostratus. The Brazilian fauna of ticks is a small one and has no more than 45 well-established species belonging to the genus Argas, Ornithodoros, Ixodes, Haemaphysalis, Rhipicephalus, Boophilus, Amblyomma and Spaelaeorhynchus. The genus Amblyomma is the best represented one, with 67% of all species of ticks known in Brazil. One of the most important species in the Amblyomma cajennense owing to its abundance and its wide parasitism in many vertebrates: reptiles, birds and mammals, incluing man, who is much attacked by the larva, the nymph and the adult of this species. The other ticks who attack the man are the Amblyomma brasiliense (the pecari tick, in the forests, and the Ornithodoros, especially the species. O. rostratus and brasiliensis. Other species can bite the man, but only occasionally, like Amblyomma fossum, striatum, oblongogutatum etc. Argas persicus, Rhipicephalus sanguineus and Boophilus are very important species not only as parasites but specially because they transmit several diseases to animals. Some of the ticks of the brazilian wild animals are now also parasites of the domestic ones and vice-versa. Arga persicus var. dissimilis is very common among the poultry and transmits the Treponema anserinum (gallinarum. Boophilus microplus is very abundant on our domestic and wild ruminants (Bos, Cervus, Mazama etc. and can also ben found on horse, dogs, Felis onca, Felis concolor etc., and it transmits to cattle

  16. Comparative analysis of spermatids of Rhipicephalus sanguineus sensu lato (Ixodidae) and Ornithodoros rostratus ticks (Argasidae): morphophysiology aimed at systematics.

    Science.gov (United States)

    Sampieri, Bruno Rodrigues; Calligaris, Izabela Bragião; Matos, Renata da Silva; Páez, Fredy Arvey Rivera; Bueno, Odair Corrêa; Camargo-Mathias, Maria Izabel

    2016-02-01

    The phylogenetic relationships among tick species (Acari: Ixodida) have been revisited by several researchers over the last decades. Two subfamilies, Rhipicephalinae (Ixodidae) and Ornithodorinae (Argasidae), deserve special attention. The male reproductive system morphology, as well as the ultrastructure of the germ cells, may provide important information for phylogeny and systematics of metazoan groups, with spermatozoa exhibiting characters that can be used for this purpose. With that information in mind, this study aimed at evaluating, through a comparative analysis, the morphology of the male reproductive systems and germ cells of ticks species Rhipicephalus sanguineus and Ornithodoros rostratus. In order to do that, histology and scanning electron microscopy techniques were used. The results have shown that despite the similarities in the general morphology of the male reproductive system among studied Ixodida so far, there are morphological differences among the species studied herein, mainly the U-shaped testis (ancestral character) in O. rostratus and the pair testes (derived character) in R. sanguineus, and the general morphology of germ cells (spermatids V). Besides that, the morphological changes observed during the spermiogenesis appear to be different between the species studied here, probably characterizing the two families considered. The data generated in this study showed the importance of comparative internal morphology studies, mainly in regard to spermatology, despite the morphological data obtained herein not being enough to product a cladogram (sperm cladistics), it was already possible to observe clear differences among families Argasidae and Ixodidae in regard to the organization of their male reproductive systems and concerning the external morphology of spermatids. Data yet to be obtained through transmission electron microscopy techniques will allow the application of spermiocladistics and spermiotaxonomy as tools for tick systematics.

  17. Relative humidity and activity patterns of Ixodes scapularis (Acari: Ixodidae)

    Science.gov (United States)

    Berger, K.A.; Ginsberg, Howard S.; Gonzalez, L.; Mather, T.N.

    2014-01-01

    Laboratory studies have shown clear relationships between relative humidity (RH) and the activity and survival of Ixodes scapularis Say (blacklegged tick). However, field studies have produced conflicting results. We examined this relationship using weekly tick count totals and hourly RH observations at three field sites, stratified by latitude, within the state of Rhode Island. Records of nymphal tick abundance were compared with several RH-related variables (e.g., RH at time of sampling and mean weekly daytime RH). In total, 825 nymphs were sampled in 2009, a year of greater precipitation, with a weighted average leaf litter RH recorded at time of sampling of 85.22%. Alternatively, 649 nymphs were collected in 2010, a year of relatively low precipitation, and a weighted average RH recorded at time of sampling was 75.51%. Negative binomial regression analysis of tick count totals identified cumulative hours <82% RH threshold as a significant factor observed in both years (2009: P = 0.0037; 2010: P < 0.0001). Mean weekly daytime RH did not significantly predict tick activity in either year. However, mean weekly daytime RH recorded with 1-wk lag before sample date was a significant variable (P = 0.0016) in 2010. These results suggest a lag effect between moisture availability and patterns of tick activity and abundance. Differences in the relative importance of each RH variable between years may have been due to abnormally wet summer conditions in 2009.

  18. Pesquisa de Rickettsia spp em carrapatos Amblyomma cajennense e Amblyomma dubitatum no Estado de São Paulo Survey of Rickettsia spp in the ticks Amblyomma cajennense and Amblyomma dubitatum in the State of São Paulo

    Directory of Open Access Journals (Sweden)

    Richard Campos Pacheco

    2009-06-01

    Full Text Available Foi pesquisada a presença de riquétsias em 3.545 carrapatos Amblyomma cajennense e 2.666 Amblyomma dubitatum. Através do teste de hemolinfa, reação em cadeia pela polimerase e isolamento de rickettsia em cultivo celular, todos os Amblyomma cajennense foram negativos, sendo que 634 (23,8% Amblyomma dubitatum mostraram-se infectados com Rickettsia bellii.The presence of rickettsial infection was surveyed in 3,545 Amblyomma cajennense ticks and 2,666 Amblyomma dubitatum ticks. Using the hemolymph test, polymerase chain reaction and isolation of Rickettsia in cell cultures, all of the Amblyomma cajennense were negative, whereas 634 (23.8% of the Amblyomma dubitatum ticks were shown to be infected with Rickettsia bellii.

  19. Primer registro de Ixodes cookei (Acari: Ixodidae) para México First record of Ixodes cookei (Acari: Ixodidae) in Mexico

    OpenAIRE

    Griselda Montiel-Parra; Helxine Fuentes-Moreno; Margarita Vargas

    2007-01-01

    En este estudio se aportan los primeros datos de la garrapata Ixodes cookei Packard, 1869 en México. Un macho, 7 larvas y 15 ninfas se recolectaron en los estados de Nuevo León y Veracruz. Además, se registra al cacomixtle Bassariscus astutus como un nuevo huésped.The presence of Ixodes cookei Packard, 1869 is documented for the first time in Mexico, based on one male, 7 larvae and 15 nymphs collected in Veracruz and Nuevo Leon. Additionally, cacomixtle (Bassariscus astutus) is presented as a...

  20. Primer registro de Ixodes cookei (Acari: Ixodidae para México First record of Ixodes cookei (Acari: Ixodidae in Mexico

    Directory of Open Access Journals (Sweden)

    Griselda Montiel-Parra

    2007-06-01

    Full Text Available En este estudio se aportan los primeros datos de la garrapata Ixodes cookei Packard, 1869 en México. Un macho, 7 larvas y 15 ninfas se recolectaron en los estados de Nuevo León y Veracruz. Además, se registra al cacomixtle Bassariscus astutus como un nuevo huésped.The presence of Ixodes cookei Packard, 1869 is documented for the first time in Mexico, based on one male, 7 larvae and 15 nymphs collected in Veracruz and Nuevo Leon. Additionally, cacomixtle (Bassariscus astutus is presented as a new host record.

  1. Does Aponomma varanensis (Acari: Ixodida: Ixodidae) occur on the Taiwanese mainland?

    Science.gov (United States)

    Robbins, R G

    1996-08-01

    On 15 July 1976, teams from the U.S. Naval Medical Research Unit No. 2, Taipei, Taiwan, made 3 collections of ticks from beneath the dorsal scales of the Taiwan stink snake, Elaphe carinata, at Makung in the Penghu Islands, which lie astride the Tropic of Cancer in the Taiwan Strait between southern mainland China and Taiwan proper. These ticks were later determined to be Aponomma varanensis (Supino, 1897), but this discovery was never published, and no member of the genus Aponomma has heretofore been reported from Taiwan or any of its outlying islets. Because suitable hosts, including E. carinata, are abundant on Taiwan and because A. varanensis is widely distributed in tropical Asia, it is argued that this or a related species of Aponomma will one day be found on the Taiwanese mainland.

  2. Acari uit Ambon

    NARCIS (Netherlands)

    Oudemans, A.C.

    1927-01-01

    Prof. Dr. E. D. VAN OORT, Directeur van 's Rijks Museum van Natuurlijke Historie te Leiden, was zoo vriendelijk, het materiaal aan Acari, door den Gouvernements-Arts Dr. PH. F. KOPSTEIN, thans te Weltevreden bij Batavia, gedurende zijn verblijf op Ambon 1922 en 1923 verzameld, mij ter determineering

  3. The sialotranscriptome of Amblyomma triste, Amblyomma parvum and Amblyomma cajennense ticks, uncovered by 454-based RNA-seq

    OpenAIRE

    Garcia, Gustavo Rocha; Gardinassi, Luiz Gustavo; Ribeiro, José Marcos; Anatriello, Elen; Ferreira, Beatriz Rossetti; Moreira, Higo Nasser Santanna; Mafra, Cláudio; Martins, Maria Marlene; Szabó, Matias Pablo Juan; de Miranda-Santos, Isabel Kinney Ferreira; Maruyama, Sandra Regina

    2014-01-01

    Background Tick salivary constituents antagonize inflammatory, immune and hemostatic host responses, favoring tick blood feeding and the establishment of tick-borne pathogens in hosts during hematophagy. Amblyomma triste, A. cajennense and A. parvum ticks are very important in veterinary and human health because they are vectors of the etiological agents for several diseases. Insights into the tick salivary components involved in blood feeding are essential to understanding vector-pathogen-ho...

  4. First molecular detection of Rickettsia parkeri in Amblyomma tigrinum and Amblyomma dubitatum ticks from Uruguay.

    Science.gov (United States)

    Lado, Paula; Castro, Oscar; Labruna, Marcelo B; Venzal, José M

    2014-10-01

    Rickettsia parkei is the etiological agent of spotted fever in Uruguay, where is transmitted to humans by the tick Amblyomma triste. In the present study, ticks were collected from capybaras (Hydrochoerus hydrochaeris) and domestic dogs during 2011-2012 in different parts of Uruguay. Three out of 11 (27.3%) Amblyomma dubitatum ticks collected from capybaras, and 4 out of 6 (66.7%) Amblyomma tigrinum ticks collected from dogs were shown by molecular analyses to be infected by Rickettsia parkeri strain Maculatum 20. Until the present work, A. triste was the only tick species that was found infected by R. parkeri in Uruguay. This is the first report of R. parkeri infecting these two tick species in Uruguay, expanding the current distribution of this rickettsial pathogen in the country.

  5. ISOLATION OF Ricket tsia bellii FROM Amblyomma ovale AND Amblyomma incisum TICKS FROM SOUTHERN BRAZIL

    OpenAIRE

    Richard Pacheco; Simone Rosa; Leonardo Richtzenhain; Szabó, Matias P. J.; Marcelo B Labruna

    2008-01-01

    Objetivo. Aislar Rickettsias mediante cultivo celular a partir de muestras de garrapatas Amblyomma ovale y Amblyomma incisum del estado de São Paulo Materiales y métodos. A. ovale y A. incisum adultas de vida libre fueron colectadas en una área de selva tropical Atlántica en el estado de São Paulo, Brazil. Cada garrapata fue sometida a la prueba de hemolinfa, las garrapatas positivas en esta prueba fueron evaluadas con la técnica de shell vial con el propósito de aislar rickettsias en cultivo...

  6. Neuronal projections from the Haller's organ and palp sensilla to the synganglion of Amblyomma americanum§.

    Science.gov (United States)

    Borges, Lígia Miranda Ferreira; Li, Andrew Yongsheng; Olafson, Pia Untalan; Renthal, Robert; Bauchan, Gary Roy; Lohmeyer, Kimberly Hutchison; León, Adalberto Angel Pérez de

    2016-06-14

    The present study was conducted to elucidate the neuronal pathways between peripheral olfactory and taste sensilla and the synganglion in an Ixodidae tick species. The tarsus of the front legs (olfactory nerves) and the fourth palpal segment (gustatory nerves) of unfed Amblyomma americanum males and females were excised. A neuronal tracer, dextran tetramethylrhodamine, was used for filling of the sensory neurons. The synganglion preparations were examined using a confocal microscope. Neuronal arborizations from the Haller's organ were confined to the olfactory lobes and the first pedal ganglion. The estimated number of olfactory glomeruli ranged from 16 to 22 per olfactory lobe in the females. The number of glomeruli was not counted in males because they were densely packed. Sensory neurons associated with sensilla at the distal end of the palpal organ projected into the palpal ganglion in the synganglion through the palpal nerve. Gustatory sensory neurons associated with palpal sensilla projected into a commissure with several bulges, which are confined in the palpal ganglion. The findings of distinct projection patterns of sensory neurons associated with the Haller's organ and palpal organ in the lone star tick from this study advanced our knowledge on mechanisms of sensory information processing in ticks.

  7. New records of Amblyomma multipunctum and Amblyomma naponense from Ecuador, with description of A. multipunctum nymph.

    Science.gov (United States)

    Labruna, Marcelo B; Martins, Thiago F; Nunes, Pablo H; Costa, Francisco B; Portero, Francisco; Venzal, Jose M

    2013-12-01

    We provide new data for the ticks Amblyomma multipunctum and Amblyomma naponense from Ecuador. In addition, we describe the nymph of A. multipunctum for the first time. During December 2012, ticks were collected by dragging in forest trails of 1 locality at Puyo, Pastaza Province (elevation 979 m), and another locality at Papallacta, Napo Province (3,474 m). A total of 10 adults of A. naponense were collected at Puyo, whereas 27 adults and 3 nymphs of A. multipunctum were collected at Papallacta. Compared to sequences of a fragment of the mitochondrial 16S rDNA gene of adult and nymphal ticks, the sequence of an Amblyomma nymph was identical to the sequences generated from the A. multipunctum adults. The 3 collected nymphs (including the 1 used for molecular analysis) had the same morphotype, and were used for the first morphological description of the nymphal stage of A. multipunctum. Sequences generated from the A. naponense specimens were closest (97% identity by BLAST) to a corresponding sequence of A. naponense from Brazil, whereas the A. multipunctum sequences were closer to (90-91% identity) several Neotropical Amblyomma species. Herein, we provide just the second record of A. naponense in Ecuador, more than 100 yr after this tick was reported in this country. Adults and nymphs of A. multipunctum were found in highland, humid montane forest areas, in agreement with the only 2 previous reports of A. multipunctum in Ecuador and Colombia. No genetic differences were found among A. multipunctum ticks that presented significant morphological differences, suggesting intraspecific polymorphism in the adult stages of this species. PMID:23750669

  8. Morphological description of the nymphal stage of Amblyomma geayi and new nymphal records of Amblyomma parkeri.

    Science.gov (United States)

    Martins, Thiago F; Scofield, Alessandra; Oliveira, Wanessa B L; Nunes, Pablo H; Ramirez, Diego G; Barros-Battesti, Darci M; Sá, Lilian R M; Ampuero, Fernanda; Souza, Julio C; Labruna, Marcelo B

    2013-04-01

    The external morphology of the nymph of Amblyomma geayi Neumann is described by optical and scanning electron microscopy. Unfed nymphs were obtained from an engorged A. geayi female, which had been collected on a sloth (Bradypus variegatus) from Belém municipality, State of Pará, northern Brazil, and was kept under laboratory conditions. With the present description, we propose a modification of a taxonomic key published in 2010 for the Amblyomma nymphs that occur in Brazil, through the inclusion of A. geayi. The nymph of A. geayi is morphologically very similar to the nymph of Amblyomma parkeri Fonseca and Aragão, with only slight morphological differences related to scutal surface and punctuations (more shagreened and less punctuated in A. geayi). These 2 nymphs differ from all other known Amblyomma nymphs from Brazil by the combination of auriculae present as small posterolateral rounded projections, eyes located at the level of the scutal midlength, and a rounded hypostome. These nymphal similarities as well the morphology of the adult stage corroborate previous studies that showed that A. geayi and A. parkeri are genetically closely related. Unpublished host records of the nymphs of both A. geayi and A. parkeri are provided. Established populations of A. geayi and A. parkeri seem to be geographically separated, since all confirmed records of A. geayi are from the northern half of South America (mainly the Amazonian region) and Central America, whereas all known records of A. parkeri are from the Atlantic rainforest biome in northeastern, southeastern, and southern Brazil. PMID:23414796

  9. Molecular detection of Rickettsia species in Amblyomma ticks collected from snakes in Thailand.

    Science.gov (United States)

    Sumrandee, Chalao; Hirunkanokpun, Supanee; Doornbos, Kathryn; Kitthawee, Sangvorn; Baimai, Visut; Grubhoffer, Libor; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2014-10-01

    Some reptile ticks are potential vectors of pathogens such as spotted fever group (SFG) rickettsiae. Here, we report for the first time in detail the molecular evidence, DNA sequences and phylogenetic studies, for the presence of Rickettsia spp. in Amblyomma ticks (Amblyomma helvolum and Amblyomma varanense) from snakes in Thailand. A total of 24 tick samples was collected from 4 snake species and identified. A phylogenetic analysis inferred from the partial sequences of the gltA gene indicated that the Rickettsia spp. from 2 Amblyomma helvolum and 1 Amblyomma varanense belong to the same group as the SFG rickettsiae, which are closely related to Rickettsia raoultii strains. In contrast, there was 1 Rickettsia sp. from Amblyomma helvolum grouped into the same clade with other SFG rickettsiae (Rickettsia tamurae, Rickettsia monacensis, and a Rickettsia endosymbiont of Amblyomma dubitatum from Brazil). However, another Rickettsia sp. from Amblyomma varanense was closely related to Rickettsia bellii and Rickettsia sp. strain RDa420 from Thailand. In addition, from phylogenetic results based on the 16S rRNA gene and a concatenated tree of the 3 genes (gltA, ompA, and ompB), we found what may be a novel SFG rickettsia species closely related to Rickettsia raoultii (from both Amblyomma varanense and Amblyomma helvolum). In conclusion, our findings are the first report on the presence of novel SFG rickettsiae in 2 snake tick species, Amblyomma varanense and Amblyomma helvolum in Thailand and in south-eastern Asia.

  10. ISOLATION OF Rickettsia bellii FROM Amblyomma ovale AND Amblyomma incisum TICKS FROM SOUTHERN BRAZIL

    Directory of Open Access Journals (Sweden)

    Richard Pacheco

    2008-08-01

    Full Text Available Objective. To isolate and characterize rickettsiae from the ticks Amblyomma ovale and Amblyomma incisum collected in the state of São Paulo. Materials and methods. Adult, free-living A. ovale and A. incisum were collected in an Atlantic rainforest area in the state of São Paulo, Brazil. Each tick was tested using the hemolymph assay; samples from positive ticks were placed in shell vials in order to isolate rickettsiae and subsequently grown in Vero cells. Amplification of three rickettsial genes (gltA, htrA and ompA was attempted using polymerase chain reaction (PCR for each isolate obtained. Amplicons were subsequently sequenced. Results. A total of 388 A. incisum and 50 A. ovale were collected. Only one A. incisum and one A. ovale were hemolymph-test positive. Rickettsiae were successfully isolated from these ticks; however establishment in Vero cell culture was successful only for the isolate from A. ovale. Bacterial contamination in the first cell passage of the A. incisum isolate precluded successful isolation of the organism. PCR products were obtained with the gltA and htrA primers for the two isolates, but no product was obtained with the ompA primers. By BLAST analysis, partial gltA and htrA sequences of isolates from A. ovale and A. incisum were similar to the corresponding sequences of R. bellii. Conclusions. This is the first report of R. bellii infecting A. incisum and the first successful isolation from A. ovale.

  11. Rhipicephalus sanguineus (Acari: Ixodidae, the brown dog tick, parasitizing humans in Brazil Rhipicephalus sanguineus (Acari: Ixodidae, o carrapato vermelho do cão, parasitando humanos no Brasil

    Directory of Open Access Journals (Sweden)

    Filipe Dantas-Torres

    2006-02-01

    Full Text Available The objective of this paper is to describe four cases of human parasitism by Rhipicephalus sanguineus (Latrielle in Brazil. During an investigation regarding the species of ectoparasites of domestic dogs from the metropolitan region of Recife, Pernambuco state, four dog owners were found to be parasitized by ticks. The ticks were collected from these individuals and their dogs. All the ticks were identified as Rhipicephalus sanguineus . These are, to our knowledge, the first four cases of human parasitism by this tick species in Brazil. The possible implications of this finding are discussed here.O objetivo deste artigo é descrever quatro casos de parasitismo humano por Rhipicephalus sanguineus (Latrielle no Brasil. Durante uma investigação sobre as espécies de ectoparasitas de cães domésticos provenientes da Região Metropolitana de Recife, Pernambuco, quatro proprietários de cães foram encontrados parasitados por carrapatos. Foram coletados carrapatos dos indivíduos e de seus cães. Todos os carrapatos foram identificados como Rhipicephalus sanguineus, sendo, portanto, descritos os primeiros quatro casos de parasitismo humano por esta espécie de carrapato, no Brasil. Neste trabalho, são discutidas as possíveis implicações epidemiológicas deste achado.

  12. Larvicidal potencial of Sapindus saponaria (Sapindaceae against Rhipicephalus sanguineus (Latreille, 1806 (Acari: Ixodidae Potencial larvicida de Sapindus saponaria (Sapindaceae sobre Rhipicephalus sanguineus (Latreille, 1806 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    F.F. Fernandes

    2007-02-01

    Full Text Available The larvicidal potential of the crude ethanolic extracts (CEE of the stem peel of Sapindus saponaria was evaluated against Rhipicephalus sanguineus. Lethal concentrations (LC, were calculated by preparing CEE solutions at different concentrations in distilled water. Larvae fasted for 14-21 days were utilized in the bioassays, after incubation of engorged females collected from infested environments frequented by dogs in several neighborhoods of Goiânia, GO. Bioassays were performed in a specially constructed biological chamber for testing botanical acaricides, acclimatized to 27±1ºC, RH>80%. The larvae were counted on filter paper envelopes impregnated with the solutions or distilled water and larval mortality observed after 48h. S. saponaria showed good larvicidal activity (LC50 and LC99 of 1994 and 3922ppm, respectively and the results demonstrated its potential as a botanical acaricide and an alternative control measure for R. sanguineus.Avaliou-se a potencialidade larvicida do extrato-bruto etanólico (EBE da casca do caule de Sapindus saponaria sobre Rhipicephalus sanguineus. Para o cálculo das concentrações letais (CL foram preparadas soluções com diferentes concentrações do EBE dissolvido em água destilada. Foram utilizadas larvas em jejum com 14 a 21 dias, obtidas pela incubação de teleóginas, coletadas em ambientes infestados, freqüentados por cães de vários bairros de Goiânia. Os bioensaios foram realizados em uma câmara biológica para testes com acaricidas botânicos, climatizada a 27±1ºC e UR>80%. As larvas foram contidas em envelopes de papel filtro impregnados com as soluções (grupo teste ou com água destilada (grupo-controle e a mortalidade larval foi observada após 48h. S. saponaria demonstrou atividade larvicida satisfatória (CL50 e CL99 respectivamente de 1994 e 3922ppm e os resultados demonstraram seu potencial como acaricida botânico e medida alternativa para o controle de R. sanguineus.

  13. Rickettsia infection in Amblyomma tonelliae, a tick species from the Amblyomma cajennense complex.

    Science.gov (United States)

    Tarragona, Evelina L; Cicuttin, Gabriel L; Mangold, Atilio J; Mastropaolo, Mariano; Nazarena De Salvo, M; Nava, Santiago

    2015-03-01

    The present study was performed to evaluate the Rickettsia infection in Amblyomma tonelliae ticks from Argentina. All ticks were subjected to DNA extraction and tested by a battery of PCRs to amplify fragments of four rickettsial genes, 23S-5S, gltA, ompA and htrA. Two ticks were positive. The Rickettsia detected in one tick represents a new lineage which is named Rickettsia sp. strain El Tunal. This new strain belongs to the canadensis group because it is closely related to Rickettsia monteiroi, Rickettsia canadensis and Candidatus "Rickettsia tarasevichiae". They clustered together on a high supported clade with both gltA and htrA genes. The other positive tick was infected with Candidatus "Rickettsia amblyommii". The results presented in this study constitute the first records of Rickettsia infection in A. tonelliae ticks. However, the medical relevance of these findings should be considered cautiously because the pathogenicity of Rickettsia sp. strain El Tunal and Candidatus "R. amblyommii" remains undetermined.

  14. Experimental Infection of Amblyomma aureolatum Ticks with Rickettsia rickettsii

    OpenAIRE

    Labruna, Marcelo B.; Ogrzewalska, Maria; Soares, João F.; Martins, Thiago F.; Soares, Herbert S.; Moraes-Filho, Jonas; Nieri-Bastos, Fernanda A.; Almeida, Aliny P.; Pinter, Adriano

    2011-01-01

    We experimentally infected Amblyomma aureolatum ticks with the bacterium Rickettsia rickettsii, the etiologic agent of Rocky Mountain spotted fever (RMSF). These ticks are a vector for RMSF in Brazil. R. rickettsii was efficiently conserved by both transstadial maintenance and vertical (transovarial) transmission to 100% of the ticks through 4 laboratory generations. However, lower reproductive performance and survival of infected females was attributed to R. rickettsii infection. Therefore, ...

  15. Morphometric Study on Male Specimens of Hyalomma anatolicum (Acari: Ixodidae in West of Iran

    Directory of Open Access Journals (Sweden)

    A Hosseini

    2011-12-01

    Conclusion: Morphometric variation in Hyalomma spp is poorly studied. The variation in range and quantity of the mor­phometric parameters of H.anatolicum ‎underlies that the correct recognition and key construction for Hyalomma spe­cies dependes ‎on a complement morphometric study on the other species.

  16. In vitro activity of pineapple extracts (Ananas comosus, Bromeliaceae) on Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Domingues, Luciana Ferreira; Giglioti, Rodrigo; Feitosa, Karina Alves; Fantatto, Rafaela Regina; Rabelo, Márcio Dias; Oliveira, Márcia Cristina de Sena; Oliveira, Gilson Pereira de; Bechara, Gervasio Henrique; Chagas, Ana Carolina de Souza

    2013-07-01

    Measures to control the cattle tick, Rhipicephalus (Boophilus) microplus, based only on chemical products are becoming unsustainable, mainly because of the development of resistance. The objective of this study was to test the effect of the aqueous extract of pineapple skin (AEPS) and bromelain extracted from the stem (Sigma-Aldrich®, B4882) on engorged females and larvae of R. (B.) microplus in vitro. These substances were diluted in water and evaluated at eight concentrations. Engorged females were collected and distributed in groups of 10, with three repetitions for each treatment. After immersion in the solutions, the females were placed in an incubator for observation of survival, oviposition and larval hatching. The larval packet method was used, also with three repetitions with about 100 larvae each. The packets were incubated and the readings were performed after 24 h. The estimated reproduction and efficacy of the solutions were calculated. The LC(50) and LC(90) were estimated using the Probit procedure of the SAS program. The eight concentrations were compared within each treatment by the Tukey test. For the experiment with engorged females, the most effective concentrations were 125, 250 and 500 mg/mL: 33%, 48% and 59% for the AEPS and 27%, 51% and 55% for the bromelain. The LC(50) and LC(90) values were, respectively, 276 and 8691 mg/mL for AEPS and 373 and 5172 mg/mL for bromelain. None of the dilutions tested was effective against the larvae of R. (B.) microplus. This is the first report of the action of pineapple extracts or their constituents on cattle ticks. The results demonstrate that further studies regarding composition of tick cuticle, with evaluation of other solvents and formulations, should be conducted seeking to enhance the effect of pineapple extracts and compounds against this ectoparasite. PMID:23541882

  17. Susceptibility of Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) to pyrethroids and their associations in Pernambuco, Brazil.

    Science.gov (United States)

    de Santana, Breno Barros; Ramos, Rafael Antonio Nascimento; Santana, Marília de Andrade; Alves, Leucio Cãmara; de Carvalho, Gílcia Aparecida

    2013-01-01

    The synthetic pyrethroids and their associations have been widely used for controlling Rhipicephalus (Boophilus) microplus. The frequent use of acaricides has been inducing the development of resistance in the tick populations. The aim of this study was to assess the susceptibility of R. (B.) microplus populations to pyrethroids and their associations in the region of Garanhuns, Pernambuco, Brazil. In addition, the level of information among farm owners regarding tick control measures was investigated. Ticks were collected directly from naturally infested dairy cattle in the region and were exposed to pyrethroids and their associations. At the same time, an epidemiological questionnaire was applied with the aim of investigating the level of information among the farmers. The results reported here indicate that R. (B.) microplus populations in the dairy region of Garanhuns show resistance to pyrethroids and their associations, except when the product is associated with piperonyl butoxide. Regarding the results from the epidemiological survey, it was seen that there is a considerable lack of information among the farmers in relation to ixodid control measures. The level of ticks resistance to acaricides varied widely across the region studied. No alternative control programs have been implemented among these farms, thus demonstrating that there is a need for more information relating to the biology and control of R. (B.) microplus. PMID:23856731

  18. Towards a genomics approach to tick (Acari: Ixodidae) control in cattle: a review.

    Science.gov (United States)

    Mapholi, Ntanganedzeni O; Marufu, Munyaradzi C; Maiwashe, Azwihangwisi; Banga, Cuthbert B; Muchenje, Voster; MacNeil, Michael D; Chimonyo, Michael; Dzama, Kennedy

    2014-09-01

    Ticks and tick-borne disease (TBD) are major challenges to cattle production in the tropics and subtropics. Economic losses associated with ticks amount to billions of dollars annually. Although efforts to eradicate ticks and TBD using chemical control strategies have been implemented in many developing countries for decades, these acaricides are costly, and cattle susceptibility to ticks remains unchanged. Traditional breeding methods, where the farmer selected animals using records to improve the host genetic resistance to ticks (HGRT), are less than fully effective and time consuming. The HGRT has been reported in literature. To date, solutions to fight ticks and TBD are still unclear. Development of single-nucleotide polymorphism (SNP) technologies has created an opportunity to estimate breeding values of animals from DNA samples. The use of SNP technology for genomic selection allows information retrieval from the genotype even before the gene is expressed; thus potentially giving farmers the ability to make selection decisions on HGRT at an earlier age. This review discusses factors that affect HGRT, breeding selection, immunology, and genomic approaches and their application to improve HGRT in order to enhance livestock production. PMID:24954600

  19. Cloning and characterization of a cDNA clone encoding calreticulin from Haemaphysalis qinghaiensis (Acari: Ixodidae).

    Science.gov (United States)

    Gao, Jinliang; Luo, Jianxun; Fan, Ruiquan; Fingerle, Volker; Guan, Guiquan; Liu, Zhijie; Li, Youquan; Zhao, Haiping; Ma, Miling; Liu, Junlong; Liu, Aihong; Ren, Qiaoyun; Dang, Zhisheng; Sugimoto, Chihiro; Yin, Hong

    2008-03-01

    The application of anti-tick vaccine has been shown to be the most promising alternative strategy compared to the current use of acaricides that suffer from a number of serious limitations. The success of this method is dependent upon identification and cloning of potential tick vaccine antigens. Previously, we have cloned 21 positive clones (named from Hq02 to Hq22) by immunoscreening complimentary DNA (cDNA) libraries of Haemaphysalis qinghaiensis; however, some of those clones did not contain open reading frames (ORF). In this study, we amplified the entire sequence of Hq07 by using rapid amplification of the cDNA ends. Hq07 contains an ORF of 1,233 bp that encodes for 410 amino acid residues with a coding capacity of 47 kDa. Search of the cloned sequences against GenBank revealed that Hq07 is a calreticulin (CRT)-similar clone and designated HqCRT. Expression analysis by reverse transcription-polymerase chain reaction showed that this gene is ubiquitously expressed at different developmental stages and in different tissues of H. qinghaiensis. The gene was expressed as glutathione S-transferase-fused proteins in a prokaryotic system. Western blot analysis revealed that native HqCRT was secreted into their hosts by ticks during blood sucking. Vaccination of sheep with rHqCRT conferred protective immunity against ticks, resulting in 54.3% mortality in adult ticks, compared to the 38.7% death rate in the control group. These results demonstrated that rHqCRT might be a useful vaccine candidate antigen for biological control of H. qinghaiensis.

  20. Deltamethrin resistance in field populations of Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) in Jammu and Kashmir, India.

    Science.gov (United States)

    Ahanger, R R; Godara, R; Katoch, R; Yadav, A; Bhutyal, A D S; Katoch, M; Singh, N K; Bader, M A

    2015-11-01

    Detection of resistance levels against deltamethrin in Rhipicephalus (Boophilus) microplus collected from six districts of Jammu and Kashmir (India) was carried out using the adult immersion test. The regression graphs of probit mortality of ticks plotted against log values of concentration of drug were utilised for the determination of slope of mortality, lethal concentration for 50% (LC50), 95% (LC95) and resistance factor (RF). On the basis of the data generated on mortality, egg mass weight, reproductive index and percentage inhibition of oviposition, the resistance level was categorised as I, II, III and IV. Out of these six districts, resistance to deltamethrin at level I was detected in one district (RF = 1.9), at level II in two districts (RF = 7.08-10.07) and at level IV in three districts (RF = 96.08-288.72). The data generated on deltamethrin resistance status will help in formulating tick control strategy in the region.

  1. A review of Hyalomma scupense (Acari, Ixodidae in the Maghreb region: from biology to control

    Directory of Open Access Journals (Sweden)

    2014-01-01

    Full Text Available Hyalomma scupense (syn. Hyalomma detritum is a two-host domestic endophilic tick of cattle and secondarily other ungulates in the Maghreb region (Africa. This species transmits several pathogens, among which two are major livestock diseases: Theileria annulata and Theileria equi. Various other pathogens are also transmitted by this tick species, such as Anaplasma phagocytophilum and Ehrlichia bovis. Hyalomma scupense is common in sub-humid and semi-arid areas of several regions in the world, mainly in the Maghreb region. In this region, adults attach to animals during the summer season; larvae and nymphs attach to their hosts during autumn, but there is a regional difference in H. scupense phenology. There is an overlap between immature and adult ticks, leading in some contexts to a dramatic modification of the epidemiology of tick-borne diseases. This tick species attaches preferentially to the posterior udder quarters and thighs. Tick burdens can reach 130 ticks per animal, with a mean of 60 ticks. Calves are 70 times less infested than adult cattle. The control can be implemented through six options: (i rehabilitation of the farm buildings by roughcasting and smoothing the outer and inner surfaces of the enclosures and walls. This control option should be recommended to be combined with a thorough cleaning of the farm and its surrounding area. With regard to Theileria annulata infection, this control option is the most beneficial. (ii Acaricide application to animals during the summer season, targeting adults. (iii Acaricide application during the autumn period for the control of the immature stages. (iv Acaricide application to the walls: many field veterinarians have suggested this option but it is only partially efficient since nymphs enter deep into the cracks and crevices. It should be used if there is a very high tick burden or if there is a high risk of tick-borne diseases. (v Manual tick removal: this method is not efficient since the ticks can feed on several other animal species in the farm. This control option can lead to a reduction of the tick population, but not a decrease in tick-borne disease incidence. (vi Vaccination: this control option consists of injecting the protein Hd86; trials have shown a partial effect on nymphs, with no effect on adult ticks. Combination of two of these control options is recommended in regions where there are high burdens of important tick vectors. Further studies are needed to improve our knowledge on this tick species in the Maghreb region, since the number of published studies on Hyalomma scupense in this region is very limited.

  2. Rhipicephalus sanguineus (Acari: Ixodidae) female ticks exposed to castor oil (Ricinus communis): an ultrastructural overview.

    Science.gov (United States)

    Sampieri, B R; Furquim, K C S; Nunes, P H; Camargo-Mathias, M I

    2013-02-01

    Tick control has been accomplished through the use of synthetic acaricides, which has created resistant individuals, as well as contaminating the environment and nontarget organisms. Substances of plant origin, such as oils and extracts of eucalyptus and neem leaves, have been researched as an alternative to replace the synthetic acaricides. Ricinoleic acid esters from castor oil have recently been shown as a promising alternative in eliminating bacterial contamination during ethanol fermentation, by acting as an effective biocide. The same positive results have been observed when these esters are added to the food given to tick-infested rabbits. This study tested the effect of these substance on the reproductive system of Rhipicephalus sanguineus females, added to rabbit food, more specifically on oogenesis. For this, four groups were established: four control groups (CG1, CG2, CG3, and CG4) and four treatment groups (TG1, TG2, TG3, and TG4) with one rabbit in each (New Zealand White), used as hosts. After full 4 days feeding (semi-engorgement), the females were collected and had their ovaries extracted. In this study, it was observed that R. sanguineus females exposed to esters had their ovaries modified, which was demonstrated through transmission electron microscopy techniques. The addition of ricinoleic esters to the diet of tick-infested rabbits revealed how toxic such substances are for the cytoplasmic organelles of oocytes and pedicel cells. These compounds can change the morphophysiology of germ and somatic cells, consequently influencing their viability and, therefore, confirming that the ricinoleic acid esters from castor oil are a promising substance in the control of R. sanguineus. PMID:23086445

  3. Morphometric Study on Male Specimens of Hyalomma Anatolicum (Acari: Ixodidae in West of Iran

    Directory of Open Access Journals (Sweden)

    M Abdigoudarzi

    2011-12-01

    Full Text Available Background: Hyalomma anatolicum is the well-known hard tick, which is one of the most important livestock and hu­man pathogens vector, wide range in host and distributed in all over the Hyalomma geographic fauna as well as in Iran. Taxonomy of the Hyalomma ssp. is debatable whereas their identification is a problematic work. The reasons for this claim is time consuming Delpy’s researches in Iran also Schulze School, Feldman-Muhsam and the Russian tick workers. We would like to understand morphometric variation in the field collected H. anatolicum in Iran also validat­ing some morphologic quantitative and qualitative characters.Methods: A total 247 field-collected tick specimens from different geographical regions in west of Iran includes Khuzestan and Lorestan Provinces were studied. The morphologic characters of the ticks were measured by the cali­brated stereomicroscope ‎armed scaled lens. The measurements were analyzed using SPSS ‎for windows, version 16 on an IBM PC, ‎so varied shapes of species in different geographic ‎regions were drawn by the ‎aid of a drawing tube con­nected to a light stereomicroscope.‎Results: One way ANOVA test revealed significant differences among the quantitative parameters in five zones (P<‎‎ 0.‎‎00‎‎1‎ also each zone to other zone by Post Hoc Tests e.g. LSD. No significant differences in the lateral grooves length/conscutum length ratio parameter were found.Conclusion: Morphometric variation in Hyalomma spp is poorly studied. The variation in range and quantity of the mor­phometric parameters of H.anatolicum ‎underlies that the correct recognition and key construction for Hyalomma spe­cies dependes ‎on a complement morphometric study on the other species.

  4. Ixodes dammini (Acari: Ixodidae) infestation on medium-sized mammals and blue jays in northwestern Illinois.

    Science.gov (United States)

    Mannelli, A; Kitron, U; Jones, C J; Slajchert, T L

    1993-09-01

    High prevalence of infestation of five species of medium-sized mammals and blue jays, Cyanocitta cristata (L.), by immature Ixodes dammini Spielman, Clifford, Piesman and Corwin was found in Castle Rock State Park in northwestern Illinois during May-August 1991. Raccoons, Procyon lotor L., and opossums, Didelphis virginiana Kerr, were infested with the highest larval densities and were trapped primarily in bottomland forest and ecotone habitats. All species had similar nymphal densities, except the eastern cottontails, Sylvilagus floridanus Allen, which were infested with fewer nymphs. Infestation by I. dammini is reported for the first time for fox squirrels, Sciurus niger E. G. St. Hilaire, and for the first time in the midwestern United States for blue jays, C. cristata. These two species were hosts for nymphs in upland forest habitat. Molting rates varied among ticks that fed on different host species and among larvae that fed on individuals of the same species. Molting rate is proposed as an important factor in determining the relative importance of a host species to I. dammini population dynamics. PMID:8254647

  5. Host utilization and seasonal occurrence of Dermacentor species (Acari:Ixodidae) in Missouri, USA.

    Science.gov (United States)

    Kollars, T M; Oliver, J H; Masters, E J; Kollars, P G; Durden, L A

    2000-08-01

    A total of 3,235 Dermacentor variabilis (Say) specimens were collected from birds, mammals, and by dragging vegetation, and 2,683 D. albipictus (Packard) ticks were collected from deer from 1993 to 1996. Peak seasonal occurrence of adult D. variabilis was from May through July with a precipitous decrease in August. Nymphal D. variabilis populations peaked in June. Peak activity of larvae was bimodal, with one activity peak during late summer (September) and a second peak in winter or early spring. The raccoon, Procyon lotor (L.), was the principal host of adults followed by the Virginia opossum, Didelphis virginiana Kerr. Rodents and the eastern cottontail rabbit, Sylvilagus floridanus (J. A. Allen), were the primary hosts of nymphs. The marsh rice rat, Oryzomys palustris (Harlan), was the principal host of larvae followed by the pine vole, Microtus pinetorum (Le Conte), and white-footed mouse, Peromyscus leucopus (Rafinesque). All stages of D. albipictus were found only on white-tailed deer, Odocoileus virginianus (Zimmermann). Numbers of adult and nymphal D. albipictus peaked in November, whereas larvae peaked in September. PMID:11201355

  6. Seasonal activity and host associations of Ixodes scapularis (Acari: Ixodidae) in southeastern Missouri.

    Science.gov (United States)

    Kollars, T M; Oliver, J H; Kollars, P G; Durden, L A

    1999-11-01

    Based on tick collections recovered from wild vertebrates and by dragging, the seasonal occurrence of adult blacklegged ticks, Ixodes scapularis Say, extended from October through May in southeastern Missouri. Adult activity was bimodal with the higher peak occurring in November followed by a lower peak in February. The activity of immature I. scapularis had the general pattern of that found in the Northeast where Lyme disease is hyperendemic, with larval activity (July) peaking after that of nymphs (May and June). Vertebrates varied in their importance as hosts of I. scapularis. White-tailed deer, Odocoileus virginanus (Zimmerman), and coyotes, Canis latrans Say, were the primary hosts of adult I. scapularis. Broad-headed skinks, Eumeces laticeps (Schneider), and eastern fence lizards, Sceloporus undulatus (Latreille), were the primary hosts of nymphal I. scapularis. The broad-headed skink, 5-lined skink, Eumeces fasciatus (L.), and Carolina wren, Thryothorus ludovicianus (Latham), were the primary hosts of larval I. scapularis. Homeotherms were important hosts of immature I. scapularis, accounting for 30% of nymphs and 39% of larvae collected. The eastern cottontail rabbit, Sylvilagus floridanus (Allen), may play an important role in the epidemiology of Lyme disease in Missouri. Isolates of Borrelia burgdorferi Johnson, Schmid, Hyde, Steigerwalt & Brenner were made from ticks recovered from rabbits, making the cottontail rabbit a key species for further study of the epidemiology of Lyme borreliosis in Missouri. PMID:10593072

  7. Precise identification of different stages of a tick, Ixodes granulatus Supino, 1897 (Acari:Ixodidae)

    Institute of Scientific and Technical Information of China (English)

    Ernieenor Faraliana Che Lah; Salmah Yaakop; Mariana Ahamad; Ernna George; Shukor Md Nor

    2016-01-01

    Objective: To identify different stages of Ixodes granulatus (I. granulatus) based on morphological characters prior to molecular identification which is significant for con-firming and identifying the nymphal stages of I. granulatus. Methods: A total of 14 individuals of adult, engorged and nymphal ticks collected from three different localities were examined morphologically using taxonomic keys, followed by PCR using cytochrome oxidase subunit I (COI). Clustering analysis based on COI sequences was carried out by constructing neighbor-joining and maximum parsimony tree to clarify the genetic variation and diversity of local I. granulatus. Results: Based on external morphological characterizations, nine individuals (64.3%) were successfully identified as I. granulatus, while five individuals were recognized only as Ixodes sp. due to lack of morphological characters visible and development during that stage. Molecular analysis of local I. granulatus using COI gene revealed 93%–94%sequence homology from available sequence in GenBank and was in concordance with the morphological identification. Furthermore, a low intraspecific variation was observed among the species of I. granulatus collected from different localities (0%–3.7%). Conclusions: These findings demonstrated for the first time the establishment of COI gene for identifying I. granulatus nymphal tick which is of paramount importance to the control of potential tick-borne infections in Malaysia. Moreover, this study provides evidence that a combination of morphology and molecular data was corroborated as an accurate tool for tick identification.

  8. Polymorphism of Beauveria bassiana (Deuteromycota: Hyphomycetes) strains isolated from Ixodes ricinus (Acari: Ixodidae) in Moldova.

    Science.gov (United States)

    Mitina, G V; Tokarev, Y S; Movila, A A; Yli-Mattila, T

    2011-03-01

    Polymorphism of 10 Beauveria bassiana strains, isolated from Ixodes ricinus in Moldova, was evaluated using traditional (morphological and cultural properties) and molecular (RAPD patterns and ITS sequences) methods. The isolates differed greatly in morphological and cultural features, such as color, consistence, and growth rate. Four RAPD-PCR markers were used to evaluate genetic diversity of the strains. Phylogenetic neighbor-joining analysis of RAPD patterns divided strains into 3 major clades. The ITS sequences of 8 strains were identical to those of known B. bassiana strains. Two subsets (1 and 2) different by one nucleotide change were found in the ITS1 region. One strain of subset 1 was different from known B. bassiana strains by possessing 2 point mutations in the ITS region. RAPD-based clustering correlated to ITS sequence and colony morphology-based grouping of the strains.

  9. Infection of Ixodes ricinus (Acari: Ixodidae) by Borrelia burgdorferi sensu lato in North Africa

    Science.gov (United States)

    Zhioua, E.; Bouattour, A.; Hu, C.M.; Gharbi, M.; Aeschliman, A.; Ginsberg, H.S.; Gern, L.

    1999-01-01

    Free-living adult Ixodes ricinus L. were collected in Amdoun, situated in the Kroumiry mountains in northwestern Tunisia (North Africa). Using direct fluorescence antibody assay, the infection rate of field-collected I. ricinus by Borrelia burgdorferi sensu lato was 30.5% (n = 72). No difference in infection rate was observed between male and female ticks. Spirochetes that had been isolated from I. ricinus from Ain Drahim (Kroumiry Mountains) in 1988 were identified as Borrelia lusitaniae (formerly genospecies PotiB2). This is the first identification of a genospecies of Borrelia burgdorferi sensu lato from the continent of Africa.

  10. Screening and Identification of Antigenic Proteins from the Hard Tick Dermacentor silvarum (Acari: Ixodidae).

    Science.gov (United States)

    Zhang, Tiantian; Cui, Xuejiao; Zhang, Jincheng; Wang, Hui; Wu, Meng; Zeng, Hua; Cao, Yuanyuan; Liu, Jingze; Hu, Yonghong

    2015-12-01

    In order to explore tick proteins as potential targets for further developing vaccine against ticks, the total proteins of unfed female Dermacentor silvarum were screened with anti-D. silvarum serum produced from rabbits. The results of western blot showed that 3 antigenic proteins of about 100, 68, and 52 kDa were detected by polyclonal antibodies, which means that they probably have immunogenicity. Then, unfed female tick proteins were separated by 12% SDS-PAGE, and target proteins (100, 68, and 52 kDa) were cut and analyzed by LC-MS/MS, respectively. The comparative results of peptide sequences showed that they might be vitellogenin (Vg), heat shock protein 60 (Hsp60), and fructose-1, 6-bisphosphate aldolase (FBA), respectively. These data will lay the foundation for the further validation of antigenic proteins to prevent infestation and diseases transmitted by D. silvarum. PMID:26797451

  11. Molecular, biological, and morphometric comparisons between different geographical populations of Rhipicephalus sanguineus sensu lato (Acari: Ixodidae).

    Science.gov (United States)

    Sanches, Gustavo S; Évora, Patrícia M; Mangold, Atílio J; Jittapalapong, Sattaporn; Rodriguez-Mallon, Alina; Guzmán, Pedro E E; Bechara, Gervásio H; Camargo-Mathias, Maria I

    2016-01-15

    In this study, different geographical populations of Rhipicephalus sanguineus sensu lato were compared by molecular, biological, and morphometric methods. Phylogenetic trees were constructed using 12S and 16S rDNA sequences and showed two distinct clades: one composed of ticks from Brazil (Jaboticabal, SP), Cuba (Havana) Thailand (Bangkok) and the so-called "tropical strain" ticks. The second clade was composed of ticks from Spain (Zaragoza), Argentina (Rafaela, Santa Fe) and the so-called "temperate strain" ticks. Morphometric analysis showed good separation between females of the two clades and within the temperate clade. Males also exhibited separation between the two clades, but with some overlap. Multiple biological parameters revealed differences between the two clades, especially the weight of the engorged female. These results confirm the existence of at least two species under the name "R. sanguineus". PMID:26790741

  12. Isolation of Entomopathogenic Fungi From Soils and Ixodes scapularis (Acari: Ixodidae) Ticks: Prevalence and Methods

    OpenAIRE

    Tuininga, Amy R.; Miller, Jessica L.; Shannon U. Morath; Daniels, Thomas J.; Falco, Richard C.; Marchese, Michael; Sahabi, Sadia; Rosa, Dieshia; Stafford, Kirby C.

    2009-01-01

    Entomopathogenic fungi are commonly found in forested soils that provide tick habitat, and many species are pathogenic to Ixodes scapularis Say, the blacklegged tick. As a first step to developing effective biocontrol strategies, the objective of this study was to determine the best methods to isolate entomopathogenic fungal species from field-collected samples of soils and ticks from an Eastern deciduous forest where I. scapularis is common. Several methods were assessed: (1) soils, leaf lit...

  13. Repellent activity of fractioned compounds from Chamaecyparis nootkatensis essential oil against nymphal Ixodes scapularis (Acari: Ixodidae).

    Science.gov (United States)

    Dietrich, Gabrielle; Dolan, Marc C; Peralta-Cruz, Javier; Schmidt, Jason; Piesman, Joseph; Eisen, Rebecca J; Karchesy, Joseph J

    2006-09-01

    Preliminary repellent activity of 14 natural products isolated from essential oil components extracted from the heartwood of Alaska yellow cedar, Chamaecyparis nootkatensis (D. Don) Spach., were evaluated against nymphal Ixodes scapularis Say in a laboratory bioassay and compared with technical grade N,N-diethyl-3-methylbenzamide (deet). Four hours after treatment, nootkatone and valencene-13-ol had repellent concentration (RC)50 values of 0.0458 and 0.0712% (wt:vol), respectively; two additional Alaska yellow cedar compounds, nootkatone 1 --> 10 epoxide and carvacrol had reported RC50 values of 0.0858 and 0.112%, respectively. The observed RC50 value for deet was 0.0728% (wt:vol). Although not statistically significantly more active than deet, the ability of these natural products to repel ticks at relatively low concentrations may represent a potential alternative to synthetic commercial repellents. PMID:17017233

  14. Genetic diversity of Salp15 in the Ixodes ricinus complex (Acari: Ixodidae.

    Directory of Open Access Journals (Sweden)

    Xin Wang

    Full Text Available Salp15, a 15-kDa tick salivary gland protein, is both essential for ticks to successfully obtain host blood and also facilitates transmission of Lyme borreliosis. To determine whether the Salp15 gene is expressed in Ixodes persulcatus and Ixodes sinensis, principle vectors of Lyme borreliosis in China, we studied transcriptions of this gene in semi-engorged larvae, nymph and adults of these two species. A total of eight Salp15 homologues, five in I. persulcatus and three in I. sinensis, were identified by reverse transcriptase-polymerase chain reaction (RT-PCR. Interestingly, the intra-species similarity of Salp15 is approximately equal to its interspecies similarity and more than one Salp15 protein is expressed in a certain tick developmental stage. Comparison of DNA and proteins with other available tick Salp15 homologues suggests that the Salp15 superfamily is genetically conserved and diverse in the Ixodes ricinus complex. These findings indicate that Salp15 proteins in the I. ricinus complex may play an essential role in interacting with the host immune system and transmission of Borrelia genospecies.

  15. Primer registro de Ixodes cookei (Acari: Ixodidae) para México

    OpenAIRE

    Griselda Montiel Parra; Helxine Fuentes Moreno; Margarita Vargas

    2007-01-01

    En este estudio se aportan los primeros datos de la garrapata Ixodes cookei Packard, 1869 en México. Un macho, 7 larvas y 15 ninfas se recolectaron en los estados de Nuevo León y Veracruz. Además, se registra al cacomixtle Bassariscus astutus como un nuevo huésped.

  16. Hosts, seasonal occurrence and life cycle of Rhipicentor nuttalli (Acari: Ixodidae).

    Science.gov (United States)

    Fourie, L J; Horak, I G; Kok, D J; Van Zyl, W

    2002-09-01

    There are only two species worldwide within the genus Rhipicentor, namely Rhipicentor bicornis and Rhipicentor nuttalli and both occur only in Africa. Rhipicentor nuttali has a widespread distribution in South Africa and the present investigation was initiated to elucidate its host preference, seasonality and life cycle. Rock elephant shrews, Elephantulus myurus were examined for ticks at four localities in the Free State Province, one in Gauteng Province and two in Limpopo Province, South Africa. Cape elephant shrews, Elephantulus edwardii were examined at two places in the Western Cape Province, and a single specimen of the bushveld elephant shrew, Elephantulus intufi was examined in central Namibia. Small mammals of other species were also examined at two of these localities. The majority of E. myurus at two sites in the Free State, at the locality in Gauteng and both sites in Limpopo Province were infested with larvae and/or nymphs of R. nuttalli, while the single E. edwardii examined at one site in the Western Cape Province and the single E. intufi examined in Namibia were infested with nymphs of this tick. Not one of the other small animals was infested. Although larvae and nymphs of R. nuttalli were present on E. myurus throughout the year, the former were generally most numerous during the period March to September, and the latter during May to October. The preferred hosts of the adults are domestic dogs, leopards, Panthera pardus and South African hedgehogs, Atelerix frontalis. Adult females engorged on Atelerix frontalis in 16-32 days and, after a preoviposition period of 2-4 days, produced approximately 170,00 eggs during the following 60-70 days. The average incubation period of the eggs was 59 days. Larvae engorged on E. myurus in 4-10 days and moulted to nymphs 12-20 days later. Nymphs required 11-15 days to engorge on E. myurus and moulted to adults 32-47 days later. Allowing 14 days for the exoskeletons and mouthparts of each of the three parasitic stages to harden before they can attach to a host, the life cycle took approximately 214 days to complete in the laboratory. The length of this period, considered in conjunction with the times of maximum seasonal occurrence of the immature stages, indicates that the life cycle probably takes a year to complete in the field. PMID:12356163

  17. Detection of permethrin resistance and fipronil tolerance in Rhipicephalus sanguineus (Acari: Ixodidae) in the United States

    Science.gov (United States)

    Permethrin is a commonly used acaricide for tick control on domestic animals and in residential environments, while fipronil use is restricted to on-animal treatment. Following widespread reports of permethrin and fipronil application failures to control indoor infestations of Rhipicephalus sanguin...

  18. Ticks (Acari: Ixodida) parasitizing humans in Corum and Yozgat provinces, Turkey.

    Science.gov (United States)

    Keskin, Adem; Keskin, Aysun; Bursali, Ahmet; Tekin, Saban

    2015-12-01

    In order to identify ticks infesting humans in Corum and Yozgat provinces in Turkey, a total of 2110 ticks representing 14 species were collected on humans, between June and September 2009. Of those, 1551 (687♂, 450♀, 407 nymphs, 7 larvae) were collected from Corum and 559 (330♂, 180♀, 49 nymphs) were collected from Yozgat. The majority of ticks (n = 1121, 53.1 %) was Hyalomma marginatum. Other common ticks infesting humans were Dermacentor marginatus (n = 209, 9.9 %) and Rhipicephalus turanicus sensu lato (n = 145, 6.9 %) in the study area. In addition, a total of 386 immature Hyalomma were found on humans in Corum (335 nymphs, 7 larvae) and Yozgat (44 nymphs). Ixodes laguri and Haemaphysalis erinacei taurica were recorded for the first time in Corum. To the best of our knowledge, this study is the first detailed investigation on ticks infesting humans in Corum and Yozgat, except individual or incidental records. The present study provides useful information for those concerned with ticks and tick-borne diseases in Turkey.

  19. The patterns of seasonal activity of Ixodes vespertilionis (Acari: Ixodidae) on Rhinolophus hipposideros in nursery colonies.

    Science.gov (United States)

    Piksa, Krzysztof; Górz, Andrzej; Nowak-Chmura, Magdalena; Siuda, Krzysztof

    2014-02-01

    The aim of this study was to describe the dynamics of the long-legged bat tick Ixodes vespertilionis infestation on the lesser horseshoe bat Rhinolophus hipposideros in 2 nursery colonies roosting in attics. Out of a total of 810 lesser horseshoe bats examined, 217 (26.8%) were found to be infested with a total of 464 I. vespertilionis individuals. The developmental stage most frequently found was the larva, followed by the nymph, and the adult female. Bats were significantly more frequently infested with I. vespertilionis ticks in the period April to May than in other months. In these months, all tick developmental stages were observed. During summer and autumn, only immature developmental stages were recorded, whilst in September and October larvae predominated. Considerable differences in tick load between nursery colonies were observed. The length of seasonal presence on bats, prevalence, and infestation intensity of I. vespertilionis on lesser horseshoe bats were higher in the nursery colony situated in close vicinity of a cave than in the colony situated far from the caves. The results suggest that the pattern of seasonal infestation of ticks on bats roosting in nursery colonies coincides with the seasonal activity of Rh. hipposideros in the caves. The first case of mixed infestation of the lesser horseshoe bat with I. vespertilionis and I. ricinus were also recorded. PMID:24252260

  20. Rhipicephalus sanguineus and R. turanicus (Acari:Ixodidae): closely related species with different biological characteristics.

    Science.gov (United States)

    Ioffe-Uspensky, I; Mumcuoglu, K Y; Uspensky, I; Galun, R

    1997-01-01

    Life cycle parameters of 2 closely related tick species, Rhipicephalus sanguineus Latreille and R. turanicus Pomerantsev, were studied under laboratory conditions. Both Rhipicephalus, which have small adults, demonstrated the same adaptations as large tick species inhabiting deserts and semideserts: high reproductive rate, decrease in egg size, and an increase in interstage growth to compensate for the smaller size at birth. Pronounced quantitative differences between both species were discerned in relation to these adaptations. Female R. turanicus produced twice as many eggs as R. sanguineus which was facilitated by the greater amount of blood engorged by females and by the smaller egg weight in R. turanicus as compared with R. sanguineus. In all developmental stages, the weight increase from unfed to fed ticks was greater in R. turanicus than in R. sanguineus (23% higher in larvae, 118% in nymphs, and 26% in females). The increase in weight in R. turanicus from the unfed larva (0.013 mg) to the unfed female (3.31 mg) was 254-fold, and in R. sanguineus it was 127-fold (from 0.021 to 2.54 mg). In nymphal R. turanicus, the higher density and the greater height of the dorsal epicuticular folds, as well as procuticular indentations found inside the folds allow this tick to stretch its alloscutum during blood engorgement to a greater extent than R. sanguineus. The rates of blood ingestion (for nymphs and females), egg maturation, and metamorphosis were 1.1-1.7 times greater in R. turanicus than in R. sanguineus. A life cycle strategy with both a higher reproductive rate and faster development in R turanicus may be explained by its greater dependence on environmental factors than that in R. sanguineus. PMID:9086715

  1. Life cycle of Ixodes (Ixodes) loricatus (Acari: Ixodidae) under laboratory conditions.

    Science.gov (United States)

    Schumaker, T T; Labruna, M B; Abel, I dos S; Clerici, P T

    2000-09-01

    The life cycle of Ixodes (Ixodes) loricatus Neumann, reared in the laboratory, is described. Engorged females collected from opossums trapped in the states of Minas Gerais and São Paulo, Brazil, which were used to start the laboratory colonies, were designated as BMG and CSP, respectively. Larval and nymphal ticks from both colonies fed separately on Rattus norvergicus Berkenhout or Calomys callosus Rengger, whereas Didelphis marsupialis L and Didelphis albiventris Lund were used as hosts for BMG and CSP adults, respectively. Biological and developmental data obtained from ticks of both the BMG and CSP colonies that were reared separately for two consecutive generations were compared. The percentage of fed or molted ticks reared on C. callosus was higher than that recorded for ticks fed on R. norvergicus in the majority of the observations. Despite significant differences among several of the biological parameters, the pattern of the life cycles of the two tick colonies was similar. Results indicated that the mean life cycle duration of I. (I.) loricatus was approximately 7 mo from parental oviposition to the occurrence of F1 eggs, regardless of geographic origin or host species. PMID:11004783

  2. Fenvalerate resistance status in Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) from Punjab, India.

    Science.gov (United States)

    Jyoti; Nandi, Abhijit; Singh, Harkirat; Singh, N K; Rath, S S

    2016-09-01

    Larval packet test was used for evaluating the resistance levels in Rhipicephalus (Boophilus) microplus collected from different districts of central plain zone of Punjab state, India against fenvalerate. The regression graphs of probit mortality of larvae plotted against log values of progressively increasing concentrations of fenvalerate were utilized for the estimation of lethal concentration for 50 % (LC50) and 95 % (LC95) values against various field isolates of R. (B.) microplus. The slope of mortality (95 % confidence levels) varied from 0.730 ± 0.097 (0.419-1.043) to 1.455 ± 0.281 (0.558-2.352) and the value of R(2) varied from 0.881 to 0.997. From the regression equation the values of LC50 and LC95 were recorded in range of 184.39-1,338.01 and 3,253.33-112,706.26 ppm, respectively. Among the various tick isolates resistance factors in range of 1.56-54.34 were determined and all field isolates studied were found resistant against fenvalerate. Two field isolates (Jalandhar and Ludhiana) showed level I resistance; three (Patiala, Fatehgarh Sahib and Amritsar) showed level II and Kapurthala isolate showed level IV resistance. The data generated on fenvalerate resistant status will help in judicious use of the drug and formulation of effective tick control strategy for the region. PMID:27605769

  3. Pathogenicity of Steinernema carpocapsae and Steinernema glaseri (Nematoda:Steinernematidae) to Ixodes Scapularis (Acari:Ixodidae)

    Science.gov (United States)

    Zhioua, E.; LeBrun, R.A.; Ginsberg, H.S.; Aeschliman, A.

    1995-01-01

    The entomopathogenic nematodes Steinernema carpocapsae (Weiser) and S. glaseri (Steiner) are pathogenic to engorged adult, blacklegged ticks, Ixodes scapularis (Say), but not to unfed females, engorged nymphs, or engorged larvae. Nematodes apparently enter the tick through the genital pore, thus precluding infection of immature ticks. The timing of tick mortality, and overall mortality after 17 d, did not differ between infections by S. carpocapsae and S. glaseri. These nematodes typically do not complete their life cycles or produce infective juveniles in I. scapularis. However, both species successfully produced infective juveniles when the tick body was slit before nematode infection. Mortality of engorged I. scapularis females infected by S. carpocapsae was greater than uninfected controls, but did not vary significantly with nematode concentration (50-3,000 infective juveniles per 5-cm-diameter petri dish). The LC50 was 347.8 infective juveniles per petri dish (5 ticks per dish). Hatched egg masses of infected ticks weighed less than those of uninfected controls. Mortality of infected ticks was greatest between 20 and 30?C, and was lower at 15?C.

  4. Experimental infection of the bat tick Carios fonsecai (Acari: Ixodidae with the rabies virus

    Directory of Open Access Journals (Sweden)

    Silvana Regina Favoretto

    2013-12-01

    Full Text Available Introduction This study assessed the viability of the rabies virus in the argasid tick Carios fonsecai following experimental infection. Methods The mouse inoculation test (MIT, fluorescent antibody test (FAT and polymerase chain reaction (PCR were used. The rabies virus was administered to ticks via the intra-coelomic route, and the ticks were sacrificed at different time points. Results The inoculated ticks were negative for rabies according to the MIT. Ticks macerated with rabies virus were positive according to the MIT and FAT. All of the tick lots tested by PCR were positive. Conclusions The rabies virus became unviable shortly after its inoculation into tick bodies. Ticks are not likely to play an important role in the epidemiology of rabies.

  5. Species Diversity and Distribution of Ticks (Acari: Ixodidae) in Zabol County, Eastern Iran

    OpenAIRE

    Maryam Ganjali; Mansour Dabirzadeh; Masoud Sargolzaie

    2014-01-01

    Background: Ticks are important vectors of human and animal pathogens. They are considered as main vectors for transmission of many viral, bacterial, rickettsial and parasitical pathogens. The aim of the present study was to find out species diversity of ticks, which infested the domestic ruminants in Zabol County, Eastern Iran in 2012. Methods: Ticks were selected randomly from sheep, goats, cattle and camels. The ticks were collected from the body of infested animals and stored in 70% ethan...

  6. Effect of temperature on feeding period of larval blacklegged ticks (Acari: Ixodidae) on eastern fence lizards

    Science.gov (United States)

    Rulison, Eric L.; LeBrun, Roger A.; Ginsberg, Howard S.

    2014-01-01

    Ambient temperature can influence tick development time, and can potentially affect tick interactions with pathogens and with vertebrate hosts. We studied the effect of ambient temperature on duration of attachment of larval blacklegged ticks, Ixodes scapularis Say, to eastern fence lizards, Sceloporus undulatus (Bose & Daudin). Feeding periods of larvae that attached to lizards under preferred temperature conditions for the lizards (WARM treatment: temperatures averaged 36.6°C at the top of the cage and 25.8°C at the bottom, allowing behavioral thermoregulation) were shorter than for larvae on lizards held under cool conditions (COOL treatment temperatures averaged 28.4°C at top of cage and 24.9°C at the bottom). The lizards were infested with larvae four times at roughly monthly intervals. Larval numbers successfully engorging and dropping declined and feeding period was longer after the first infestation.

  7. Synganglion histology in different stages of Rhipicephalus sanguineus ticks (Acari: Ixodidae).

    Science.gov (United States)

    Roma, Gislaine Cristina; Nunes, Pablo Henrique; Remédio, Rafael Neodini; Camargo-Mathias, Maria Izabel

    2012-06-01

    The present study performs a morpho-histological description of the central nervous system of Rhipicephalus sanguineus ticks in order to analyze if there are differences in this tissue among larvae, nymphs, and adults. The results showed that the central nervous system in all the life stages of R. sanguineus consists of a mass of fused nerves named synganglion. Externally, this organ does not present segmentation, consisting of a single structure located ventromedially in the third anterior of the body. This organ is externally covered by the neural lamella or neurilemma, a uniform and acellular layer. Below, there is the periganglionic membrane or perineurium, formed by glial cells, which are characterized by their elongated nuclei. The esophagus penetrates the synganglion dividing it in two regions: supraesophageal, which is the smaller of the two and consists of a protocerebrum, a single dorsal ganglion located anteriordorsally to the esophagus; and the subesophageal, which is the largest part of the synganglion, located in the posterior region and ventral to the esophagus. Internally, the synganglion is subdivided in an external cortical region-which contains the cellular body of the nervous cells-and an internal neuropile formed by a set of neural fibers and it is constituted by bilaterally symmetric ganglia, from where nerves emerge towards several parts of the body. The results here obtained showed that there are no differences in the morpho-histology of this tissue in different life stages of R. sanguineus, suggesting that the initial structure is maintained during the whole life cycle of the tick, i.e., from larval to adult stage. PMID:22218921

  8. Central nervous system of Rhipicephalus sanguineus ticks (Acari: Ixodidae): an ultrastructural study.

    Science.gov (United States)

    Roma, Gislaine Cristina; Nunes, Pablo Henrique; de Oliveira, Patrícia Rosa; Remédio, Rafael Neodini; Bechara, Gervásio Henrique; Camargo-Mathias, Maria Izabel

    2012-09-01

    This study performed the ultrastructural description of the synganglion of Rhipicephalus sanguineus males and females, aiming to contribute to the understanding of the cellular organization of this organ. The results show that the central nervous system of these individuals consists of a mass of fused nerves, named synganglion, from where nerves emerge towards several parts of the body. It is surrounded by the neural lamella, a uniform and acellular layer, constituted by repeated layers of homogeneous and finely granular material. The perineurium is just below, composed of glial cells, which extensions invaginate throughout the nervous tissue. The synganglion is internally divided into an outer cortex, which contains the cellular bodies of the neural cells and an inner neuropile. The neural cells can be classified into two types according to cell size, cytoplasm-nucleus relation, and neurosecretory activity. Type I cells are oval or spherical and present a large nucleus occupying most part of the cytoplasm, which contains few organelles. Type 2 cells are polygonal, present a great cytoplasm volume, and their nuclei are located in the cell periphery. The cytoplasm of these cells contains a well-developed rough endoplasmic reticulum, Golgi regions, mitochondria, and several neurosecretory granules. The subperineurium and the tracheal ramifications are found between the cortex and the neuropile. The latter is formed mainly by neural fibers, tracheal elements, and glial cells. The results obtained show that R. sanguineus males' and females' nervous tissue present an ultrastructural organization similar to the one described in the literature for other tick species. PMID:22610445

  9. Description of all the stages of Ixodes inopinatus n. sp. (Acari: Ixodidae).

    Science.gov (United States)

    Estrada-Peña, Agustín; Nava, Santiago; Petney, Trevor

    2014-10-01

    All of the parasitic stages of Ixodes inopinatus n. sp. are described from specimens collected by flagging and on lizards and foxes. The new species replaces I. ricinus in dry areas of the Mediterranean region in Spain, Portugal, Morocco, Algeria and Tunisia. It has also been collected in areas of western Germany in sympatry with I. ricinus, far of its known distribution range and on an unusual host. The females of the new species can be separated from I. ricinus by the relative dimensions and punctations of the scutum, the length of the idiosomal setae, the size of the auriculae, and the aspect of the porose areas. Nymphs of I. inopinatus can be easily separated from I. ricinus by a combination of scutal dimensions, the relative size of scutal and alloscutal setae, and the relative size of the spurs on coxa I. The larvae of the new species have a broader than long scutum and unusually long Md1 to Md3 idiosomal setae. The new species is allopatric with I. ricinus in Spain and Portugal. It is hypothesized that it has been historically overlooked and reported as I. ricinus at least in northern Africa, southern Spain and parts of south-western Portugal. The existence of a new species in the I. ricinus complex makes necessary the critical assessment of its complete distribution, its abiotic preferences and seasonal activity, as well as its hosts and implications for the transmission of pathogens. PMID:25108790

  10. Scanning electron microscopy of all parasitic stages of Haemaphysalis qinghaiensis Teng, 1980 (Acari: Ixodidae).

    Science.gov (United States)

    Chen, Ze; Li, Youquan; Liu, Zhijie; Ren, Qiaoyun; Ma, Miling; Luo, Jianxun; Yin, Hong

    2014-06-01

    Haemaphysalis qinghaiensis Teng (Acta Zootaxon Sin 5:144-149, 1980) is an endemic species in China. This tick species was first described based on engorged or semi-engorged specimens, and the drawings and description in words of morphological characteristics were poor. Therefore, the present study aims to redescribe morphological characteristics of all active stages of this tick species in detail by scanning electron microscopy. Additionally, a comparison between H. qinghaiensis and other sympatric Haemaphysalis species was also analyzed. Males of H. qinghaiensis can be distinguished from sympatric Haemaphysalis species by the following characters: palpi less salient laterally and curved in contour; ventrointernal setae of palpal segment II thin, number <7; the tips of palpal segment III not so strongly recurved inward to become "pincerlike" and lacking dorsal spur; dental formula 5/5; lateral grooves enclose first festoon; coxa IV with a short, broadly triangular spur; tarsi somewhat humped; and spiracular plates long comma-shaped. Females of H. qinghaiensis can be distinguished by palpi less salient laterally and curved in contour; ventrointernal setae of palpal segment II thin, number <7; segment III of palpi lacking dorsal spur; dental formula 4/4; scutum subcircula; and tarsi somewhat humped. Nymphs of H. qinghaiensis can be distinguished from those of other species by palpi less salient laterally and curved in contour; dental formula 2/2; basis capituli rectangular, with distinct dorsal cornua, without ventral cornua; and spiracular plates with short and narrow dorsal prolongation. Larvae of H. qinghaiensis can be distinguished by palpi less salient laterally and curved in contour; basis capituli rectangular, without distinct cornua. PMID:24687283

  11. Description of a New Dermacentor (Acari: Ixodidae) Species from Thailand and Vietnam.

    Science.gov (United States)

    Apanaskevich, Dmitry A; Apanaskevich, Maria A

    2015-09-01

    A new tick species belonging to the genus Dermacentor Koch, 1844, namely, Dermacentor filippovae n. sp., is described. All stages of this species are similar to those of D. auratus Supino, 1897, D. compactus Neumann, 1901, and D. limbooliati Apanaskevich and Apanaskevich, 2015 with which it was previously confused. Males of D. filippovae may be distinguished from those of D. auratus, D. compactus, and D. limbooliati by the following suite of characters: conscutum broadly oval with convex lateral sides, widest posteriorly; trapezium-like shape of pseudoscutum; central brown patch on conscutum indistinct; coxa I with internal spur narrowly triangular with tapering apex and external spur fairly long, narrowly triangular with tapering apex; numerous internal spurs on coxa IV; and trochanter I with moderate, broadly triangular spur with tapering apex. Females of D. filippovae may be distinguished from those of D. auratus, D. compactus, and D. limbooliati by the following suite of characters: central patch of scutum narrow, distinct line interrupted around midlength; more rounded shape of scutum; long and distinct alloscutal setae; moderately broad U-shaped genital aperture with preatrial fold bulging anteriorly and thereafter sharply sloping to flat surface posteriorly; coxa I with internal spur narrowly triangular with tapering apex and external spur fairly long, narrowly triangular with tapering apex; and trochanter I with moderate, broadly triangular spur with tapering apex. Dermacentor filippovae is known from Thailand and Vietnam where the adults were collected from wild boar, Sus scrofa L., and vegetation. PMID:26336207

  12. Description of New Dermacentor (Acari: Ixodidae) Species from Malaysia and Vietnam.

    Science.gov (United States)

    Apanaskevich, Maria A; Apanaskevich, Dmitry A

    2015-03-01

    A new tick species belonging to the genus Dermacentor Koch, 1844, namely, Dermacentor limbooliati n. sp., is described. Adults of this species are similar to those of Dermacentor auratus Supino, 1897 and Dermacentor compactus Neumann, 1901, with which it was previously confused. Males of D. limbooliati may be distinguished from those of D. auratus and D. compactus by the following suite of characters: relatively broad conscutum with slightly straightened lateral sides, conscutum widest approximately at mid-length, oval shape of pseudoscutum, central brown patch in the center of pseudoscutum broad and diffused and not continuous with central patch in posteromedian area, conscutum posterior to pseudoscutum rugose, wide and blunt internal spur on coxa I, relatively long, narrow, and pointed external spur on coxa I, numerous internal spurs on coxa IV and trochanter I with moderate and broadly triangular spur with tapering apex. Females of D. limbooliati may be distinguished from those of D. auratus and D. compactus by the following suite of characters: rounded shape of scutum, central brown patch broad and diffused in the center of scutum, relatively long alloscutum setae, genital aperture moderately narrow V-shaped with preatrial fold bulging, wide and blunt internal spur on coxa I, relatively long, narrow, and pointed external spur on coxae I and trochanter I with moderate and broadly triangular spur with tapering apex. D. limbooliati is known from Malaysia and Vietnam where the adults were collected from vegetation, Sus scrofa resting beds, a human, and clothing. The immature stages remain unknown. PMID:26336300

  13. Description of a new Dermacentor (Acari: Ixodidae) species, a parasite of wild mammals in Central America.

    Science.gov (United States)

    Apanaskevich, Dmitry A; Bermúdez, Sergio E

    2013-11-01

    A new tick species belonging to the genus Dermacentor Koch, 1844, Dermacentor panamensis n. sp., is described. All stages of this species are similar to those of Dermacentor halli McIntosh, 1931, with which it was confused for a long time. Males of D. panamensis can be distinguished from those of D. halli by the following suite of characters: narrower conscutum, broader basis capituli, shorter dorsal cornua, narrower palpi, palpal segment III tapering to its apex, legs poorly ornate: ivory colored patches present only on dorsal aspects of leg segments (mostly on legs III and IV), and internal spur of coxae I narrower and more tapering. Females of D. panamensis can be distinguished from those of D. halli by the following suite of characters: narrower and less ornate scutum, broader basis capituli, shorter dorsal cornua, larger porose areas, narrower palpi, palpal segment III tapering to its apex, legs poorly ornate: ivory colored patches present only on dorsal aspects of leg segments (mostly on legs III and IV), and internal spur of coxae I narrower and more tapering. Nymphs of D. panamensis can be distinguished from those of D. halli by clear posterolateral projections of scutum and by absence of coxal "pore" on coxae I-IV, while larvae of D. panamensis can be distinguished from those ofD. halli by shorter and less sharp lateral projections of basis capituli dorsally and slightly sharp anterior angle of basis capituli. D. panamensis is known from highlands of Costa Rica, Guatemala, Honduras, Nicaragua, and Panama where the adults were collected from porcupines and unidentified sloth and mouse while nymphs and larvae were found on various rodents and a bat. PMID:24843922

  14. Effects of Ricinus communis oil esters on salivary glands of Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae).

    Science.gov (United States)

    Arnosti, André; Brienza, Paula Desjardins; Furquim, Karim Christina Scopinho; Chierice, Gilberto Orivaldo; Neto, Salvador Claro; Bechara, Gervásio Henrique; Sampieri, Bruno Rodrigues; Camargo-Mathias, Maria Izabel

    2011-02-01

    This study showed the interference of esters extracted from Ricinus communis in the secretory cycle of salivary glands of Rhipicephalus sanguineus ticks, which consequently caused collateral effects on their feeding process. Ticks attached on hosts which were fed with commercial feed containing different concentrations of R. communis oil esters suffered damages such as cytoplasmic changes in their salivary glands, notably in the acinar cells, impairing the functioning of the acini and accelerating the organs degeneration as a whole. It was found that esters interfered with the activity of cellular secretion by changing the glycoprotein of salivary composition especially in acini II cells. It was also shown that the damages caused by esters in the salivary glands cells of these ectoparasites increased in higher concentrations of the product and degenerative glandular changes were more pronounced.

  15. Rhipicephalus sanguineus (Acari: Ixodidae) female ticks exposed to castor oil (Ricinus communis): an ultrastructural overview.

    Science.gov (United States)

    Sampieri, B R; Furquim, K C S; Nunes, P H; Camargo-Mathias, M I

    2013-02-01

    Tick control has been accomplished through the use of synthetic acaricides, which has created resistant individuals, as well as contaminating the environment and nontarget organisms. Substances of plant origin, such as oils and extracts of eucalyptus and neem leaves, have been researched as an alternative to replace the synthetic acaricides. Ricinoleic acid esters from castor oil have recently been shown as a promising alternative in eliminating bacterial contamination during ethanol fermentation, by acting as an effective biocide. The same positive results have been observed when these esters are added to the food given to tick-infested rabbits. This study tested the effect of these substance on the reproductive system of Rhipicephalus sanguineus females, added to rabbit food, more specifically on oogenesis. For this, four groups were established: four control groups (CG1, CG2, CG3, and CG4) and four treatment groups (TG1, TG2, TG3, and TG4) with one rabbit in each (New Zealand White), used as hosts. After full 4 days feeding (semi-engorgement), the females were collected and had their ovaries extracted. In this study, it was observed that R. sanguineus females exposed to esters had their ovaries modified, which was demonstrated through transmission electron microscopy techniques. The addition of ricinoleic esters to the diet of tick-infested rabbits revealed how toxic such substances are for the cytoplasmic organelles of oocytes and pedicel cells. These compounds can change the morphophysiology of germ and somatic cells, consequently influencing their viability and, therefore, confirming that the ricinoleic acid esters from castor oil are a promising substance in the control of R. sanguineus.

  16. Histopathological study of ovaries of Rhipicephalus sanguineus (Acari: Ixodidae) exposed to different thymol concentrations.

    Science.gov (United States)

    da Silva Matos, Renata; Daemon, Erik; Camargo-Mathias, Maria Izabel; Furquim, Karim Christina Scopinho; Sampieri, Bruno Rodrigues; Remédio, Rafael Neodini; Araújo, Laryssa Xavier; Novato, Tatiane Pinheiro Lopes

    2014-12-01

    Thymol is a monoterpene with proven acaricide action for several tick species. In addition to killing these ectoparasites, thymol can also reduce oviposition and egg hatch rate. However, the effects of thymol on the morphophysiology of tick ovaries are still unknown. Thus, the aim of this study was to evaluate the morphophysiological changes caused by this active principle in ovaries of Rhipicephalus sanguineus after a 6-day feeding period, through the application of morphohistochemical techniques. After the feeding period, a total of 50 females were divided into five groups and immersed in the following solutions: (I) distilled water (control), (II) 30% ethanol (control), (III) 1.25 mg/mL thymol, (IV) 2.5 mg/mL thymol, and (V) 5.0 mg/mL thymol. The experimental groups were kept in a climatic chamber (27 ± 1 °C; RH 80 ± 10%) for 5 days. After this period, morphological (hematoxylin/eosin) and histochemical (von Kossa) techniques were applied after remotion of the ovaries. The morphological results revealed large vacuoles in germ cells at different developmental stages and invaginations that represent deformations in the chorionic membrane. From the results obtained in this study, it was concluded that thymol interfered with the development of oocytes, which showed degeneration signs. The treatment containing 5.0 mg/mL thymol affected more accentuately the morphological development. Moreover, thymol also altered the calcium content of yolk granules, which generally showed an intense staining for this element.

  17. Effect of a botanical acaricide on Ixodes scapularis (Acari: Ixodidae) and nontarget arthropods.

    Science.gov (United States)

    Elias, Susan P; Lubelczyk, Charles B; Rand, Peter W; Staples, Joseph K; St Amand, Theodore W; Stubbs, Constance S; Lacombe, Eleanor H; Smith, Leticia B; Smith, Robert P

    2013-01-01

    We tested the effectiveness of the rosemary oil-based insecticide, Eco-Exempt IC2, to control all stages of Ixodes scapularis (Say) in southern Maine. We selected plots in oak-pine forest where I. scapularis is endemic and recorded the abundance of ticks and nontarget arthropods before and after applications of IC2, bifenthrin (a synthetic pyrethroid), and water (reference treatment). Licensed applicators applied high-pressure spray treatments during the summer nymphal and fall adult seasonal peaks. Both acaricides sprayed during the summer nymphal season reduced nymphal I. scapularis/hour to zero. IC2 was as effective as bifenthrin in controlling nymphs through the rest of the nymphal season and also controlled adult ticks 9 mo postspray compared with 16 mo for bifenthrin, and both acaricides reduced larvae through 14 mo postspray. Both acaricides sprayed during the fall adult season reduced adult I. scapularis/hour to zero; IC2 controlled adult ticks 6 mo postspray compared with 1 yr for bifenthrin. Both fall-applied acaricides controlled nymphs 9 mo postspray and reduced larvae up to 10 mo postspray. Impacts on some nontarget arthropods was assessed. Colleoptera, Hymenoptera, and Collembola declined 1 wk postspray in acaricide-treated plots, and in IC2 plots all numbers rebounded by 20 d postspray. For bees and other flower-visiting insects there were no detectable reductions in nests produced, number emerged from nests, or number of foraging visits to flowering plants in IC2 or bifenthrin plots. IC2 was phytotoxic to the leafy portions of select understory plants that appeared to recover by the next growing season. PMID:23427661

  18. Potential nontarget effects of Metarhizium anisopliae (Deuteromycetes) used for biological control of ticks (Acari: Ixodidae)

    Science.gov (United States)

    Ginsberg, H.S.; LeBrun, R.A.; Heyer, K.; Zhioua, E.

    2002-01-01

    The potential for nontarget effects of the entomopathogenic fungus Metarhizium anisopliae (Metschnikoff) Sorokin, when used for biological control of ticks, was assessed in laboratory trials. Fungal pathogenicity was studied against convergent ladybird beetles, Hippodamia convergens Guerin-Meneville, house crickets, Acheta domesticus (L.), and milkweed bugs, Oncopeltus fasciatus (Dallas). Fungal spores applied with a spray tower produced significant mortality in H. convergens and A. domesticus, but effects on O. fasciatus were marginal. Treated insects placed with untreated individuals resulted in mortality from horizontal transmission to untreated beetles and crickets, but not milkweed bugs. Spread of fungal infection in the beetles resulted in mortality on days 4-10 after treatment, while in crickets mortality was on day 2 after treatment, suggesting different levels of pathogenicity and possibly different modes of transmission. Therefore, M. anisopliae varies in pathogenicity to different insects. Inundative applications can potentially affect nontarget species, but M. anisopliae is already widely distributed in North America, so applications for tick control generally would not introduce a novel pathogen into the environment. Pathogenicity in lab trials does not, by itself, demonstrate activity under natural conditions, so field trials are needed to confirm these results and to assess methods to minimize nontarget exposure.

  19. Species Diversity and Distribution of Ticks (Acari: Ixodidae in Zabol County, Eastern Iran.

    Directory of Open Access Journals (Sweden)

    Maryam Ganjali

    2014-12-01

    Full Text Available Ticks are important vectors of human and animal pathogens. They are considered as main vectors for transmission of many viral, bacterial, rickettsial and parasitical pathogens. The aim of the present study was to find out species diversity of ticks, which infested the domestic ruminants in Zabol County, Eastern Iran in 2012.Ticks were selected randomly from sheep, goats, cattle and camels. The ticks were collected from the body of infested animals and stored in 70% ethanol, then transported to the laboratory of Zabol University of Medical Sciences. Following examinations under stereomicroscope, ticks were identified using available taxonomic keys.In this study, a total number of 469 adult ticks (381 males and 88 females were collected. Ticks were classified into 2 genera and 9 species including: Hyalomma dromedarii (17.3%, Hy. schulzei (1.8%, Hy. marginatum (0.5%, Hy. anatolicum excavatum (12.60%, Hy. anatolicum anatolicum (11.2%, Hy. asiaticum asiaticum (11.0%, Rhipicephalus sanguineus (21.2%, Rh. bursa (10.2% and Rh. turacunis (13.911%. The frequency of genus Hyalomma (54.6% was higher than Rhipicephalus. Rh. sanguineus was the predominant tick species and accounted for 21.26% of the ticks. The ratio of males was more than the female ticks.Hyalomma and Rhipicephalus species are commonly distributed in the study area. Further investigations are needed to identify the role of above tick species as vectors of pathogenic organisms.

  20. Two neuropeptides from synganglia of the hard tick,Ixodes sinensis (Acari:Ixodidae)

    Institute of Scientific and Technical Information of China (English)

    LI Jianxu; LIU Tongguang; YANG Hailong; XU Xueqing; LIU Zhigang; LAI Ren

    2006-01-01

    Two neuropeptides were isolated from synganglia (central nervous system) of the hard tick,Ixodes sinensis. Their primary sequences were established as Leu-VaI-VaI-Tyr-Pro-Trp-Thr-Lys and TrpGlu-Lys-Leu-Gly-Ser-Met-Glu-Thr-Leu. By hot plate bioassay, neuropeptide a displayed strong antinociceptive effect in mice by a dose-dependent behavior, while neuropeptide b had some relaxant effects on the isolated rat strip. These neuropeptides might be involved in down-regulating the host's defensive reaction.

  1. Canis familiaris, un nuevo hospedero de ornithodoros (a.) puertoricensis fox, 1947 (acari: ixodida) en colombia

    OpenAIRE

    BEJARANO EDUAR E. E.; PATERNINA-GÓMEZ MARGARET; DÍAZ-OLMOS YIRYS; PATERNINA LUIS E.

    2009-01-01

    RESUMEN

    Las garrapatas revisten gran importancia en el campo biomédico por sus hábitos hematófagos y asociación con la transmisión de agentes patógenos a humanos y animales. El objetivo de esta investigación fue establecer las especies de g...

  2. New host records of Haemaphysalis leporispalustris (Acari: Ixodidae) on birds in Brazil.

    Science.gov (United States)

    Zeringóta, Viviane; Maturano, Ralph; Santolin, Ísis Daniele Alves Costa; McIntosh, Douglas; Famadas, Kátia Maria; Daemon, Erik; Faccini, João Luiz Horacio

    2016-05-01

    Birds are an important component of the life histories and bioecology of a number of tick species and of some tick associated pathogens. An examination of the data concerning bird/tick associations in the Neotropics, showed that the tick Haemaphysalis leporispalustrisis (Packard, 1869) was rarely recorded infesting birds. The current study reports parasitism by H. leporispalustris in wild birds collected from Atlantic rain forest environments in the states of Rio de Janeiro (4LL) and Minas Gerais (17LL, 1NN), Brazil. All ticks were identified morphologically to the genus level; total DNA was extracted from each Haemaphysalis tick and examined by PCR and nucleotide sequencing of fragments of the eukaryotic genes encoding 16S rRNA and 12S rRNA. The bird species Arremon semitorquatus, Corythopis delalandi, Fluvicola nengeta, Troglodytes musculus, and Volatinia jacarina were recorded as hosts for H. leporispalustris for the first time in South America, and Turdus rufiventris represented a new record for Brazil. PMID:26965425

  3. Distribution of Rickettsia rickettsii in ovary cells of Rhipicephalus sanguineus (Latreille1806 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    da Silva Costa Luís

    2011-11-01

    Full Text Available Abstract Background Considering the fact that the dog tick, Rhipicephalus sanguineus, has a great potential to become the vector of Brazilian Spotted Fever (BSF for humans, the present study aimed to describe the distribution of the bacterium Rickettsia rickettsii, the etiological agent of BSF, in different regions of the ovaries of R. sanguineus using histological techniques. The ovaries were obtained from positive females confirmed by the hemolymph test and fed in the nymph stage on guinea pigs inoculated with R. rickettsii. Results The results showed a general distribution of R. rickettsii in the ovary cells, being found in oocytes in all stages of development (I, II, III, IV and V most commonly in the periphery of the oocyte and also in the cytoplasm of pedicel cells. Conclusions The histological analysis of the ovaries of R. sanguineus infected females confirmed the presence of the bacterium, indicating that the infection can interfere negatively in the process of reproduction of the ticks, once alterations were detected both in the shape and cell structure of the oocytes which contained bacteria.

  4. Susceptibility of Boophilus microplus (Canestrini, 1887) (Acari: Ixodidae) to seven ixodicides in Nuevo Leon, Mexico

    OpenAIRE

    Jesús A. Esparza Rentería; Emily Lizett Esparza Sevilla

    2015-01-01

    This article reports the results of research only. Mention of a proprietary product does not constitute an endorsement or a recommendation by the FAUANL for its use Animal husbandry and meat industry in Mexico are one of the principal activities of the agricultural sector of the country, which are threatened by factors that affect the production of meat, skin and milk; among these, the damages caused by Boophilus microplus (Canestrini), the common tick of cattle, and the diseases it transm...

  5. Susceptibility of Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae to seven ixodicides in Nuevo Leon, Mexico

    Directory of Open Access Journals (Sweden)

    Jesús A. Esparza Rentería

    2015-07-01

    Full Text Available This article reports the results of research only. Mention of a proprietary product does not constitute an endorsement or a recommendation by the FAUANL for its use Animal husbandry and meat industry in Mexico are one of the principal activities of the agricultural sector of the country, which are threatened by factors that affect the production of meat, skin and milk; among these, the damages caused by Boophilus microplus (Canestrini, the common tick of cattle, and the diseases it transmits, such as anaplasmosis and babesiosis (Xianxun and Wenshun, 1997; Yeruhan et al., 1998, are of special interest. The objective of this study was to determine the susceptibility of the larvae of Boophilus microplus to seven tick-killing agents commonly used in the state of Nuevo Leon. The methodology used for the diagnosis of the susceptibility of B. microplus tick to Organochlorine, Organophosphorate and Pyrethroid compounds was the one applied by Rodriguez-Vivas et al., (2007; in which it was used a discriminant dose (table 1, using the larvae package test technique (Stone & Haydock, 1962. The results of the CL50 to the ticks of cattle in the state of Nuevo Leon, Mexico showed a greater susceptibility to Deltamethrine, followed by Chlorfenvinphos; in third place Diazinon, then Flumethrin; after that Cypermethrin, in sixth place Lindane and a less toxicological action for the Coumaphos (Asuntol. The result was already expected due to the fact that it is the most commonly used product in the control of ticks through the larval immersion technique.

  6. Evaluation of Four Bed Bug Traps for Surveillance of the Brown Dog Tick (Acari: Ixodidae).

    Science.gov (United States)

    Carnohan, Lucas P; Kaufman, Phillip E; Allan, Sandra A; Gezan, Salvador A; Weeks, Emma N I

    2015-03-01

    The brown dog tick, Rhipicephalus sanguineus (Latrielle), can be a serious residential pest due to its unique ability, among ticks, to complete its lifecycle indoors. A single engorged and fertilized female tick can oviposit around 4,000 eggs, allowing indoor establishment to be rapid and easy to miss in early-stage infestations. Acaricide treatment is currently the primary method of control, but can be costly and can lead to the development of acaricide resistance in tick populations. Traps of various designs can be used to help monitor and manage populations of indoor pests, such as cockroaches and bed bugs, but there are currently no commercially available traps for use with brown dog tick infestations. This study included a comparison of four commercially available bed bug traps (NightWatch [BioSensory Inc., Putnam, CT], Bed Bug Beacon [PackTite, Fort Collins, CO], ClimbUp [Susan McKnight Inc., Memphis, TN], and Verify [FMC Corporation, Philadelphia, PA]) with regard to their efficacy in capturing brown dog ticks, and also compared tick attraction to ClimbUp traps baited with several stimuli including CO2. Significantly more ticks were captured and attracted to the NightWatch and CO2-baited ClimbUp traps than the other two trap models. The results suggest that bed bug traps may be useful in brown dog tick monitoring, and CO2 will likely be an important component of a trapping system employed in the future. PMID:26336310

  7. Atlas van de Nederlandse watermijten (Acari: Hydrachnidia)

    NARCIS (Netherlands)

    Smit, H.; Hammen, van der H.

    2000-01-01

    Atlas of the Dutch water mites (Acari: Hydrachnidia) Few biogeographic studies have been published on water mites. Only Lundblad (1962) has published an atlas of the Swedish water mites. So far, there are no complete publications on the distribution of Dutch water mites. Acarologists who worked on D

  8. Molecular evidence of potential novel spotted fever group rickettsiae, Anaplasma and Ehrlichia species in Amblyomma ticks parasitizing wild snakes

    OpenAIRE

    Kho, Kai Ling; Koh, Fui Xian; Tay, Sun Tee

    2015-01-01

    Background Amblyomma ticks parasitize a wide range of animals in tropical regions. This study describes the identification of Amblyomma ticks from wild snakes in Malaysia and the detection of potential human pathogens such as Rickettsia, Anaplasma, Ehrlichia and bartonellae in the ticks. Findings Twenty one adult ticks (twelve A. varanense and nine Amblyomma helvolum ticks) identified from seven Python molurus snakes in Sepang and a pool of six A. helvolum ticks from a Naja sumatrana snake in...

  9. Description of Amblyomma romitii in Capybara (Hydrochoerus hydrochaeris in São Francisco do Guapor, Rondônia

    Directory of Open Access Journals (Sweden)

    R. T. Kemper

    2013-03-01

    Full Text Available Abstract: The present work report the finding of the tick species Amblyomma romitii Tonelli Rondelli,1939, in S Francisco do Guaporcity, west of Rondia state, in the mesoregion Madeira-Guapor The specimen was found in a capybara (Hydrochoerus hydrochaeris found dead on a farm in the region.Keywords: parasitism, Amblyomma, Rondônia, capybara

  10. Ticks (Acari: Ixodida: Argasidae, Ixodidae) infesting humans in Northwestern Córdoba province, Argentina Garrapatas infestando humanos en el noroeste de la provincia de Córdoba, Argentina

    OpenAIRE

    Nava Santiago; José A. Caparrós; Mangold, Atilio J.; Alberto A. Guglielmone

    2006-01-01

    Ticks infesting humans were collected from September 2004 to August 2005 in Northwestern Córdoba in an area with a southern limit in the locality of Dean Funes (30°25´S 64°20´W) and San José de las Salinas (30°00´S 64°37´W) in the North. The collections consisted in ticks found attached on man obtained from three sources: 1) specimens fixed on two workers during two successive days per month of field work in the northern part of the area which belongs to Western Chaco district of the phytogeo...

  11. An Immunosuppressant Peptide from the Hard Tick Amblyomma variegatum

    Directory of Open Access Journals (Sweden)

    Yufeng Tian

    2016-05-01

    Full Text Available Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1–2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts’ immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA. In rat splenocytes, amregulin exerts significant anti-inflammatory effects by inhibiting the secretion of inflammatory factors in vitro, such as tumor necrosis factor-alpha (TNF-α, interleukin-1 (IL-1, interleukin-8 (IL-8 and interferon-gamma (IFN-γ. In rat splenocytes, treated with amregulin, compared to lipopolysaccharide (LPS alone, the inhibition of the above inflammatory factors was significant at all tested concentrations (2, 4 and 8 µg/mL. Amregulin shows strong free radical scavenging and antioxidant activities (5, 10 and 20 µg/mL in vitro. Amregulin also significantly inhibits adjuvant-induced paw inflammation in mouse models in vivo. This peptide may facilitate the ticks’ successful blood feeding and may lead to host immunotolerance of the tick. These findings have important implications for the understanding of tick-host interactions and the co-evolution between ticks and the viruses that they bear.

  12. Highly Prevalent Coxiella sp. Bacterium in the Tick Vector Amblyomma americanum▿

    OpenAIRE

    Jasinskas, Algimantas; Zhong, Jianmin; Barbour, Alan G.

    2006-01-01

    Laboratory-reared and field-collected Amblyomma americanum ticks were hosts of a Coxiella sp. and a Rickettsia sp. While the Coxiella sp. was detected in 50 of 50 field-collected ticks, the Rickettsia sp. was absent from 32% of ticks. The Coxiella sp. showed evidence of a reduced genome and may be an obligate endosymbiont.

  13. Rickettsia parkeri infecting free-living Amblyomma triste ticks in the Brazilian Pantanal.

    Science.gov (United States)

    Melo, Andréia L T; Alves, Alvair S; Nieri-Bastos, Fernanda A; Martins, Thiago F; Witter, Rute; Pacheco, Thábata A; Soares, Herbert S; Marcili, Arlei; Chitarra, Cristiane S; Dutra, Valéria; Nakazato, Luciano; Pacheco, Richard C; Labruna, Marcelo B; Aguiar, Daniel M

    2015-04-01

    The present study evaluated the infection of rickettsiae in 151 Rhipicephalus sanguineus, 59 Amblyomma ovale, 166 Amblyomma triste, one Amblyomma dissimile and four Amblyomma dubitatum ticks collected in the municipality of Poconé, State of Mato Grosso, within the Pantanal biome of Brazil. Ticks were individually processed by the hemolymph test with Gimenez staining, isolation of rickettsia in Vero cell culture by the shell vial technique, and polymerase chain reaction (PCR) targeting the citrate synthase rickettsial gene. Through the shell vial technique, rickettsiae were successfully isolated and established in Vero cell culture from one free-living A. triste female tick, which previously showed to contain Rickettsia-like organisms by the hemolymph test. Molecular characterization of the rickettsial isolate was achieved through DNA partial sequences of three rickettsial genes (gltA, ompA, ompB), which showed to be all 100% identical to Rickettsia parkeri. After testing all ticks by PCR, the frequency of R. parkeri infection was 7.23% (12/166) in A. triste adult ticks. The remaining ticks were negative by PCR. This is the first report of in vitro isolation of R. parkeri in the Pantanal biome, confirming the occurrence of this emerging rickettsial pathogen in this natural area of South America.

  14. Avaliação in vitro de uma cepa de campo de Boophilus microplus (Acari : Ixodidae resistente à amitraz In vitro evaluation of a field strain of Boophilus microplus (Acari:Ixodidae resistant to amitraz

    Directory of Open Access Journals (Sweden)

    Minerva Santamaría Vargas

    2003-08-01

    Full Text Available O uso dos acaricidas químicos ainda se constitui no principal instrumento de controle do carrapato bovino Boophilus microplus. No sul do Brasil, o amitraz aplicado por imersão e aspersão é o ingrediente ativo mais utilizado, nos últimos anos, contra as cepas de carrapatos resistentes aos organofosforados (OF e piretróides sintéticos (PS. Em conseqüência, torna-se importante a realização de investigações que possam contribuir para prolongar a vida útil desse ixodicida. No presente estudo, foi analisado o comportamento toxicológico de uma cepa de B. microplus colhida na localidade de Alegrete, Rio Grande do Sul, usando-se químicos da família dos OF, PS, misturas OF/PS, além do amitraz. Os resultados indicaram que a cepa denominada "Santa Luiza" apresentou fatores de resistência (FR que variaram entre 2,3 e 3,95 para OF, 23,3 e 147,56 para PS e de 3,76 a 21.57 para amitraz em testes realizados com larvas de carrapatos. A caracterização e purificação de uma cepa de B. microplus resistente ao amitraz permitem seu uso como cepa de referência para a avaliação biológica de ixodicidas alternativos, além de padronizar e validar métodos de diagnósticos toxicológicos que possam detectar resistência frente a esse acaricida.The use of chemical acaricide still remains as the main tool against the cattle tick Boophilus microplus. In Southern Brazil, amitraz applied by immersion and/or spray is the main active ingredient to control organophosphate and synthetic pyrethroid resistant strains. In consequence it is important to conduct investigations in order to prolong useful life of this ingredient. In this article, toxicological behaviour of a strain of Boophilus microplus named "Santa Luiza" collected in the locality of Alegrete, state of Rio Grande do Sul, Brazil, was analyzed against acaricides organophosphorous, pyrethroids, mixtures SP and OP and amitraz. Results showed factors of resistance from 2.3 to 3.95 to OP, 23.3 to 147.56 to SP and 3.76 to 21.57 to amitraz indicating that this strain showed multiple resistance to tested acaricides. Characterization and purification of a B. microplus strain resistant to amitraz will allow its use as a reference strain for future utilization in biological evaluation of alternative acaricides as well as to standard and to validate diagnostic methods to detect resistant to this acaricide.

  15. New host records of Ixodes luciae (Acari: Ixodidae in the State of Para, Brazil Registros de novos hospedeiros para Ixodes luciae (Acari: Ixodidae no estado do Pará, Brasil

    Directory of Open Access Journals (Sweden)

    Hermes Ribeiro Luz

    2013-03-01

    Full Text Available The aim of this paper is to record new hosts for Ixodes luciae Sénevet in the State of Para, Brazil, and present a case of malformation (teratogeny in a nymph of this species. The new host records are Marmosa murina (parasitized by females and Philander opossum (parasitized by nymphs. One of these nymphs showed malformation in the posterior margin of the opisthosoma resulting in a heart shaped posterior end.O objetivo deste trabalho foi registrar novos hospedeiros para Ixodes luciae Sénevet no estado do Pará, Brasil, e um caso de malformação em uma ninfa dessa espécie de carrapato. Os novos hospedeiros são Marmosa murina (parasitado por fêmeas e Philander opossum (parasitado por ninfas. Uma dessas ninfas apresentou uma malformação na parte posterior do opistossoma em forma de coração.

  16. Ocorrência de Ixodes loricatus Neumann, 1899 (Acari: Ixodidae) parasitando Didelphis albiventris (Lund, 1841), (Didelphimorphia: Didelphidae), em Campo Grande, MS Occurrence of Ixodes loricatus Neumann, 1899 (Acari: Ixodidae) parasitizing Didelphis albiventris (Lund, 1841) (Didelphimorphia: Didelphidae) in Campo Grande , MS

    OpenAIRE

    Soraya R. Miziara; Fernando Paiva; Renato Andreotti; Wilson W. Koller; Vinicius A. Lopes; Nara T. Pontes; Klaudia Bitencourt

    2008-01-01

    Este é primeiro relato da ocorrência de Ixodes no Estado do Mato Grosso do Sul e primeiro caso identificado de Ixodes loricatus Neumann, 1899, parasitando Didelphis albiventris no município de Campo Grande, MS, Brasil.This is first report of occurence of Ixodes in the State of Mato Grosso do Sul and first description of Ixodes loricatus Neumann, 1899, parasitizing Didelphis albiventris in Campo Grande, MS, Brazil.

  17. The parasitism of Ixodes luciae (Acari: Ixodidae on marsupials and rodents in Peruvian Amazon O parasitismo do Ixodes luciae (Acari: ixodidae em marsupiais e em roedores na Amazônia Peruana

    Directory of Open Access Journals (Sweden)

    María Mónica Díaz

    2009-01-01

    Full Text Available In this work the infestation with I. luciae on Didelphimorphia and Rodentia in different environments of Peruvian Amazon was studied. Didelphimorphia was represented by the family Didelphidae. Specimens belonging to Caluromys lanatus, Didelphis marsupialis, Marmosops sp.2, Metachirus nudicaudatus, Philander andersoni and Philander opossum were infested with adults I. luciae and one Micoureus sp. was infested with larvae. In Rodentia, the infestation with I. luciae nymphs was restricted to Hylaeamys perenensis, Hylaeamys yunganus and Oligoryzomys microtis, while one Oecomys bicolor (all Cricetidae was infested with larvae of this species. The few larvae were found on rodents captured in primary forest. The only significant difference (P No presente trabalho, infestações por Ixodes luciae em Didelphimorphia e Rodentia em diferentes ambientes da Amazônia peruana foram estudadas. Didelphimorphia foi representada pela família Didelphidae. Espécimes pertencentes a Caluromys lanatus, Didelphis marsupialis, Marmosops sp., Metachirus nudicaudatus, Philander andersoni e Philander opossum foram encontrados infestadas por adultos de I. luciae; um Micoureus sp. foi encontrado infestado por larvas. Em Rodentia, a infestação por ninfas de I. luciae estiveram restritas a Hylaeamys perenensis, Hylaeamys yunganus e Oligoryzomys microtis, enquanto que um Oecomys bicolor (todos Cricetidae esteve infestado por larvas de I. luciae. As poucas larvas foram encontradas em roedores capturados na floresta primária. A única diferença significante (P < 0.05 na prevalência de carrapatos adultos em Didelphimorphia foi entre P. andersoni e M. nudicaudatus (distribuição chi-quadrado. A distribuição de carrapatos adultos foi significativamente diferente em P. andersoni quando comparado com M. nudicaudatus, P. opossum e D. marsupialis (teste Kruskal-Wallis. Nenhum efeito significante do mês ou ambiente foi observado em relação à infestação por carrapato adulto em Didelphimorphia. Tanto a prevalência de infestações por ninfas, como a distribuição do carrapato indicaram que H. perenensis e H. yunganus estiveram mais propensos a estarem infestados por ninfas de I. luciae do que O. microtis. A prevalência de infestações por ninfas foi maior em florestas primária e secundária do que em áreas rurais, enquanto que a abundância foi maior em floresta secundária, quando comparada com áreas rurais (P < 0.05. O teste Kruskal-Wallis indicou diferenças (P < 0.05 para infestações por ninfas durante Dezembro, em relação a Janeiro, Março, Abril e Junho. O ciclo natural de I. luciae parece ser continuo, destacado por adultos parasitando Philander e ninfas parasitando Hylaeamys em ambientes florestais.

  18. Características biológicas de Boophilus microplus (acari: ixodidae a partir de infestação experimental em cão Biological characteristics of Boophilus microplus (acari: ixodidae on dog under experimental infestation

    Directory of Open Access Journals (Sweden)

    Marcos P. Franque

    2007-12-01

    Full Text Available Boophilus microplus (Canestrini, 1887, um parasita comum dos bovinos, tem sido observado em cães. Com objetivo de descrever características biológicas desse parasitismo, um cão foi infestado experimentalmente com 10.000 larvas de B. microplus previamente mantidas em câmara climatizada a 27 ± 1 ºC e umidade relativa superior a 80%. A média da fase parasitária foi de 24,4 ± 1,50 dias, com uma taxa de recuperação de 0,42%. Das 21 fêmeas desprendidas natural e precocemente do hospedeiro, 6 (28% ingurgitaram o suficiente (75,1 ± 30,23mg para realizar postura. O período médio de prépostura foi de 4,33 ± 1,37 dias e o período médio de postura de 9,17 ± 2,32 dias, com produção média de 18,78 ± 15,34mg de postura. O índice médio de produção de ovos observado foi de 22,38%. Estes resultados demonstraram que fêmeas de B. microplus alimentadas em cão experimentalmente infestado, completam seu ciclo biológico. A obtenção de fêmeas, capazes de realizar posturas viáveis, sugerem a possibilidade do cão atuar como hospedeiro alternativo para B. microplus, especialmente quando não há disponível outra espécie de hospedeiro preferencial.Boophilus microplus, a common parasite of cattle, has eventually reported in dogs. To describe biological features of this parasitism, one dog was experimentally infested with 10,000 larvae of B. microplus which were previously held in acclimatized camera at 27 ±1ºC and relative humidity up to 80%. The mean of parasitic phase was 24.4 ± 1.50 days, with 0.42% of recovery rate. Of 21 natural detached B. microplus females, six engorged enough (75.1 ± 30.23mg to achieve posture. The mean period of pre-posture was 4.33 ± 1.37 days and the means period of posture was 9.17 ± 2.32, producing a mean of 18.78 ± 15.34 posture weight. The mean of eggs production index observed was 22.38%. The results showed that B. microplus females fed on dogs to complete their life cycle. The females collected were able to ovoposite viable eggs suggesting that dogs can be a possible alternative hosts to B. microplus, especially when there is no other preferential host species available.

  19. Extratos de plantas no controle de Rhipicephalus (Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae em laboratório Plant extracts in control of Rhipicephalus (Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae in laboratory

    Directory of Open Access Journals (Sweden)

    Sônia Maria Forti Broglio-Micheletti

    2009-12-01

    Full Text Available Extratos vegetais foram estudados com o objetivo de avaliar suas eficiências no controle de Rhipicephalus (Boophilus microplus (Canestrini, 1887 em laboratório. Fêmeas ingurgitadas de carrapato foram coletadas de bovinos e mantidas em placas de Petri. Foram utilizados extratos orgânicos alcoólicos 2% (peso/volume de sementes de Annona muricata L. (Annonaceae (graviola; flores de Syzygium malaccensis (L. (Myrtaceae (jambo; folhas de Cymbopogon citratus (DC. Stapf (Poaceae (capim-santo; folhas de Azadirachta indica A. Juss (Meliaceae (nim; e extrato hexânico na mesma concentração de A. indica (sementes. Os grupos-controle foram compostos por fêmeas sem tratamento e fêmeas tratadas com água destilada e esterilizada e dimetilsulfóxido (DMSO a uma concentração de 1%. O extrato de A. muricata apresentou o maior poder acaricida, com eficácia de 100%, seguido dos extratos de S. malaccensis (75 e 59,24% e A. indica (65 e 38,49%. Houve 100% de redução na eclosão das larvas quando se utilizou o extrato de sementes de A. muricata.Plant extracts were studied to evaluate its efficiency in the control of Rhipicephalus (Boophilus microplus (Canestrini, 1887 in laboratory. Engorged female ticks were collected from the cattle, kept in Petri dishes. Organic alcoholic extracts 2% (weight/volume were used: seeds of Annona muricata L. (Annonaceae (soursop; flowers of Syzygium malaccensis (L. (Myrtaceae (iamb, leaves of Cymbopogon citratus (DC. Stapf (Poaceae (holy grass, leaves of Azadirachta indica A. Juss (Meliaceae (neem and hexane extract 2% (weight/volume of A. indica (seeds. The control groups consisted of untreated females and females treated with distilled water and sterile and dimethylsulfoxide (DMSO a concentration of 1%. The extract of A. muricata (seed had the highest mortality with acaricide activity and 100% efficacy followed by extracts of S. malaccensis (75 and 59.24% and A. indica (65 and 38.49%. The seed extract of A. muricata reduced 100% larvae hatch.

  20. Molecular cloning and characterization of a glycine-like receptor gene from the cattle tick Rhipicephalus (Boophilus microplus (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Flores-Fernández José Miguel

    2014-01-01

    Full Text Available The cattle tick Rhipicephalus (Boophilus microplus is the most economically important ectoparasite affecting the cattle industry in tropical and subtropical areas around the world. The principal method of tick control has relied mainly on the use of chemical acaricides, including ivermectin; however, cattle tick populations resistant to ivermectin have recently been reported in Brazil, Mexico, and Uruguay. Currently, the molecular basis for ivermectin susceptibility and resistance are not well understood in R. microplus. This prompted us to search for potential molecular targets for ivermectin. Here, we report the cloning and molecular characterization of a R. microplus glycine-like receptor (RmGlyR gene. The characterized mRNA encodes for a 464-amino acid polypeptide, which contains features common to ligand-gated ion channels, such as a large N-terminal extracellular domain, four transmembrane domains, a large intracellular loop and a short C-terminal extracellular domain. The deduced amino acid sequence showed around 30% identity to GlyRs from some invertebrate and vertebrate organisms. The polypeptide also contains the PAR motif, which is important for forming anion channels, and a conserved glycine residue at the third transmembrane domain, which is essential for high ivermectin sensitivity. PCR analyses showed that RmGlyR is expressed at egg, larval and adult developmental stages. Our findings suggest that the deduced receptor is an additional molecular target to ivermectin and it might be involved in ivermectin resistance in R. microplus.

  1. Molecular cloning and characterization of a glycine-like receptor gene from the cattle tick Rhipicephalus (Boophilus) microplus (Acari: Ixodidae)

    OpenAIRE

    Flores-Fernández José Miguel; Gutiérrez-Ortega Abel; Padilla-Camberos Eduardo; Rosario-Cruz Rodrigo; Hernández-Gutiérrez Rodolfo; Martínez-Velázquez Moisés

    2014-01-01

    The cattle tick Rhipicephalus (Boophilus) microplus is the most economically important ectoparasite affecting the cattle industry in tropical and subtropical areas around the world. The principal method of tick control has relied mainly on the use of chemical acaricides, including ivermectin; however, cattle tick populations resistant to ivermectin have recently been reported in Brazil, Mexico, and Uruguay. Currently, the molecular basis for ivermectin susceptibility and resistance are not we...

  2. Esterase profile in a pyrethroid-resistant Brazilian strain of the cattle tick Boophilus microplus (Acari, Ixodidae

    Directory of Open Access Journals (Sweden)

    Milla Alves Baffi

    2005-12-01

    Full Text Available The cattle tick Boophilus microplus causes great damage in livestock and is considered one of the most important tropical ectoparasites. The traditional method of control is based on the intensive use of pesticides, however the indiscriminate use of these compounds over the years has led to the selection of resistant ticks. Hydrolases, particularly esterases (EST, have been reported to be associated with acaricide resistance in B. microplus. We compared the esterase profile of susceptible and cypermethrin-resistant strains of adult B. microplus and a pyrethroid susceptible reference strain (the Mozzo strain using polyacrylamide gel electrophoresis and specific staining. The electrophoretic profiles of protein extracts revealed the presence of four regions with esterase activity in the cypermethrin-resistant strain and three of these regions in the susceptible strains. The bands were numbered EST-1 to EST-4 in sequence (starting from the anode according to their decrease in negative charge. The EST-1A and EST-1B enzymes were detected only in the resistant strain. The inhibition studies with eserine sulfate, copper sulfate, p- p-chloromercuribenzoate (pCMB, malathion and phenylmethylsulfonyl fluoride (PMSF indicated that the EST-1A and EST-1B enzymes belong to the acetylcholinesterase class and are probably associated with resistance to acaricides in this Brazilian resistant strain of B. microplus.

  3. In vitro acaricidal efficacy of plant extracts from Brazilian flora and isolated substances against Rhipicephalus microplus (Acari: Ixodidae).

    Science.gov (United States)

    Valente, Paula Pimentel; Amorim, Juliana Mendes; Castilho, Rachel Oliveira; Leite, Romário Cerqueira; Ribeiro, Múcio Flávio Barbosa

    2014-01-01

    The tick Rhipicephalus microplus causes significant losses in livestock cattle and has developed increasing resistance to the primary acaricides that are used to treat these infections. The objective of this study was to identify new biomolecules or isolated substances showing acaricidal activity from plants. Larval packet tests were conducted to evaluate the effects of 11 species of plants and three isolated substances (betulinic acid, eugenol, and nerolidol) on R. microplus. An adult female immersion test was performed with the substance that showed the highest larvicidal activity, which was evaluated for inhibition of reproduction. Tests using Licania tomentosa, Hymenaea stigonocarpa, Hymenaea courbaril, Stryphnodendron obovatum, Jacaranda cuspidifolia, Jacaranda ulei, Struthanthus polyrhizus, Chrysobalanus icaco, Vernonia phosphorea, Duguetia furfuracea, and Simarouba versicolor extracts as well as the isolated substance betulinic acid indicated lower acaricidal effects on R. microplus larvae. The extract displaying the best larvicidal activity was the ethanolic extract from L. tomentosa at a concentration of 60%, resulting in a mortality rate of 40.3%. However, nerolidol and eugenol showed larvicidal activity, which was highest for eugenol. Nerolidol caused a 96.5% mortality rate in the R. microplus larvae at a high concentration of 30%, and eugenol caused 100% mortality at a concentration of 0.3%. In the adult immersion test, 5% eugenol was identified as a good biomolecule for controlling R. microplus, as demonstrated by its high acaricidal activity and inhibition of oviposition. PMID:24221889

  4. Acetylcholinesterase 1 in populations of organophosphate-resistant North American strains of the cattle tick, Rhipicephalus microplus (Acari: Ixodidae).

    Science.gov (United States)

    Bendele, Kylie G; Guerrero, Felix D; Miller, Robert J; Li, Andrew Y; Barrero, Roberto A; Moolhuijzen, Paula M; Black, Michael; McCooke, John K; Meyer, Jason; Hill, Catherine A; Bellgard, Matthew I

    2015-08-01

    Rhipicephalus microplus, the cattle fever tick, is a global economic problem to the cattle industry due to direct infestation of cattle and pathogens transmitted during feeding. Cattle fever tick outbreaks continue to occur along the Mexico-US border even though the tick has been eradicated from the USA. The organophosphate (OP) coumaphos targets acetylcholinesterase (AChE) and is the approved acaricide for eradicating cattle fever tick outbreaks. There is evidence for coumaphos resistance developing in cattle ticks in Mexico, and OP-resistant R. microplus ticks were discovered in outbreak populations of Texas in 2005. The molecular basis of coumaphos resistance is not known, and our study was established to gather further information on whether AChE1 is involved in the resistance mechanism. We also sought information on allele diversity in tick populations with different levels of coumaphos resistance. The overarching project goal was to define OP resistance-associated gene mutations such that a DNA-based diagnostic assay could be developed to assist the management of resistance. Three different AChE transcripts have been reported in R. microplus, and supporting genomic and transcriptomic data are available at CattleTickBase. Here, we report the complete R. microplus AChE1 gene ascertained by sequencing a bacterial artificial chromosome clone containing the entire coding region and the flanking 5' and 3' regions. We also report AChE1 sequences of larval ticks from R. microplus strains having different sensitivities to OP. To accomplish this, we sequenced a 669-bp region of the AChE1 gene corresponding to a 223 amino acid region of exon 2 to assess alleles in seven strains of R. microplus with varying OP resistance phenotypes. We identified 72 AChE1 sequence variants, 2 of which are strongly associated with OP-resistant phenotypes. Esterase-like sequences from the R. microplus transcriptome RmiTr Version 1.0 were compared to the available sequence databases to identify other transcripts with similarity to AChE1. PMID:25952704

  5. Evaluation of Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) resistance to different acaricide formulations using samples from Brazilian properties.

    Science.gov (United States)

    Higa, Leandro de Oliveira Souza; Garcia, Marcos Valério; Barros, Jacqueline Cavalcante; Koller, Wilson Werner; Andreotti, Renato

    2016-06-01

    The Rhipicephalus (Boophilus) microplus tick is responsible for considerable economic losses in Brazil, causing leather damage, weight loss and reduced milk production in cattle and results in the transmission of pathogens. Currently, the main method for controlling this tick is using acaricides, but their indiscriminate use is one of the major causes of resistance dissemination. In this study, the adult immersion test (AIT) was used to evaluate resistance in ticks from 28 properties located in five different states (Mato Grosso do Sul, Mato Grosso, Ceará, São Paulo, e Minas Gerais) and the Distrito Federal (DF) of Brazil. The resistance was found in 47.64% of the repetitions demonstrating an efficacy of less than 90% in various locations throughout the country. The larvae packet test was used to evaluate samples from ten properties in four states (Mato Grosso do Sul, Mato Grosso, Minas Gerais and Espírito Santo). Spray products belonging to the main classes of acaricides, including combination formulations, were used in both types of test. New cases of resistance were found on properties within the states of Ceará, Espírito Santo and Mato Grosso, where such resistance was not previously reported. PMID:27334816

  6. Identification of potential plant extracts for anti-tick activity against acaricide resistant cattle ticks, Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Ghosh, Srikanta; Tiwari, Shashi Shankar; Kumar, Bhanu; Srivastava, Sharad; Sharma, Anil Kumar; Kumar, Sachin; Bandyopadhyay, A; Julliet, Sanis; Kumar, Rajesh; Rawat, A K S

    2015-05-01

    To develop an eco-friendly tick control method, seven plant extracts were prepared using 50 and 95% ethanol and evaluated for acaricidal activity against cattle tick, Rhipicephalus (Boophilus) microplus. The adult immersion test was adopted for testing different extracts. Based on 72 h screening criterion, 95% ethanolic extracts of Datura metel fruits and Argemone mexicana whole plant were found effective showing more than 50% mortality of treated ticks. The 95% ethanolic extracts of D. metel fruits and A. mexicana whole plant exhibited acaricidal and reproductive inhibitory effects on treated ticks. The LC90 values of D. metel and A. mexicana extracts were determined as 7.13 and 11.3%, respectively. However, although both the extracts were found efficacious against deltamethrin-resistant IVRI-4 and multi-acaricide resistant IVRI-5 lines of R. (B.) microplus, they caused less mortality than treated ticks of the reference IVRI-I line. Phytochemical studies indicated the presence of alkaloids and glucosides in D. metel fruits and alkaloids, terpenoids, flavonoids and phenolics in A. mexicana whole plant extracts. The results indicated that these botanicals may play an important role in reducing the use of chemicals for tick control and possibly to manage resistant tick population in environment friendly manner. PMID:25717008

  7. Molecular cloning and characterization of a glycine-like receptor gene from the cattle tick Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Flores-Fernández, José Miguel; Gutiérrez-Ortega, Abel; Padilla-Camberos, Eduardo; Rosario-Cruz, Rodrigo; Hernández-Gutiérrez, Rodolfo; Martínez-Velázquez, Moisés

    2014-01-01

    The cattle tick Rhipicephalus (Boophilus) microplus is the most economically important ectoparasite affecting the cattle industry in tropical and subtropical areas around the world. The principal method of tick control has relied mainly on the use of chemical acaricides, including ivermectin; however, cattle tick populations resistant to ivermectin have recently been reported in Brazil, Mexico, and Uruguay. Currently, the molecular basis for ivermectin susceptibility and resistance are not well understood in R. microplus. This prompted us to search for potential molecular targets for ivermectin. Here, we report the cloning and molecular characterization of a R. microplus glycine-like receptor (RmGlyR) gene. The characterized mRNA encodes for a 464-amino acid polypeptide, which contains features common to ligand-gated ion channels, such as a large N-terminal extracellular domain, four transmembrane domains, a large intracellular loop and a short C-terminal extracellular domain. The deduced amino acid sequence showed around 30% identity to GlyRs from some invertebrate and vertebrate organisms. The polypeptide also contains the PAR motif, which is important for forming anion channels, and a conserved glycine residue at the third transmembrane domain, which is essential for high ivermectin sensitivity. PCR analyses showed that RmGlyR is expressed at egg, larval and adult developmental stages. Our findings suggest that the deduced receptor is an additional molecular target to ivermectin and it might be involved in ivermectin resistance in R. microplus. PMID:25174962

  8. Prevalence of Borrelia burgdorferi (Spirochaetales: Spirochaetaceae) in Ixodes scapularis (Acari: Ixodidae) adults in New Jersey, 2000-2001.

    Science.gov (United States)

    Schulze, Terry L; Jordan, Robert A; Hung, Robert W; Puelle, Rose S; Markowski, Daniel; Chomsky, Martin S

    2003-07-01

    Using polymerase chain reaction, we analyzed 529 Ixodes scapularis Say adults collected from 16 of New Jersey's 21 counties for the presence of Borrelia burgdorferi, the etiological agent of Lyme disease. Overall, 261 (49.3%) were positive. B. burgdorferi was detected in ticks obtained from each county and from 53 of the 58 (93.1%) municipalities surveyed. The observed statewide prevalence in New Jersey is similar to those reported from other northeastern and mid-Atlantic states. PMID:14680126

  9. Evaluation of the vectorial capacity of Rhipicephalus sanguineus (Acari: Ixodidae) in the transmission of canine visceral leishmaniasis.

    Science.gov (United States)

    Paz, Gustavo Fontes; Ribeiro, Múcio Flávio Barbosa; Michalsky, Erika Monteiro; da Rocha Lima, Ana Cristina Vianna Mariano; França-Silva, João Carlos; Barata, Ricardo Andrade; Fortes-Dias, Consuelo Latorre; Dias, Edelberto Santos

    2010-01-01

    The vectorial capacity of Rhipicephalus sanguineus in the transmission of canine visceral leishmaniasis has been evaluated through a laboratory-controlled experiment. One healthy Leishmania-free dog and two dogs naturally infected with Leishmania were infested with R. sanguineus in various stages of development. Engorged larvae, unfed nymphs, engorged nymphs, unfed adults, engorged female adults and fed male adults were collected from the experimental animals and examined for Leishmania infection by optical microscopy, polymerase chain reaction (PCR) and parasite culture. Leishmania forms were not detected in any of the 433 smears prepared from engorged colonies nor in any of the 118 smears prepared from unfed colonies. However, one flagellate structure was identified in one of the smears. All pools of R. sanguineus that had fed on the infected dogs tested PCR-positive for Leishmania DNA, with the single exception of the pool of engorged larvae. In contrast, all pools of ticks that had fed on the Leishmania-free dog were PCR-negative. Leishmania growth was not observed in any of the tick colonies following incubation on culture medium. Considering that no Leishmania forms were identified in any of the meticulously analysed smears derived from engorged colonies of R. sanguineus, it appears somewhat unlikely that the maintenance and multiplication of Leishmania occurs within the tick.

  10. Chemical composition and repellency of essential oils from four medicinal plants against Ixodes ricinus nymphs (Acari: Ixodidae).

    Science.gov (United States)

    El-Seedi, Hesham R; Khalil, Nasr S; Azeem, Muhammad; Taher, Eman A; Göransson, Ulf; Pålsson, Katinka; Borg-Karlson, Anna-Karin

    2012-09-01

    In our search for effective tick repellents from plant origin, we investigated the effect of essential oils of four medicinal and culinary plants belonging to the family Lamiaceae on nymphs of the tick Ixodes ricinus (L.). The essential oils of the dry leaves of Rosmarinus officinalis (Rosemary) (L.), Mentha spicata (Spearmint) (L.), Origanum majorana (Majoram) (L.), and Ocimum basilicum (Basil) (L.) were isolated by steam distillation and 15 microg/cm2 concentration of oils was tested against ticks in a laboratory bioassay. The oils of R. officinalis, M. spicata, and O. majorana showed strong repellency against the ticks 100, 93.2, and 84.3%, respectively, whereas O. basilicum only showed 64.5% repellency. When tested in the field, the oils of R. officinalis and M. spicata showed 68.3 and 59.4% repellency at a concentration of 6.5 microg/cm2 on the test cloths. The oils were analyzed by gas chromatography mass spectrometry and the major compounds from the most repellent oils were 1,8-cineole, camphor, linalool, 4-terpineol, borneol, and carvone. PMID:23025188

  11. Partial characterization of a novel anti-inflammatory protein from salivary gland extract of Hyalomma anatolicum anatolicum (Acari: Ixodidae ticks

    Directory of Open Access Journals (Sweden)

    Mayukh Ghosh

    2015-06-01

    Full Text Available Aim: Hyalomma anatolicum anatolicum ticks transmit Theileria annulata, causative agent of tropical theileriosis to cattle and buffaloes causing a major economic loss in terms of production and mortality in tropical countries. Ticks have evolved several immune evading strategies to circumvent hosts’ rejection and achieve engorgement. Successful feeding of ticks relies on a pharmacy of chemicals located in their complex salivary glands and secreted saliva. These chemicals in saliva could inhibit host inflammatory responses through modulating cytokine secretion and detoxifying reactive oxygen species. Therefore, the present study was aimed to characterize anti-inflammatory peptides from salivary gland extract (SGE of H. a. anatolicum ticks with a view that this information could be utilized in raising vaccines, designing synthetic peptides or peptidomimetics which can further be developed as novel therapeutics. Materials and Methods: Salivary glands were dissected out from partially fed adult female H. a. anatolicum ticks and homogenized under the ice to prepare SGE. Gel filtration chromatography was performed using Sephadex G-50 column to fractionate the crude extract. Protein was estimated in each fraction and analyzed for identification of anti-inflammatory activity. Sodium dodecyl sulfate - polyacrylamide gel electrophoresis (SDS-PAGE was run for further characterization of protein in desired fractions. Results: A novel 28 kDa protein was identified in H. a. anatolicum SGE with pronounced anti-inflammatory activity. Conclusion: Purification and partial characterization of H. a. anatolicum SGE by size-exclusion chromatography and SDSPAGE depicted a 28 kDa protein with prominent anti-inflammatory activity.

  12. Morphological alterations in salivary glands of Rhipicephalus sanguineus ticks (Acari: Ixodidae) exposed to neem seed oil with known azadirachtin concentration.

    Science.gov (United States)

    Remedio, R N; Nunes, P H; Anholeto, L A; Oliveira, P R; Sá, I C G; Camargo-Mathias, M I

    2016-04-01

    Neem (Azadirachta indica) has attracted the attention of researchers worldwide due to its repellent properties and recognized effects on the morphology and physiology of arthropods, including ticks. Therefore, this study aimed to demonstrate the effects of neem seed oil enriched with azadirachtin on salivary glands of Rhipicephalus sanguineus ticks, targets of great veterinary interest because of their ability to transmit pathogens to dogs. For this, R. sanguineus semi-engorged females were subjected to treatment with neem seed oil, with known azadirachtin concentrations (200, 400 and 600ppm). After dissection, salivary glands were collected and evaluated through morphological techniques in light microscopy, confocal scanning laser microscopy and transmission electron microscopy, so that the possible relation between neem action and further impairment in these ectoparasites feed performance could be established. Neem oil demonstrated a clear dose-dependent effect in the analyzed samples. The agranular (type I) and granular acini (types II and III) showed, particularly in individuals treated with the highest concentrations of the product, cells with irregular shape, intense cytoplasmic disorganization and vacuolation, dilation of rough endoplasmic reticulum lumen, besides alterations in mitochondrial intermembrane space. These morphological damages may indicate modifications in salivary glands physiology, demonstrating the harmful effects of compounds present in neem oil on ticks. These results reinforce the potential of neem as an alternative method for controlling R. sanguineus ticks, instead of synthetic acaricides. PMID:26852009

  13. First survey of hard ticks (Acari:Ixodidae) on cattle, sheep and goats in Boeen Zahra and Takistan counties, Iran

    Institute of Scientific and Technical Information of China (English)

    Masoomeh Shemshad; Khadijeh Shemshad; Mohammad Mehdi Sedaghat; Majid Shokri; Alireza Barmaki; Mojgan Baniardalani; Javad Rafinejad

    2012-01-01

    Objective: To carry out the distribution survey of hard ticks of livestock in Boeen Zahra and Takistan counties of Qazvin province from April 2010 to September 2010. Methods:Nearly about 2 638 sheep, 461 goats and 318 cattle of 38 herds in different geographical areas were searched for tick infestation. Results:The species compositions collected from the livestock of Boeen Zahra and Takistan were Haemaphysalis concinna (0.63%), Haemaphysalis sulcata (12.66%), Hyalomma anatolicum (3.80%), Hyalomma asiaticum (3.16%), Hyalomma detritum (5.70%), Hyalomma dromedarii (28.48%), Hyalomma marginatum (13.29%), Hyalomma schulzei (1.89%), Rhipicephalus bursa (3.16%) and Rhipicephalus sanguineus (3.16%), and for Takistan’s livestock were Hyalomma dromedarii (9.86%), Hyalomma marginatum (13.29%), Hyalomma schulzei (1.89%) and Rhipicephalus sanguineus (3.16%), respectively. Hard ticks compositions in different topographic areas were different. Hyalomma species had the most prevalence in the areas. Conclusions:The veterinary and public health investigation of the above species should be taken.

  14. Prevalence of Borrelia burgdorferi (Spirochaetales: Spirochaetaceae) in Ixodes scapularis (Acari: Ixodidae) adults in New Jersey, 2000-2001.

    Science.gov (United States)

    Schulze, Terry L; Jordan, Robert A; Hung, Robert W; Puelle, Rose S; Markowski, Daniel; Chomsky, Martin S

    2003-07-01

    Using polymerase chain reaction, we analyzed 529 Ixodes scapularis Say adults collected from 16 of New Jersey's 21 counties for the presence of Borrelia burgdorferi, the etiological agent of Lyme disease. Overall, 261 (49.3%) were positive. B. burgdorferi was detected in ticks obtained from each county and from 53 of the 58 (93.1%) municipalities surveyed. The observed statewide prevalence in New Jersey is similar to those reported from other northeastern and mid-Atlantic states.

  15. Evaluation of Rhipicephalus (Boophilus microplus (Acari: Ixodidae resistance to different acaricide formulations using samples from Brazilian properties

    Directory of Open Access Journals (Sweden)

    Leandro de Oliveira Souza Higa

    2016-01-01

    Full Text Available Abstract The Rhipicephalus (Boophilus microplus tick is responsible for considerable economic losses in Brazil, causing leather damage, weight loss and reduced milk production in cattle and results in the transmission of pathogens. Currently, the main method for controlling this tick is using acaricides, but their indiscriminate use is one of the major causes of resistance dissemination. In this study, the adult immersion test (AIT was used to evaluate resistance in ticks from 28 properties located in five different states (Mato Grosso do Sul, Mato Grosso, Ceará, São Paulo, e Minas Gerais and the Distrito Federal (DF of Brazil. The resistance was found in 47.64% of the repetitions demonstrating an efficacy of less than 90% in various locations throughout the country. The larvae packet test was used to evaluate samples from ten properties in four states (Mato Grosso do Sul, Mato Grosso, Minas Gerais and Espírito Santo. Spray products belonging to the main classes of acaricides, including combination formulations, were used in both types of test. New cases of resistance were found on properties within the states of Ceará, Espírito Santo and Mato Grosso, where such resistance was not previously reported.

  16. County-Scale Distribution of Ixodes scapularis and Ixodes pacificus (Acari: Ixodidae) in the Continental United States.

    Science.gov (United States)

    Eisen, Rebecca J; Eisen, Lars; Beard, Charles B

    2016-03-01

    The blacklegged tick, Ixodes scapularis Say, is the primary vector to humans in the eastern United States of the Lyme disease spirochete Borrelia burgdorferi, as well as causative agents of anaplasmosis and babesiosis. Its close relative in the far western United States, the western blacklegged tick Ixodes pacificus Cooley and Kohls, is the primary vector to humans in that region of the Lyme disease and anaplasmosis agents. Since 1991, when standardized surveillance and reporting began, Lyme disease case counts have increased steadily in number and in geographical distribution in the eastern United States. Similar trends have been observed for anaplasmosis and babesiosis. To better understand the changing landscape of risk of human exposure to disease agents transmitted by I. scapularis and I. pacificus, and to document changes in their recorded distribution over the past two decades, we updated the distribution of these species from a map published in 1998. The presence of I. scapularis has now been documented from 1,420 (45.7%) of the 3,110 continental United States counties, as compared with 111 (3.6%) counties for I. pacificus. Combined, these vectors of B. burgdorferi and other disease agents now have been identified in a total of 1,531 (49.2%) counties spread across 43 states. This marks a 44.7% increase in the number of counties that have recorded the presence of these ticks since the previous map was presented in 1998, when 1,058 counties in 41 states reported the ticks to be present. Notably, the number of counties in which I. scapularis is considered established (six or more individuals or one or more life stages identified in a single year) has more than doubled since the previous national distribution map was published nearly two decades ago. The majority of county status changes occurred in the North-Central and Northeastern states, whereas the distribution in the South remained fairly stable. Two previously distinct foci for I. scapularis in the Northeast and North-Central states appear to be merging in the Ohio River Valley to form a single contiguous focus. Here we document a shifting landscape of risk for human exposure to medically important ticks and point to areas of re-emergence where enhanced vector surveillance and control may be warranted.

  17. The in vitro efficacy of deltamethrin and alpha-cypermethrin against engorged female Haemaphysalis qinghaiensis ticks (Acari: Ixodidae).

    Science.gov (United States)

    Ma, Miling; Guan, Guiquan; Liu, Qing; Dang, Zhisheng; Liu, Aihong; Ren, Qiaoyun; Liu, Zhijie; Li, Youquan; Chen, Ze; Liu, Junlong; Yang, Jifei; Yin, Hong; Luo, Jianxun

    2013-08-01

    Currently, the most efficient and widely used method for tick control is the application of acaricides, especially deltamethrin and alpha-cypermethrin, two pyrethroids with neurotoxic action. In this study, the in vitro efficacy of deltamethrin and alpha-cypermethrin was assessed on engorged female Haemaphysalis qinghaiensis ticks. An in vitro bioassay (adult immersion test) was carried out to determine the LC (lethal concentration) 50 and LC90 of both compounds, calculated by probit analysis. The LC50 and LC90 values of deltamethrin and alpha-cypermethrin were 5.67 (LC50) and 51.72ppm (LC90), and 166.56 (LC50) and 1366.69ppm (LC90), respectively. This study provides important information on the efficacy of deltamethrin and alpha-cypermethrin for the control of H. qinghaiensis.

  18. Efficacy and environmental persistence of nootkatone for the control of the blacklegged tick (Acari: Ixodidae) in residential landscapes.

    Science.gov (United States)

    Bharadwaj, Anuja; Stafford, Kirby C; Behle, Robert W

    2012-09-01

    The ability of the plant-derived compound nootkatone to control nymphs of the blacklegged tick, Ixodes scapularis Say, was evaluated at lawn perimeter plots at homes in Lyme disease endemic areas of Connecticut. Three formulations of nootkatone ranging from 0.05 to 0.84% (0.06 - 1.03 g AI/m2) were applied by a hydraulic sprayer from 2008 to 2010. In 2008, the 0.84% emulsifiable nootkatone formulation provided 100% control of I. scapularis through week 1, but declined to 49 and 0% by 2 and 3 wk posttreatment, respectively. A combination of 0.05% nootkatone and entomopathogenic fungus, Metarhizium brunneum Petch F52, resulted in 50% control for the first week posttreatment and no control in subsequent weeks. The 0.84% emulsifiable nootkatone formulation was phytotoxic, although no damage was observed with the 0.05% formulation with Metarhizium. Residual analysis of nootkatone collected on filter paper disks showed that > or = 95% of the emulsified nootkatone for both formulations was lost within 7 d after application. A lignin-encapsulated nootkatone formulation (0.56 and 0.46% in 2009 and 2010, respectively) provided 100% control of I. scapularis for 8 wk in 2009 and, in 2010, 67% control at approximately 1 wk posttreatment with respect to the pretreatment counts, although there was no difference in tick abundance posttreatment. A 0.60% Maillard-reaction encapsulated nootkatone formulation in 2010 provided a similar level of control (62%). Nootkatone in the lignin and Maillard formulations were more persistent than the emulsifiable formulation. Little or no phytotoxicity was observed with the encapsulated formulations. Encapsulating nootkatone reduced phytotoxicity and appeared to reduce environmental loss. While nootkatone can provide effective tick control, further work is needed to refine formulations to address phytotoxicity, yet provide sufficient material to control ticks. PMID:23025184

  19. Acaricidal activity of the organic extracts of thirteen South African plants against Rhipicephalus (Boophilus) decoloratus (Acari: Ixodidae).

    Science.gov (United States)

    Fouche, Gerda; Ramafuthula, Mary; Maselela, Vusi; Mokoena, Moses; Senabe, Jeremiah; Leboho, Tlabo; Sakong, Bellonah M; Adenubi, Olubukola T; Eloff, Jacobus N; Wellington, Kevin W

    2016-07-15

    The African blue tick, Rhipicephalus (Boophilus) decoloratus, is a common tick species found in South Africa and affects cattle production as well as vectoring pathogens in regions of Africa and Asia. In an attempt to develop a non-toxic, lower cost and environmentally friendly tick control method, twenty-six plant extracts were prepared from thirteen plant species using 99.5% acetone and 99% ethanol. The adapted Shaw Larval Immersion Test (SLIT) was used to test the efficacy of the extracts. A 1% solution of each of the plant extracts was prepared for efficacy testing and the ethanol extracts were found to have better acaricidal activity than the acetone extracts. The ethanol extract from the leaves and flowers of Calpurnia aurea had the best activity [corrected mortality (CM)=82.9%] which was followed by the stem extract of Cissus quadrangularis (CM=80.4%). The plant species were screened against Vero cells and were found to have low toxicity. From this study it is apparent that there is potential for the development of botanicals as natural acaricides against R. (B.) decoloratus. PMID:27270388

  20. Chemical composition and efficacy of dichloromethane extract of Croton sphaerogynus Baill. (Euphorbiaceae) against the cattle tick Rhipicephalus microplus (Acari: Ixodidae).

    Science.gov (United States)

    Righi, Adne A; Motta, Lucimar B; Klafke, Guilherme M; Pohl, Paula C; Furlan, Cláudia M; Santos, Deborah Y A C; Salatino, Maria L F; Negri, Giuseppina; Labruna, Marcelo B; Salatino, Antonio

    2013-02-18

    The cattle tick Rhipicephalus microplus is widely distributed in tropical and subtropical regions, causing high economic impact on cattle production. The control of tick infestations is regarded worldwide as critical and has been based on the use of organophosphates, synthetic pyretroids, amitraz and recently ivermectin and fipronil. The present study reports the analysis by gas chromatography/mass spectrometry of the constituents of leaf extracts of Croton sphaerogynus and results of acaricidal activity against the cattle tick R. microplus. The larval package test using the serial dilutions 0.625%, 1.25%, 2.5%, 5.0%, 10.0% and 20.0% (v/v) gave mortality rates 2.25%, 8.26%, 8.81%, 24.80%, 83.66% and 99.32%, respectively. Relevant constituents identified were abietanes, podocarpenes and clerodane type furano diterpenes. The present work may represent a possibility of attainment of natural substances useful for the control of R. microplus.

  1. Toxicity of Piper aduncum L. (Piperales: Piperaceae) from the Amazon forest for the cattle tick Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    Science.gov (United States)

    Silva, Wilson Castro; Martins, João Ricardo de Souza; de Souza, Hellen Emília Menezes; Heinzen, Horacio; Cesio, Maria Verônica; Mato, Mauricio; Albrecht, Francine; de Azevedo, João Lúcio; de Barros, Neiva Monteiro

    2009-10-14

    The mortality of 14-21-day-old Rhipicephalus (Boophilus) microplus larvae, and the mortality and fertility of groups of engorged adult females exposed to different concentrations of hexane, ethyl acetate and ethanol extracts of spiked pepper (Piper aduncum) were evaluated, using a completely randomized design with five treatment groups, two control groups, and two replicates for the larvae and five replicates for the adult females. Similar methodology was used to investigate the toxicity of the essential oil hydro-distillate (94.84% dillapiole) obtained from the P. aduncum crude hexane extract. The LC(50) of the hexane extract was 9.30 mg ml(-1) for larvae and the reproduction reduction ranged from 12.48% to 54.22%, while 0.1mg/ml(-1) of the essential oil induced 100% mortality in larvae. Literature reports on natural products active against R. microplus were listed and compared with the results presented here. These results indicate that P. aduncum extracts, and particularly its essential oil, are potential alternative control agents for R. microplus. PMID:19573994

  2. Oviposition capacity and egg mass to fecundity weight ratios in laboratory cultured amblyoma variegatum fabricius, 1794 (Acari: Ixodida

    Directory of Open Access Journals (Sweden)

    E. Nkegbe

    2014-02-01

    Full Text Available We studied the reproductive characteristics of femaleAmblyoma variegatum in the laboratory. These included variations in engorgedweight, percentage body mass due to eggs, and quantity of eggs an engorgedfemale could lay. The results showed that different volumes of blood mealswould be consumed by the same progeny of Am. variegatum female ticks leading todifferent engorged weights. The study revealed that in Am. variegatum egg masscould account for as high as 51% of the engorged body weight. The female tickcould also oviposit as high as 31,487 eggs and also as low as 2421 eggs in samestudy cohorts. The study also showed that the actual engorged weight might notreflect the actual ovipositing capacity of the tick. Only the weight of the eggmass laid determined the actual quantity of eggs.

  3. Description of a new tick species, Ixodes collaris n. sp. (Acari: Ixodidae), from bats (Chiroptera: Hipposideridae, Rhinolophidae) in Vietnam

    OpenAIRE

    Hornok, Sándor; Görföl, Tamás; Estók, Péter; Tu, Vuong Tan; Kontschán, Jenő

    2016-01-01

    Background In a recent study on ixodid bat ticks from Eurasia, a high genetic difference was found between Ixodes vespertilionis from Europe and Vietnam. Accordingly, it was proposed that I. vespertilionis is a species complex, with at least one additional, hitherto undescribed species. The aim of the present study was to investigate the morphology of bat ticks from Vietnam and to assess their taxonomic status in comparison with those collected in Europe. Findings Ixodid bat ticks (two female...

  4. Detection of Borrelia burgdorferi sensu lato and spotted fever group rickettsiae in hard ticks (Acari, Ixodidae) parasitizing bats in Poland.

    Science.gov (United States)

    Piksa, Krzysztof; Stańczak, Joanna; Biernat, Beata; Górz, Andrzej; Nowak-Chmura, Magdalena; Siuda, Krzysztof

    2016-04-01

    A total of 491 Ixodes vespertilionis and 8 Ixodes ricinus collected from bats and cave walls in southern Poland between 2010 and 2012 were examined by the polymerase chain reaction for tick-transmitted pathogens. PCR analysis for Borrelia burgdorferi s.l., Rickettsia spp., and Anaplasma phagocytophilum yielded negative results for all I. vespertilionis. DNA of Rickettsia helvetica was detected in three specimens of I. ricinus attached to Rhinolophus hipposideros or Myotis myotis, while Borrelia garinii was found in one tick parasitizing Myotis daubentonii. These pathogens were recorded for the first time in hard ticks that parasitized bats. PMID:26833325

  5. Detection of Borrelia burgdorferi sensu lato and spotted fever group rickettsiae in hard ticks (Acari, Ixodidae) parasitizing bats in Poland

    OpenAIRE

    Piksa, Krzysztof; Stańczak, Joanna; Biernat, Beata; Górz, Andrzej; Nowak-Chmura, Magdalena; Siuda, Krzysztof

    2016-01-01

    A total of 491 Ixodes vespertilionis and 8 Ixodes ricinus collected from bats and cave walls in southern Poland between 2010 and 2012 were examined by the polymerase chain reaction for tick-transmitted pathogens. PCR analysis for Borrelia burgdorferi s.l., Rickettsia spp., and Anaplasma phagocytophilum yielded negative results for all I. vespertilionis. DNA of Rickettsia helvetica was detected in three specimens of I. ricinus attached to Rhinolophus hipposideros or Myotis myotis, while Borrel...

  6. Effects of andiroba (Carapa guianensis) oil in ticks: Ultrastructural analysis of the synganglion of Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae).

    Science.gov (United States)

    Roma, Gislaine Cristina; Camargo-Mathias, Maria Izabel; Nunes, Pablo Henrique; Remédio, Rafael Neodini; de Faria, Adriano Uemura; Bechara, Gervásio Henrique

    2015-01-01

    The present study performed an analysis of the ultrastructural changes induced by andiroba seed oil in the synganglion of Rhipicephalus sanguineus female ticks, aiming to provide scientific grounds to help in the creation of more specific and efficient methods of control. The synganglion consists of a mass of fused nerves externally covered by the neural lamella, a uniform and acellular layer. Just below, the perineurium is found, formed by glial cells. Internally, the synganglion is subdivided into an outer cortical region (cortex), which contains the cellular bodies of the neural cells and an inner region, the neuropile, formed by a set of nerve fibers (extensions of the neural cells). The results showed that the synganglion of females exposed to andiroba oil showed structural changes, such as: irregular and apparently thinner neural lamella, perineurium glial cells presenting large cytoplasmic vacuoles, decrease in the extensions of glial cells, separation of cortex cells, which were formerly attached through their membranes, neural cells presenting irregular plasma membranes and cytoplasm with autophagic vacuoles and mitochondria with disorganized cristae and in process of degeneration. This study confirmed the neurotoxic action of the andiroba oil, which would probably be able to impair the neural functions. Thus, it is suggested that this product has the potential to be used as an alternative method to control ticks. PMID:25261600

  7. Morphological alterations in salivary glands of Rhipicephalus sanguineus ticks (Acari: Ixodidae) exposed to neem seed oil with known azadirachtin concentration.

    Science.gov (United States)

    Remedio, R N; Nunes, P H; Anholeto, L A; Oliveira, P R; Sá, I C G; Camargo-Mathias, M I

    2016-04-01

    Neem (Azadirachta indica) has attracted the attention of researchers worldwide due to its repellent properties and recognized effects on the morphology and physiology of arthropods, including ticks. Therefore, this study aimed to demonstrate the effects of neem seed oil enriched with azadirachtin on salivary glands of Rhipicephalus sanguineus ticks, targets of great veterinary interest because of their ability to transmit pathogens to dogs. For this, R. sanguineus semi-engorged females were subjected to treatment with neem seed oil, with known azadirachtin concentrations (200, 400 and 600ppm). After dissection, salivary glands were collected and evaluated through morphological techniques in light microscopy, confocal scanning laser microscopy and transmission electron microscopy, so that the possible relation between neem action and further impairment in these ectoparasites feed performance could be established. Neem oil demonstrated a clear dose-dependent effect in the analyzed samples. The agranular (type I) and granular acini (types II and III) showed, particularly in individuals treated with the highest concentrations of the product, cells with irregular shape, intense cytoplasmic disorganization and vacuolation, dilation of rough endoplasmic reticulum lumen, besides alterations in mitochondrial intermembrane space. These morphological damages may indicate modifications in salivary glands physiology, demonstrating the harmful effects of compounds present in neem oil on ticks. These results reinforce the potential of neem as an alternative method for controlling R. sanguineus ticks, instead of synthetic acaricides.

  8. Intra-aural ticks (Acari:Metastigmata:Ixodidae)from hu-man otoacariasis cases in Pahang,Malaysia

    Institute of Scientific and Technical Information of China (English)

    Mariana A; Srinovianti N; Ho TM; Halimaton I; Hatikah A; Shaharudin MH; Rosmaliza I; Wan Ishlah L; Sathananthar KS

    2008-01-01

    Ticks were extracted from ear canal of 318 cases in Hospital Tengku Ampuan Afzan,Kuantan,Pahang over a 5-year period (January 2002 to December 2006).A total of 329 ticks were recorded and a majority belonged to the genus Dermacentor (99.7%).The genus was represented by Dermacentor atrosignatus,Dermacentor compactus and Dermacentor steini.A single tick of the genus Haemaphysalis was found.All active stages (lar-vae,nymphs and adults)were present.The nymphal stages were most frequently encountered (82.4%).U-sually,there was only one tick per case.However,there were 7 cases where 2 or 3 ticks were extracted from a single ear canal.Throughout the study,there were 6 repeat cases.Average body engorgement indices for de-tached larvae,nymph,male and female ticks were 1.04,1.24,1.32 and 1.31,respectively.Based on these indices,duration of attachment was then predicted.Attachment for most nymphal (99.6%)and all adult ticks were less than 24 hours.Only 1 nymphal tick attached for a 60 hours'duration.Ticks were commonly found in the bony part of ear auditory canal (47.3%),followed by tympanic membrane (29.1%)and cartilage part of ear auditory canal (22.0%);a small percent was attached to the pinna (1.6 %).All ticks were alive before extraction.However,most attached ticks were found dead (71.7%)after extraction.Majority of the ticks were intact (90.3%)while others were either in a bad condition (3.6%)or broken (6.1%).Those alive were either unfed or at early stage of feeding.Generally,removal of ticks did not result in any complication (61.4%)to the cases.The most common complication was bleeding (27.6%),followed by haematoma of external auditory canal (5.5%),haematoma of tympanic membrane (3.1%)and perforated tympanic mem-brane (1.6%).Bleeding was a common complication at the site of skin abrasion due to the strong grip of ticks'mouthparts that were deeply embedded into the skin of cases.In this study,32.5% of removal ticks had rem-nants of case tissues attached to the ticks'mouthparts.

  9. Morphology of the midgut of Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae) adult ticks in different feeding stages.

    Science.gov (United States)

    Remedio, R N; Sampieri, B R; Vendramini, M C R; Souza, N M; Anholeto, L A; Denardo, T A G B; Camargo-Mathias, M I

    2013-01-01

    The intestinal epithelial cells of ticks are fundamental for their full feeding and reproductive success, besides being considered important sites for the development of pathogens. Rhipicephalus sanguineus ticks are known for their great medical and veterinary importance, and for this reason, the knowledge of their intestinal morphology may provide relevant subsidies for the control of these animals, either by direct acaricidal action over these cells or by the production of vaccines. Therefore, this study aimed to describe the midgut morphology of male and female R. sanguineus ticks in different feeding stages, by means of histological analysis. Significant differences were observed between the genders, and such alterations may refer mainly to the distinct demands for nutrients, much higher in females, which need to develop and carry out the egg-laying process. In general, the midgut is coated by a thin muscle layer and presents a pseudostratified epithelium, in which two basic types of cells can be observed, connected to a basal membrane-generative or stem and digestive cells. The latter was classified as follows: residual, deriving from the phase anterior to ecdysis; pinocytic, with vesicles containing liquid or pre-digested components of blood; phagocytic, with entire cells or remnants of nuclear material inside cytoplasmic vesicles; and mature, free in the lumen. Digestion is presumably intracellular and asynchronous and corresponds to a process which starts with the differentiation of generative cells into pinocytic digestive cells, which subsequently start to phagocytize intact blood cells and finally detach from the epithelium, being eliminated with feces.

  10. Life cycle of the taiga tick Ixodes persulcatus (Acari: Ixodidae) in the North-West of Russia.

    Science.gov (United States)

    Grigoryeva, L A; Stanyukovich, M K

    2016-07-01

    The life cycle of Ixodes persulcatus lasts 3 years in the conditions of the Leningrad province (North-West Russia), the development of each phase taking a year. The normal age of the taiga tick is 3 years. The calendar age of larvae and nymphs reaches 11-12 months under favorable abiotic and biotic factors, while the calendar age of adults does not exceed 11 months. At the preimaginal phases of development the ticks that breed in August can feed before or after winter. However, their metamorphosis begins and reaches completion within the same timeframes (from late June to early August) and lasts for about 30-50 (60) days. The survival rate of hungry and engorged larvae and nymphs after wintering is quite high (88.6-100 %). We explain the low activity of larvae and nymphs in late summer and autumn by incomplete development. Morphogenetic diapause of engorged larvae and nymphs interrupts digestion but not metamorphosis which starts only in late June and July after the complete absorption of blood from the gut cavity. PMID:26979586

  11. Two novel non-cationic defensin-like antimicrobial peptides from haemolymph of the female tick, Amblyomma hebraeum.

    Science.gov (United States)

    Lai, Ren; Lomas, Lee O; Jonczy, Jan; Turner, Philip C; Rees, Huw H

    2004-01-01

    Two non-cationic defensin-like antimicrobial peptides, named Amblyomma defensin peptide 1 and Amblyomma defensin peptide 2, were identified from the hard tick, Amblyomma hebraeum, by a combination of suppression subtractive hybridization for differentially expressed genes and proteomics. cDNA clones encoding each of these two defensin-like antimicrobial peptides were isolated from the differentially expressed cDNA library of the tick synganglia (central nervous system). The preproproteins deduced from the cDNA sequences each have 92 amino acid residues. Amblyomma defensin peptide 2 was purified from the haemolymph of fed female ticks. The purified peptide displayed antibacterial activity against Gram-negative and Gram-positive bacteria. Amblyomma defensin peptide 1 was further identified by protein chip capture combined with SELDI-TOF (surface-enhanced laser desorption/ionization-time-of-flight) MS. By screening for differentially expressed proteins, it was found that the expression of Amblyomma defensin peptide 1 was upregulated during 4 days post-feeding. Our findings firstly provide two defensin-like antimicrobial peptides that are particularly novel in being anionic, together with corresponding cDNA sequences, in hard ticks, and prove that the combination of suppression subtractive hybridization and protein profiling is a powerful method to study differentially expressed proteins, especially for organisms without available genome sequence information. PMID:14705963

  12. Infection of Amblyomma ovale by Rickettsia sp. strain Atlantic rainforest, Colombia.

    Science.gov (United States)

    Londoño, Andrés F; Díaz, Francisco J; Valbuena, Gustavo; Gazi, Michal; Labruna, Marcelo B; Hidalgo, Marylin; Mattar, Salim; Contreras, Verónica; Rodas, Juan D

    2014-10-01

    Our goal was to understand rickettsial spotted fevers' circulation in areas of previous outbreaks reported from 2006 to 2008 in Colombia. We herein present molecular identification and isolation of Rickettsia sp. Atlantic rainforest strain from Amblyomma ovale ticks, a strain shown to be pathogenic to humans. Infected ticks were found on dogs and a rodent in Antioquia and Córdoba Provinces. This is the first report of this rickettsia outside Brazil, which expands its known range considerably.

  13. Occurrence of Amblyomma longirostre in Ramphastos dicolorus in Southern Brazil Ocorrência de Amblyomma longirostre em Ramphastos dicolorus no Sul do Brasil

    Directory of Open Access Journals (Sweden)

    João Fabio Soares

    2009-06-01

    Full Text Available The species Amblyomma longirostre Koch, 1844 is poorly known in the state of Rio Grande do Sul. Usually the adult stage could be found on Sphigurus spp. and the immatures on birds (Passeriformes. Although A. longirostre is distributed in the Neotropical region, from Panama to Uruguay, it also occurs in Central America and the United States. The aim of this study was to report that Ramphastos dicolorus Linnaeus 1766 is a new host record for this tick species.A espécie Amblyomma longirostre Koch, 1844 é pouco conhecida no Estado do Rio Grande do Sul. Normalmente a fase adulta pode ser encontrada em porquinhos Sphigurus spp., e as fases imaturas podem ser encontradas em aves (Passeriformes. A. longirostre distribui-se na região neotropical, do Panamá ao Uruguai. Ela também ocorre na América Central e nos Estados Unidos. Este estudo tem como objetivo relatar que Ramphastos dicolorus Linnaeus 1766 é um novo hospedeiro dessa espécie de carrapato.

  14. An overview on Sardinia's soft ticks (Ixodida: Argasidae).

    Science.gov (United States)

    Fois, Francesco; Culurgioni, Jacopo; Cappai, Stefano; Mereu Piras, Pierpaola; Toma, Luciano; Rolesu, Sandro; Liciardi, Manuele

    2016-06-01

    Knowledge about soft ticks (Ixodida: Argasidae) in Sardinia is incomplete and distribution data need to be updated. This work studies soft ticks on the island focusing on two species, Argas reflexus and Ornithodoros maritimus, both recently recorded. A total number of 12 specimens of these species of interest were collected between 2004 and 2015. This study reports for the first time the presence of O. maritimus in a coastal area in Italy, and more generally in a coastal area rather than small islands near the coastline, confirming the presence of this species on the island 20 years after its last recording. Moreover we confirm the presence of A. reflexus on the island, in the town of Cagliari and, for the first time, in the town of Quartu Sant'Elena. At the present state of knowledge, in Sardinia, Ornithodoros erraticus, which was actively looked for within the surveillance for African swine fever, an endemic disease since 1978 on the island, is not present. The presence of another species reported only once in Sardinia, Argas vespertilionis, needs further confirmation. PMID:26940844

  15. Rickettsia bellii in Amblyomma rotundatum ticks parasitizing Rhinella jimi from northeastern Brazil.

    Science.gov (United States)

    Horta, Mauricio C; Saraiva, Danilo G; Oliveira, Glauber M B; Martins, Thiago F; Labruna, Marcelo B

    2015-01-01

    This study evaluated rickettsial infection in Amblyomma rotundatum ticks collected from toads (Rhinella jimi) in the Brazilian Caatinga biome, an unique semiarid region of South America. Tick infestations were observed in 57.8% toads (26/45); mean infestation: 1.6 ticks/toad. DNA extraction from 42 ticks (6 larvae, 22 nymphs and 11 female adults) was tested by polymerase chain reaction (PCR) targeting Rickettsia organisms, which were detected in 100% of the ticks. Amplicons' DNA sequences were identical to each other and 99% identical to Rickettsia bellii from GenBank. DNA samples extracted from the blood of the 45 toads were negative by rickettsia-PCR protocols.

  16. Neoseiulus fallacis (Garman) (Acari: Phytoseiidae) as a potential biological control agent for spider mites (Acari: Tetranychidae) in Virginia vineyards

    OpenAIRE

    Metzger, Jessica A.

    2001-01-01

    Outbreaks of spider mites (Acari: Tetranychidae) in vineyards have been increasing with the expansion of the industry in Virginia. Only three effective acaricides are registered on grapes and as resistance begins to occur, control options are limited. Biological control of spider mites by inoculative or inundative releases of predatory mites has been tried on a wide range of crops including grapes. This project examined the feasibility of using Neoseiulus fallacis (Acari: Phytoseiidae) as ...

  17. Potential species distribution and richness of ixodidae ticks associated with wild vertebrates from Michoacán, Mexico

    NARCIS (Netherlands)

    Vargas-Sandoval, Margarita; Priego-Santander, Angel G.; Larrazábal, Alejandra; Sosa-Gutiérrez, Carolina G.; Lara-Chávez, Blanca; Avila-Val, Teresita

    2014-01-01

    Ticks are regarded as the most relevant vectors of disease-causing pathogens in domestic and wild animals. The diversity of Ixodidae is known for a very small number of genera. Ixodes are repre- sented by 26 species, and in 2007 the first reported ticks vectors in Mexico for the causal agent of Lyme

  18. Distribution and habitat utilization of the gopher tortoise tick (Amblyomma tuberculatum) in Southern Mississippi

    Science.gov (United States)

    Ennen, J.R.; Qualls, C.P.

    2011-01-01

    The distribution of the gopher tortoise tick (Amblyomma tuberculatum) has been considered intrinsically linked to the distribution of its primary host, gopher tortoises (Gopherus polyphemus). However, the presence of G. polyphemus does not always equate to the presence of A. tuberculatum. There is a paucity of data on the ecology, habitat preferences, and distribution of A. tuberculatum. The goals of this study were to assess the distribution of A. tuberculatum in southern Mississippi and to determine which, if any, habitat parameters explain the distribution pattern of A. tuberculatum. During 2006-2007, we examined 13 G. polyphemus populations in southern Mississippi for the presence of A. tuberculatum, and we measured a suite of habitat parameters at each site. Only 23% of the G. polyphemus populations supported A. tuberculatum, suggesting a more restricted distribution than its host. The results of our multivariate analyses identified several habitat variables, e.g., depth of sand and percentage of sand in the topsoil and burrow apron, as being important in discriminating between sites with, and without, A. tuberculatum. Amblyomma tuberculatum was only found at sites with a mean sand depth of >100 cm and a mean percentage of topsoil and burrow apron sand composition >94.0 and 92.4, respectively. Thus, environmental factors, and not just its host's range, seem to influence the distribution of A. tuberculatum. ?? American Society of Parasitologists 2011.

  19. An acarologic survey and Amblyomma americanum distribution map with implications for tularemia risk in Missouri

    Science.gov (United States)

    Brown, H.E.; Yates, K.F.; Dietrich, G.; MacMillan, K.; Graham, C.B.; Reese, S.M.; Helterbrand, Wm. S.; Nicholson, W.L.; Blount, K.; Mead, P.S.; Patrick, S.L.; Eisen, R.J.

    2011-01-01

    In the United States, tickborne diseases occur focally. Missouri represents a major focus of several tickborne diseases that includes spotted fever rickettsiosis, tularemia, and ehrlichiosis. Our study sought to determine the potential risk of human exposure to human-biting vector ticks in this area. We collected ticks in 79 sites in southern Missouri during June 7-10, 2009, which yielded 1,047 adult and 3,585 nymphal Amblyomma americanum, 5 adult Amblyomma maculatum, 19 adult Dermacentor variabilis, and 5 nymphal Ixodes brunneus. Logistic regression analysis showed that areas posing an elevated risk of exposure to A. americanum nymphs or adults were more likely to be classified as forested than grassland, and the probability of being classified as elevated risk increased with increasing relative humidity during the month of June (30-year average). Overall accuracy of each of the two models was greater than 70% and showed that 20% and 30% of the state were classified as elevated risk for human exposure to nymphs and adults, respectively. We also found a significant positive association between heightened acarologic risk and counties reporting tularemia cases. Our study provides an updated distribution map for A. americanum in Missouri and suggests a wide-spread risk of human exposure to A. americanum and their associated pathogens in this region. Copyright ?? 2011 by The American Society of Tropical Medicine and Hygiene.

  20. Molecular detection of Rickettsia bellii in Amblyomma rotundatum from imported red-footed tortoise (Chelonoides carbonaria).

    Science.gov (United States)

    Erster, Oran; Roth, Asael; Avni, Zvi; King, Rony; Shkap, Varda

    2015-06-01

    Introduction of exotic ticks and pathogens through international animal trade (farm animals and pets) is a serious threat to public health and local fauna. Rapid and correct identification of potential threats is an important step on the way to conduct an efficient control of imported pests. In this report we describe the molecular identification of the neotropic tick Amblyomma rotundatum intercepted from red-footed tortoise (Chelonoides carbonaria), imported to Israel from Florida, USA. Molecular analysis of the ticks conducted upon their identification, revealed that they were infected with Rickettsia bellii. Following their collection, the ticks were examined morphologically and five molecular markers were used to determine their taxonomic identity: cytochrome c oxidase subunit 1 (COX1), cytochrome b (CytB), 12S rRNA, 16S rRNA and internal transcribed sequence 2 (ITS-2). Molecular analysis indicated that all of the collected ticks were Amblyomma rotundatum. Using rickettsial gltA (citrate synthase) gene in real-time PCR analysis we found that approximately 25% of the intercepted ticks (8 of 33) were infected with Rickettsia bellii. It is concluded that accurate and timely identification of imported exotic ticks prevented their introduction to Israel, and that use of molecular tools may further improve the response to such potential threats.

  1. A new genus and species Mangalaus krishianusandhanus (Acari: Eriophyidae) from India

    Science.gov (United States)

    Mangalaus ikrishianusandhanus n. gen., n. sp., (Acari: Prostigmata: Eriophyoidea), collected from erineum on the underside of leaves of Cordia dichotoma (Boraginaceae) is described and illustrated from specimens collected at the Indian Agricultural Research Institute (IARI) in New Delhi, India....

  2. Primeiro registro de Tetranychus urticae (Acari: Tetranychidae) em mudas de teca no Brasil

    OpenAIRE

    Alexandre dos Santos; Vagner Aniceto Teixeira; Otávio Peres Filho; Milson Evaldo Serafin; Marçal Pedro Neto; Carlos Alberto da Cunha Oliveira

    2014-01-01

    O ácaro fitófago Tetranychus urticae (Kock, 1836) (Acari: Tetranychidae) foi relatado e suas injúrias caracterizadas pela primeira vez em viveiro de produção mudas de teca (Tectona grandis) no Brasil.

  3. Temperature-dependent development and reproductive traits of Tetranychus macfarlanei (Acari: Tetranychidae)

    DEFF Research Database (Denmark)

    Ullah, Mohammad Shaef; Haque, Md. Ahsanul; Nachman, Gösta;

    2012-01-01

    Development and reproductive traits of Tetranychus macfarlanei Baker & Pritchard (Acari: Tetranychidae) were investigated on kidney bean, Phaseolus vulgaris L., at eleven constant temperatures. Tetranychus macfarlanei was able to develop and complete its life cycle at temperatures ranging from 17...

  4. Candidatus Rickettsia andeanae, a spotted fever group agent infecting Amblyomma parvum ticks in two Brazilian biomes

    Directory of Open Access Journals (Sweden)

    Fernanda Aparecida Nieri-Bastos

    2014-04-01

    Full Text Available Adult ticks of the species Amblyomma parvum were collected from the vegetation in the Pantanal biome (state of Mato Grosso do Sul and from horses in the Cerrado biome (state of Piauí in Brazil. The ticks were individually tested for rickettsial infection via polymerase chain reaction (PCR targeting three rickettsial genes, gltA, ompA and ompB. Overall, 63.5% (40/63 and 66.7% (2/3 of A. parvum ticks from Pantanal and Cerrado, respectively, contained rickettsial DNA, which were all confirmed by DNA sequencing to be 100% identical to the corresponding fragments of the gltA, ompA and ompB genes of Candidatus Rickettsia andeanae. This report is the first to describe Ca. R. andeanae in Brazil.

  5. Candidatus Rickettsia andeanae, a spotted fever group agent infecting Amblyomma parvum ticks in two Brazilian biomes.

    Science.gov (United States)

    Nieri-Bastos, Fernanda Aparecida; Lopes, Marcos Gomes; Cançado, Paulo Henrique Duarte; Rossa, Giselle Ayres Razera; Faccini, João Luiz Horácio; Gennari, Solange Maria; Labruna, Marcelo Bahia

    2014-04-01

    Adult ticks of the species Amblyomma parvum were collected from the vegetation in the Pantanal biome (state of Mato Grosso do Sul) and from horses in the Cerrado biome (state of Piauí) in Brazil. The ticks were individually tested for rickettsial infection via polymerase chain reaction (PCR) targeting three rickettsial genes, gltA, ompA and ompB. Overall, 63.5% (40/63) and 66.7% (2/3) of A. parvum ticks from Pantanal and Cerrado, respectively, contained rickettsial DNA, which were all confirmed by DNA sequencing to be 100% identical to the corresponding fragments of the gltA, ompA and ompB genes of Candidatus Rickettsia andeanae. This report is the first to describe Ca. R. andeanae in Brazil.

  6. Role of Amblyomma lepidum in the transmission of Mycobacterium farcinogenes, the causal agent of Bovine farcy

    Directory of Open Access Journals (Sweden)

    Eltayib Badowi Hasabelrasoul

    2015-06-01

    Full Text Available The present study was conducted to investigate the role of Amblyomma lepidum in the transmission of Mycobacterium farcinogenes, the causal agent of bovine farcy in Sudan. A total of 22 samples comprising of prescapular, submaxillary, mediastinal, parotid, retropharengeal and pulmonary lymph nodes, and subcutaneous nodules were collected for this study. M. farcinogenes was successfully isolated from the specimens by following traditional bacteriological techniques, and the bacteria were identified using standard biochemical assays, lipid analysis using Thin Layer Chromatography, and duplex Polymerase Chain Reaction. Larvae and nymphs of A. lepidum acquired M. farcinogenes from experimentally infected rabbits, and subsequently transmitted the infection to fresh rabbits within a maximum period of ten weeks. In contrast, adult A. lepidum failed to contract the organism from the infected rabbits; so, trans-ovarian transmission could be ruled out. In conclusion, this study confirmed the trans-stadial transmission of M. farcinogenes through larvae and nymphs of A. lepidum.

  7. Hosts, seasonality and geographic distribution of the South African tortoise tick, Amblyomma marmoreum

    Directory of Open Access Journals (Sweden)

    I.G. Horak

    2006-09-01

    Full Text Available The tortoise tick Amblyomma marmoreum was collected from large numbers of reptiles and other animals during the course of numerous surveys conducted in South Africa. A total of 1 229 ticks, of which 550 were adults, were recovered from 309 reptiles belonging to 13 species, with leopard tortoises, Geochelone pardalis being the most heavily infested. The 269 birds sampled harboured 4 901 larvae, 217 nymphs and no adult ticks, and the prevalence of infestation was greatest on hel meted guinea fowls, Numida meleagris. Only two larvae were recovered from 610 rodents, including 31 spring hares, Pedetes capensis, whereas 1 144 other small mammals yielded 1 835 immature ticks, of which 1 655 were collected from 623 scrub hares, Lepus saxatilis. The 213 carnivores examined harboured 2 459 ticks of which none were adult. A single adult tick and 6 684 larvae and 62 nymphs were recovered from 656 large herbivores, and a total of 4 081 immature ticks and three adults were collected from 1 543 domestic animals and 194 humans. Adult male and female A. marmoreum were most numerous on reptiles during January and February, and larvae during March. The largest numbers of larvae were present on domestic cattle and helmeted guineafowls in the Eastern Cape Province during March or April respectively, whereas larvae were most numerous on helmeted guineafowls, scrub hares and the vegetation in north-eastern Mpumalanga Province during May. In both provinces nymphs were most numerous between October and December. Amblyomma marmoreum appears to be most prevalent in the western regions of the Western and Eastern Cape and Free State provinces, and the north-eastern regions of the Northern Cape, KwaZulu- Natal, Mpumulanga and Limpopo provinces.

  8. Eupalopsellus prasadi Bagheri and Khanjani 2009 (Acari: Prostigmata, Eupalopsellidae), a New record for the Turkish acaro fauna

    OpenAIRE

    KASAP, İsmail; Çobanoğlu, Sultan; PEHLİVAN, SERKAN; KÖK, Şahin

    2013-01-01

    Females of Eupalopsellus prasadi Bagheri and Khanjani 2009, (Acari: Eupalopsellidae) were collected from the colony of Tetranychus urticae Koch (Acari: Tetranychidae) which are harmful on grown apple trees (Malus domestica Borkh. (Rosaceae)) in Bigalı village at Eceabat, Çanakkale. This is a new record for the Turkish fauna.

  9. Hard ticks (Ixodidae and Crimean-Congo hemorrhagic fever virus in south west of Iran.

    Directory of Open Access Journals (Sweden)

    Narges Sharifinia

    2015-03-01

    Full Text Available Ticks are vectors of some important arthropod-borne diseases in both fields of veterinary and medicine, such as Lyme, tularemia, Rocky Mountain spotted fever, and some types of encephalitis as well as Crimean Congo hemorrhagic fever (CCHF. Iran is known as one of the main foci of CCHF in west of Asia. This study was conducted in DarrehShahr County because of the development of animal husbandry in this area to detect the fauna and viral infection of the hard ticks of livestock. A cross-sectional survey was conducted during 2011-2012 with random sampling in four villages. A sample of ticks was subjected to RT-PCR method for detection of viral infection. During the study period, 592 Ixodidae ticks were collected and identified as seven species of Hyalomma asiaticum, Hy. marginatum, Hy. anatolicum, Hy. dromedarii, Hy. detritum, Rhipicephalus bursa and Rh. sanguineus. More than 20% of these ticks were examined to detect the genome of CCHF virus while 6.6% were positive. All species of Hyalomma were found to be positive. A high rate of livestock was found to be infected with hard ticks, which can act as the vectors of the CCHF disease. Regarding infection of all five Hyalomma species captured in this area, this genus should be considered as the main vector of CCHF. Planning control program can be performed based on the obtained data on seasonal activity of Ixodidae to prevent animal infestation as well as to reduce the risk of CCHF transmission.

  10. The Microbiome of Ehrlichia-Infected and Uninfected Lone Star Ticks (Amblyomma americanum)

    Science.gov (United States)

    Trout Fryxell, R. T.; DeBruyn, J. M.

    2016-01-01

    The Lone Star tick, Amblyomma americanum, transmits several bacterial pathogens including species of Anaplasma and Ehrlichia. Amblyomma americanum also hosts a number of non-pathogenic bacterial endosymbionts. Recent studies of other arthropod and insect vectors have documented that commensal microflora can influence transmission of vector-borne pathogens; however, little is known about tick microbiomes and their possible influence on tick-borne diseases. Our objective was to compare bacterial communities associated with A. americanum, comparing Anaplasma/Ehrlichia -infected and uninfected ticks. Field-collected questing specimens (n = 50) were used in the analyses, of which 17 were identified as Anaplasma/Ehrlichia infected based on PCR amplification and sequencing of groEL genes. Bacterial communities from each specimen were characterized using Illumina sequencing of 16S rRNA gene amplicon libraries. There was a broad range in diversity between samples, with inverse Simpson’s Diversity indices ranging from 1.28–89.5. There were no statistical differences in the overall microbial community structure between PCR diagnosed Anaplasma/Ehrlichia-positive and negative ticks, but there were differences based on collection method (P < 0.05), collection site (P < 0.05), and sex (P < 0.1) suggesting that environmental factors may structure A. americanum microbiomes. Interestingly, there was not always agreement between Illumina sequencing and PCR diagnostics: Ehrlichia was identified in 16S rRNA gene libraries from three PCR-negative specimens; conversely, Ehrlichia was not found in libraries of six PCR-positive ticks. Illumina sequencing also helped identify co-infections, for example, one specimen had both Ehrlichia and Anaplasma. Other taxa of interest in these specimens included Coxiella, Borrelia, and Rickettsia. Identification of bacterial community differences between specimens of a single tick species from a single geographical site indicates that intra

  11. The Microbiome of Ehrlichia-Infected and Uninfected Lone Star Ticks (Amblyomma americanum.

    Directory of Open Access Journals (Sweden)

    R T Trout Fryxell

    Full Text Available The Lone Star tick, Amblyomma americanum, transmits several bacterial pathogens including species of Anaplasma and Ehrlichia. Amblyomma americanum also hosts a number of non-pathogenic bacterial endosymbionts. Recent studies of other arthropod and insect vectors have documented that commensal microflora can influence transmission of vector-borne pathogens; however, little is known about tick microbiomes and their possible influence on tick-borne diseases. Our objective was to compare bacterial communities associated with A. americanum, comparing Anaplasma/Ehrlichia -infected and uninfected ticks. Field-collected questing specimens (n = 50 were used in the analyses, of which 17 were identified as Anaplasma/Ehrlichia infected based on PCR amplification and sequencing of groEL genes. Bacterial communities from each specimen were characterized using Illumina sequencing of 16S rRNA gene amplicon libraries. There was a broad range in diversity between samples, with inverse Simpson's Diversity indices ranging from 1.28-89.5. There were no statistical differences in the overall microbial community structure between PCR diagnosed Anaplasma/Ehrlichia-positive and negative ticks, but there were differences based on collection method (P < 0.05, collection site (P < 0.05, and sex (P < 0.1 suggesting that environmental factors may structure A. americanum microbiomes. Interestingly, there was not always agreement between Illumina sequencing and PCR diagnostics: Ehrlichia was identified in 16S rRNA gene libraries from three PCR-negative specimens; conversely, Ehrlichia was not found in libraries of six PCR-positive ticks. Illumina sequencing also helped identify co-infections, for example, one specimen had both Ehrlichia and Anaplasma. Other taxa of interest in these specimens included Coxiella, Borrelia, and Rickettsia. Identification of bacterial community differences between specimens of a single tick species from a single geographical site indicates that

  12. Mites and ticks (Acari. Chapter 7.4

    Directory of Open Access Journals (Sweden)

    Maria Navajas

    2010-07-01

    Full Text Available The inventory of the alien Acari of Europe includes 96 species alien to Europe and 5 cryptogenic species. Among the alien species, 87 are mites and 9 tick species. Besides ticks which are obligate ectoparasites, 14 mite species belong to the parasitic/predator regime. Among these species, some invaded Europe with rodents (8 spp. and others are parasitic to birds (2 spp. The remaining 77 mite species are all phytophagous and among these 40% belong to the Eriophyidae (37 spp. and 29% to the Tetranychidae (27 spp. families. These two families include the most significant agricultural pest. The rate of introductions has exponentially increased within the 20th century, the amplification of plant trade and agricultural commodities movements being the major invasion pathways. Most of the alien mite species (52% are from North America, Asia (25%, and Central and South America (10%. Half of the ticks (4 spp. alien to Europe originated from Africa. Most of the mite species are inconspicuous and data regarding invasive species and distribution range is only partially available. More research is needed for a better understanding of the ecological and economic effects of introduced Acari.

  13. Amblyomma nodosum (Neumann, 1899): observations on life cycle under laboratory conditions.

    Science.gov (United States)

    Pinheiro, Michele da Costa; Lourenço, Elizabete Captivo; Sá-Hungaro, Iwine Joyce Barbosa de; Famadas, Kátia Maria

    2015-01-01

    The natural hosts of Amblyomma nodosum in the immature stages are a variety of birds and the anteater in the adult stage. However, so far no data have been published about this tick's life cycle. To fill this gap, a record was made of its development under laboratory conditions. All the procedures were controlled in a BOD chamber set at 27±1 °C and 80±10% relative humidity and scotophase. The parasitic stages were raised on rabbits (Oryctolagus cuniculus Linnaeus, 1758), from which more than 50% of larvae and nymphs were recovered, although only a small portion performed ecdysis. The adults did not fixed on the rabbits, which suggests that the experimental conditions were unsuitable for the requirements of this species. The data obtained here indicate that A. nodosum is highly dependent on its host and environment whereas under laboratory conditions and host chosen for the study was not obtained satisfactory results and new studies with different hosts and new environmental conditions should be elaborated. PMID:26291144

  14. A deep insight into the sialotranscriptome of the gulf coast tick, Amblyomma maculatum.

    Directory of Open Access Journals (Sweden)

    Shahid Karim

    Full Text Available BACKGROUND: Saliva of blood sucking arthropods contains compounds that antagonize their hosts' hemostasis, which include platelet aggregation, vasoconstriction and blood clotting; saliva of these organisms also has anti-inflammatory and immunomodullatory properties. Perhaps because hosts mount an active immune response against these compounds, the diversity of these compounds is large even among related blood sucking species. Because of these properties, saliva helps blood feeding as well as help the establishment of pathogens that can be transmitted during blood feeding. METHODOLOGY/PRINCIPAL FINDINGS: We have obtained 1,626,969 reads by pyrosequencing a salivary gland cDNA library from adult females Amblyomma maculatum ticks at different times of feeding. Assembly of this data produced 72,441 sequences larger than 149 nucleotides from which 15,914 coding sequences were extracted. Of these, 5,353 had >75% coverage to their best match in the non-redundant database from the National Center for Biotechnology information, allowing for the deposition of 4,850 sequences to GenBank. The annotated data sets are available as hyperlinked spreadsheets. Putative secreted proteins were classified in 133 families, most of which have no known function. CONCLUSIONS/SIGNIFICANCE: This data set of proteins constitutes a mining platform for novel pharmacologically active proteins and for uncovering vaccine targets against A. maculatum and the diseases they carry.

  15. Protective action of Tagetes minuta (Asteraceae) essential oil in the control of Rhipicephalus microplus (Canestrini, 1887) (Acari: Ixodidae) in a cattle pen trial.

    Science.gov (United States)

    Andreotti, Renato; Garcia, Marcos Valério; Cunha, Rodrigo Casquero; Barros, Jacqueline Cavalcante

    2013-10-18

    The Rhipicephalus microplus tick is globally regarded as the most economically important ectoparasite of livestock, and the evolution of resistance to commercial acaricides among cattle tick populations is of great concern. The essential oil derived from Tagetes minuta may be efficacious against cattle tick infestation, and the results of a cattle pen trial using this essential oil for the control of ticks are reported here. The chemical composition of the essential oil was determined by GC-MS and NMR spectroscopy analyses, which revealed the presence of four major components in the essential oil. These components represent more than 70% of the essential oil: limonene (6.96%), β-ocimene (5.11%), dihydrotagetone (54.10%) and tagetone (6.73%). The results of the cattle pen trial indicated significant differences among the average values of the analyzed biological parameters, including the number of ticks, the average weight of the ticks, the average egg weight per engorged female and larval viability. Treatment with the T. minuta essential oil prepared in this study promoted significant effects on all biological indicators analyzed. Based on the biological indicators, the essential oil showed 99.98% efficacy compared to the control group when used at a 20% concentration. The results obtained in this study suggest that the T. minuta essential oil is a potential R. microplus tick control agent and may be used to mitigate the economic losses caused by tick infestation. PMID:23778081

  16. Use of Ivermectin as Endoparasiticide in Tropical Cattle Herds Generates Resistance in Gastrointestinal Nematodes and the Tick Rhipicephalus microplus (Acari: Ixodidae).

    Science.gov (United States)

    Alegría-López, M A; Rodríguez-Vivas, R I; Torres-Acosta, J F J; Ojeda-Chi, M M; Rosado-Aguilar, J A

    2015-03-01

    The objective of the present study was to determine simultaneously the status of resistance against ivermectin (IVM) in gastrointestinal nematodes (GIN) and Rhipicephalus microplus (Canestrini, 1888) ticks in 12 cattle farms where IVM was used for the control of GIN in the Mexican tropics. Six farms had frequent use of IVM (≥ 4 times per year) and six farms had low frequency of IVM use (1-2 times per year). The fecal egg count reduction test and the larval immersion test were used to determine the resistant status of GIN and R. microplus against IVM, respectively. The results indicated that 100% of the surveyed farms had IVM-resistant GIN (reduction % from 0 to 67%). The genera involved were Haemonchus, Cooperia, Ostertagia, Trichostrongylus, and Oesophagostomum. Although the IVM was never used for the control of ticks, 50% of the surveyed farms presented GIN and R. microplus simultaneously resistant to IVM. Furthermore, two R. microplus populations showed high resistance ratio (RR) to IVM (farm TAT: RR50% = 7 and RR99% = 40.1; and farm SLS: RR50% = 2.4; RR99% = 11.0). A high frequency of IVM use (≥ 4 times per year) seemed to promote IVM resistance amongst R. microplus ticks compared with the farms with low frequency of IVM use (1-2 times per year; 66.6 vs. 25.0%, respectively). However, the number of surveyed farms was insufficient to show clear statistical inferences (odds ratio = 6.00; 95% CI = 0.341-105.5). The use of IVM for the control of GIN promoted simultaneously the development of IVM resistance in the GIN and R. microplus populations of the cattle herds surveyed. PMID:26336306

  17. Acaricide and ivermectin resistance in a field population of Rhipicephalus microplus (Acari: Ixodidae) collected from red deer (Cervus elaphus) in the Mexican tropics.

    Science.gov (United States)

    Rodríguez-Vivas, R I; Miller, R J; Ojeda-Chi, M M; Rosado-Aguilar, J A; Trinidad-Martínez, I C; Pérez de León, A A

    2014-02-24

    In the Neotropics the control of tick infestations in red deer (Cervus elaphus) is achieved primarily through the use of acaricides and macrocyclic lactones. In Mexico, resistance to one or multiple classes of acaricides has been reported in Rhipicephalus microplus infesting cattle, but information on acaricide susceptibility in R. microplus infesting red deer is lacking. In this study we report the level of resistance to different classes of acaricides and ivermectin in R. microplus collected from red deer in the Mexican tropics. Engorged R. microplus females were collected from a red deer farm in Yucatan, Mexico. The larval packet test was used to detect resistance to the organophosphates (OPs) chlorpyrifos and coumaphos, synthetic pyrethroids (SPs) cypermethrin and permethrin, and the phenylpyrazol, fipronil. Resistance to the formamidine amitraz (Am), and ivermectin was ascertained using the larval immersion test. Data were subjected to probit analysis to determine lethal concentrations and resistance ratios to kill 50% (RR50) and 99% (RR99) of the tick population under evaluation in relation to susceptible reference strains. Additionally, allele specific polymerase chain reaction was used to detect the sodium channel F1550I mutation associated with SP resistance in R. microplus. The R. microplus population from red deer in Yucatan showed very high resistance to the two SPs evaluated (RRs>72.2 for cypermethrin; RR for permethrin resistance was so high a dose-response curve was not possible). All individual larvae tested to detect the sodium channel F1550I mutation associated with SP resistance in R. microplus were homozygous. The same tick population showed different levels of resistance to OPs (chlorpyrifos: RR50=1.55, RR99=0.63; coumaphos: RR50=6.8, RR99=5.9), fipronil (RR50=1.8, RR99=0.9), and amitraz (RR50=2.3, RR99=4.4). Resistance to ivermectin was regarded as moderate (RR50=7.1, RR99=5.0). This is the first report of R. microplus ticks collected from red deer in Mexico with different levels of resistance to four acaricide groups and ivermectin. PMID:24365245

  18. In vitro and in vivo evaluation of cypermethrin, amitraz, and piperonyl butoxide mixtures for the control of resistant Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) in the Mexican tropics.

    Science.gov (United States)

    Rodriguez-Vivas, R I; Li, A Y; Ojeda-Chi, M M; Trinidad-Martinez, I; Rosado-Aguilar, J A; Miller, R J; Pérez de León, A A

    2013-10-18

    A study was conducted to evaluate the efficacy of cypermethrin, amitraz, and piperonyl butoxide (PBO) mixtures, through in vitro laboratory bioassays and in vivo on-animal efficacy trials, for the control of resistant Rhipicephalus (Boophilus) microplus on cattle in the Mexican tropics. Also, to examine mechanisms of resistance to cypermethrin in this tick population, the frequency of a mutated sodium channel gene (F1550I) was determined using a PCR assay. Results of laboratory bioassays using modified larval packet tests revealed that cypermethrin toxicity was synergized by PBO (from 46.6-57.0% to 83.7-85.0% larval mortality; Presistant tick larvae in vitro (96.7-100% of larval mortality). Tick larvae surviving exposure to cypermethrin or mixtures either with amitraz and PBO in vitro showed 2.9-49.6 higher probability to present the mutated allele than those killed by acaricide treatment (P95% control that persisted for 28 days post-treatment against R. microplus infesting cattle when tested under field conditions in the Mexican tropics. Although this mixture is a potentially useful tool to combat pyrethroid resistance, a product based on an acaricide mixture like the one tested in this study has to be used rationally. PMID:23948559

  19. A new approach to characterization of the resistance of populations of Rhipicephalus microplus (Acari: Ixodidae) to organophosphate and pyrethroid in the state of Minas Gerais, Brazil.

    Science.gov (United States)

    Faza, Aline Pasqualini; Pinto, Isabella Silvestre Barreto; Fonseca, Isabela; Antunes, Gustavo Resende; Monteiro, Caio Márcio de Oliveira; Daemon, Erik; Muniz, Michelle de Souza; Martins, Marta Fonseca; Furlong, John; Prata, Márcia Cristina de Azevedo

    2013-08-01

    The monitoring of resistance of cattle tick populations in Brazil to the chemical bases in use is largely limited to investigation of the phenotypic profile. There are few studies investigating the role played by the genotypic profile in acaricide resistance in the country. Therefore, the aim of the present study was to carry out molecular characterization and trace out the genetic profile of populations of Rhipicephalus microplus with respect to resistance to the organophosphate and pyrethroid chemical groups. For that purpose, larvae were genotyped belonging to 587 populations for pyrethroids and 306 for organophosphates, using the polymerase chain reaction technique. It was found that 75.49% and 97.44% of the larvae studied showed resistance to the organophosphates and pyrethroids, respectively. Among the populations resistant to pyrethroids, 91.9% were heterozygotes, showing that most of the resistant populations have only one allele responsible for resistance. Therefore, it is possible to conclude that the genotyped populations have high resistance to organophosphates, and even more so to pyrethroids. This information is fundamental for understanding the mechanisms of resistance of R. microplus to acaricides, to enable improvement of control techniques. PMID:23639866

  20. Chemo-profiling and bioassay of phytoextracts from Ageratum conyzoides for acaricidal properties against Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) infesting cattle and buffaloes in India.

    Science.gov (United States)

    Kumar, K G Ajith; Tayade, Amol B; Kumar, Rajesh; Gupta, Suman; Sharma, Anil Kumar; Nagar, Gaurav; Tewari, Shashi Shankar; Kumar, Bhanu; Rawat, A K S; Srivastava, Sharad; Kumar, Sachin; Ghosh, Srikant

    2016-03-01

    In India, Rhipicephalus (Boophilus) microplus populations have developed a certain level of resistance to most of the acaricides marketed against tick species. To manage the problem, the present study was undertaken to evaluate the acaricidal potential of Ageratum conyzoides plants against acaricides-resistant ticks infesting cattle and buffaloes. The regression analysis of dose-response data of ethanolic extract of A. conyzoides revealed LC90 value of 8.91% against reference susceptible IVRI-1 line of R.(B.) microplus. The ethanolic extract was found efficacious against 76.7-90% acaricides-resistant field ticks and adversely affected oviposition showing 7.04-31.3% reduction in egg laying capacity. The extract was also showed an in vitro efficacy of 52.5 and 76.7% against reference resistant IVRI-4 and 5 lines. The GC/MS/MS profiling of hexane extract, two bioactive sub-fractions and essential oils revealed the presence of 6,7-dimethoxy-2,2-dimethyl-2H-1-benzopyran (precocene II) as a major phyto-compound. The bioactive sub-fractions showed 96.2-97.5% efficacy against larvae of IVRI-1 and 77.1-94.9% against multi-acaricide resistant larvae of IVRI-5 line of R.(B.) microplus. The results of this study provided significant support for the development of a phyto-formulation based on A. conyzoides species. PMID:26723275

  1. Determination of acaricide resistance in Rhipicephalus (Boophilus) microplus (Acari: Ixodidae) field populations of Argentina, South Africa, and Australia with the Larval Tarsal Test.

    Science.gov (United States)

    Lovis, L; Reggi, J; Berggoetz, M; Betschart, B; Sager, H

    2013-03-01

    Infestations with ticks have an important economic impact on the cattle industry worldwide and resistance to acaricides has become a widespread phenomenon. To optimize their treatment strategy, farmers need to know if and against which classes potential acaricide-resistance does occur. Bioassays are used to assess the resistance level and pattern of Rhipicephalus (Boophilus) microplus populations. The objective of the current study was to assess the susceptibility of field populations originating from Argentina (8), South Africa (3), and Australia (2) using the Larval Tarsal Test. Nine acaricidal compounds from five major classes were tested: organosphosphates, synthetic pyrethroids (SP), macrocyclic lactones, phenylpyrazols, and amidines. The resistance ratios at concentrations inducing 50 and 90% mortality were used to detect established and emerging resistance. This study confirmed the newly reported presence of amitraz resistance in populations from Argentina In addition, resistance to SP appeared to be widespread (88%) in the Argentinean farms, which had been selected based on the observation of lack of treatment efficacy by farmers. In South Africa one of the three populations was found to be resistant to SP and to a phenylpyrazol compound (pyriprol). Furthermore, resistance to organosphosphates and SP was observed in Australia. Finally, the Larval Tarsal Test proved to be a suitable test to evaluate the susceptibility of R. microplus field populations to the most relevant acaricidal classes. PMID:23540121

  2. Topical Treatment of White-Tailed Deer with an Acaricide for the Control of Ixodes Scapularis (Acari: Ixodidae) in a Connecticut Lyme Borreliosis Hyperendemic Community

    Science.gov (United States)

    The 4-Poster device for the topical treatment of white-tailed deer, Odocoileus virginianus (Zimmermann), against ticks using the acaricide amitraz, was evaluated in a Lyme borreliosis endemic community in Connecticut. As part of a 5-year project from 1997 to 2002, 21–24 of the 4-Posters were distrib...

  3. Assessment of the acaricidal activity of carvacrol, (E)-cinnamaldehyde, trans-anethole, and linalool on larvae of Rhipicephalus microplus and Dermacentor nitens (Acari: Ixodidae).

    Science.gov (United States)

    de Oliveira Souza Senra, Tatiane; Zeringóta, Viviane; de Oliveira Monteiro, Caio Márcio; Calmon, Fernanda; Maturano, Ralph; Gomes, Geovany Amorim; Faza, Aline; de Carvalho, Mario Geraldo; Daemon, Erik

    2013-04-01

    The acaricidal activity of carvacrol, (E)-cinnamaldehyde, trans-anethole, and linalool was studied on Rhipicephalus microplus and Dermacentor nitens larvae. All the substances were tested at concentrations of 2.5, 5.0, 10.0, 15.0, and 20.0 μl/ml, with 10 repetitions per treatment. The modified larval packet technique was employed in the tests and the mortality was evaluated after 24 h. In the groups treated with carvacrol, the lowest concentration (2.5 μl/ml) was sufficient to cause 100% death of the R. microplus and D. nitens larvae. The same concentration of (E)-cinnamaldehyde resulted in death of approximately 99% of the larvae of both tick species and reached 100% at the other concentrations. For trans-anethole, mortality rates above 90% of the R. microplus and D. nitens larvae were only observed starting at the concentration of 15.0 μl/ml and reached 100% at the highest concentration (20.0 μl/ml). Finally, the mortality rates of the groups treated with linalool were low, only reaching 8.4 and 14.5% at the highest concentration (20.0 μl/ml) for larvae of D. nitens and R. microplus, respectively. These results show that carvacrol, (E)-cinnamaldehyde, and trans-anethole have acaricidal activity, particularly carvacrol and (E)-cinnamaldehyde, both of which resulted in high mortality rates for the larvae of these two tick species even at the lowest concentration.

  4. Detection of naturally infected vector ticks (acari: ixodidae by different species of babesia and theileria agents from three different enzootic parts of iran.

    Directory of Open Access Journals (Sweden)

    Mohammad Abdigoudarzi

    2013-12-01

    Full Text Available Diagnostic study of vector ticks for different pathogens transmitted specifically have been done by Iranian old scientists working on the basis of biological transmission of pathogens. In this study we decided to confirm natural infection of different collected ticks from three different provinces of Iran.Ticks were collected from livestock (sheep, goats and cattle during favorable seasons (April to September 2007 and 2008. Slide preparations were stained by Giemsa and Feulgen and were studied searching for any trace of infection. Positive DNA from infected blood or tissue samples was provided and was used as positive control. First, PCR optimization for positive DNA was done, and then tick samples were subjected to specific PCR.Eleven pairs of primers were designed for detection of Theileria, Babesia and Anaplasma spp. Totally 21 tick samples were detected to be infected with protozoa. Hyalomma anatolicum anatolicum and Rhipicephalus turanicus from Fars Province were infected with T. lestoquardi at two different places. Hyalomma detritum was infected with T. lestoquardi in Lorestan Province and Rh. turanicus was infected to Ba. ovis from Fars Province.Totally 21 tick samples were detected to be infected with protozoa. Every sample is regarded with host-environment related factors. Since there are complex relations of vectors and their relevant protozoa, different procedures are presented for future studies.

  5. Morphological effects of neem (Azadirachta indica A. Juss) seed oil with known azadirachtin concentrations on the oocytes of semi-engorged Rhipicephalus sanguineus ticks (Acari: Ixodidae).

    Science.gov (United States)

    Remedio, R N; Nunes, P H; Anholeto, L A; Oliveira, P R; Camargo-Mathias, M I

    2015-02-01

    The concern about the harmful effects caused by synthetic pesticides has led to the search for safe and ecological alternatives for pest control. In this context, the neem tree (Azadirachta indica) stands out due to its repellent properties and effects on various arthropods, including ticks. For this reason, this study aimed to demonstrate the potential of neem as a control method for Rhipicephalus sanguineus ticks, important vectors of diseases in the veterinary point of view. For this, R. sanguineus semi-engorged females were subjected to treatment with neem seed oil enriched with azadirachtin, its main compound, and ovaries were assessed by means of morphological techniques in conventional light microscopy, confocal laser scanning microscopy, and transmission electron microscopy. Neem demonstrated a clear dose-dependent effect in the analyzed samples. The observed oocytes presented, especially in the groups treated with higher concentrations of neem oil, obvious signs of cytoplasmic disorganization, cellular vacuolization, nuclear and nucleolar irregularity, dilation in mitochondrial cristae, alterations in mitochondrial matrix, and swelling of rough endoplasmic reticulum. Intracellular microorganisms were observed in all analyzed groups, reinforcing the importance of ticks in the transmission of pathogens. A greater quantity of microorganisms was noted as the concentration of neem increased, indicating that the damaged oocytes may be more susceptible for their development. Such morphological alterations may promote future damages in reproductive performance of these animals and demonstrate the potential of neem seed oil for the control of R. sanguineus ticks, paving the way for new, cheaper, and safer methods of control. PMID:25346198

  6. Host, habitat and climate preferences of Ixodes angustus (Acari: Ixodidae) and infection with Borrelia burgdorferi and Anaplasma phagocytophilum in California, USA.

    Science.gov (United States)

    Stephenson, Nicole; Wong, Johnny; Foley, Janet

    2016-10-01

    The Holarctic tick Ixodes angustus is a competent vector for Borrelia burgdorferi, the etiologic agent of Lyme disease, and possibly Anaplasma phagocytophilum, the etiologic agent of granulocytic anaplasmosis, as well. From 2005 to 2013, we collected host-feeding I. angustus individuals from live-trapped small mammals and by flagging vegetation from 12 study sites in northern and central California, and tested for B. burgdorferi sensu lato, A. phagocytophilum, and Rickettsia spp. DNA by real-time PCR. Among 261 I. angustus collected (259 from hosts and two by flagging), the most common hosts were tree squirrels (20 % of ticks) and chipmunks (37 %). The PCR-prevalence for A. phagocytophilum and B. burgdorferi in ticks was 2 % and zero, respectively. The minimum infection prevalence on pooled DNA samples was 10 % for Rickettsia spp. DNA sequencing of the ompA gene identified this rickettsia as Candidatus Rickettsia angustus, a putative endosymbiont. A zero-inflated negative binomial mixed effects model was used to evaluate geographical and climatological predictors of I. angustus burden. When host species within study site and season within year were included in the model as nested random effects, all significant variables revealed that I. angustus burden increased as temperature decreased. Together with published data, these findings suggest that I. angustus is a host generalist, has a broad geographic distribution, is more abundant in areas with lower temperature within it's range, and is rarely infected with the pathogens A. phagocytophilum and B. burgdorferi.

  7. Host associations of ticks (Acari: Ixodidae) parasitizing medium-sized mammals in a Lyme disease endemic area of southern New York.

    Science.gov (United States)

    Fish, D; Dowler, R C

    1989-05-01

    Ticks of eight medium-sized mammal species were studied in an area of endemic Lyme disease in Westchester County, N.Y., from 1 April 1984 to 31 March 1985. Most (81%) of the 266 total mammal captures were raccoon, Procyon lotor (L.) (47%), opossum, Didelphis virginiana (Kerr) (19%), and striped skunk, Mephitis mephitis Schreber (15%); these host species accounted for 91% of the 1,519 ticks collected. Although the total number of ticks was rather evenly distributed among these mammals, species composition of ticks on each host species differed markedly. Ixodes dammini Spielman, Clifford, Piesman, and Corwin was the most abundant tick species and accounted for 45% (690) of the total ticks collected. Immatures were most prevalent (56%) on opossum, and nearly all (86%) adults were found on this host species. I. cookei Marx was second in abundance (34%) and was most prevalent (60%) on skunk. I. texanus Banks and Dermacentor variabilis (Say) were less abundant (less than 20% collectively) and were most prevalent on raccoon. I. dentatus Marx on eastern cottontail, Sylvilagus floridanus (Allen), and I. marxi Banks on gray squirrel, Sciurus carolinensis Gmelin, were least abundant (less than 2% collectively). The prevalence of I. dammini on medium-sized mammals in southern New York may influence the epizoötiology of Lyme disease. PMID:2724317

  8. Prevention of infectious tick-borne diseases in humans: Comparative studies of the repellency of different dodecanoic acid-formulations against Ixodes ricinus ticks (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    Dautel Hans

    2008-04-01

    Full Text Available Abstract Background Ticks of the species Ixodes ricinus are the main vectors of Lyme Borreliosis and Tick-borne Encephalitis – two rapidly emerging diseases in Europe. Repellents provide a practical means of protection against tick bites and can therefore minimize the transmission of tick-borne diseases. We developed and tested seven different dodecanoic acid (DDA-formulations for their efficacy in repelling host-seeking nymphs of I. ricinus by laboratory screening. The ultimately selected formulation was then used for comparative investigations of commercially available tick repellents in humans. Methods Laboratory screening tests were performed using the Moving-object (MO bioassay. All test formulations contained 10% of the naturally occurring active substance DDA and differed only in terms of the quantitative and qualitative composition of inactive ingredients and fragrances. The test procedure used in the human bioassays is a modification of an assay described by the U.S. Environmental Protection Agency and recommended for regulatory affairs. Repellency was computed using the equation: R = 100 - NR/N × 100, where NR is the number of non-repelled ticks, and N is the respective number of control ticks. All investigations were conducted in a controlled laboratory environment offering standardized test conditions. Results All test formulations strongly repelled nymphs of I. ricinus (100-81% protection as shown by the MO-bioassay. The majority of ticks dropped off the treated surface of the heated rotating drum that served as the attractant (1 mg/cm2 repellent applied. The 10% DDA-based formulation, that produced the best results in laboratory screening, was as effective as the coconut oil-based reference product. The mean protection time of both preparations was generally similar and averaged 8 hours. Repellency investigations in humans showed that the most effective 10% DDA-based formulation (~1.67 mg/cm2 applied strongly avoided the attachment of I. ricinus nymphs and adults for at least 6 hours. The test repellent always provided protection (83-63% against I. ricinus nymphs equivalent to the natural coconut oil based reference product and a better protection (88-75% against adult ticks than the synthetic Icaridin-containing reference repellent. Conclusion We found that the 10% DDA-based formulation (ContraZeck® is an easily applied and very effective natural repellent against I. ricinus ticks. By reducing the human-vector contact the product minimises the risk of transmission of tick-borne diseases in humans.

  9. Diversity and distribution of tick species (Acari: Ixodidae) associated with human otoacariasis and socio-ecological risk factors of tick infestations in Sri Lanka.

    Science.gov (United States)

    Ariyarathne, S; Apanaskevich, D A; Amarasinghe, P H; Rajakaruna, R S

    2016-09-01

    Tick infestation in humans is a major public health concern. The diversity and distribution of tick species associated with human otoacariasis was studied in five districts: Anuradhapura, Kandy, Kurunegala, Nuwara Eliya and Ratnapura in the main agro-climatic zones of Sri Lanka. Ticks from patients attending the ear, nose and throat clinics of the General Hospitals were collected during a 3 year period. In total 426 ticks were collected. Most human otoacariasis cases were reported from Kandy (33.8 %) and the fewest from Nuwara Eliya (8.2 %). Of the five tick species identified, nymphs of Dermacentor auratus constituted 90.6 % of the collection. Rhipicephalus sanguineus, Hyalomma isaaci, Haemaphysalis bispinosa and Otobius megnini were found rarely infesting humans possibly as an accidental host; H. bispinosa and O. megnini in the human ear canal were first time records in Sri Lanka. Females and children under 10 years were identified as risk groups of human otoacariasis. Subsequently, a field study was carried out to determine socio-ecological risk factors of human tick infestations in the five districts. Based on hospital data, eight villages with high prevalence of otoacariasis were selected from each district. A total 40 villages were visited and 1674 household members were interviewed. Involvement in outdoor activities, presence of wild animals around the house, location of the house in close proximity to a forest and occupation were identified as major risk factors.

  10. Efficacy and environmental persistence of nootkatone for the control of the blacklegged tick, Ixodes scapularis (Acari: Ixodidae) in the residential landscape

    Science.gov (United States)

    We evaluated the ability of the plant-derived compound nootkatone to control nymphs of the blacklegged tick, Ixodes scapularis Say, applied to the perimeter of lawns around homes in Lyme disease endemic areas of Connecticut. Three formulations of nootkatone ranging from 0.05 to 0.84% (0.06 to 1.03 g...

  11. Comparison of the Efficiency of Biological Transmission of Anaplasma marginale (Rickettsiales: Anaplasmataceae) by Dermacentor andersoni Stiles (Acari: Ixodidae) with Mechanical Transmission by the Horse Fly, Tabanus fuscicos

    Science.gov (United States)

    Mechanical transmission of Anaplasma marginale by horse flies (Tabanidae) is thought to be epidemiologically significant in some areas of the US. We compared the relative efficiencies of mechanical transmission of Anaplasma marginale by the horse fly, Tabanus fuscicostatus Hine during acute infectio...

  12. Morphological and cytochemical changes in synganglion of Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae) female ticks from exposure of andiroba oil (Carapa guianensis).

    Science.gov (United States)

    Roma, Gislaine Cristina; Mathias, Maria Izabel Camargo; De Faria, Adriano Uemura; De Oliveira, Patrícia Rosa; Furquim, Karim Christina Scopinho; Bechara, Gervásio Henrique

    2013-07-01

    Actually, the most used method to control ticks is synthetic acaricides with neurotoxic action. However, the use of these methods presents inconveniences, such as the contamination of the environment and risks to the host's health due to the residual effects. Thus, several studies have been developed aiming to find alternative ways to control these ectoparasites, such as the use of natural compounds with active ingredients, which act controlling some species of plagues in addition to presenting medicinal properties that are beneficial to humans. The present study aimed to analyze the action of andiroba oil (Carapa guianensis) on the synganglion of Rhipicephalus sanguineus semiengorged females through morphological and cytochemical techniques aiming to verify if this natural product have neurotoxic action as the numerous synthetic acaricides. The results showed that andiroba oil interferes in the synganglion through structural and enzymatic changes, which lead the nervous tissue to apoptotic death involving autophagy. Among these changes was observed the emergence of large empty spaces between the perineurium and the cortical region, vacuolated cortex cells and with cell swelling, neural cells with picnotic nuclei or in initial stage of chromatin margination and neuropile with high structural disorganization. Considering these data, it can be concluded that andiroba seed oil can be used as an alternative method in the control of R. sanguineus ticks due to its neurotoxic action. PMID:23625505

  13. Action of andiroba oil and permethrin on the central nervous and reproductive systems of Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae) ticks females. A confocal study.

    Science.gov (United States)

    Roma, Gislaine Cristina; Vendramini, Maria Cláudia Ramalho; Camargo-Mathias, Maria Izabel; Nunes, Pablo Henrique; de Faria, Adriano Uemura; Bechara, Gervásio Henrique

    2013-10-01

    Research for acaricides with lower toxicity and impact on the environment has been intensified. An alternative would be the use of natural compounds or of synthetic products in lower concentrations than the ones sold commercially. Thus, this study describes the action of andiroba seed oil on the nuclei of the ovary and synganglion cells of Rhipicephalus sanguineus, and presents an analysis of the nuclear morphology of the nervous system cells of this tick species when exposed to permethrin. The results obtained showed that, although no changes have been observed in the genetic material of the ovary cells exposed to the andiroba oil, this compound, as well as permethrin, has neurotoxic action on the females of this species. The damages caused to the physiology of the synganglion, due to the loss of integrity of the genetic material, would result in the impairment of the metabolism of other systems of R. sanguineus ticks. PMID:23823663

  14. Action of andiroba oil (Carapa guianensis) on Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae) semi-engorged females: morphophysiological evaluation of reproductive system.

    Science.gov (United States)

    Vendramini, Maria Cláudia Ramalho; Mathias, Maria Izabel Camargo; De Faria, Adriano Uemura; Furquim, Karim Christina Scopinho; De Souza, Leonardo Peres; Bechara, Gervásio Henrique; Roma, Gislaine Cristina

    2012-12-01

    Because of the increasing medical-veterinary importance of ticks, the development of alternative control methods, less aggressive to the host and the environment has become the target of several researches. In this sense, the present study analyzed the action of different concentrations (5, 10, and 20%) of andiroba seed oil (Carapa guianensis) on the reproductive system of Rhipicephalus sanguineus females, through histochemical techniques and the quantification of the reproductive efficiency index. The results showed that andiroba oil is a potent natural agent, able to cause several changes in the oocytes of this species, impairing the reproductive success, once this natural product induces great physiological changes in the oocytes in all development stages, such as drastic reduction in proteins, polysaccharides, and lipids in these cells, and these components are essential for the viability of the embryo. In addition, it was observed that this product stimulate the oviposition, mainly at the concentration of 20%. This higher production of eggs represents a defense mechanism developed by the organism in order to ensure the reproductive success of the species, even in the presence of the toxic agent. However, the results obtained suggested that the laid eggs would not be viable, due to the great changes undergone by the oocytes. Thus, the present study showed that the use of this vegetal product would be an alternative way to control the ticks, bringing benefits similar to the ones obtained through the use of synthetic acaricides; however, with less damage to nontarget organisms and the environment as well. PMID:22972770

  15. Cytotoxic effects of andiroba oil (Carapa guianensis) in reproductive system of Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae) semi-engorged females.

    Science.gov (United States)

    Vendramini, Maria Cláudia Ramalho; Camargo-Mathias, Maria Izabel; de Faria, Adriano Uemura; Bechara, Gervásio Henrique; de Oliveira, Patrícia Rosa; Roma, Gislaine Cristina

    2012-11-01

    The present study performed an analysis about the effects of andiroba seed oil (Carapa guianensis) in the ovary of Rhipicephalus sanguineus semi-engorged females; once, there are few studies about the action of natural products on the reproductive system, a vital organ for the biological success of this animal group. The results showed that andiroba oil is a potent natural agent which causes significant structural changes in the oocytes, such as the emergence of large vacuolated cytoplasmic regions, reduction in the number of yolk granules, changes in the shape of the cells, as well as impairment of genetic material. In addition, the ovary epithelium showed severe morphological changes, such as extreme structural disorganization, with highly vacuolated cells and picnotic nuclei, forming an amorphous mass. This study showed also that oocytes (mainly in the initial stages of development) and the ovary epithelium of R. sanguineus females subjected to different concentrations of andiroba oil presented morphological changes which became more numerous and intense as the concentration of the product increased. Based on the results, it can be inferred that although the defense mechanisms are developed by oocytes to recover the cellular integrity (presence of autophagic vacuoles), these cells are not able to revert the damage caused by this product. Thus, it can be concluded that although the damages caused to the oocytes by andiroba oil are comparatively less severe than the ones caused by synthetic acaricides, this product can be considered a potent natural agent that reduce and/or prevent the reproduction of R. sanguineus females, with the advantage of not causing environmental impact such as synthetic chemical acaricides. PMID:22797575

  16. Linkages of Weather and Climate With Ixodes scapularis and Ixodes pacificus (Acari: Ixodidae), Enzootic Transmission of Borrelia burgdorferi, and Lyme Disease in North America.

    Science.gov (United States)

    Eisen, Rebecca J; Eisen, Lars; Ogden, Nicholas H; Beard, Charles B

    2016-03-01

    Lyme disease has increased both in incidence and geographic extent in the United States and Canada over the past two decades. One of the underlying causes is changes during the same time period in the distribution and abundance of the primary vectors: Ixodes scapularis Say and Ixodes pacificus Cooley and Kohls in eastern and western North America, respectively. Aside from short periods of time when they are feeding on hosts, these ticks exist in the environment where temperature and relative humidity directly affect their development, survival, and host-seeking behavior. Other important factors that strongly influence tick abundance as well as the proportion of ticks infected with the Lyme disease spirochete, Borrelia burgdorferi, include the abundance of hosts for the ticks and the capacity of tick hosts to serve as B. burgdorferi reservoirs. Here, we explore the linkages between climate variation and: 1) duration of the seasonal period and the timing of peak activity; 2) geographic tick distributions and local abundance; 3) enzootic B. burgdorferi transmission cycles; and 4) Lyme disease cases. We conclude that meteorological variables are most influential in determining host-seeking phenology and development, but, while remaining important cofactors, additional variables become critical when exploring geographic distribution and local abundance of ticks, enzootic transmission of B. burgdorferi, and Lyme disease case occurrence. Finally, we review climate change-driven projections for future impact on vector ticks and Lyme disease and discuss knowledge gaps and research needs.

  17. Reinstatement of Dermacentor bellulus (Acari: Ixodidae) as a Valid Species Previously Confused with D. taiwanensis and Comparison of All Parasitic Stages

    Science.gov (United States)

    Apanaskevich, Maria A.; Apanaskevich, Dmitry A.

    2015-01-01

    Re-examination of Dermacentor taiwanensis Sugimoto, 1935 specimens in the United States National Tick Collection revealed that two morphologically distinct Dermacentor species were identified under this name. One of them corresponds to Sugimoto’s description of D. taiwanensis, while another species is identical to Schulze’s Dermacentor bellulus (Schulze, 1935). The latter species has not been considered valid by recent workers. D. bellulus is reinstated here as a valid species and all its stages are redescribed. The adults of D. taiwanensis are also redescribed, and its immature stages are described for the first time. Males and females of D. bellulus can be distinguished from those of D. taiwanensis by the shape of the conscutum and scutum, color pattern, genital structures, size of the palpi and cornua, and the spurs of coxa I. Nymphs of D. bellulus can be distinguished from those of D. taiwanensis by the shape of the scutum, basis capituli, and the hypostomal dentition. Larvae of D. bellulus can be differentiated from those of D. taiwanensis by the shape of the basis capituli, and the degree of development of the auriculae and spur on palpal segment III ventrally. D. bellulus has been recorded from China, Japan, Nepal, Taiwan, and Vietnam; adults have been collected from wild boars, bears, panda, dog, and human; the immature stages are known from rodents, hares, ferret-badger, and bamboo-partridge. D. taiwanensis is found in China, Taiwan, and Vietnam; adults have been collected from wild boars; the immature stages are known from rodents, hares, mustelids, and domestic dog. PMID:26335464

  18. Analysis of doramectin in the serum of repeatedly treated pastured cattle used to predict the probability of cattle fever ticks (Acari: Ixodidae) feeding to repletion

    Science.gov (United States)

    Doramectin concentration in the serum of pastured cattle treated repeatedly at 28 d intervals at two dosage rates was used to predict the probability that cattle fever ticks could successfully feed to repletion during the interval between treatments. At ~270 µg/kg, the doramectin concentration dropp...

  19. Acaricidal Treatment of White-Tailed Deer to Control Ixodes Scapularis (Acari: Ixodidae) in a New York Lyme Disease-Endemic Community

    Science.gov (United States)

    The 4-Poster device for the topical treatment of white-tailed deer, Odocoileus virginianus (Zimmermann) against ticks using the acaricide amitraz was evaluated in a Lyme borreliosis endemic community in Connecticut. As part of a 5-year project from 1997 to 2002, 21–24 of the 4-Posters were distribut...

  20. Morphological effects of neem (Azadirachta indica A. Juss) seed oil with known azadirachtin concentrations on the oocytes of semi-engorged Rhipicephalus sanguineus ticks (Acari: Ixodidae).

    Science.gov (United States)

    Remedio, R N; Nunes, P H; Anholeto, L A; Oliveira, P R; Camargo-Mathias, M I

    2015-02-01

    The concern about the harmful effects caused by synthetic pesticides has led to the search for safe and ecological alternatives for pest control. In this context, the neem tree (Azadirachta indica) stands out due to its repellent properties and effects on various arthropods, including ticks. For this reason, this study aimed to demonstrate the potential of neem as a control method for Rhipicephalus sanguineus ticks, important vectors of diseases in the veterinary point of view. For this, R. sanguineus semi-engorged females were subjected to treatment with neem seed oil enriched with azadirachtin, its main compound, and ovaries were assessed by means of morphological techniques in conventional light microscopy, confocal laser scanning microscopy, and transmission electron microscopy. Neem demonstrated a clear dose-dependent effect in the analyzed samples. The observed oocytes presented, especially in the groups treated with higher concentrations of neem oil, obvious signs of cytoplasmic disorganization, cellular vacuolization, nuclear and nucleolar irregularity, dilation in mitochondrial cristae, alterations in mitochondrial matrix, and swelling of rough endoplasmic reticulum. Intracellular microorganisms were observed in all analyzed groups, reinforcing the importance of ticks in the transmission of pathogens. A greater quantity of microorganisms was noted as the concentration of neem increased, indicating that the damaged oocytes may be more susceptible for their development. Such morphological alterations may promote future damages in reproductive performance of these animals and demonstrate the potential of neem seed oil for the control of R. sanguineus ticks, paving the way for new, cheaper, and safer methods of control.

  1. Biological activities of chamomile (Matricaria chamomile) flowers' extract against the survival and egg laying of the cattle fever tick (Acari Ixodidae)

    Institute of Scientific and Technical Information of China (English)

    2007-01-01

    In the present work, the potential of acaricidal activity of chamomile flowers' extract was studied against engorged Rhipicephalus annulatus tick under laboratory condition. For this purpose, the engorged females of Rhipicephalus annulatus were exposed to two-fold serial dilutions of chamomile flowers' extract (0.5%, 1.0%, 2.0%, 4.0% and 8.0%) using "dipping method" in vitro. The engorged ticks were immersed in different plant dilutions (five ticks for each dilution) for 1 min and they were immediately incubated in separate Petri dishes for each replicate at 26 ℃ and 80% relative humidity. Mortality rate for each treatment was recorded 5 d after incubation.The mortality rate caused by different dilutions of chamomile flowers' extract ranged from 6.67% to 26.7%, whereas no mortality was recorded for non-treated control group. The mass of produced eggs varied from 0.23 g (in 8.0% solution) to 0.58 g (in control), with no statistical differences between the treatments and control (P>0.05). Also the chamomile flowers' extract in highest concentration used (8.0%) caused 46.67% failure in egg laying in engorged females while no failure was observed for non-treated control group. Macroscopic observations indicated that in effective concentrations of plant (4.0% and 8.0%), patchy hemorrhagic swelling appeared on the skin of treated ticks. The results presented for the first time in this study imply that chamomile may be considered as a promising plant for biocontrol of cattle fever tick disease in the field condition.

  2. Diversity and distribution of tick species (Acari: Ixodidae) associated with human otoacariasis and socio-ecological risk factors of tick infestations in Sri Lanka.

    Science.gov (United States)

    Ariyarathne, S; Apanaskevich, D A; Amarasinghe, P H; Rajakaruna, R S

    2016-09-01

    Tick infestation in humans is a major public health concern. The diversity and distribution of tick species associated with human otoacariasis was studied in five districts: Anuradhapura, Kandy, Kurunegala, Nuwara Eliya and Ratnapura in the main agro-climatic zones of Sri Lanka. Ticks from patients attending the ear, nose and throat clinics of the General Hospitals were collected during a 3 year period. In total 426 ticks were collected. Most human otoacariasis cases were reported from Kandy (33.8 %) and the fewest from Nuwara Eliya (8.2 %). Of the five tick species identified, nymphs of Dermacentor auratus constituted 90.6 % of the collection. Rhipicephalus sanguineus, Hyalomma isaaci, Haemaphysalis bispinosa and Otobius megnini were found rarely infesting humans possibly as an accidental host; H. bispinosa and O. megnini in the human ear canal were first time records in Sri Lanka. Females and children under 10 years were identified as risk groups of human otoacariasis. Subsequently, a field study was carried out to determine socio-ecological risk factors of human tick infestations in the five districts. Based on hospital data, eight villages with high prevalence of otoacariasis were selected from each district. A total 40 villages were visited and 1674 household members were interviewed. Involvement in outdoor activities, presence of wild animals around the house, location of the house in close proximity to a forest and occupation were identified as major risk factors. PMID:27382981

  3. Morphological characterization of the nymphs Rhipicephalus sanguineus ticks (Latreille, 1806) (Acari: Ixodidae). Description of the testes, integument, Malpighian tubules, and midgut on the detachment day.

    Science.gov (United States)

    De Oliveira, Patrícia Rosa; Calligaris, Izabela Braggião; Roma, Gislaine Cristina; Bechara, Gervásio Henrique; Mathias, Maria Izabel Camargo

    2012-06-01

    This study presents the morpho-histological and histochemical characterization of the testes, integument, Malpighian tubules, and midgut of engorged Rhipicephalus sanguineus nymphs on the detachment day, showing the morphological and physiological characteristics to this phase in the life cycle of these individuals. The testis is constituted by germinative cells (only spermatogonia) with large, round-shaped and strongly stained nuclei which are organized into cysts by a thin layer of somatic cells. The integument consists of a cuticle subdivided into epicuticle (lipoprotein) and procuticle (glycoproteic), and a layer of epithelial cells which present glycolipoprotein elements. The procuticle presents two distinct regions: the exocuticle (next to the epicuticle) and the endocuticle (next to the epithelial layer). The Malpighian tubules present a simple epithelium with small flat and/or cubic cells, which form its wall and delimitates a lumen full of lipoprotein material. The midgut consists of an epithelial wall formed by two types of digestive cells, spent cells and empty digest cells, and by generative cells supported by a basal lamina and a thin layer of muscular tissue. This study described the main organs of engorged nymphs of R. sanguineus, to generate information that can help researchers to better understand the biology of these ectoparasites; which is fundamental for the development of compounds that are less aggressive to the environment. In addition, if the immature stages of the ticks are controlled, the number of adult ticks able to cause damages to the animals--and to the man as well--is also under control. PMID:22615106

  4. First description of the nymph and larva of Dermacentor raskemensis (Acari: Ixodidae), parasites of pikas and other small mammals in Central Asia.

    Science.gov (United States)

    Apanaskevich, Dmitry A

    2013-09-01

    Dermacentor raskemensis Pomerantzev, 1946 is one of the rare Asian species in this genus. The immature stages of this species have never been described. Reexamination of D. raskemensis holdings stored in the United States National Tick Collection revealed a collection lot containing reared nymphs and larvae of this species. This collection made it possible for us to find numerous nymphs and larvae of D. raskemensis among previously unidentified material collected in the field. Both immature stages of D. raskemensis are described here for the first time. Nymphs of D. raskemensis can be distinguished from those of other Dermacentor species in the region by small spiracular plate, relatively short and obtuse lateral projections of basis capituli dorsally, relatively short spurs on coxa I and the internal spur is characteristically very broadly rounded at its apex, and very small spur on coxa IV, whereas larvae of D. raskemensis can be distinguished from other Dermacentor by relatively short and obtuse lateral projections of basis capituli, approximately 6 denticles in the median files on hypostome, and relatively short, broad, and rounded spur on coxa I. The nymphs and larvae of D. raskemensis studied originate from Afghanistan, India, Iran, and Pakistan, where they were collected from pikas and other small mammals. PMID:24180099

  5. Genetic diversity of Ixodes pavlovskyi and I. persulcatus (Acari: Ixodidae) from the sympatric zone in the south of Western Siberia and Kazakhstan.

    Science.gov (United States)

    Livanova, Natalia N; Tikunov, Artem Yu; Kurilshikov, Alexander M; Livanov, Stanislav G; Fomenko, Nataliya V; Taranenko, Dmitrii E; Kvashnina, Anna E; Tikunova, Nina V

    2015-11-01

    The most epidemiologically significant tick species in Siberia involved in transmission of a large number of pathogens causing human infectious diseases is Ixodes persulcatus. Ixodes pavlovskyi, being more active, also poses epidemiological threats. These tick species share morphology, activity seasons and geographic distribution range. In this paper, we characterize the geographic and genetic structures of I. persulcatus and I. pavlovskyi populations inhabiting the southern part of Western Siberia (Russia and Kazakhstan)--the western part of I. pavlovskyi distribution range. The data are based on six distinct Ixodes tick populations. Analysis of the concatenated mitochondrial marker sequences (16S rRNA and COI) and the nuclear sequence (ITS2) showed genetic polymorphisms in both I. persulcatus and I. pavlovskyi ticks inhabiting the sympatric zone. We could not determine the phylogeographic structure of I. pavlovskyi populations whereas for I. persulcatus significant within-region variance was shown. Notably, the abundance of I. persulcatus ticks negatively correlates with nucleotide and haplotype diversity in the concatenated sequence of mitochondrial gene (16S rRNA and COI) fragments. This is the first description of the genetic polymorphism of I. persulcatus and I. pavlovskyi ticks coexisting in a sympatric zone based on analysis of mitochondrial and nuclear markers. PMID:26201397

  6. Reinstatement of Dermacentor bellulus (Acari: Ixodidae) as a Valid Species Previously Confused with D. taiwanensis and Comparison of All Parasitic Stages.

    Science.gov (United States)

    Apanaskevich, Maria A; Apanaskevich, Dmitry A

    2015-07-01

    Re-examination of Dermacentor taiwanensis Sugimoto, 1935 specimens in the United States National Tick Collection revealed that two morphologically distinct Dermacentor species were identified under this name. One of them corresponds to Sugimoto's description of D. taiwanensis, while another species is identical to Schulze's Dermacentor bellulus (Schulze, 1935). The latter species has not been considered valid by recent workers. D. bellulus is reinstated here as a valid species and all its stages are redescribed. The adults of D. taiwanensis are also redescribed, and its immature stages are described for the first time. Males and females of D. bellulus can be distinguished from those of D. taiwanensis by the shape of the conscutum and scutum, color pattern, genital structures, size of the palpi and cornua, and the spurs of coxa I. Nymphs of D. bellulus can be distinguished from those of D. taiwanensis by the shape of the scutum, basis capituli, and the hypostomal dentition. Larvae of D. bellulus can be differentiated from those of D. taiwanensis by the shape of the basis capituli, and the degree of development of the auriculae and spur on palpal segment III ventrally. D. bellulus has been recorded from China, Japan, Nepal, Taiwan, and Vietnam; adults have been collected from wild boars, bears, panda, dog, and human; the immature stages are known from rodents, hares, ferret-badger, and bamboo-partridge. D. taiwanensis is found in China, Taiwan, and Vietnam; adults have been collected from wild boars; the immature stages are known from rodents, hares, mustelids, and domestic dog. PMID:26335464

  7. Acaricidal effects of Corymbia citriodora oil containing para-menthane-3,8-diol against nymphs of Ixodes ricinus (Acari: Ixodidae).

    Science.gov (United States)

    Elmhalli, Fawzeia H; Pålsson, Katinka; Orberg, Jan; Jaenson, Thomas G T

    2009-07-01

    The toxicity of para-menthane-3,8-diol (PMD), the main arthropod-repellent compound in the oil of the lemon eucalyptus, Corymbia citriodora, was evaluated against nymphs of Ixodes ricinus using five methods (A-E) of a contact toxicity bioassay. Mortality rates were estimated by recording numbers of dead nymphs at 30 min intervals during the first 5 h after the start of exposure and at longer intervals thereafter. The mortality rate increased with increasing concentration of PMD and duration of exposure with a distinct effect after 3.5 h. From the results obtained by methods A, C and E, the LC(50) range was 0.035-0.037 mg PMD/cm(2) and the LC(95) range was 0.095-0.097 mg PMD/cm(2) at 4 h of exposure; the LT(50) range was 2.1-2.8 h and the LT(95) range was 3.9-4.2 h at 0.1 mg PMD/cm(2). To determine the duration of toxic activity of PMD, different concentrations (0.002, 0.01, 0.1 mg PMD/cm(2)) were tested and mortality was recorded at each concentration after 1 h; thereafter new ticks were tested. This test revealed that the lethal activity of PMD remained for 24 h but appeared absent after 48 h. The overall results show that PMD is toxic to nymphs of I. ricinus and may be useful for tick control. PMID:19169833

  8. Acaricidal effects of Corymbia citriodora oil containing para-menthane-3,8-diol against nymphs of Ixodes ricinus (Acari: Ixodidae)

    OpenAIRE

    Elmhalli, Fawzeia; Pålsson, Katinka; Örberg, Jan; Jaenson, Thomas

    2009-01-01

    The toxicity of para-menthane-3,8-diol (PMD), the main arthropod-repellent compound in the oil of the lemon eucalyptus, Corymbia citriodora, was evaluated against nymphs of Ixodes ricinus using five methods (A-E) of a contact toxicity bioassay. Mortality rates were estimated by recording numbers of dead nymphs at 30 min intervals during the first 5 h after the start of exposure and at longer intervals thereafter. The mortality rate increased with increasing concentration of PMD and duration o...

  9. Vector-Borne Diseases in Stray Dogs in Peninsular Malaysia and Molecular Detection of Anaplasma and Ehrlichia spp. from Rhipicephalus sanguineus (Acari: Ixodidae) Ticks.

    Science.gov (United States)

    Koh, Fui Xian; Panchadcharam, Chandrawathani; Tay, Sun Tee

    2016-01-01

    Little data are available on the prevalence and transmission of vector-borne diseases in stray dogs in Peninsular Malaysia. This study was designed to determine the occurrence of vector-borne pathogens in Malaysian stray dogs using serological and molecular approaches. In total, 48 dog blood samples were subjected to serological analysis using SNAP 4Dx kit (IDEXX Laboratories, Westbrook, ME). The presence of Ehrlichia and Anaplasma DNA in the dog blood samples and Rhipicephalus sanguineus (Latreille) ticks was detected using nested polymerase chain reaction assays. Positive serological findings against Ehrlichia canis and Anaplasma phagocytophilum were obtained in 17 (39.5%) and four (9.3%) of 43 dog samples, respectively. None of the dog blood samples were positive for Borrelia burgdorferi and Dirofilaria immitis. DNA of E. canis and A. phagocytophilum was detected in 12 (25.5%) and two (4.3%) of 47 dog blood samples, and 17 (51.5%) and one (3.0%) of 33 R. sanguineus ticks, respectively. Additionally, DNA of Ehrlichia spp. closely related to Ehrlichia chaffeensis was detected in two (6.1%) R. sanguineus ticks. This study highlights the prevalence of anaplasmosis and ehrlichiosis in dogs in Malaysia. Due to the zoonotic potential of Ehrlichia and Anaplasma spp., appropriate measures should be instituted for prevention and control of vector-borne diseases in dogs.

  10. Efficacy of amitraz (Taktic 12.5% EC) as a dip for the control of Boophilus microplus (Canestrini) (Acari: Ixodidae) on cattle.

    Science.gov (United States)

    George, J E; Davey, R B; Ahrens, E H; Pound, J M; Drummond, R O

    1998-12-01

    Four groups of cattle infested with Boophilus microplus (Canestrini) were each dipped in a different concentration of amitraz diluted from a 12.5% EC formulation to determine the efficacy and performance of the product in an 11,400 l dipping vat. Except for the period when heifers were dipped, animals were restrained in stanchions placed individually inside 3.3 x 3.3 m2 stalls within an open-sided barn. The amitraz in the vat was stabilized with hydrated lime to maintain a pH of ca. 12. Analyses of vat samples showed that concentrations of amitraz in the vat were 7.6 to 13% lower than the targeted concentrations of 0.010, 0.015, 0.020, and 0.025% active ingredient (AI) for dilutions prepared according to instructions on the manufacturer's label. The large quantity of hydrated lime added to the vat (10 kg/1000 l) interfered with the HPLC analysis of vat samples. Therapeutic efficacy of each of the four observed concentrations (0.0088, 0.0131, 0.0174, and 0.0231% AI) of amitraz was excellent (> 99% control). However, the rapid detachment of all ticks from an animal within a few hours after treatment with amitraz, that has been frequently observed, was not pronounced in the present study. Only 47% of the B. microplus detached in the first 4 h post-treatment, and 84% detached within the first 24 h. All of the treatments, except the lowest concentration, provided protection of cattle against re-infestation by B. microplus larvae for 14 days post-treatment. Possibly as a result of the formation of a compact layer of lime and amitraz on the bottom after the vat was undisturbed for six weeks, intense agitation was required to re-suspend the active ingredient. PMID:9879580

  11. Effect of ricinoleic acid esters from castor oil (Ricinus communis) on the oocyte yolk components of the tick Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae).

    Science.gov (United States)

    Sampieri, Bruno Rodrigues; Arnosti, André; Furquim, Karim Christina Scopinho; Chierice, Gilberto Orivaldo; Bechara, Gervásio Henrique; de Carvalho, Pedro Luiz Pucci Figueiredo; Nunes, Pablo Henrique; Camargo-Mathias, Maria Izabel

    2013-01-31

    Rhipicephalus sanguineus are bloodsucking ectoparasites, whose main host is the domestic dog, thus being present in urban areas and closely located to people. Eventually, this tick species parasitize humans and can become a potential vector of infectious diseases. Methods to control this type of pest have been the focus of many research groups worldwide. The use of natural products is increasingly considered nowadays, due to the low toxicity levels to the host and low waste generation to the environment. This study tested the effect of ricinoleic acid esters from castor oil (as an potential acaricide) on the reproductive system of R. sanguineus females, more specifically on the vitellogenesis process. For this, two groups were established: the control group (CG) and the treatment group (TG) with five rabbits in each (New Zealand White), used as hosts. NaCl and ester were added to rabbits' food and offered to the hosts. After full engorgement, the females were collected and had their ovaries extracted. The ticks ovaries were submitted to histochemical techniques so the effects of esters could be observed over polysaccharides, proteins and lipids yolk. Changes in the deposition of yolk components were observed. This caused modifications on elements of polysaccharide origin and on glycoprotein compounds, interfering in the final yolk synthesis and compromising the development of the future embryo.

  12. Toxicity of extract of Magonia pubescens (Sapindales: Sapindaceae) St. Hil. to control the brown dog tick, Rhipicephalus sanguineus (Latreille)(Acari: Ixodidae)

    Energy Technology Data Exchange (ETDEWEB)

    Fernandes, Fernando F.; D' Alessandro, Walmirton B.; Freitas, Edmeia P.S. [Universidade Federal de Goias (UFG), Goiania, GO (Brazil). Instituto de Patologia Tropical e Saude Publica. Lab. de Artropodologia Medica e Veterinaria]. E-mail: fernandesff@pesquisador.cnpq.br

    2008-03-15

    The action of crude ethanol extract of the stem bark of the soapberry Magonia pubescens St. Hil. was studied upon larvae of the Brown Dog tick Rhipicephalus sanguineus (Latreille). Tick larvae were obtained by maintaining gravid females in an incubator, after collecting them from naturally infested kennels. The tick larvae were placed in envelopes of filter paper impregnated with different concentrations of the extract dissolved in dimethylsulfoxide (DMSO) and distilled water. Four tests were repeated with each solution (n {>=} 120). The control was carried out in DMSO and distilled water. The bioassays were performed at 27{+-}1 deg C, RH {>=} 80% and 12:12 light cycle. Mortality was observed after 48h exposure. All motionless larvae were considered to be dead. The extract of M. pubescens showed larvicidal potential against R. sanguineus. The lethal concentrations of 1503 ppm (LC{sub 50}) and 9991 ppm (LC{sub 99}) were obtained. There was no mortality in the control group. Based on the results of the current study, M. pubescens should be recognized as an future alternative acaricide for the control of Brown Dog tick. These results reinforce the importance of the preservation of this soapberry in its natural biome. (author)

  13. Activity studies of sesquiterpene oxides and sulfides from the plant Hyptis suaveolens (Lamiaceae) and its repellency on Ixodes ricinus (Acari: Ixodidae).

    Science.gov (United States)

    Ashitani, T; Garboui, S S; Schubert, F; Vongsombath, C; Liblikas, I; Pålsson, K; Borg-Karlson, A-K

    2015-12-01

    Hyptis suaveolens (Lamiaceae), a plant traditionally used as a mosquito repellent, has been investigated for repellent properties against nymphs of the tick Ixodes ricinus. Essential oils and volatile compounds of fresh and dried leaves, from plants originating from Laos and Guinea-Bissau, were identified by GC-MS and tested in a tick repellency bioassay. All the essential oils were strongly repellent against the ticks, even though the main volatile constituents differed in their proportions of potentially tick repellent chemicals. (+)/(-)-sabinene were present in high amounts in all preparations, and dominated the emission from dry and fresh leaves together with 1,8-cineol and α-phellandrene. 1,8-Cineol and sabinene were major compounds in the essential oils from H. suaveolens from Laos. Main compounds in H. suaveolens from Guinea-Bissau were (-)-sabinene, limonene and terpinolene. Among the sesquiterpene hydrocarbons identified, α-humulene exhibited strong tick repellency (96.8 %). Structure activity studies of oxidation or sulfidation products of germacrene D, α-humulene and β-caryophyllene, showed increased tick repellent activity: of mint sulfide (59.4 %), humulene-6,7-oxide (94.5 %) and caryophyllene-6,7-oxide (96.9 %). The substitution of oxygen with sulfur slightly lowered the repellency. The effects of the constituents in the oils can then be regarded as a trade off between the subsequently lower volatility of the sesquiterpene derivatives compared to the monoterpenes and may thus increase their potential usefulness as tick repellents. PMID:26385208

  14. Differential transcription of two highly divergent gut-expressed Bm86 antigen gene homologues in the tick Rhipicephalus appendiculatus (Acari: Ixodida).

    Science.gov (United States)

    Kamau, L; Skilton, R A; Odongo, D O; Mwaura, S; Githaka, N; Kanduma, E; Obura, M; Kabiru, E; Orago, A; Musoke, A; Bishop, R P

    2011-02-01

    The transcriptional control of gene expression is not well documented in the Arthropoda. We describe transcriptional analysis of two exceptionally divergent homologues (Ra86) of the Bm86 gut antigen from Rhipicephalus appendiculatus. Bm86 forms the basis of a commercial vaccine for the control of Rhipicephalus (Boophilus) microplus. The R. appendiculatus Ra86 proteins contain 654 and 693 amino acids, with only 80% amino acid sequence identity. Reverse-transcription PCR of gut cDNA showed transcription of only one genotype in individual female ticks. PCR amplification of 3' untranslated sequences from genomic DNA indicated that both variants could be encoded within a single genome. When both variants were present, one of the two Ra86 genotypes was transcriptionally dominant. PMID:20854482

  15. Efficacy of the Bm86 antigen against immature instars and adults of the dog tick Rhipicephalus sanguineus (Latreille, 1806) (Acari: Ixodidae).

    Science.gov (United States)

    Perez-Perez, D; Bechara, G H; Machado, R Z; Andrade, G M; Del Vecchio, R E M; Pedroso, M S; Hernández, M V; Farnós, O

    2010-02-10

    The Bm86 antigen has been used to control ticks of the Boophilus genera in integrated programs that also include the use of acaricides. Because of recent phylogenetic studies have lead to the inclusion of all Boophilus species within the Rhipicephalus genera, we aimed to investigate the efficacy of the Bm86 antigen on the biotic potential of Rhipicephalus sanguineus. Domestic dogs were vaccinated with Bm86 and challenged with the three instars of R. sanguineus. Male and female mongrel dogs were divided into two groups of four animals each, comprising non-vaccinated and vaccinated animals. Immunized dogs were given two doses of an experimental formulation containing 50mug of recombinant Bm86, at 21 days interval while the other group was given placebo, consisting of the same preparation without Bm86. Each dog was challenged 21 days after the last dose with 250 larvae, 100 nymphs and 55 adults (25 females and 30 males) released inside feeding chambers (one per instar) glued to their shaved flank. The effect of the vaccination was evaluated by determining biological parameters of ticks including the yield rates of larvae, nymphs and adult females. Adult females engorged weight, egg mass weight, efficiency rate of conversion to eggs (ERCE) and hatchability. In addition, sera were collected from dogs at 0, 21, 36, 45 and 75 days after the vaccination and used for the detection of specific antibodies by ELISA. Collection rates of larvae, nymphs and adult females fed on vaccinated dogs were significantly (pBm86. We concluded that the Bm86 antigen used as a vaccine for dogs reduced the viability and biotic potential of the R. sanguineus. PMID:19836894

  16. Control de Rhipicephalus microplus (Acari: Ixodidae) mediante el uso del hongo entomopatógeno Metarhizium anisopliae (Hypocreales: Clavicipitaceae). Revisión

    OpenAIRE

    Melina Maribel Ojeda-Chi; Roger Ivan Rodríguez-Vivas; Edelmira Galindo-Velasco; Roberto Lezama-Gutiérrez; Carlos Cruz-Vázquez

    2011-01-01

    Las infestaciones de la garrapata del ganado, Rhipicephalus microplus, producen el mayor problema global de ectoparásitos en ganado de regiones tropicales y subtropicales, provocan importantes pérdidas económicas en la producción de carne, leche y pieles, además incrementan los gastos derivados de los programas de control, y son capaces de transmitir Babesia bovis, B. bigemina y Anaplasma marginale. El control de R. microplus se basa principalmente en el uso de ixodicidas, sin embargo, su uso...

  17. Interspecific differences between small mammals as hosts of immature Dermacentor variabilis (Acari: Ixodidae) and a model for detection of high risk areas of Rocky Mountain spotted fever.

    Science.gov (United States)

    Kollars, T M

    1996-10-01

    Fourteen species of small mammals were captured from July 1990 through August 1991 in Tennessee, from which 1,217 immature Dermacentor variabilis and 1 Ixodes dentatus were collected. Mammal species were given scores of importance (TS) as hosts to immature D. variabilis based on mean intensity and prevalence. The rice rat ranked the highest, with a TS = 5, followed by the golden mouse TS = 4, white-footed mouse TS = 3, pine vole TS = 2, cotton rat TS = 1, with the Norway rat, house mouse, and short-tailed shrew all having a TS = 0. Assigning a TS allows a quantitative method for differentiating and ranking small mammals as hosts for immature D. variabilis. Relative abundance of a species can also be important in determining D. variabilis populations, even with a low TS. The potential of Rocky Mountain spotted fever (RMSFP) to occur in an area was estimated using the total score of small mammal hosts in an area and multiplying the relative abundance of important host species. The RMSFP of a site, based only upon small mammal species composition and relative abundance of important host species, was an accurate estimate of adult D. variabilis infesting raccoons and opossums at that trap site (P < or = 0.001). A RMSFP of 1.61 is needed to produce an estimated 252 adults per ha (RMSF threshold) at 98% survival of engorged immature ticks (P < 0.001). PMID:8885876

  18. Myrmecophilous pygmephoroid mites (Acari: Pygmephoroidea) associated with Lasius flavus (Hymenoptera: Formicidae) in Russia.

    Science.gov (United States)

    Khaustov, Alexander A

    2015-11-19

    Twenty four species of pygmephoroid mites (Acari: Pygmephoroidea: Neopygmephoridae, Scutacaridae, Microdispidae) are recorded from the ant Lasius flavus (Fabricius) or from its nests from Western Siberia and Crimea. Four of them of the genus Scutacarus Gros, 1845 (Acari: Scutacaridae), S. insolitus sp. nov., S. heterotrichus sp. nov., S. moseri sp. nov. and S. sibiriensis sp. nov. are described as new for science. Four species of scutacarid mites are recorded for the first time in Russia. The comparison of pygmephoroid mite communities associated with Lasius flavus from Crimean and West Siberian populations and notes on phoresy of pygmephoroid mites on ants are provided.

  19. Ocorrência de ixodidae parasitos de capivara (Hydrochoerus hydrochaeris linnaeus, 1766 na estação ecológica do Taim, Rio Grande - RS, Brasil Occurence of ixodidae parasites of capybara (Hydrochoeurus hydrochaeris linnaeus, 1766 in the ecologic area of Taim, Rio Grande - RS, Brazil

    Directory of Open Access Journals (Sweden)

    Afonso Lodovico Sinkoc

    1997-03-01

    Full Text Available O objetivo deste trabalho foi identificar as espécies de carrapatos observadas sobre capivaras na Estação Ecológica do Taim, Rio Grande- RS, Brasil. Foram examinadas 27 capivaras encontradas mortas por atropelamento na BR 471, em seu trecho que corta a Estação, sendo cole lados 497 carrapatos das espécies Amblyomma cooperi (=A. lutzi; = A. ypisilophorum, Amblyomma triste, Amblyomma tigrinum e ninfas do gênero Amblyomma. A. cooperi representou 68,41% dos carrapatos identificados, com uma freqüência de parasitismo de 92,60% dos hospedeiros, enquanto A. triste representou 24,75% dos carrapatos em 44,43% dos hospedeiros e A. tigrinum foi coletado em 14,81% dos hospedeiros, totalizando 1,21% dos carrapatos. As ninfas de Amblyomma sp. foram cotetadas em 18,51% dos hospedeiros apresentando um percentual de 5,63% do total de carrapatos. A relação macho : fêmea apresentou valores de 2,3 : 1 e 2 : l para o A. cooperi e A. triste, respectivamente. Todos hospedeiros apresentavam-se parasitados, com uma média de 18,4 carrapatos, variando de 1 a 64 carrapatos coletados por hospedeiro.The aim of this article was the identification ofthe tick species observed on capybara in wildlife in the Ecologic Area of Taim, Rio Grande - RS; Brazil. Twenly seven capybaras found dead by trample in the road BR 471 in the Ecologic Area, wereexamined ticks coilected of the species Amblyomma cooperi (= A. lutzi and = A. ypisilophorum, Amblyomma triste, Amblyomma tigrinum and ninphs of the Genus Amblyomma. Amblyomma cooperi represented 68.41% of the ticks with a frequency of parasitism of 92.60% of the hosts; Amblyomma triste species represented 24.75% of the collected ticks m 44.43% of the hosts; Amblyomma tigrinum species were coilected m 14.81% of the hosts from a total of 1.21% of the found ticks and, the nimphs of Amblyomma were coilected in 18.51% of the hosts per forming 5.63% of the ali ticks coilected. The relation mate .female showed values of 2.3:1 and 2

  20. Phytocystatins: Defense Proteins against Phytophagous Insects and Acari

    Science.gov (United States)

    Martinez, Manuel; Santamaria, Maria Estrella; Diaz-Mendoza, Mercedes; Arnaiz, Ana; Carrillo, Laura; Ortego, Felix; Diaz, Isabel

    2016-01-01

    This review deals with phytocystatins, focussing on their potential role as defence proteins against phytophagous arthropods. Information about the evolutionary, molecular and biochemical features and inhibitory properties of phytocystatins are presented. Cystatin ability to inhibit heterologous cysteine protease activities is commented on as well as some approaches of tailoring cystatin specificity to enhance their defence function towards pests. A general landscape on the digestive proteases of phytophagous insects and acari and the remarkable plasticity of their digestive physiology after feeding on cystatins are highlighted. Biotechnological approaches to produce recombinant cystatins to be added to artificial diets or to be sprayed as insecticide–acaricide compounds and the of use cystatins as transgenes are discussed. Multiple examples and applications are included to end with some conclusions and future perspectives. PMID:27775606

  1. Phytocystatins: Defense Proteins against Phytophagous Insects and Acari

    Directory of Open Access Journals (Sweden)

    Manuel Martinez

    2016-10-01

    Full Text Available This review deals with phytocystatins, focussing on their potential role as defence proteins against phytophagous arthropods. Information about the evolutionary, molecular and biochemical features and inhibitory properties of phytocystatins are presented. Cystatin ability to inhibit heterologous cysteine protease activities is commented on as well as some approaches of tailoring cystatin specificity to enhance their defence function towards pests. A general landscape on the digestive proteases of phytophagous insects and acari and the remarkable plasticity of their digestive physiology after feeding on cystatins are highlighted. Biotechnological approaches to produce recombinant cystatins to be added to artificial diets or to be sprayed as insecticide–acaricide compounds and the of use cystatins as transgenes are discussed. Multiple examples and applications are included to end with some conclusions and future perspectives.

  2. The complete mitochondrial genome of Tetranychus truncatus Ehara (Acari: Tetranychidae).

    Science.gov (United States)

    Chen, Da-Song; Jin, Peng-Yu; Hong, Xiao-Yue

    2016-01-01

    The complete mitochondrial genome of Tetranychus truncatus Ehara (Acari: Tetranychidae) is a typical circular DNA with length of 13,089 bp (GenBank accession number: KM111296). The genome contains all 13 protein-coding genes (PCGs), an A + T-rich region, two rRNA genes and 22 tRNA genes. The A + T content of the mitochondrial genome is 84.5%. The AT-skew is positive (0.032) while the GC-skew is negative (-0.058). The gene arrangement is conserved in T. urticae, Panonychus citri and P. ulmi which are in the same family (Tetranychidae). The A + T-rich region is only 43 bp in length with high A + T content (97.7%). All the PCGs start with typical ATD codons. Eight PCGs have complete TAA stop codons, while five PCGs have an incomplete stop codon (T). PMID:25162745

  3. Antibiotic treatment of the tick vector Amblyomma americanum reduced reproductive fitness.

    Directory of Open Access Journals (Sweden)

    Jianmin Zhong

    Full Text Available BACKGROUND: The lone star tick Amblyomma americanum is a common pest and vector of infectious diseases for humans and other mammals in the southern and eastern United States. A Coxiella sp. bacterial endosymbiont was highly prevalent in both laboratory-reared and field-collected A. americanum. The Coxiella sp. was demonstrated in all stages of tick and in greatest densities in nymphs and adult females, while a Rickettsia sp. was less prevalent and in lower densities when present. METHODOLOGY/PRINCIPAL FINDINGS: We manipulated the numbers of both bacterial species in laboratory-reared A. americanum by injecting engorged nymphs or engorged, mated females with single doses of an antibiotic (rifampin or tetracycline or buffer alone. Burdens of the bacteria after molting or after oviposition were estimated by quantitative polymerase chain reaction with primers and probes specific for each bacterial species or, as an internal standard, the host tick. Post-molt adult ticks that had been treated with rifampin or tetracycline had lower numbers of the Coxiella sp. and Rickettsia sp. and generally weighed less than ticks that received buffer alone. Similarly, after oviposition, females treated previously with either antibiotic had lower burdens of both bacterial species in comparison to controls. Treatment of engorged females with either antibiotic was associated with prolonged time to oviposition, lower proportions of ticks that hatched, lower proportions of viable larvae among total larvae, and lower numbers of viable larvae per tick. These fitness estimators were associated with reduced numbers of the Coxiella sp. but not the Rickettsia sp. CONCLUSION/SIGNIFICANCE: The findings indicate that the Coxiella sp. is a primary endosymbiont, perhaps provisioning the obligately hematophagous parasites with essential nutrients. The results also suggest that antibiotics could be incorporated into an integrated pest management plan for control of these and other

  4. Characterization of the bacterial communities of life stages of free living lone star ticks (Amblyomma americanum.

    Directory of Open Access Journals (Sweden)

    Amanda Jo Williams-Newkirk

    Full Text Available The lone star tick (Amblyomma americanum is an abundant and aggressive biter of humans, domestic animals, and wildlife in the southeastern-central USA and an important vector of several known and suspected zoonotic bacterial pathogens. However, the biological drivers of bacterial community variation in this tick are still poorly defined. Knowing the community context in which tick-borne bacterial pathogens exist and evolve is required to fully understand the ecology and immunobiology of the ticks and to design effective public health and veterinary interventions. We performed a metagenomic survey of the bacterial communities of questing A. americanum and tested 131 individuals (66 nymphs, 24 males, and 41 females from five sites in three states. Pyrosequencing was performed with barcoded eubacterial primers targeting variable 16S rRNA gene regions 5-3. The bacterial communities were dominated by Rickettsia (likely R. amblyommii and an obligate Coxiella symbiont, together accounting for 6.7-100% of sequences per tick. DNAs from Midichloria, Borrelia, Wolbachia, Ehrlichia, Pseudomonas, or unidentified Bacillales, Enterobacteriaceae, or Rhizobiales groups were also detected frequently. Wolbachia and Midichloria significantly co-occurred in Georgia (p<0.00001, but not in other states. The significance of the Midichloria-Wolbachia co-occurrence is unknown. Among ticks collected in Georgia, nymphs differed from adults in both the composition (p = 0.002 and structure (p = 0.002 of their bacterial communities. Adults differed only in their community structure (p = 0.002 with males containing more Rickettsia and females containing more Coxiella. Comparisons among adult ticks collected in New York and North Carolina supported the findings from the Georgia collection despite differences in geography, collection date, and sample handling, implying that the differences detected are consistent attributes. The data also suggest that some members of

  5. Isolation of Tacaribe virus, a Caribbean arenavirus, from host-seeking Amblyomma americanum ticks in Florida.

    Directory of Open Access Journals (Sweden)

    Katherine A Sayler

    Full Text Available Arenaviridae are a family of single stranded RNA viruses of mammals and boid snakes. Twenty-nine distinct mammalian arenaviruses have been identified, many of which cause severe hemorrhagic disease in humans, particularly in parts of sub-Saharan Africa, and in Central and South America. Humans typically become infected with an arenavirus through contact with excreta from infected rodents. Tacaribe virus (TCRV is an arenavirus that was first isolated from bats and mosquitoes during a rabies surveillance survey conducted in Trinidad from 1956 to 1958. Tacaribe virus is unusual because it has never been associated with a rodent host and since that one time isolation, the virus has not been isolated from any vertebrate or invertebrate hosts. We report the re-isolation of the virus from a pool of 100 host-seeking Amblyomma americanum (lone star ticks collected in a Florida state park in 2012. TCRV was isolated in two cell lines and its complete genome was sequenced. The tick-derived isolate is nearly identical to the only remaining isolate from Trinidad (TRVL-11573, with 99.6% nucleotide identity across the genome. A quantitative RT-PCR assay was developed to test for viral RNA in host-seeking ticks collected from 3 Florida state parks. Virus RNA was detected in 56/500 (11.2% of surveyed ticks. As this virus was isolated from ticks that parasitize humans, the ability of the tick to transmit the virus to people should be evaluated. Furthermore, reservoir hosts for the virus need to be identified in order to develop risk assessment models of human infection.

  6. Amblyomma maculatum Feeding Augments Rickettsia parkeri Infection in a Rhesus Macaque Model: A Pilot Study.

    Science.gov (United States)

    Banajee, Kaikhushroo H; Embers, Monica E; Langohr, Ingeborg M; Doyle, Lara A; Hasenkampf, Nicole R; Macaluso, Kevin R

    2015-01-01

    Rickettsia parkeri is an emerging eschar-causing human pathogen in the spotted fever group of Rickettsia and is transmitted by the Gulf coast tick, Amblyomma maculatum. Tick saliva has been shown to alter both the cellular and humoral components of the innate and adaptive immune systems. However, the effect of this immunomodulation on Rickettsia transmission and pathology in an immunocompetent vertebrate host has not been fully examined. We hypothesize that, by modifying the host immune response, tick feeding enhances infection and pathology of pathogenic spotted fever group Rickettsia sp. In order to assess this interaction in vivo, a pilot study was conducted using five rhesus macaques that were divided into three groups. One group was intradermally inoculated with low passage R. parkeri (Portsmouth strain) alone (n = 2) and another group was inoculated during infestation by adult, R. parkeri-free A. maculatum (n = 2). The final macaque was infested with ticks alone (tick feeding control group). Blood, lymph node and skin biopsies were collected at several time points post-inoculation/infestation to assess pathology and quantify rickettsial DNA. As opposed to the tick-only animal, all Rickettsia-inoculated macaques developed inflammatory leukograms, elevated C-reactive protein concentrations, and elevated TH1 (interferon-γ, interleukin-15) and acute phase inflammatory cytokines (interleukin-6) post-inoculation, with greater neutrophilia and interleukin-6 concentrations in the tick plus R. parkeri group. While eschars formed at all R. parkeri inoculation sites, larger and slower healing eschars were observed in the tick feeding plus R. parkeri group. Furthermore, dissemination of R. parkeri to draining lymph nodes early in infection and increased persistence at the inoculation site were observed in the tick plus R. parkeri group. This study indicates that rhesus macaques can be used to model R. parkeri rickettsiosis, and suggests that immunomodulatory factors

  7. The complete mitochondrial genome of the scab mite Psoroptes cuniculi (Arthropoda: Arachnida) provides insights into Acari phylogeny

    OpenAIRE

    Gu, Xiao-Bin; Liu, Guo-Hua; Song, Hui-Qun; Liu, Tian-Yu; Yang, Guang-You; Zhu, Xing-Quan

    2014-01-01

    Background Limited available sequence information has greatly impeded population genetics, phylogenetics and systematics studies in the subclass Acari (mites and ticks). Mitochondrial (mt) DNA is well known to provide genetic markers for investigations in these areas, but complete mt genomic data have been lacking for many Acari species. Herein, we present the complete mt genome of the scab mite Psoroptes cuniculi. Methods P. cuniculi was collected from a naturally infected New Zealand white ...

  8. Efficacy of Rhipicephalus (Boophilus) microplus Bm86 against Hyalomma dromedarii and Amblyomma cajennense tick infestations in camels and cattle.

    Science.gov (United States)

    Rodríguez-Valle, Manuel; Taoufik, Amar; Valdés, Mario; Montero, Carlos; Ibrahin, Hassan; Hassan, Shawgi Mohammed; Jongejan, Frans; de la Fuente, Jose

    2012-05-14

    The recombinant Bm86-based tick vaccines have shown their efficacy for the control of cattle ticks, Rhipicephalus (Boophilus) microplus and R. annulatus infestations. However, cattle ticks often co-exist with multi-host ticks such as Hyalomma and Amblyomma species, thus requiring the control of multiple tick infestations for cattle and other hosts. Vaccination trials using a R. microplus recombinant Bm86-based vaccine were conducted in cattle and camels against Hyalomma dromedarii and in cattle against Amblyomma cajennense immature and adult ticks. The results showed an 89% reduction in the number of H. dromedarii nymphs engorging on vaccinated cattle, and a further 32% reduction in the weight of the surviving adult ticks. In vaccinated camels, a reduction of 27% and 31% of tick engorgement and egg mass weight, respectively was shown, while egg hatching was reduced by 39%. However, cattle vaccination with Bm86 did not have an effect on A. cajennense tick infestations. These results showed that Bm86 vaccines are effective against R. microplus and other tick species but improved vaccines containing new antigens are required to control multiple tick infestations. PMID:22446633

  9. Recovery of some of the missing wrappers of Berlese's Acari, Myriopoda et Scorpiones

    NARCIS (Netherlands)

    Hammen, van der L.

    1986-01-01

    Reproductions are given of the original wrappers of A. Berlese's Acari, Myriopoda et Scorpiones, fasc. II, IV, VI, VII and XIV. These wrappers (on some of which the first descriptions of new species are published) could not be included in the 1979 reprint edition of the work, as no extant copies of

  10. A new pomegranate pest for Turkey; Pomegranate false spidermite, Tenuipalpus punicae Pirtchard and Baker (Acari: Tenuipalpidae)

    OpenAIRE

    DÖKER, İsmail; KAZAK, Cengiz; KARUT, Kamil

    2013-01-01

    In this study, the pomegranate false spider mite Tenuipalpus punicae Pirtchard and Baker (Acari: Tenuipalpidae) collected from pomegranate growing areas of Adana province is determined for the first record for Turkish mite fauna. Some information related to world distribution, damage, biology and control of this pest are presented in the paper.

  11. Primeiro registro de Tetranychus urticae (Acari: Tetranychidae em mudas de teca no Brasil

    Directory of Open Access Journals (Sweden)

    Alexandre dos Santos

    2014-07-01

    Full Text Available O ácaro fitófago Tetranychus urticae (Kock, 1836 (Acari: Tetranychidae foi relatado e suas injúrias caracterizadas pela primeira vez em viveiro de produção mudas de teca (Tectona grandis no Brasil.

  12. Stigmaeus ceylani, a new species of the genus Stigmaeus Koch (Acari: Stigmaeidae) from Turkey

    OpenAIRE

    Uluçay, İsmail

    2015-01-01

    In this study a new species of Stigmaeus Koch (Acari: Stigmaeidae), Stigmaeus ceylani sp. nov., is described and illustrated. Specimens have been collected from the soil and litter under Punica granatum, 2014, İskenderun, Hatay, Turkey. Besides, the male, female, deutonymph, protonymph and larva of the species are illustrated in this article.  

  13. Sexual selection and mating behavior in spider mites of the genus Tetranychus (Acari: Tetranychidae)

    NARCIS (Netherlands)

    Oku, K.

    2014-01-01

    As sexual selection is a coevolutionary process between males and females, various morphological and behavioral traits have evolved in each sex. In the tetranychid mites Tetranychus urticae Koch and T. kanzawai Kishida (Acari: Tetranychidae), males can mate repeatedly, whereas females normally accep

  14. Investigations of Gamasina mites in natural and man-affected soils in Latvia (Acari: Mesostigmata)

    NARCIS (Netherlands)

    Salmane, I.

    2003-01-01

    Investigations of Gamasina mites in natural and man-affected soils in Latvia (Acari: Mesostigmata) A short overview is presented on Gamasina material collected in 22 natural and man-disturbed habitats in Latvia. Species diversity, average density and species dominance were investigated. Altogether 1

  15. De corticole fauna van platanen: i. Arachniden (Arachnida: Araneae, Pseudoscorpiones, Acari)

    NARCIS (Netherlands)

    Noordijk, J.; Berg, M.P.

    2001-01-01

    The corticolous fauna of plane trees: I. Arachnids (Arachnida: Araneae, Pseudoscorpiones, Acari) From February until September 2000 an inventory was made of the bark-dwelling arthropod fauna of more than 400 plane trees (Platanus hybrida), all over the Netherlands. Arthropods were collected from bar

  16. Amblyomma americanum as a Bridging Vector for Human Infection with Francisella tularensis.

    Directory of Open Access Journals (Sweden)

    Rinosh J Mani

    Full Text Available The γ-proteobacterium Francisella tularensis causes seasonal tick-transmitted tularemia outbreaks in natural rabbit hosts and incidental infections in humans in the south-central United States. Although Dermacentor variabilis is considered a primary vector for F. tularensis, Amblyomma americanum is the most abundant tick species in this endemic region. A systematic study of F. tularensis colonization of A. americanum was undertaken to better understand its potential to serve as an overwintering reservoir for F. tularensis and as a bridging vector for human infections. Colony-reared A. americanum were artificially fed F. tularensis subspecies holarctica strain LVS via glass capillaries and colonization levels determined. Capillary-fed larva and nymph were initially infected with 10(4 CFU/tick which declined prior to molting for both stages, but rebounded post-molting in nymphs and persisted in 53% at 10(3 to 10(8 CFU/nymph at 168 days post-capillary feeding (longest sampling time in the study. In contrast, only 18% of adults molted from colonized nymphs maintained LVS colonization at 10(1 to 10(5 CFU/adult at 168 days post-capillary feeding (longest sampling time. For adults, LVS initially colonized the gut and disseminated to salivary glands by 24 h and had an ID50 of <5CFU in mice. Francisella tularensis infected the ovaries of gravid females, but transmission to eggs was infrequent and transovarial transmission to hatched larvae was not observed. The prolonged persistence of F. tularensis in A. americanum nymphs supports A. americanum as an overwintering reservoir for F. tularensis from which seasonal epizootics may originate; however, although the rapid dissemination of F. tularensis from gut to salivary glands in adults A. americanum is compatible with intermittent feeding adult males acting as bridging vectors for incidental F. tularensis infections of humans, acquisition of F. tularensis by adults may be unlikely based on adult feeding

  17. Crimean-Congo hemorrhagic fever:a molecular survey on hard ticks (Ixodidae) in Yazd province, Iran

    Institute of Scientific and Technical Information of China (English)

    Salim Abadi Yaser; Chinikar Sadegh; Telmadarraiy Zakkyeh; Vatandoost Hassan; Moradi Maryam; Oshaghi Mohammad Ali; Ghiasi Seyed Mojtaba

    2011-01-01

    Objective: To determine the rate of Crimean-Congo hemorrhagic fever virus (CCHFV) infection in hard ticks (Ixodidae) in Yazd province of Iran. Methods: A molecular survey on hard ticks(Ixodidae) was conducted in Yazd province during 2008 -2009. A total of 140 hard ticks (three genera and 7 species) were collected from randomly selected villages and were exanimate for presence of CCHFV reverse transcription-polymerase chain reaction (RT-PCR) method. Results:CCHFV genome was found in 5.71% of hard ticks. All positive ticks were from Hyalomma genus. Positive ticks including: Hyalomma dromedarii, Hyalomma marginatum, Hyalomma anatolicum,Hyalomma detritum, Hyalomma asiaticum . We were not able to find virus in in Rhipicephalus sanguineus and Dermacentor marginatus. Results exhibited that Hyalomma is the main vector in the study area. Conclusions: Due to the presence of virus in 24 provinces' out of 31, we recommend the use of acaricides and repellent to prevent disease transmission among humans. Greta care should be taken by the people who are working in slaughter houses.

  18. Molecular detection of the human pathogenic Rickettsia sp. strain Atlantic rainforest in Amblyomma dubitatum ticks from Argentina.

    Science.gov (United States)

    Monje, Lucas D; Nava, Santiago; Eberhardt, Ayelen T; Correa, Ana I; Guglielmone, Alberto A; Beldomenico, Pablo M

    2015-02-01

    To date, three tick-borne pathogenic Rickettsia species have been reported in different regions of Argentina, namely, R. rickettsii, R. parkeri, and R. massiliae. However, there are no reports available for the presence of tick-borne pathogens from the northeastern region of Argentina. This study evaluated the infection with Rickettsia species of Amblyomma dubitatum ticks collected from vegetation and feeding from capybaras (Hydrochoerus hydrochaeris) in northeastern Argentina. From a total of 374 A. dubitatum ticks collected and evaluated by PCR for the presence of rickettsial DNA, 19 were positive for the presence of Rickettsia bellii DNA, two were positive for Rickettsia sp. strain COOPERI, and one was positive for the pathogenic Rickettsia sp. strain Atlantic rainforest. To our knowledge, this study is the first report of the presence of the human pathogen Rickettsia sp. strain Atlantic rainforest and Rickettsia sp. strain COOPERI in Argentina. Moreover, our findings posit A. dubitatum as a potential vector for this pathogenic strain of Rickettsia.

  19. Determination of hard tick species (Acarina:Ixodidae) on sheep and cattle in Hamedan Province, Iran

    Institute of Scientific and Technical Information of China (English)

    Jamal Gharekhani; Abbas Gerami-Sadeghian; Zivar Sadeghi-Dehkordi; Mohammadreza Youssefi

    2015-01-01

    Objective: To determine the fauna and frequency of hard tick species on sheep and cattle in Hamedan Province, Western Iran. Methods: Tick sampling was performed on the whole body of 18000 sheep and 4200 cattle in 3 rural regions (mountain, plateau, and plain-mountainous zone) during the year of 2010 to 2011. The ticks were identified with appropriate identification keys. Results: A total of 1534 hard ticks (62.1% male and 37.9% female) were collected in animals. The infestation rate was found 2.4% in animals (4.2% in cattle and 2.0% in sheep). The ticks were classified into 3 genera and 7 species including: Hyalomma marginatum (34.1%), Hyalomma excavatum (29.7%), Rhipicephalus bursa (13.8%), Rhipicephalus sanguineus (7.5%), Hyalomma detritum (7.1%), Haemaphysalis punctata (5.1%) and Hyalomma dromedarii (2.7%). Conclusions: Current study is the first report of fauna and frequency of hard ticks in this region. The results showed that Hyalomma marginatum is the dominant hard tick species. Further studies are needed to determine the importance of Ixodidae ticks of veterinary and public health in this region of Iran.

  20. Amblyomma sculptum tick saliva: α-Gal identification, antibody response and possible association with red meat allergy in Brazil.

    Science.gov (United States)

    Araujo, Ricardo Nascimento; Franco, Paula Ferreira; Rodrigues, Henrique; Santos, Luiza C B; McKay, Craig S; Sanhueza, Carlos A; Brito, Carlos Ramon Nascimento; Azevedo, Maíra Araújo; Venuto, Ana Paula; Cowan, Peter J; Almeida, Igor C; Finn, M G; Marques, Alexandre F

    2016-03-01

    The anaphylaxis response is frequently associated with food allergies, representing a significant public health hazard. Recently, exposure to tick bites and production of specific IgE against α-galactosyl (α-Gal)-containing epitopes has been correlated to red meat allergy. However, this association and the source of terminal, non-reducing α-Gal-containing epitopes have not previously been established in Brazil. Here, we employed the α-1,3-galactosyltransferase knockout mouse (α1,3-GalT-KO) model and bacteriophage Qβ-virus like particles (Qβ-VLPs) displaying Galα1,3Galβ1,4GlcNAc (Galα3LN) epitopes to investigate the presence of α-Gal-containing epitopes in the saliva of Amblyomma sculptum, a species of the Amblyomma cajennense complex, which represents the main tick that infests humans in Brazil. We confirmed that the α-1,3-galactosyltransferase knockout animals produce significant levels of anti-α-Gal antibodies against the Galα1,3Galβ1,4GlcNAc epitopes displayed on Qβ-virus like particles. The injection of A. sculptum saliva or exposure to feeding ticks was also found to induce both IgG and IgE anti-α-Gal antibodies in α-1,3-galactosyltransferase knockout mice, thus indicating the presence of α-Gal-containing epitopes in the tick saliva. The presence of α-Gal-containing epitopes was confirmed by ELISA and immunoblotting following removal of terminal α-Gal epitopes by α-galactosidase treatment. These results suggest for the first known time that bites from the A. sculptum tick may be associated with the unknown etiology of allergic reactions to red meat in Brazil.

  1. Avaliação in vitro da eficácia de acaricidas sobre Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae de bovinos no município de Ilhéus, Bahia, Brasil In vitro valuation of acaricides efficiency to Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae from bovines at the region of Ilhéus, Bahia, Brazil

    Directory of Open Access Journals (Sweden)

    Dunezeu Alves Campos Júnior

    2005-12-01

    Full Text Available O carrapato Boophilus microplus é a espécie de maior distribuição geográfica e importância econômica para os países produtores de bovinos em áreas tropicais e sub-tropicais do planeta. No Brasil, a Região Nordeste apresenta algumas áreas mais favoráveis para as infestações do gado. O controle químico ainda é a forma mais eficaz de combate deste ectoparasita, mas o manejo inadequado dos acaricidas tem contribuído com o aparecimento de resistência de populações aos produtos disponíveis no mercado. O município de Ilhéus, na Região Cacaueira da Bahia, vem incrementando sua atividade pecuária em substituição à lavoura cacaueira devastada. Foram realizados 30 testes de imersão in vitro (biocarrapaticidogramas com fêmeas ingurgitadas de B. microplus colhidas em propriedades rurais aleatoriamente selecionadas num grupo de 96 entrevistadas na região. O estudo revelou a existência de resistência ou sensibilidade de populações de B. microplus frente aos carrapaticidas de contato mais utilizados nas propriedades de exploração pecuária da região de Ilhéus. Os quatro carrapaticidas testados apresentaram as seguintes eficiências médias: Amitraz - 30,95%; Deltametrina - 65,04%; Cipermetrina / diclorvos - 75,73%; e Triclorfon / coumaphos / cyfluthrin - 75,13%.The tick Boophilus microplus is the species with the greatest geographical distribution and economic importance for the countries situated at tropical and sub-tropical zones of the planet. In Brazil, the Northwest Region is showed as the most favorable to the cattle infestation. Chemical control is an efficient control method employed, but the inadequate handling of acaricides contributed for to the onset of resistant ticks to the available acaricides in the market. The county of Ilhéus, at the Cocoa's Region from Bahia, has been increasing the cattle activity instead of the devastated cocoa's plantations. Between April and September 2000, in vitro imersion tests were performed with engorged females of B. microplus collected from 30 farms randomly chosen in a group of 96 interviewed at the region. The current study showed the existence of resistance or sensibility of the populations of B. microplus to the contact acaricides commonly used at cattle properties of the region of Ilhéus. The four acaricides tested showed the following levels of efficiency: Amidin - 30.95%; Deltamethrin - 65.04%; Cipermethrin / diclorvos - 75.73%; and Triclorfon / coumaphos / cyfluthrin - 75.13%.

  2. Avaliação do comportamento anômalo de Anocentor nitens (Neumann (Acari: Ixodidae, durante a fase não parasitária Avaliation of the anomalous behavior of Anocentor nitens (Neumann (Acari: Ixodidae, during the non parasitic phase

    Directory of Open Access Journals (Sweden)

    Nicolau Maués da Serra-Freire

    1993-01-01

    Full Text Available A new technique was develop to study the anomalous behavior of non parasitic phase of Anocentor nitens on horse host. From the total teleogines was still alive during all experimental period, 89.1% laided eggs on ear host. The eclosion index was 77.05% with 80.0% of eclodibility.The preoviposition period and oviposition period was 3 to 17 days (4.92±0.73 days and 16 to 41 days (24.38±1.05 days, respectively. The incubation period was 26 to 48 days (34.94±2.92 days. It was confirmed that A. nilens teleogine could laid on ear of horse, when it was dettachment and a factor impossibilited it down on ground.

  3. Controle de Rhipicephalus sanguineus (Latreille, 1806 (Acari: Ixodidae no canil da Escola de Veterinária da UFMG, Belo Horizonte, Minas Gerais, Brasil Control of Rhipicephalus sanguineus (Latreille, 1806 (Acari: Ixodidae in the kennel of the UFMG Veterinary School, Belo Horizonte, Minas Gerais, Brazil

    Directory of Open Access Journals (Sweden)

    Gustavo F. Paz

    2008-03-01

    Full Text Available O presente estudo teve como proposta controlar uma infestação natural de Rhipicephalus sanguineus em um canil pertencente à Escola de Veterinária da UFMG, com uma área de 72 m² e 25 cães de diversas raças. Um teste de sensibilidade a produtos acaricidas foi aplicado em uma amostra de carrapatos capturados no canil. Dos produtos testados: Amitraz 12,5% (Produto 1; uma associação de Alfametrina 2% e Dichlorvós 60% (produto 2; Deltametrina 5% (produto 3 e uma associação de Trichlorfon 77,6%, Coumaphós 1% e Cyfluthrin 1% (produto 4; somente os produtos 1 e 4 apresentaram 100% de eficácia. O Amitraz 12,5% foi utilizado no controle dos estádios de R. sanguineus presentes no ambiente do canil, com um esquema de 4 aplicações a cada 7 dias de intervalo. Para os estádios parasitários, um único tratamento com Flumetrina 1.0% pour-on foi empregado em todos os animais. A inspeção e o monitoramento do ambiente e dos animais foram realizados durante um período de um ano. Estas medidas de controle reduziram significativamente a população de carrapatos dentro do canil. O canil não apresentou infestação pelo carrapato nos seis meses seguintes aos tratamentos. Uma infestação leve foi observada no 7º mês pós-tratamento, quando foi realizada uma nova aplicação de Amitraz 12,5% no ambiente do canil e um novo tratamento com Flumetrina 1.0% pour-on nos animais, com resultados satisfatórios.The present work was aimed at proposing a control measure for Rhipicephalus sanguineus in a naturally infected kennel of 72 m² of the UFMG Veterinary School with 25 dogs of different breeds. A sensitivity test to acaricide products was applied in a sample of R. sanguineus. Out of the acaricide products tested: 12.5% Amitraz (product 1; 2% Alfamethrin and 60% Dichlorvos association (product 2; 5% Deltamethrin (product 3 and the association between 77.6% Trichlorfon, 1.0% Coumaphos and 1.0% Cyfluthrin (product 4; only 1 and 4 products showed 100% efficacy. Amitraz (12.5% was used for controlling R. sanguineus in the surrounding of the kennel, on which four treatments every seven days were carried out in the facilities. For parasitic R. sanguineus, a single topical treatment was used: Flumetrin 1.0% pour - on on all the 25 dogs. This control measure significantly reduced the population of R. sanguineus within the kennel. A slight infestation was observed in the seventh month after treatment. A new application of 12.5% Amitraz was done in the kennel as well as a new topical treatment with Flumetrin 1.0% pour - on on the dogs. The control procedure proposed in the present study was an emergency measure and its effectiveness was checked through environmental surveys throughout a one-year period.

  4. New histochemical and morphological findings in the female genital tract of Boophilus microplus (Acari, Ixodidae: an attempt toward the elucidation of fertilization in ticks Novas características histoquímicas e morfológicas no trato genital feminino de Boophilus microplus (Acari: Ixodidae: uma tentativa para a elucidação da fertilização nos carrapatos

    Directory of Open Access Journals (Sweden)

    Casimiro García-Fernández

    2005-09-01

    Full Text Available At present not only is the site of fertilization in ticks still unknown but it is also unclear as to how this mystery can be solved. Signs of fertilization can be observed throughout the female genital tract and these can be clues for the elucidation of the unsolved questions relating to ticks fertilization. In Boophilus microplus (Canestrini, 1887 the most important signs are the following: the final eversion of the acrosomal canal in females ready for oviposition; the presence of small tubules, resembling the subplasmalemal process of the spermatozoon between the oviduct cells; budding nuclei throughout the female genital tract; and the two Feulgen and DAPI positive areas in the oocyte at vitelogenesis. These morphological characteristics suggest that fertilization takes place in the internal cylinder which extends from the uterus to the ovary itself.Até o momento, não só o lugar da fertilização em carrapatos é desconhecido, mas também não é claro como este mistério possa ser esclarecido. Sinais de fertilização podem ser observados ao longo do trato genital feminino e estes podem ser pistas para a elucidação das questões relacionadas à fertilização em ácaros. Em Boophilus microplus (Canestrini, 1887, os sinais mais importantes são os seguintes: a eversão final do canal acrossômico em fêmeas prestes à oviposição; a presença de pequenos túbulos assemelhando-se a processos subplasmalêmicos dos espermatozóides entre as células do oviduto; brotamentos nucleares ao longo do trato genital feminino e as duas áreas Feulgen e DAPI positivas nos ovócitos em processo de vitelogênese. Estas características morfológicas sugerem que a fertilização ocorra no cilindro interno, o qual se estende desde o útero até o ovário inclusive.

  5. Influência do comportamento gregário nos processos de muda de Rhipicephalus sanguineus (Latreille, 1806 (acari: ixodidae, em condições laboratoriais Influence of aggregation on the molting process of Rhipicephalus sanguineus, (Latreille, 1806 (acari: ixodidae under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Paulo Henrique D. Cançado

    2007-12-01

    Full Text Available Objetivou-se com o experimento verificar a influência de diferentes agregações sobre os parâmetros relacionados ao processo de ecdise ninfal e de adulto de Rhipicephalus sanguineus (Latreille, 1806. Foram utilizados como hospedeiros 10 coelhos domésticos (Oryctolagus cuniculus primos-infestados. Foram analisados os períodos de pré-ecdise, de ecdise e de muda, o percentual e o ritmo de ecdise para todos os estágios estudados. Durante toda a fase não-parasitária, os carrapatos foram mantidos em condições controladas de umidade (80±5% e temperatura (27±1ºC. Um total de 1560 larvas ingurgitadas e de 1560 ninfas ingurgitadas foi utilizado. Os carrapatos foram divididos em seis grupos contendo um, cinco, dez, 20, 40 e 80 espécimes cada. Para cada um desses grupos foram realizadas dez repetições. Os processos de ecdise ninfal e de adulto foram acompanhados diariamente. Após a análise dos resultados, verificou-se que não houve relação entre as diferentes agregações e o percentual de ecdise em nenhuma etapa experimental. Em todos os outros parâmetros biológicos estudados, verificaram-se diferenças significativas (pThe objective of this experiment was to evaluate the influence of different aggregations on the molting process of Rhipicephalus sanguineus (Latreille, 1806. Tick-naïve domestic rabbits (Oryctolagus cuniculus were used as experimental hosts for the parasitic phase. A total of 10 rabbits were used on the experiment. All tick free-living phases were kept in incubator at 27±1ºC, 80±5% relative humidity and scotophase. The periods of pre-molt, molt, percentage of ecdisis and molt rhythm of larvae and nymphs were studied. A total of 1560 engorged larvae and 1560 nymphs of R. sanguineus were divided in six groups of aggregations: 1, 5, 10, 20, 40 and 80 ticks with ten repetitions each one. The ecdises of nymphs and adults were daily observed. The percentage of ecdysis was the only parameter with no aggregations effects. All others parameters were statistically different (p<0,05. The results suggested that highest aggregations accelerate the molting process.

  6. Ação do fungo Beauveria bassiana (Balsamo Vuillemin, 1912 sobre a fase parasitária do carrapato Anocentor nitens (Neumann, 1897 Schulze, 1937 (Acari: ixodidae Action of the fungus Beauveria bassiana (Balsamo Vuillemin, 1912 on the parasitic phase of the tick Anocentor nitens (Neumann, 1897 Schulze, 1937 (Acari: ixodidae

    Directory of Open Access Journals (Sweden)

    Silvia Gonzalez Monteiro

    2003-06-01

    Full Text Available A patogenicidade do fungo Beauveria bassiana (isolado 986 foi avaliada no desenvolvimento da fase parasitária do Anocentor nitens, acompanhando o desenvolvimento de larvas não alimentadas até o estágio adulto. Foram utilizados dois tratamentos e um grupo controle com cinco repetições cada. No tratamento 1 (T1, as orelhas dos bovinos foram banhadas com a suspensão fúngica de 10(8 conídios ml-1; no tratamento 2 (T2, as orelhas foram banhadas com água destilada e espalhante adesivo. No grupo controle (C, as orelhas foram banhadas com água destilada. Após 24 horas dos tratamentos, as orelhas de cada animal foram infestadas com 100mg de larvas. Os parâmetros analisados, em cada tratamento, foram: número e peso de fêmeas recuperadas; períodos de pré-postura, postura, incubação, eclosão e longevidade; percentual de eclosão; peso da massa de ovos e da quenógina; índices de eficiência reprodutiva e nutricional. Verificou-se que, no T1 e T2, o número de fêmeas recuperadas, após 35 dias, foi significantemente menor (PThis study evaluated the pathogenicity of the fungus Beauveria bassiana (Isolate 986 on the development of the parasitic phase of Anocentor nitens by accompanying the development of unfed larvae until the adult stage. Two treated and one control group were used with five repetitions each. In the first treated group (T1, cattle ears were bathed with a fungal suspension of 10(8 conidia ml-1, second treated group (T2, the ears were bathed with distilled water and Tween 80 1% and the control group (C, the ears were bathed with distilled water. One day after treatment, the ears of each animal were infested with 100 mg of larvae. The parameters analyzed in each treatment were: number and weight of females recovered; periods of pre-oviposition, oviposition, incubation, eclosion and longevity; percentage of eggs hatched; weight of the egg mass and of females after oviposition. We found that in the two treated groups the number of females recovered was significantly lower (P<0.05 than in the control group. 35, 70 and 117 females were recovered from the T1, T2 and C, respectively. The females obtained from the surviving larvae of the treated groups did not suffer any deleterious effects from the entomopathogen studied.

  7. Determinação da CL90 e TL90 do isolado IBCB66 de Beauveria bassiana (Ascomycetes: Clavicipitaceae para o controle de Rhipicephalus (Boophilus microplus (Acari: Ixodidae Determination of LC 90 and LT 90 of IBCB66 Beauveria bassiana (Ascomycetes: Clavicipitaceae isolate for Rhipicephalus (Boophilus microplus (Acari: Ixodidae control

    Directory of Open Access Journals (Sweden)

    Barci Leila A. G.

    2009-12-01

    Full Text Available O presente trabalho teve por objetivo avaliar a patogenicidade e a virulência do isolado IBCB66 de Beauveria bassiana para larvas de Rhipicephalus (Boophilus microplus. O isolado IBCB66 foi utilizado como padrão, com a finalidade de determinar a CL50 (Concentração Letal, CL90, TL50 (Tempo Letal e TL90. O isolado IBCB66 foi testado em seis concentrações diferentes (5 × 10(6, 10(7, 5 × 10(7, 10(8, 5 × 10(8 e 10(9 para determinar a porcentagem de mortalidade. A mortalidade total de larvas foi observada 18 dias após o início do teste no grupo tratado com 5 × 10(9 conídios.mL-1. A análise de Probit dos dados consignados apontou a CL50 e CL90 concentrações de 3 × 10(7 e 5 × 10(8 conídios.mL-1 e para TL50 e TL90, foram 10 e 16 dias, respectivamente.The objective of this research was to evaluate the pathogenicity and the virulence of the IBCB66 isolate of Beauveria bassiana on infected larvae of Rhipicephalus (Boophilus microplus. The IBCB66 fungus strain was used as standard isolates of B. bassiana against R. (B. microplus larvae. The larval bioassay tests using the IBCB66 isolate were carried out to determine the (Lethal Concentration LC50, LC90, (Lethal Time LT50 and LT90. The IBCB66 fungus strain was tested at six different concentrations (5 × 10(6, 10(7, 5 × 10(7, 10(8, 5 × 10(8 and 10(9 conidia.mL-1 to determine the percentage of larval mortality. In addition, a Probit analysis was also performed. Total larval mortality was observed eighteen days after the beginning of the test in the group treated with 5 × 10(9 conidia.mL-1. The LC50 and LC90 were 3 × 10(7 and 5 × 10(8 respectively and the LT50 and LT90 were 10 and 16 days.

  8. Percepção dos produtores de leite do município de Passos, MG, sobre o carrapato Boophilus microplus (Acari: Ixodidae, 2001 Perception of dairy farmers from Passos county, MG, Brazil, concerning the tick Boophilus microplus (acari: ixodidae, 2001

    Directory of Open Access Journals (Sweden)

    Christiane Maria Barcellos Magalhães da Rocha

    2006-08-01

    Full Text Available Entrevistas com 25 proprietários de rebanhos com produção diária acima de 500 litros de leite, sorteados da listagem da cooperativa de Passos/MG/Brasil, foram aplicadas para caracterizar suas percepções sobre a biologia do Boophilus microplus e suas atitudes no controle de carrapatos. A maioria desses produtores tem pelo menos o ensino médio completo e está na atividade há mais de dez anos. Os prejuízos biológicos produzidos pelos carrapatos são bem percebidos por eles; porém, não demonstraram conhecimento sobre a biologia do B. microplus e as desvantagens dos banhos carrapaticidas, principalmente com relação aos riscos toxicológicos. Esses produtores realizam controle de carrapatos sem critérios técnicos e com alta freqüência, baseando-se na avaliação subjetiva da infestação nos animais. Isto favorece o estabelecimento da resistência aos acaricidas e demonstra que a transferência de tecnologia sobre controle de carrapatos para o setor pecuário é falha.Twenty five dairy farms were randomly chosen from all farms producing more than 500 liters of milk/ day in Passos, MG, Brazil. The owners were interviewed to characterize their perceptions about the biology of B. microplus and their attitudes towards tick control. Most of the producers have a college degree and more than six year-experience in the activity. The biological damages caused by ticks are perceived by the farmers. Their tick control is performed without technical criteria and they did not show a proper knowledge on the biology of B. microplus nor on the toxicological risks of acaricides application. The results reveal a gap between the technology and farmers, favoring tick resistance to acaricides.

  9. Avaliação da atividade repelente do timol, mentol, salicilato de metila e ácido salicilico sobre larvas de Boophilus microplus (Canestrini, 1887 (Acari: Ixodidae Evaluation of repellent activity of thymol, menthol, methyl salicylate and salicylic acid on Boophilus microplus larvae (Canestrini, 1887 (Acari: Ixodidae

    Directory of Open Access Journals (Sweden)

    A.M.S. Novelino

    2007-06-01

    Full Text Available Verificou-se a atividade repelente do timol, mentol, ácido salicílico e salicilato de metila sobre larvas de Boophilus microplus. Essas substâncias foram usadas em emulsões em dimetilsulfuxido aquoso a 1% ou solução aquosa. Para cada substância foram testadas três concentrações, 1,0%; 0,5% e 0,25%, com cinco repetições cada. Cerca de 100 larvas, com 21 dias de idade, foram inseridas na base de hastes de madeira para avaliação da repelência, a cada duas horas, totalizando 12 horas. As concentrações mais elevadas apontaram que as quatro substâncias causaram alteração no comportamento das larvas. Timol, com mortalidade de 65% e 35% de repelência e mentol e salicilato de metila, ambos com 80% de repelência foram os mais eficientes.The repellent activity of thymol, menthol, salicylic acid and methyl salicylate on Boophilus microplus larvae was studied. These substances were tested according to their solubility: emulsions in 1% aqueous dimethylsulphoxide or in pure water. Three concentrations were tested for each substance, 1.0%, 0.5% and 0.25%, with five repetitions for each. Approximately 100 larvae at 21 days of age were placed on the base of wooden sticks and then observed for repellent action every two hours, during twelve hours. The results obtained from the higher concentrations showed that the four substances caused alterations on the larvae behavior. However, thymol (65% of mortality and 35% of repellency, menthol (80% of repellency and methyl salicylate (80% of repellency were the most efficient.

  10. Infection Prevalences of Common Tick-borne Pathogens in Adult Lone Star Ticks (Amblyomma americanum) and American Dog Ticks (Dermacentor variabilis) in Kentucky

    OpenAIRE

    Fritzen, Charissa M.; Huang, Junjun; Westby, Kathleen; Freye, James D.; Dunlap, Brett; Yabsley, Michael J.; Schardein, Mike; Dunn, John R.; Jones, Timothy F.; Moncayo, Abelardo C.

    2011-01-01

    Rocky Mountain spotted fever, Lyme disease, and ehrlichiosis are tick-borne diseases that are reported annually in Kentucky. We conducted a survey to describe infection prevalence of tick-borne pathogens in Amblyomma americanum and Dermacentor variabilis ticks collected in Kentucky. During 2007–2008, we collected 287 ticks (179 D. variabilis and 108 A. americanum) from canine, feral hog, horse, raccoon, white-tailed deer, and human hosts in six counties in Kentucky. Ticks were screened for Ri...

  11. Comparative speed of kill of sarolaner (Simparica™) and afoxolaner (NexGard®) against induced infestations of Amblyomma americanum on dogs

    OpenAIRE

    Six, Robert H.; Everett, William R.; Chapin, Sara; Mahabir, Sean P.

    2016-01-01

    Background The lone star tick, Amblyomma americanum, infests dogs and cats in North America and is the vector of the pathogens that cause monocytic and granulocytic ehrlichiosis in dogs and humans. A parasiticide’s speed of kill is important to minimize the direct and deleterious effects of tick infestation and especially to reduce the risk of transmission of tick-borne pathogens. In this study, speed of kill of a novel orally administered isoxazoline parasiticide, sarolaner (Simparica™ chewa...

  12. A large parasitengonid mite (Acari, Erythraeoidea from the Early Cretaceous Crato Formation of Brazil

    Directory of Open Access Journals (Sweden)

    J. A. Dunlop

    2007-08-01

    Full Text Available A new large, fossil mite (Arachnida: Acari, Pararainbowia martilli n. gen. n. sp., is described from the Early Cretaceous (Aptian Crato Formation from Ceará State, Brazil. It is assigned to the Cohort Parasitengona and the superfamily Erythraeoidea, some extant members of which can reach up to seven millimetres in body length. Given that doubts have been raised about the identity of putative Crato feather mite eggs, this new fossil represents the first unequivocal record of Acari from the Crato Formation, the first non-amber record of an erythraeoid mite and the oldest named example of this superfamily. Fossil erythraeoids from Mesozoic and Tertiary ambers are briefly reviewed – including a widely overlooked Late Cretaceous species – with comments on Mesozoic mites in general. Thirteen Baltic amber erythraeoids have been formally described, but much unstudied material from various amber sources remains. Ein neues großes Milbenfossil (Arachnida: Acari, Pararainbowia martilli n. gen. n. sp., wird aus der Crato Formation (Unterkreide, Aptium des Ceará Gebietes in Brasilien beschrieben. Es wird der Kohorte Parasitengona und der Überfamilie Erythraeoidea zugeordnet; die modernen Vertreter erreichen eine Körperlänge bis zu sieben mm. Weil die Identität von Federmilbeneiern aus der Crato Formation in Frage gestellt wurde, ist dieser Neufund der erste klare Hinweis von Acari aus der Crato Formation. Es ist die erste erythraeoide Milbe, die nicht aus dem Bernstein stammt sowie das älteste genannte Beispiel dieser Überfamilie. Fossile erythraeoide Milben aus dem Bernstein des Mesozoikum und des Tertiärs werden kurz zusammengefasst – u. a. eine weitgehend übersehene Art aus der Oberkreide – mit allgemeinen Anmerkungen zu den mesozoischen Milben. Dreizehn erythraeoide Milbenarten sind aus dem baltischen Bernstein genannt und beschrieben worden, aber weiteres unbearbeitetes Material von verschiedenen Bernstein-Fundpunkten liegt noch vor

  13. De corticole fauna van platanen: i. Arachniden (Arachnida: Araneae, Pseudoscorpiones, Acari)

    OpenAIRE

    Noordijk, J.; Berg, M.P.

    2001-01-01

    The corticolous fauna of plane trees: I. Arachnids (Arachnida: Araneae, Pseudoscorpiones, Acari) From February until September 2000 an inventory was made of the bark-dwelling arthropod fauna of more than 400 plane trees (Platanus hybrida), all over the Netherlands. Arthropods were collected from bark and under the ‘loose’ bark fragments at a height of 160-175 cm from the ground. Algae, mosses and fungi are important resources for the corticolous fauna. Crevices in the tree trunk and loose bar...

  14. Development and reproduction of spider mites Tetranychus turkestani (Acari: Tetranychidae) under water deficit condition in soybeans

    OpenAIRE

    Ivelina Nikolova; Natalia Georgieva; Jordanka Naydenova

    2014-01-01

    One of the major pests of soybeans in Bulgaria is the spider mite Tetranychus turkestani Ug et Nik (Acari: Tetranychidae) and different results have been reported about the impact of water stress on its development and reproduction. Soybean plants exposed to natural infestation by spider mites, water deficit and treatment with imidacloprid were examined under greenhouse conditions at the Institute of Forage Crops, Pleven, Bulgaria, over the period 2011-2012...

  15. Acaricidal and repellent activities of essential oil of Eucalyptus globulus against Dermanyssus gallinae (Acari: Mesostigmata)

    OpenAIRE

    Dehghani-Samani Amir; Madreseh-Ghahfarokhi Samin; Dehghani-Samani Azam; Pirali-Kheirabadi Khodadad

    2015-01-01

    Introduction: By considering an increase in drug resistance against red mites, finding the nonchemical herbal acaricide against Dermanyssus gallinae (De Geer) (Acari: Mesostigmata) is necessary to kill them and to reduce the chemical resistance against chemical acaricides in this specie. Dermanyssus gallinae is a potential vector of the causal agent of several viral diseases such as Equine encephalitis and St. Louis encephalitis. It can be a vector of bacteria such as Salmonella spp., Mycobac...

  16. Description of a new species of Gaeolaelaps (Acari: Laelapidae) from Iran.

    Science.gov (United States)

    Saeidi, Zarir; Nemati, Alireza; Khalili-Moghadam, Arsalan

    2016-01-01

    A new species of Gaeolaelaps (Acari, Mesostigmata, Laelapidae), Gaeolaelaps izajiensis sp. n. is described based on the morphological characters of adult females which were collected from soil sample in the Izeh and Ghaletol regions of the Khuzestan province, Iran. It can be distinguished from the other members of the genus by some morphological characteristics of dorsal shield, form and reticulation of epigynal shield, the exopodal plates, and the peritremes. PMID:27667922

  17. A new species of Atractides Koch, 1837 (Acari: Hydrachnidia, Hygrobatidae from Ethiopia, with a discussion on the biodiversity of the genus Atractides in the Afrotropical region

    Directory of Open Access Journals (Sweden)

    Vladimir Pesic

    2011-03-01

    Full Text Available A new species of Atractides Koch, 1837 (Acari, Hydrachnidia is described from Ethiopia. The world number of Atractides now tallies 297 species. The diversity of the genus Atractides in the Afrotropical region is briefly discussed.

  18. The complete mitochondrial genome of the citrus red mite Panonychus citri (Acari: Tetranychidae): high genome rearrangement and extremely truncated tRNAs

    OpenAIRE

    Dou Wei; Wang Bao-Jun; Wei Dan-Dan; Yuan Ming-Long; Wang Jin-Jun

    2010-01-01

    Abstract Background The family Tetranychidae (Chelicerata: Acari) includes ~1200 species, many of which are of agronomic importance. To date, mitochondrial genomes of only two Tetranychidae species have been sequenced, and it has been found that these two mitochondrial genomes are characterized by many unusual features in genome organization and structure such as gene order and nucleotide frequency. The scarcity of available sequence data has greatly impeded evolutionary studies in Acari (mit...

  19. Eradication of the tropical bont tick in the Caribbean: is the Caribbean amblyomma program in a crisis?

    Science.gov (United States)

    Pegram, Rupert G; Gersabeck, Edward F; Wilson, David; Hansen, Jorgen W

    2002-10-01

    The progress and problems in the Caribbean Amblyomma Program (CAP) are reviewed since its inception in 1995. During 1998, there were funding and administrative management problems. USDA resolved the acute funding crisis, and after three years of negotiation, the CAP has now secured an additional euro 1.5 million from the European Community. Changes in administration in 1998 included the withdrawal of IICA from the program, and the transition during the decentralization of administrative and financial management from FAO headquarters to the Regional Office for Latin America and the Caribbean, based in Chile. A general overview of technical progress and one case study, St. Kitts, is presented. One major concern that emerged during 2000 is that the elimination of the small remaining tropical bont tick (TBT) "hot spots" in both St. Kitts and St. Lucia remained elusive. Why is this so? Egrets? Alternative residual hosts? Or is it fatigue in both technical and administrative management functions? Of even greater concern is the finding of two, apparently new, foci in St. Croix (USVI) in the north and St. Vincent in the south. A critical overview of the program has identified one major remaining constraint-an appropriate management support function at both regional and, in some countries, at the national level. A proposal for a revised management strategy, coupled with the identification of a future strategy to succeed the CAP, namely a Caribbean Animal Resources Management (CARM) Program. PMID:12381609

  20. Development of Iphiseiodes quadripilis (Banks) (Acari: Phytoseiidae) on pollen or mite diets and predation on Aculops pelekassi (Keifer) (Acari: Eriophyidae) in the laboratory.

    Science.gov (United States)

    Villanueva, Raul T; Childers, Carl C

    2007-02-01

    Development and reproduction of Iphiseiodes quadripilis (Banks) were evaluated on single food diets of pollen (Malephora crocea Jacquin [ice plant] or Quercus sp. [oak]), spider mites, [Eutetranychus banksi (McGregor) or Panonychus citri (McGregor) (Acari: Tetranychidae)], or the citrus rust mite Phyllocoptruta oleivora (Ashmead) (Acari: Eriophyidae). Experiments were conducted in an environmental chamber at 28 degrees +/- 1 degrees C, 14:10 (L:D) daylength, and 45% RH. I. quadripilis completed development and laid viable eggs that subsequently hatched on diets of either ice plant or oak pollen or eggs and motile stages of E. banksi. P. citri was acceptable as prey, but survival of larvae to adults was only 36%, whereas survival on E. banksi, ice plant pollen, and oak pollen was 48, 60, and 68%, respectively. The webbing produced by P. citri seemed to inhibit foraging behavior of I. quadripilis larvae and nymphs. Larvae of I. quadripilis developed only to the second nymphal instar on a diet of P. oleivora alone or water alone. Starved I. quadripilis females and deutonymphs were observed preying on the pink citrus rust mite, Aculops pelekassi (Keifer) (Eriophyidae). During 4-min observation trials, two series of I. quadripilis fed on 1.8 +/- 0.47 and 3.5 +/- 0.45 A. pelekassi motile stages after being starved for 6 and 24 h, respectively. I. quadripilis females did not prey on P. oleivora in arenas containing both rust mite species. PMID:17349110

  1. Effect of coconut palm proximities and Musa spp. germplasm resistance to colonization by Raoiella indica (Acari: Tenuipalpidae)

    Science.gov (United States)

    Although coconut (Cocos nucifera L.) is the predominant host for Raoiella indica Hirst (Acari: Tenuipalpidae), false spider mite infestations do occur on bananas and plantains (Musa spp. Colla). Since its introduction, the banana and plantain industries have been negatively impacted to different deg...

  2. A novel disease affecting the predatory mite Phytoseiulus persimilis (Acari, Phytoseiidae): evidence for the involvement of bacteria

    NARCIS (Netherlands)

    Schütte, C.; Poitevin, O.J.L.; Dicke, M.

    2008-01-01

    Adult female Phytoseiulus persimilis Athias-Henriot (Acari, Phytoseiidae) of a laboratory population show drastic changes in foraging behavior, anatomy and life history compared to typical laboratory populations. We demonstrated earlier that the set of characteristic symptoms, called non-responding

  3. Development and evaluation of PCR assay for detection of low levels of Cowdria ruminantium infection in Amblyomma ticks not detected by DNA probe.

    OpenAIRE

    Peter, T F; Deem, S L; Barbet, A F; Norval, R A; Simbi, B H; Kelly, P. J.; Mahan, S. M.

    1995-01-01

    The sensitivities of a PCR assay and a DNA probe assay were compared for the detection of Cowdria ruminantium in Amblyomma ticks that were fed on C. ruminantium-infected, clinically reacting, and recovered carrier animals. The PCR assay and DNA probe detected infection in 86.0 and 37.0%, respectively, of 100 ticks fed on a febrile animal. In 75 ticks fed on carrier animals, PCR and the DNA probe detected infection in 28.0 and 1.33% of ticks, respectively. This demonstrates that the DNA probe ...

  4. IN VITRO EFFECT OF SORGHUM (SORGHUM BICOLOR SEED EXTRACTS AS A BIOLOGICAL ACARICIDAL AGAINST SOME HARD TICK (IXODIDAE IN SULAIMANI GOVERNORATE - KURDISTAN REGION/IRAQ

    Directory of Open Access Journals (Sweden)

    Bahzad H.S. Mustafa

    2016-09-01

    Full Text Available This study was conducted in Sulaimani governorate in order to identify the biological control of some Ixodidae genera among different flocks of cattle, sheep and goats. Four genera of Ixodidae; Boophilus spp., Hyalomma spp., Rhipicephalus spp. and Haemaphysalis spp., were identified in these infested animals. According to chi–square test, the highest distribution of Boophulis spp., was recorded in cattle (56.51%, and the highest distribution of Hyalomma spp., (49.82% and Rhipicephalus spp., (28.16% which were in sheep. The highest number of Haemophasylas spp., was obtained from goats (6.67%, whereas the lowest number of this genus (2.88% and 2.89% was collected from cattle and sheep respectively. The toxicity of Sorghum bicolor seed extract was tested against the more distributed Ixodidae genera (Boophilus spp. and Hyalomma spp. by immersion method on mature ticks, four concentrations (23.2, 17.4, 11.6 and 5.8 mg/dl, in addition to the control treatment (0 mg/dl of the seed were used to evaluate the engorged females in vitro. The results showed that 100% of absolute cumulative mortality of Boophilus spp., was gain after 72 hr by 23.2 mg/dl extract concentration, followed by 17.4 mg/dl which gave 90% mortality, whereas 100% absolute cumulative mortality for Hyalomma spp., was obtained by 23.2 mg/dl extract concentration after 48 hr, followed by 17.4, 11.6 and 5.8 mg/dl concentration that gave 90%, 80% and 40% mortality after 72 hr.

  5. Mites (Acari Associated with the Desert Seed Harvester Ant, Messor pergandei (Mayr

    Directory of Open Access Journals (Sweden)

    Kaitlin A. Uppstrom

    2011-01-01

    Full Text Available Mites (Acari associated with the seed harvester ant Messor pergandei were investigated in the Sonoran desert of Arizona. At least seven representatives of the mite genera Armacarus, Lemanniella, Petalomium, Forcellinia, Histiostoma, Unguidispus, and Cosmoglyphus are phoretically associated with M. pergandei. Most of these morphospecies show preference for specific phoretic attachment sites and primarily use female alates rather than male alates for dispersal. Five mite morphospecies were found in low numbers inhabiting the chaff piles: Tydeidae sp., Procaeculus sp., Anystidae sp., Bakerdania sp., and Tetranychidae sp. The phoretic Petalomium sp. was observed consuming fungus growing on a dead queen, but the roles of the other mite species remain mostly unresolved.

  6. Two new Meitingsunes species (Acari: Syringophilidae) from Indonesian doves (Columbiformes: Columbidae).

    Science.gov (United States)

    Kaszewska, Katarzyna; Skoracki, Maciej; Kavetska, Katarzyna

    2016-01-01

    We describe two new quill mite species of the genus Meitingsunes Glowska and Skoracki, 2010 (Acari: Prostigmata: Syringophilidae) parasitizing columbiform birds (Columbiformes: Columbidae): M. chalcophaps sp. nov. collected from the Emerald Dove, Chalcophaps indica (Linnaeus) and M. turacoenas sp. nov. from the White-faced Cuckoo Dove, Turacoena manadensis (Quoy and Gaimard) (type host) and the Black Cuckoo-Dove, Turacoena modesta (Temminck). All host species were collected in Indonesia. These represent two new genus-level host records for Meitingsunes. In addition, we summarize the diversity of Meitingsunes and present a key to species in this genus. PMID:27394880

  7. A rare finding of mites (Arachnida: Acari: Leeuwenhoekiidae) parasitising a whip spider (Arachnida: Amblypygi: Charinidae).

    Science.gov (United States)

    Gonçalves-Souza, Thiago; Giupponi, Alessandro P L; Hernandes, Fabio A

    2014-04-01

    Twelve larvae of unidentified species of Odontacarus Ewing, 1929 (Acari: Leeuwenhoekiidae) were found parasitising an adult male whip spider Charinus brasilianus Weygoldt (Charinidae) in Santa Teresa, mountainous region of Espirito Santo state, southeastern Brazil. These larvae occurred in the intersegmental membrane of prosoma and legs. This is the first report of ectoparasitic mites infecting a charinid whip spider and the first record of leeuwenhoekiid mites parasitising an invertebrate host. We suggest that future studies are essential to understand the reasons why these events of parasitism are so rare in the order Amblypygi.

  8. New species, new records and re-description of spider mites (Acari: Tetranychidae) from India.

    Science.gov (United States)

    Zeity, Mahran; Srinivasa, N; Gowda, C Chinnamade

    2016-01-01

    Two species of Tetranychidae (Acari), Oligonychus neotylus sp. nov. from Zea mays and Pennisetum purpureum (Poaceae) and Tetranychus hirsutus sp. nov. from Gymnema sylvestre R. Br. (Apocynaceae) are described from Karnataka state, south India. Tetranychus bambusae Wang and Ma is recorded for the first time from India and re-described. Four other species are reported for the first time from India viz., Oligonychus coniferarum (McGregor), Oligonychus duncombei Meyer, Tetranychus marianae McGregor and Tetranychus okinawanus Ehara from Cupressus sp., an undetermined grass, Centrosema pubescens and Adenium obesum, respectively. PMID:27394311

  9. In vitro isolation and infection intensity of Rickettsia parkeri in Amblyomma triste ticks from the Paraná River Delta region, Argentina.

    Science.gov (United States)

    Monje, Lucas D; Nava, Santiago; Antoniazzi, Leandro R; Colombo, Valeria C; Beldomenico, Pablo M

    2014-10-01

    In the present study, we report the first in vitro isolation and infection intensity of Rickettsia parkeri in Amblyomma triste ticks from Argentina. No genetic differences in the molecular targets evaluated were found between R. parkeri isolates from Argentina and those R. parkeri isolates reported in Uruguay and Brazil, both obtained from A. triste. Only a minor difference was observed when compared to R. parkeri isolated from Amblyomma maculatum from United States. Moreover, the prevalence of infection by R. parkeri in ticks collected from the vegetation in the Paraná Delta was high (20.4%). Interestingly, the distribution of R. parkeri infection intensity observed in A. triste ticks was distinctly bimodal, with approximately 60% of the infected ticks presenting high rickettsial loads (3.8×10(5)-4.5×10(7) ompA copies/tick) and the remainder with low rickettsial levels (5.6×10(1)-6.5×10(3) ompA copies/tick). This bimodality in R. parkeri infection intensity in ticks could determine differences in the severity of the disease, but also be important for the infection dynamics of this pathogen. Further research exploring the distribution of rickettsial infection levels in ticks, as well as its determinants and implications, is warranted.

  10. Phytoseiid mites of the Canary Islands (Acari, Phytoseiidae. II. Tenerife and La Gomera Islands

    Directory of Open Access Journals (Sweden)

    Ferragut, F.

    2007-12-01

    Full Text Available Phytoseiid mites (Acari, Phytoseiidae inhabiting plants in natural ecosystems from Tenerife and La Gomera islands (Canary Islands have been studied. Surveys were conducted from 1997 to 2002. Eleven species were collected, one of them being reported for the first time from the Canary Islands and six of them reported for the first time from Tenerife and La Gomera islands. Euseius machadoi n. sp. collected from woody plants in the Canarian laurisilva is proposed as a new species.

    En muestreos realizados desde 1997 hasta 2002 se ha estudiado la fauna de ácaros fitoseidos (Acari, Phytoseiidae asociada a plantas de ecosistemas naturales de las islas de Tenerife y La Gomera (Islas Canarias. Se han recolectado un total de 11 especies, siendo una de ellas citada por vez primera en las islas Canarias y seis de ellas citadas por primera vez en las islas de Tenerife y La Gomera. Euseius machadoi n. sp., recolectado en plantas leñosas de la laurisilva canaria, se propone como una nueva especie.

  11. Pyrethroid resistance in Phytoseiulus macropilis (Acari: Phytoseiidae): cross-resistance, stability and effect of synergists.

    Science.gov (United States)

    Queiroz, Maria Cristina Vitelli; Sato, Mario Eidi

    2016-01-01

    Phytoseiulus macropilis Banks (Acari: Phytoseiidae) is an effective predator of Tetranychus urticae Koch (Acari: Tetranychidae). The objectives of this research were to study the stability of fenpropathrin resistance and the cross-resistance relationships with different pyrethroids, and also to evaluate the effect of synergists [piperonyl butoxide (PBO), diethyl maleate (DEM) and S,S,S-tributyl phosphorotrithioate (DEF)] on fenpropathrin resistant and susceptible strains of this predaceous mite. The stability of fenpropathrin resistance was studied under laboratory conditions, using P. macropilis populations with initial frequencies of 75 and 50% of resistant mites. The percentages of fenpropathrin resistant mites were evaluated monthly for a period of up to 12 months. A trend toward decreased resistance frequencies was observed only during the first 3-4 months. After this initial decrease, the fenpropathrin resistance was shown to be stable, maintaining constant resistance frequencies (around 30%) until the end of the evaluation period. Toxicity tests carried out using fenpropathrin resistant and susceptible strains of P. macropilis indicated strong positive cross-resistance between fenpropathrin and the pyrethroids bifenthrin and deltamethrin. Bioassays with the synergists DEM, DEF and PBO were also performed. The maximum synergism ratio (SR = LC50 without synergist/LC50 with synergist) detected for the three evaluated synergists (PBO, DEM, DEF) was 5.86 (for DEF), indicating low influence of enzyme detoxification processes in fenpropathrin resistance. PMID:26530989

  12. Beklemishevia hispaniola n. sp., nuevo representante de la Cohorte Palaeosomata (Acari, Oribatei en España

    Directory of Open Access Journals (Sweden)

    Pérez-Iñigo, C.

    1996-12-01

    Full Text Available A new species of oribatid mite (Acari, Oribatei belonging to the family Ctenacaridae (Cohors Palaeosomata is described; this species was recorded several times in Spain as Beklemishevia galeodula Zachvatkin, 1945. The new species is easily distinguishable from the mentioned one because of the presence of three claws in every leg, a noticeable pigidial neotrichy and the absence of short, almost spiniform, setae on the pygidium.Se describe una nueva especie de oribátido (Acari, Oribatei perteneciente a la familia Ctenacaridae (Cohorte Palaeosomata que habia sido citada varias veces en España como Beklemishevia galeodula Zachvatkin, 1945, y de la que se diferencia por presentar tres uñas en todas las patas, una acentuada neotriquia pigidial y carecer de setas cortas espiniformes en el pigidio.

  13. A new genus and species of Schizogyniidae (Acari: Mesostigmata) associated with carabid beetles (Coleoptera: Carabidae) from Ukraine.

    Science.gov (United States)

    Trach, Viacheslav A; Seeman, Owen D

    2014-04-29

    A new genus and species of Schizogyniidae (Acari: Mesostigmata: Celaenopsoidea), Euroschizogynium calvum gen. nov. and sp. nov., associated with Scarites terricola Bonelli, 1813 (Coleoptera: Carabidae) is described from Ukraine, representing the first record of the family from the Palaearctic. Fusura civica Valle & Fox, 1966 is moved out of the Schizogyniidae and placed into the Megacelaenopsidae. A new diagnosis for the family Schizogyniidae and a key to genera are provided.

  14. A review of Amblypalpus and Priscapalpus (Acari: Trombidiformes: Tenuipalpidae), including two new species of Amblypalpus from Iran.

    Science.gov (United States)

    Farzan, Sadegh; Asadi, Mahdieh; Ueckermann, Edward A; Seeman, Owen D; Beard, Jennifer J

    2013-01-01

    Two new species of Amblypalpus (Acari: Trombidiformes: Tenuipalpidae) are described from Iran: Amblypalpus iraniensis sp. nov., from Wild Almond, Amygdalus scoparia (Rosaceae), and Amblypalpus thymus sp. nov., from Common Thyme, Thymus vulgaris (Lamiaceae). The new species are classified tentatively in Amblypalpus. The species Priscapalpus thomissus Meyer, 1979 is transferred to Amblypalpus and the genus concept of Priscapalpus is narrowed and therefore redefined. Similarly, we present an expanded concept of Amblypalpus. A key to brevipalpine genera and Amblypalpus species is provided. PMID:26106764

  15. Nota sobre os Ixodideos da Republica Argentina

    Directory of Open Access Journals (Sweden)

    Henrique de Beaurepaire Aragão

    1938-01-01

    Full Text Available A study of and addicional collection of Argentine ixodidae is made on material send to the Author by Professor Salvador Mazza of Departamento de pathologia do Norte - Jujuy and Professor Doello Jurado of the Museu Rivadavia. There was examined 37 lots of Ixodidae. Among them there were found the nymph of Ixodes auritulus Nn. and 3 other species already known on the South American fauna and from which there was til yet no record in Argentine; they are Ixodes ricinus, Amblyomma parvum and Amblyomma pseudo-concolor.

  16. [Taxonomic status of the Burana virus (BURV) (Bunyaviridae, Nairovirus, Tamdy group) isolated from the ticks Haemaphysalis punctata Canestrini et Fanzago, 1877 and Haem. concinna Koch, 1844 (Ixodidae, Haemaphysalinae) in Kyrgyzstan].

    Science.gov (United States)

    L'vov, D K; Al'khovskiĭ, S V; Shchelkanov, M Iu; Shchetinin, A M; Deriabin, P G; Gitel'man, A K; Aristova, V A; Botikov, A G

    2014-01-01

    Complete genome sequence of the Burana virus (BURV) was determined using the next-generation sequencing approach (ID GenBank KF801651). The prototype strain of BURV LEIV-Krg760 was originally isolated from the ticks Haemaphysalis punctata Canestrini et Fanzago, 1877 (Ixodidae, Haemaphysalinae), collected from cows in Tokmak wildlife sanctuary, eastern part of the Chu valley (43 degrees 10' N, 74 degrees 40' E) near Burana village, Kirgizia, in April 1971. Molecular genetics and phylogenetic analyses showed that the BURV belonged to the Nairovirus genus, Bunyaviridae and is related to Tamdy virus (TAMV) that is also associated with the ixodidae ticks of pasture biocenosis in Central Asia. Previous studies showed that TAMV is the prototypic virus of new phylogenetic Tamdy group in the Nairovirus genus. Thus, BURV was classified as a new virus of the Tamdy group, Nairovirus, Bunyaviridae. PMID:25549462

  17. The complete mitochondrial genome of the citrus red mite Panonychus citri (Acari: Tetranychidae: high genome rearrangement and extremely truncated tRNAs

    Directory of Open Access Journals (Sweden)

    Dou Wei

    2010-10-01

    Full Text Available Abstract Background The family Tetranychidae (Chelicerata: Acari includes ~1200 species, many of which are of agronomic importance. To date, mitochondrial genomes of only two Tetranychidae species have been sequenced, and it has been found that these two mitochondrial genomes are characterized by many unusual features in genome organization and structure such as gene order and nucleotide frequency. The scarcity of available sequence data has greatly impeded evolutionary studies in Acari (mites and ticks. Information on Tetranychidae mitochondrial genomes is quite important for phylogenetic evaluation and population genetics, as well as the molecular evolution of functional genes such as acaricide-resistance genes. In this study, we sequenced the complete mitochondrial genome of Panonychus citri (Family Tetranychidae, a worldwide citrus pest, and provide a comparison to other Acari. Results The mitochondrial genome of P. citri is a typical circular molecule of 13,077 bp, and contains the complete set of 37 genes that are usually found in metazoans. This is the smallest mitochondrial genome within all sequenced Acari and other Chelicerata, primarily due to the significant size reduction of protein coding genes (PCGs, a large rRNA gene, and the A + T-rich region. The mitochondrial gene order for P. citri is the same as those for P. ulmi and Tetranychus urticae, but distinctly different from other Acari by a series of gene translocations and/or inversions. The majority of the P. citri mitochondrial genome has a high A + T content (85.28%, which is also reflected by AT-rich codons being used more frequently, but exhibits a positive GC-skew (0.03. The Acari mitochondrial nad1 exhibits a faster amino acid substitution rate than other genes, and the variation of nucleotide substitution patterns of PCGs is significantly correlated with the G + C content. Most tRNA genes of P. citri are extremely truncated and atypical (44-65, 54.1 ± 4.1 bp, lacking

  18. A review of the natural enemies of the red palm mite, Raoiella indica (Acari: Tenuipalpidae).

    Science.gov (United States)

    Carrillo, Daniel; Frank, J Howard; Rodrigues, Jose Carlos V; Peña, Jorge E

    2012-08-01

    A review of all the available information about the natural enemies reported in association with the red palm mite, Raoiella indica is presented. Twenty-eight species of predatory arthropods, including mites and insects, have been reported in association with R. indica in Asia, Africa and the Neotropics. In addition, pathogenic fungi associated with R. indica in the Caribbean have been reported. The available literature indicates that each site has a different natural enemy complex with only one predator species, Amblyseius largoensis (Acari: Phytoseiidae), present in all the geographical areas. The phytoseiids, Amblyseius caudatus Berlese, Amblyseius channabasavanni Gupta and A. largoensis, were regarded as important natural enemies of R. indica, and their predatory efficiency was studied in some detail. Among the predatory insects the coccinellids Stethorus keralicus Kapur and Telsimia ephippiger Chapin were reported as major predators of R. indica. The known distribution, abundance and relative importance of each species reported in association with R. indica are discussed.

  19. Description of a new species of bat-associated argasid tick (Acari: Argasidae) from Brazil.

    Science.gov (United States)

    Dantas-Torres, Filipe; Venzal, José M; Bernardi, Leopoldo F O; Ferreira, Rodrigo L; Onofrio, Valéria C; Marcili, Arlei; Bermúdez, Sergio E; Ribeiro, Alberto F; Barros-Battesti, Darci M; Labruna, Marcelo B

    2012-02-01

    A new species of argasid tick (Acari: Argasidae) is described from immature and adult specimens collected from several localities in Brazil. A complete morphological account is provided for all postembryonic life stages, i.e., larva, nymph, female, and male. Ornithodoros cavernicolous n. sp. is the 113(th) in the genus. Morphologically, the new species shares common features, e.g., presence of well-developed cheeks and legs with micromammillate cuticle, with other bat-associated argasid ticks included in the subgenus Alectorobius. In particular, the new species is morphologically related to Ornithodoros azteci Matheson, with which it forms a species group. Phylogenetic analysis based on the 16S rRNA gene sequences supports the placement of the new species within a large clade that includes other New World bat-associated argasids. However, the new species seems to represent an independent lineage within the genus Ornithodoros. PMID:21955330

  20. Arthropod colonization of land--linking molecules and fossils in oribatid mites (Acari, Oribatida).

    Science.gov (United States)

    Schaefer, Ina; Norton, Roy A; Scheu, Stefan; Maraun, Mark

    2010-10-01

    Terrestrial fossils that document the early colonization of land are scarce for >100 my after the Cambrian explosion. This raises the question whether life on land did not exist or just did not fossilize. With a molecular dating technique, we analyzed the origin of terrestrial chelicerate microarthropods (Acari, Oribatida) which have a fossil record since the Middle Devonian that is exceptional among soil animals. Our results suggest that oribatid mites originated in the Precambrian (571+/-37 mya) and that the radiation of basal groups coincides with the gap in the terrestrial fossil record between the Cambrian explosion and the earliest fossilized records of continental ecosystems. Further, they suggest that the colonization of land started via the interstitial, approximately 150 my earlier than the oldest fossils of terrestrial ecosystems. Overall, the results imply that omnivorous and detritivorous arthropods formed a major component in early terrestrial food webs, thereby facilitating the invasion of terrestrial habitats by later colonizers of higher trophic levels. PMID:20420932

  1. AVALIAÇÃO IN VITRO DA AÇÃO DE ACARICIDAS SOBRE Rhipicephalus (Boophilus microplus CANESTRINI, 1887 (ACARI: IXODIDAE DE BOVINOS LEITEIROS NO MUNICÍPIO DE ITAMARAJU, BAHIA, BRASIL

    Directory of Open Access Journals (Sweden)

    Fernando Henrique Spagnol

    2010-10-01

    Full Text Available As many tick populations of Rhipicephalus (Boophilus microplus can be resistant to drugs in the municipality of Itamaraju,Bahia, Brazil, an in vitro immersion test was carried out, from January to November 2008, in ticks from 22 dairy farms using the nine most used acaricides in the market. Fipronil had 99% efficacy, Chlorpyriphos+Cypermethrin high-cis 92%, Amitraz+Chlorpyriphos 90.7%, Diclorvos+Chlorpyriphos 81.4%, Cypermethrin+Chlorpyriphos+Citronelol 49.2%, Amitraz 49.0%, Cypermethrin+Ethion 39.9%, Deltamethrin 33.9%, Cypermethrin 21.1%. There was a range from one to five efficient acaricides (≥ 95% in each property. The results show that there is a wrong use of acaricides by the farmers and a high degree of resistance by ticks.

  2. Rhipicephalus (Boophilus microplus (Acari: Ixodidae as a parasite of pampas deer (Ozoctoceros bezoarticus and cattle in Brazil's Central Pantanal Rhipicephalus (Boophilus microplus como parasita de veado-campeiro (Ozoctoceros bezoarticus e do gado bovino no Pantanal Central do Brasil

    Directory of Open Access Journals (Sweden)

    Paulo Henrique Duarte Cançado

    2009-03-01

    Full Text Available In the Pantanal, domestic and wild animals share the same habitats; their parasites and environment interact in a complex and dynamic way. The Rhipicephalus (Boophilus microplus is the most important cattle tick in Brazil. In the past two decades, some traditional management practices are being replaced with the aim of intensifying cattle production. Forested areas are being replaced by exotic pasture and ranch owners are replacing Nelore for European breeds. The pampas deer (Ozoctoceros bezoarticus is a medium-sized cervid that occurs in grasslands of South America. Between December 2005 and January 2007, we captured and collected ticks from 15 pampas deer and 172 bovines. The abundance, intensity, and prevalence of ticks found in cattle were lower than those in pampas deer (p No Pantanal Brasileiro, onde animais domésticos e selvagens compartilham os mesmos habitats; hospedeiros, parasitas e ambientes encontram-se em interação complexa e dinâmica. Rhipicephalus (Boophilus microplus é o carrapato bovino mais importante no Brasil. Nas últimas duas décadas práticas de manejo vem sendo substituídas com objetivo de aumentar a produtividade. Áreas de florestas estão sendo substituídas por pastagens exóticas e os produtores começam a utilizar raças européias no lugar do Nelore. O veado-campeiro é um cervídeo que ocorre em áreas de campo na América do sul. Entre dezembro de 2005 e janeiro de 2007, foram coletados carrapatos de 20 veados-campeiros e 172 bovinos. Os valores de abundância, intensidade parasitária e prevalência de carrapatos no gado foram menores que os valores encontrados no veado-campeiro (p < 0,05, indicando que o veado-campeiro é mais susceptível que o bovino. O elevado número de fêmeas ingurgitadas coletadas, sua capacidade de ovipor e o percentual de eclosão indicam que a população veado-campeiro na região de estudo é suficiente para manter o R. (B. microplus, desta maneira participando na epidemiologia dos carrapatos e das doenças por eles transmitidas. O recente desmatamento, a introdução de Brachiaria sp. e do gado europeu precisam ser cuidadosamente avaliados, para prevenir perdas na industria do gado e vida selvagem.

  3. The genus Hyalomma Koch, 1844. I. Reinstatement of Hyalomma (Euhyalomma glabrum Delpy, 1949 (Acari, Ixodidae as a valid species with a redescription of the adults, the first description of its immature stages and notes on its biology

    Directory of Open Access Journals (Sweden)

    D.A. Apanaskevich

    2006-09-01

    Full Text Available For nearly 50 years the ixodid tick Hyalomma marginatum turanicum, reputedly introduced into South Africa on imported Persian sheep, has been considered identical to the Asian Hyalomma (Euhyalomma marginatum turanicum Pomerantzev, 1946. Comparisons of this tick with the Asian H. (E. m. turanicum and other subspecies of Hyalomma (Euhyalomma marginatum, however, reveal that it is an old taxon, namely Hyalomma rufipes glabrum Delpy, 1949. It is hereby reinstated as Hyalomma (Euhyalomma glabrum, and its adults are redescribed and its immature stages described for the first time. The preferred hosts of its adults are large herbivores such as zebras, gems bok and eland, on which it occurs during summer. The preferred hosts of its immature stages are scrub hares and ground-frequenting birds, on which it is present during autumn and winter. Data on its distribution and possible disease relationships are also provided.

  4. 全沟硬蜱Salp15蛋白家族成员基因的克隆与融合表达%CLONE AND EXPRESSION OF SALP15 SUPER FAMILY PROTEIN GENE FROM IXODES PERSULCATUS (ACARI: IXODIDAE)

    Institute of Scientific and Technical Information of China (English)

    王欣; 孙毅; 牛思博; 蒋宝贵

    2013-01-01

    为明确全沟硬蜱涎腺Salp15蛋白家族的基因表达情况,本文根据已知的Salp15序列设计引物对全沟硬蜱幼蜱的总RNA进行RT-PCR,克隆到可与莱姆病螺旋体外膜蛋白OspC互作的涎腺蛋白Salp15 CDS序列,命名为Ⅰ.p larva5.对该蛋白做生物信息学预测,其肽链在N端含有信号肽,在C端含有与CD4分子的结合位点.与其他蜱种Salp15蛋白的相似性分别为:62.3%(北美的肩突硬蜱Ixodes scapularis)、74.5%(欧洲的篦子硬蜱Ⅰ.ricinus iric3)、59.4%(西伯利亚全沟硬蜱Ⅰ.persulcatus)、67.6%(日本地区的全沟硬蜱iper1).将该cDNA序列分别加上EcoR Ⅰ,SalⅠ酶切位点,插入pMAL-c4X表达载体上,经IPTG诱导,在Transetta (DE3)上融合蛋白成功表达.此工作为研究全沟硬蜱的Salp15与莱姆病螺旋体,以及与宿主动物的相互关系奠定了基础.%As one of main vectors for Lyme borreliosis,Ixodes persulcatus threats both innocent individuals and domestic livestock.Salp15,a 15-kDa salivary protein in Ixodid ticks,has been known to suppress against the activities of host immunity and enhance the transmission of Lyme borrelia.To determine Salp15-1ike gene in Ixodes persulcatus,the primers for RT-PCR against total RNA from nymph according to other Salp15 homologues were designed,and firstly the Salp15 protein entitling Ⅰ.p larva5 (HE820731) potentially interacting with the outer surface protein C (OspC) of Lyme spirochaeta was obtained.The deduced protein Ⅰ.p larva5 shows similarity to Salp15 from other speices,i.e.62.3% (Ⅰ.scapularis in North America),74.5% (Ⅰ.ricinus in Western Europe),59.4% (Ⅰ.persulcatus in Siberia),67.6% (Ⅰ.persulcatus in Japan) respectively.Ⅰ.p larva5 CDS was then subcloned into expression vector pMAL-c4X,expressing in E.coli Rosseta (DE3),induced by IPTG.The recombinant protein was confirmed expressed successfully by SDS-PAGE and western blot,and its relative molecular weights about 60 kDa with MBP Taq protein.This study lays the fundamental basis for the interacting between spirochaeta and Ixodes persulcatus and host reservoir.

  5. Notas de ixodologia: III - conformação de Ixodes aragãoi Fonseca, 1935, de Ixodes amarali Fonseca, 1935, e lista das espécies do gênero Ixodes que ocorrem no Brasil (Acari, Ixodidae

    Directory of Open Access Journals (Sweden)

    Henrique Aragão

    1952-03-01

    Full Text Available After comparison of the types of Ixodes ricinus aragãoi Fonseca, 1935, with a lot of Ixodes affinis Neumann, 1899, kindly loaned by Dr. Kohls, it was observed that both species differ by the aspect of the dorsal scutm, no large punctations being in the posterior border in the Brazilian material. Therefore is FONSECA'S species maintened as Ixodes aragãoi Fonseca, 1935. Ixodes amarali Fonseca, 1935 was reexamined and confirmed as a valid species. A list of Brazilian species of the genus Ixodes studied by the authors is presented.

  6. INFLUÊNCIA DO PESO INICIAL E DA ESTAÇÃO DO ANO NA CONVERSÃO EM OVOS DE FÊMEAS DE Boophilus microplus (ACARI: IXODIDAE

    Directory of Open Access Journals (Sweden)

    Abraão Garcia Gomes

    2006-10-01

    Full Text Available Este trabalho objetivou avaliar a influência do peso inicial da fêmea e da estação do ano na conversão em ovos de Boophilus microplus. O índice de eficiência reprodutiva (IER de 411 fêmeas pesando entre 31 e 360 mg foi correlacionado com seu peso inicial. Para avaliar a influência das diferentes estações do ano neste parâmetro biológico, dez fêmeas ingurgitadas de B. microplus pesando acima de 150 mg foram colhidas, a cada duas semanas, e mantidas em condições climáticas controladas até a determinação do IER. Uma relação curvilinear foi observada entre o peso das fêmeas e o IER. Fêmeas pesando entre 151 e 360 mg tiveram IER’s mais altos (variando de 44,9% a 51,4% do que aquelas mais leves, as quais apresentaram uma menor capacidade de conversão em ovos (variando de 31,4% a 39,0%. Foi observado que a capacidade de as fêmeas converterem o peso em ovos variou sazonalmente. Os mais altos IER foram observados no período seco, de abril a setembro (47,6% a 58,3%, do que no período chuvoso, de outubro a março (40,2% a 43,6% (P<0,05. PALAVRAS-CHAVE: Boophilus microplus, biologia, conversão em ovos, bovinos.

  7. Infestación natural de hembras de Boophilus microplus Canestrini, 1887 (Acari: Ixodidae) en dos genotipos de bovinos en el trópico húmedo de Veracruz, México

    OpenAIRE

    Miguel Ángel Alonso Díaz; Barud Josué López Silva; Ana Carolina Leme de Magalhães Labarthe; Roger Iván Rodríguez Vivas

    2007-01-01

    El objetivo del presente estudio fue determinar la dinámica poblacional anual de Boophilus microplus en dos genotipos de ganado bovino. El estudio se realizó en Martínez de la Torre, Veracruz, México (región trópico húmeda). Se utilizaron 20 toretes de diez meses de edad y 185 kg de peso, infestados naturalmente con garrapatas B. microplus. Se formaron dos grupos de diez animales cada uno, según el genotipo (¾ Bos taurus [½ Holstein, ¼ Simmental, ¼ Cebú] y ½ Bos taurus [½ Holstein, ½ Cebú]). ...

  8. Benefits and risks of the subcutaneous immunotherapy with acari extracts in allergic rhinoconjunctivitis and bronchial asthma

    Directory of Open Access Journals (Sweden)

    Olimpio Rodríguez-Santos

    2014-12-01

    Full Text Available The records of patients from the Allergology Service in the Previsora Policlinic, Camagüey were revised to evaluate benefits and risks of the subcutaneous immunotherapy (ITSC with extracts of acari. The study was observational, analytic and retrospective of cases and controls in allergic rhinoconjunctivitis and bronchial asthma. A total of 160 subjects, older than 18 years old, were chosen. Eighty out of them had already received ITSC with dose increase during 13 weeks and maintenance with monthly injections during 18 months. A total of 80 patients who only received prevention measures and medications during the crises were paired. Questionnaires were applied for quality of rhinoconjunctivitis life and asthma, about the consumption of medications and the frequency of the crises. The adverse events were measured, as they were local and systemic to the cutaneous tests, to the ITSC and the different pharmacological treatments. There was a significant increase of the punctuation of life quality questionnaires, (p=0.011. The consumption of medications decreased in both the cases and the controls, without significant differences (p=0.083. The frequency of the rhinitis and asthma crises decrease in the group of ITSC (p=0.029. Slight local and systemic reactions were reported in both groups with Odds ratio (OR=2.029 in the ITSC group, with a 95% confidence interval of 1.114–3.967 (p=0.019. The results show that the subcutaneous immunotherapy with acari offers benefits and few risks to patients with allergic rhinoconjunctivitis and asthma.

  9. Investigation ofBorrelia spp. in ticks (Acari:Ixodidae) at the border crossings between China and Russia in Heilongjiang Province, China

    Institute of Scientific and Technical Information of China (English)

    Shi Liu; Chao Yuan; Yun-Fu Cui; Bai-Xiang Li; Li-Jie Wu; Ying Liu

    2012-01-01

    Objective:To investigate the precise species of tick vector and theBorrelia spirochete pathogen at the Heilongjiang Province international border with Russia.Methods:In this study, ticks were collected from12 Heilongjiang border crossings (including grasslands, shrublands, forests, and plantantions) to determine the rate and species type of spirochete-infected ticks and the most prevalent spirochete genotypes.Results:The ticks represented three genera and four species of the Ixodidae family [Ixodes persulcatus,Dermacentor silvarum,Haemaphysalis concinna and Haemaphysalis japonica].Ixodes persulcatus had the highest amount ofBorrelia burgdorferi sensu lato infection of25.6% and the most common species ofBorreliaisolated from Ixodes persulcatus wasBorrelia garinii, strainPD91.Conclusions: Our results suggest thatBorrelia gariniiPD91-infectedIxodes persulcatus may be the principal cause of Lyme disease in the border crossing areas of Heilongjiang Province.

  10. Two new families (Acari: Alicorhagiidae and Platyhelminthes: Prorhynchidae) reported for the Hungarian fauna From leaf litter in the Bükk Mountains

    OpenAIRE

    Pfliegler, W.P.; Bolton, S.J.

    2016-01-01

    Two new members of the Hungarian fauna are reported, both of them were collected in beech forest leaf litter in the Bükk Mountains, North-East Hungary: Alicorhagia fragilis Berlese, 1910 (Arthropoda: Arachnida: Acari: Sarcopti-formes: Endeostigmata: Alicorhagiidae) and Geocentrophora baltica (Kennel, 1883) (Platyhelminthes: Rhabditophora: Trepaxonemata: Amplimatricata: 'Lecithoepitheliata': Prorhynchida: Prorhynchidae). The families Alicorhagiidae and Prorhynchidae both represent...

  11. Evaluation of corn plant as potential banker plant for supporting predatory gall Midge, Feltiella acarisuga (Diptera: Cecidomyiidae) against Tetranychus urticae (Acari: Tetranychidae) in greenhouse vegetable production

    Science.gov (United States)

    The twospotted spider mite, Tetranychus urticae Koch (Acari: Tetranychidae), is one of the most important and highly polyphagous pests of vegetables and other crops worldwide. In this study, several experiments were conducted under laboratory and greenhouse conditions to evaluate whether corn plant ...

  12. Progress in the complete mitochondrial genomes of the Acari%蜱螨线粒体基因组研究进展

    Institute of Scientific and Technical Information of China (English)

    袁明龙; 王进军

    2012-01-01

    Acari, including ticks and mites, is one of the most diverse group of arthropods. In this paper, we reviewed the research progress in the 28 sequenced complete mitochondrial genomes of acari species. These mitochondrial genomes have several marked features; (1) There is significant variation in the size of mitochondrial genomes among the 28 acari species, and the mitochondrial genome of Panonychus citri (13 077 bp) is the smallest among all sequenced arthropods; (2) The base composition of all acari mitochondrial genomes are biased toward A and T, with six species harboring reverse GC-skew values (positive value) ; (3) The base composition and the position, length, copy number of the A +T-rich regions vary greatly among the 28 acari species, of which four tetranychid species harbor the highest A +T content within acari and the shortest A +T-rich region (44-57 bp) among arthropods; (4) High gene rearrangements are found in acari mitochondrial genomes, especially in those of Acariformes, but the rearrangements are not correlated to high taxonomic ranks; (5) The tRNA genes in some species of Acariformes are extremely truncated, presenting atypical cloverleaf structures. We suggest that it is necessary to sequence more acari mitochondrial genomes aiming to investigate whether these tRNA genes lacking both D- and T-arms are functional or not, to analyze the molecular mechanisms of evolution in acari mitochondrial genomes, and to carry out the acari mitochondrial transcriptome studies.%蜱螨亚纲包括蜱类和螨类,是节肢动物中物种多样性最高的类群之一.本文综述了当前已测序的28种蜱螨线粒体基因组的研究成果.概括起来,蜱螨线粒体基因组具有以下特点:(1)大小变异显著,其中柑橘全爪螨Panonychus citri线粒体基因组在目前已测节肢动物中最小(13077 bp);(2)一般碱基组成偏向A和T,但6种蜱螨具有相反的GC-偏斜(正值);(3)基因组的碱基组成及A+T富集区的位置、长度和

  13. Driving forces for changes in geographical distribution of Ixodes ricinus ticks in Europe

    DEFF Research Database (Denmark)

    Medlock, Jolyon M.; Hansford, Kayleigh M.; Bormane, Antra;

    2013-01-01

    Many factors are involved in determining the latitudinal and altitudinal spread of the important tick vector Ixodes ricinus (Acari: Ixodidae) in Europe, as well as in changes in the distribution within its prior endemic zones. This paper builds on published literature and unpublished expert opini...

  14. Molecular and pharmacological characterization of the first Chelicerata pyrokinin receptor from a worldwide tick vector of zoonotic pathogens, Rhipicephalus (Boophilus) microplus

    Science.gov (United States)

    We identified the first pyrokinin receptor (Rhimi-PK-R) from the Chelicerata and analyzed structure-activity relationships of cognate ligand neuropeptides and their analogs. This receptor, which we cloned from larvae of the tick Rhipicephalus microplus (Acari: Ixodidae), is the ortholog of the inse...

  15. The characterization and manipulation of the bacterial microbiome of the Rocky Mountain wood tick, Dermacentor andersoni

    Science.gov (United States)

    Background: In North America, ticks are the most economically impactful vectors of human and animal pathogens. The Rocky Mountain wood tick, Dermacentor andersoni (Acari: Ixodidae), transmits Rickettsia rickettsii and Anaplasma marginale to humans and cattle, respectively. In recent years, studies h...

  16. Efeitos de Beauveria bassiana (Bals Vuill e Metarhizium anisopliae (Metsc Sorok sobre fêmeas ingurgitadas de Amblyomma cajennense (Fabricius, 1787 em condições de laboratório Effects of Beauveria bassiana (Bals Vuill and Metarhizium anisopliae (Metsc Sorok on engorged females of Amblyomma cajennense (Fabricius, 1787 in laboratory conditions

    Directory of Open Access Journals (Sweden)

    R.C.S. Reis

    2004-12-01

    Full Text Available The in vitro susceptibility of Amblyomma cajennense engorged females to some isolated of the fungus Beauveria bassiana and Metarhizium anisopliae was verified and lethal concentrations (LC 50 and LC 90 were calculated. The females were dived in conidia suspensions for five minutes, and kept in climatically controlled chambers BOD under 27° C and 80% relative humidity. Each bioassay had four treatments in concentrations of 10(5,10(6,10(7e10(8 conidia/ml. A control group was also used. The following characteristics were evaluated: weight and period of oviposition, indexes of reproductive and nutritional efficiency and percentage of microbiological control. A dose dependent negative effect was observed in ticks treated with the suspension. All isolates tested cause a negative effect on in vitro tests of engorged females of A. cajennense, suggesting its potential for microbiological control of tick's species.

  17. Tick pests and vectors (Acari: Ixodoidea) in European towns: Introduction, persistence and management.

    Science.gov (United States)

    Uspensky, Igor

    2014-02-01

    Ticks have always been a part of fauna in and around human settlements, and their significance changed concurrently with the enlargement of settlements and their transformation into towns. The increased rate of urbanization during the last decades has created a new reality for tick existence. Two groups of ticks are of major concern for modern towns: those living under natural conditions of urban surroundings and those well-adapted to urban conditions. During the process of urbanization, encroachment into forested and uncultivated areas as well as protection of existing green spaces create opportunities for ticks living in nature to also exist under urban and suburban conditions. Conditions of modern urban and especially suburban environment in developed European countries adequately meet tick requirements. Tick species having an advantage in urban areas are those that can use one and the same host at all parasitic stages, can starve for a prolonged time, can use either urban pests or domesticated animals as hosts, and can live in man-made buildings. The ticks of the Argas reflexus group (Argasidae) and the brown dog tick Rhipicephalus sanguineus (Ixodidae) comply with practically all conditions necessary for successful survival in urban areas. The ability of ticks to transmit numerous human and animal pathogens and the presence of many reservoir hosts in urban and suburban areas create persistent danger for human populations and domestic animals. Impact on urban ticks should be directed against the two major requirements of tick existence: reducing populations of potential tick hosts (feral pigeons, stray dogs and cats, and urban rodents), and changing other environmental conditions to make them less suitable for ticks. It is especially important that urban inhabitants be properly informed about the danger posed by ticks, the sites of possible tick attacks, and basic self-protection techniques.

  18. Detection of Rickettsia rickettsii in the tick Amblyomma cajennense in a new Brazilian spotted fever-endemic area in the state of Minas Gerais

    Directory of Open Access Journals (Sweden)

    Elizângela Guedes

    2005-12-01

    Full Text Available The present study evaluated rickettsial infection in Amblyomma spp. ticks collected in a farm in Coronel Pacheco, a Brazilian spotted fever (BSF endemic area. A total of 78 A. cajennense and 78 A. dubitatum free-living adult ticks were collected and tested by polymerase chain reaction (PCR targeting a fragment of the rickettsial gene gltA. Only one pool of three A. cajennense ticks showed the expected product by PCR. This pool was further tested by PCR using sets of primers targeting the rickettsial genes gltA, ompA, and ompB. All reactions yielded the expected bands that by sequencing, showed 100% identity to the corresponding sequences of the Rickettsia rickettsii gene fragments gltA (1063-bp, ompA (457-bp, and ompB (720-bp. The minimal infection rate of R. rickettii in the A. cajennense population was 1.28% (at least one infected tick within 78 ticks.The present study showed molecular evidence for the presence of R. rickettsii in A. cajennense from a BSF-endemic area in Coronel Pacheco, state of Minas Gerais. Although R. rickettsii has been previously reported infecting A. cajennense ticks in Brazil and other Latin American countries, the present study performed the first molecular characterization of R. rickettsii from the tick A. cajennense.

  19. A prevalent alpha-proteobacterium Paracoccus sp. in a population of the Cayenne ticks (Amblyomma cajennense from Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Erik Machado-Ferreira

    2012-01-01

    Full Text Available As Rocky Mountain Spotted Fever is the most common tick-borne disease in South America, the presence of Rickettsia sp. in Amblyomma ticks is a possible indication of its endemicity in certain geographic regions. In the present work, bacterial DNA sequences related to Rickettsia amblyommii genes in A. dubitatum ticks, collected in the Brazilian state of Mato Grosso, were discovered. Simultaneously, Paracoccus sp. was detected in aproximately 77% of A. cajennense specimens collected in Rio de Janeiro, Brazil. This is the first report of Paracoccus sp. infection in a specific tick population, and raises the possibility of these bacteria being maintained and/or transmitted by ticks. Whether Paracoccus sp. represents another group of pathogenic Rhodobacteraceae or simply plays a role in A. cajennense physiology, is unknown. The data also demonstrate that the rickettsial 16S rRNA specific primers used forRickettsia spp. screening can also detect Paracoccus alpha-proteobacteria infection in biological samples. Hence, a PCRRFLP strategy is presented to distinguish between these two groups of bacteria.

  20. More about the role of 2,6-dichlorophenol in tick courtship: identification and olfactometer bioassay in Amblyomma cajennense and Rhipicephalus sanguineus

    Directory of Open Access Journals (Sweden)

    Carla Cristina Braz Louly

    2008-02-01

    Full Text Available This study aimed to identify 2,6-dichlorophenol (2,6-DCP in Amblyomma cajennense and to evaluate its role in A. cajennense and Rhipicephalus sanguineus courtship. Hexanic extract from attractive females was purified by solid phase extraction and the phenol was identified by the single ion monitoring method using GC/MS. In an olfactometer, the responses of A. cajennense and R. sanguineus males to females, control rubber septa or rubber septa impregnated with 2,6-DCP at 50, 500, and 5000 ng, respectively, were studied. 2,6-DCP was identified in A. cajennense extract and the males oriented themselves toward the concentration of 500 ng. These septa and the females were recognized as copula partners. The septa treated with 2,6-DCP did not attract and were not even recognized by the R. sanguineus males, whereas the females were recognized. Due to the presence of 2,6-DCP in A. cajennense and the results of biological bioassays, it was concluded that this compound acts as an attractant and mounting sex pheromone in this tick, but it does not play any role in R. sanguineus courtship.

  1. High prevalence of Rickettsia africae variants in Amblyomma variegatum ticks from domestic mammals in rural western Kenya: implications for human health.

    Science.gov (United States)

    Maina, Alice N; Jiang, Ju; Omulo, Sylvia A; Cutler, Sally J; Ade, Fredrick; Ogola, Eric; Feikin, Daniel R; Njenga, M Kariuki; Cleaveland, Sarah; Mpoke, Solomon; Ng'ang'a, Zipporah; Breiman, Robert F; Knobel, Darryn L; Richards, Allen L

    2014-10-01

    Tick-borne spotted fever group (SFG) rickettsioses are emerging human diseases caused by obligate intracellular Gram-negative bacteria of the genus Rickettsia. Despite being important causes of systemic febrile illnesses in travelers returning from sub-Saharan Africa, little is known about the reservoir hosts of these pathogens. We conducted surveys for rickettsiae in domestic animals and ticks in a rural setting in western Kenya. Of the 100 serum specimens tested from each species of domestic ruminant 43% of goats, 23% of sheep, and 1% of cattle had immunoglobulin G (IgG) antibodies to the SFG rickettsiae. None of these sera were positive for IgG against typhus group rickettsiae. We detected Rickettsia africae-genotype DNA in 92.6% of adult Amblyomma variegatum ticks collected from domestic ruminants, but found no evidence of the pathogen in blood specimens from cattle, goats, or sheep. Sequencing of a subset of 21 rickettsia-positive ticks revealed R. africae variants in 95.2% (20/21) of ticks tested. Our findings show a high prevalence of R. africae variants in A. variegatum ticks in western Kenya, which may represent a low disease risk for humans. This may provide a possible explanation for the lack of African tick-bite fever cases among febrile patients in Kenya.

  2. Assessment of tick antioxidant responses to exogenous oxidative stressors and insight into the role of catalase in the reproductive fitness of the Gulf Coast tick, Amblyomma maculatum.

    Science.gov (United States)

    Kumar, D; Budachetri, K; Meyers, V C; Karim, S

    2016-06-01

    As obligate blood-sucking ectoparasites, to avoid tissue damage, ticks must neutralize the reactive oxygen species (ROS) generated from uptake and digestion of a bloodmeal. Consequently, ticks utilize a battery of antioxidant molecules, including catalase (CAT), an enzyme that converts hydrogen peroxide (H2 O2 ) into water and oxygen. Here, we investigated the tick antioxidant machinery by exogenous injection of sublethal doses of H2 O2 or paraquat. The relative transcript levels of selected Amblyomma maculatum antioxidant targets in tissues were determined by quantitative reverse transcriptase PCR following treatment. The results showed 2-16-fold increases in target antioxidant gene transcripts, signifying the ability of Am. maculatum to regulate its antioxidant machinery when exposed to increased ROS levels. Next, RNA interference was used to determine the functional role of CAT in haematophagy, redox homeostasis and reproductive fitness. CAT gene silencing was confirmed by transcript depletion within tick tissues; however, CAT knockdown alone did not interfere with tick haematophagy or phenotype, as confirmed by the resulting differential expression of antioxidant genes, thereby indicating an alternative mechanism for ROS control. Interestingly, double stranded RNA of CAT gene (dsCAT) and the CAT inhibitor, 3-aminotriazole, together reduced tick reproductive fitness via a marked reduction in egg mass and larval eclosion rates, highlighting a role for CAT in tick redox-homeostasis, making it a potential target for tick control. PMID:26919203

  3. Primeiro registro de Oligonychus yothersi (McGregor (Acari: Tetranychidae em Eucalyptus grandis Hill ex Maiden no Brasil First record of Oligonychus yothersi (McGregor (Acari: Tetranychidae on Eucalyptus grandis Hill ex Maiden in Brazil

    Directory of Open Access Journals (Sweden)

    Fabrício Fagundes Pereira

    2005-08-01

    Full Text Available Relata-se a infestação de um ácaro-vermelho em mudas clonais de Eucalyptus grandis Hill ex Maiden, mantidas em casa de vegetação no município de Martinho Campos, Minas Gerais. O ácaro foi observado na parte superior das folhas que exibiam sinais de sucção de seiva e bronzeamento. Essas injúrias causaram desenvolvimento anormal e morte de plantas. O ácaro foi identificado como Oligonychus yothersi (McGregor (Acari: Tetranychidae, e isso representa o primeiro registro dessa espécie em mudas clonais de E. grandis no Brasil.An infestation of the red spider mite was reported in clone seedlings of Eucalyptus grandis Hill ex Maiden under greenhouse conditions, in the municipality of Martinho Campos, Minas Gerais State. The spider mite was found on the leaf upper faces with signs of sap suction and bronzing. Such injuries caused abnormal development and plant death. The spider mite was identified as Oligonychus yothersi (McGregor (Acari: Tetranychidae. This is the first record of O. yothersi on E. grandis seedlings in Brazil.

  4. Acaricidal and repellent activities of essential oil of Eucalyptus globulus against Dermanyssus gallinae (Acari: Mesostigmata

    Directory of Open Access Journals (Sweden)

    Dehghani-Samani Amir

    2015-07-01

    Full Text Available Introduction: By considering an increase in drug resistance against red mites, finding the nonchemical herbal acaricide against Dermanyssus gallinae (De Geer (Acari: Mesostigmata is necessary to kill them and to reduce the chemical resistance against chemical acaricides in this specie. Dermanyssus gallinae is a potential vector of the causal agent of several viral diseases such as Equine encephalitis and St. Louis encephalitis. It can be a vector of bacteria such as Salmonella spp., Mycobacterium spp. and Erysipelothrix rhusiopathiae. It is also known to cause itching dermatosis in humans. In this study acaricidal and repellent activities of essential oil of Eucalyptus globulus against Dermanyssus gallinae were studied. Methods: After extracting the essential oil, different concentrations of the plant extract were prepared. Then, acaricidal effect of different concentrations was tested on poultry red mite, Dermanyssus gallinae, by dropping 3-4 drops of essential oil on mites. Repellent activity of essential oil was tested by Y-tube olfactometer bioassay. After the test, total number of killed and repellent mites reported. Results: Concentration of 1:2 or 50% had more acaricidal effect on mites. Also essential oil of Eucalyptus globulus had repellent activity against red mites. Conclusion: This study showed that essential oil of Eucalyptus globulus had acaricidal and repellent activities against red mites. Hence it might be used as a herbal acaricide against it to kill and to reduce the chemical resistance in this specie.

  5. Study of Acari and Collembola Populations in Four Cultivation Systems in Dourados - MS

    Directory of Open Access Journals (Sweden)

    Rosilda Mara Mussury

    2002-09-01

    Full Text Available The impact four cultivation systems on the soil fauna was studied, using Oribatida and Gamasida acarids as bioindicators and collembolan. The research was carried out in experimental fields, located in EMBRAPA - CPAO in Dourados, Centerwest of Brazil from July 1997 to December 1999. The constant pasture system presented smaller impact on the soil fauna followed by agricultural cattle rotation and a direct plantation system. In the conventional plantation series, the populational density of the mesofauna organisms was low, especially collembolan families.O impacto de quatro sistemas de cultivo sobre a fauna de solo foram estudados, utilizando-se como bioindicadores os acari Oribatida e Gamasida e os Collembola. A pesquisa foi conduzida em campos experimentais, localizados na EMBRAPA - CPAO no município de Dourados, MS, no período de julho de 1997 à dezembro de 1999. O sistema de pastagem contínua apresentou menor impacto sobre a fauna de solo seguido da rotação agricultura pecuária e do sistema de plantio direto. Nas sucessões do plantio convencional, a densidade populacional dos organismos da mesofauna foi baixa, em especial as famílias de colembolos.

  6. Deoxidant-induced anoxia as a physical measure for controlling spider mites (Acari: Tetranychidae).

    Science.gov (United States)

    Suzuki, Takeshi; Wang, Chih-Hung; Gotoh, Tetsuo; Amano, Hiroshi; Ohyama, Katsumi

    2015-03-01

    Tiny agricultural pests such as spider mites (Acari: Tetranychidae) attached to seedlings grown outdoors often invade greenhouses, thereby triggering pest outbreaks. To solve the problem, we examined whether differences in anoxia tolerance between animals and plants would permit the application of an anoxic environment to control spider mites without the aid of acaricides. Under an anoxic environment created by using a commercial deoxidant at 25 °C, the time for 50 % mortality of eggs, non-diapausing adults (summer form), and diapausing adults (winter form) were 6.1, 5.5, and 23.6 h, respectively, for Tetranychus urticae Koch and 5.4, 3.9, and 23.2 h, respectively, for Tetranychus kanzawai Kishida. With anoxia for 12 h, no eggs and non-diapausing adults survived in either species, whereas most diapausing adults (98 % for T. urticae and 88 % for T. kanzawai) survived. Under this treatment, host Phaseolus vulgaris L. seedlings showed serious physiological disorders in their primary leaves and apical buds, and unusual lateral buds developed in the cotyledon axils. The spider mites acquire anoxia tolerance during diapause, but anoxia can potentially control them during the summer if no negative effects are observed in the treated seedlings.

  7. Development and reproduction of spider mites Tetranychus turkestani (Acari: Tetranychidae under water deficit condition in soybeans

    Directory of Open Access Journals (Sweden)

    Ivelina Nikolova

    2014-09-01

    Full Text Available One of the major pests of soybeans in Bulgaria is the spider mite Tetranychus turkestani Ug et Nik (Acari: Tetranychidae and different results have been reported about the impact of water stress on its development and reproduction. Soybean plants exposed to natural infestation by spider mites, water deficit and treatment with imidacloprid were examined under greenhouse conditions at the Institute of Forage Crops, Pleven, Bulgaria, over the period 2011-2012. The development of mites and their eggs was faster when plants were exposed to water deficit, which created favorable conditions for high density and reproduction of T. turkestani. There was a vertical distribution of protonymphs, deutonymphs and adults as their numbers and egg counts were significantly higher under conditions of water deficit on the upper and middle plant parts, compared with their bottom parts, and imidacloprid treatment had a stronger and more prolonged activity against mites, compared to its influence on well-watered plants. Spider mites on water-stressed plants caused a 24.8% reduction in the contents of plastid pigments, and carotenoids, and 21.5% decrease on well-watered plants.

  8. Practical sampling plans for Varroa destructor (Acari: Varroidae) in Apis mellifera (Hymenoptera: Apidae) colonies and apiaries.

    Science.gov (United States)

    Lee, K V; Moon, R D; Burkness, E C; Hutchison, W D; Spivak, M

    2010-08-01

    The parasitic mite Varroa destructor Anderson & Trueman (Acari: Varroidae) is arguably the most detrimental pest of the European-derived honey bee, Apis mellifera L. Unfortunately, beekeepers lack a standardized sampling plan to make informed treatment decisions. Based on data from 31 commercial apiaries, we developed sampling plans for use by beekeepers and researchers to estimate the density of mites in individual colonies or whole apiaries. Beekeepers can estimate a colony's mite density with chosen level of precision by dislodging mites from approximately to 300 adult bees taken from one brood box frame in the colony, and they can extrapolate to mite density on a colony's adults and pupae combined by doubling the number of mites on adults. For sampling whole apiaries, beekeepers can repeat the process in each of n = 8 colonies, regardless of apiary size. Researchers desiring greater precision can estimate mite density in an individual colony by examining three, 300-bee sample units. Extrapolation to density on adults and pupae may require independent estimates of numbers of adults, of pupae, and of their respective mite densities. Researchers can estimate apiary-level mite density by taking one 300-bee sample unit per colony, but should do so from a variable number of colonies, depending on apiary size. These practical sampling plans will allow beekeepers and researchers to quantify mite infestation levels and enhance understanding and management of V. destructor.

  9. Comparing oxalic acid and sucrocide treatments for Varroa destructor (Acari: Varroidae) control under desert conditions.

    Science.gov (United States)

    Sammataro, D; Finley, J; Underwood, R

    2008-08-01

    The effectiveness of oxalic acid (OA) and Sucrocide (S) (AVA Chemical Ventures, L.L.C., Portsmouth, NH) in reducing populations of the varroa mite Varroa destructor Anderson & Trueman (Acari: Varroidae) in honey bee, Apis mellifera L. (Hymenoptera: Apidae) colonies was measured under the desert conditions of Arizona, USA. OA and S were applied three times 7 d apart. A 3.2% solution of OA was applied in sugar syrup via a large volume syringe, trickling 5 ml per space between frames in the colony. S was applied at a concentration of 0.625% (mixed with water), according to the label directions, using a compressed air Chapin sprayer at 20 psi to apply 59 ml per frame space. Varroa mites, collected on a sticky board before, during, and after the treatments, were counted to assess the effectiveness of the treatments. This study showed that a desert climate zone did not confer any positive or negative results on the acaricidal properties of OA. Even with brood present in colonies, significant varroa mite mortality occurred in the OA colonies. In contrast, we found that Sucrocide was not effective as a mite control technique. Despite its ability to increase mite mortality in the short-term, varroa mite populations measured posttreatment were not affected any more by Sucrocide than by no treatment at all.

  10. Distribution of Chaetodactylus krombeini (Acari: Chaetodactylidae) within Osmia cornifrons (Hymenoptera: Megachilidae) nests: implications for population management.

    Science.gov (United States)

    McKinney, Matthew I; Park, Yong-Lak

    2013-06-01

    Chaetodactylus krombeini (Baker) (Acari: Chaetodactylidae) is a cleptoparasitic mite that negatively affects propagation of Osmia spp. (Hymenoptera: Megachilidae) for orchard pollination in the USA. This study was conducted to determine the effect of C. krombeini on mortality of male and female Osmia cornifrons, the Japanese hornfaced bee. A total of 107 O. cornifrons nests were examined to determine within-nest distribution of C. krombeini with regression analyses. A total of 30 mite-free O. cornifrons nests were observed and within-nest distribution of male and female O. cornifrons was determined with non-linear regression analyses. In addition, cocoons from 20 mite-infested O. cornifrons cells were examined to determine whether C. krombeini could be found inside cocoons of O. cornifrons. The results of this study showed that female O. cornifrons and C. krombeini were found more frequently in the inner part of the nest, and male O. cornifrons were found mostly in the center of the nest. No C. krombeini were found inside O. cornifrons cocoons. These results indicate that C. krombeini have a greater negative impact on mortality in the egg and larval stages of female O. cornifrons than in male O. cornifrons. Implications for management of C. krombeini and O. cornifrons populations for orchard pollination are discussed in this article. PMID:23100109

  11. Historical review of the genus Dermanyssus Dugès, 1834 (Acari: Mesostigmata: Dermanyssidae

    Directory of Open Access Journals (Sweden)

    Roy L.

    2007-06-01

    Full Text Available A synthetic review of the historical systematics of Dermanyssus Dugès, 1834 (Acari: Mesostigmata: Dermanyssidae is provided. The classification at the specific level in this early genus has not really been clarified during more than a century despite its economic impact, and the history of the genus is complex and includes various stages. Moreover, Dermanyssus currently includes 23 species, whereas the last review took only 18 species into account. Changes in the species status and position in the genus Dermanyssus from 1834 until today are presented. The evolution of the generic definition is explored and compared with other genera of the group. How the discrimination between the different species evolved in the genus is also examined. Some difficulties in the specific definitions are discussed. A current diagnosis of the genus Dermanyssus is given. A table of the species included in this genus since its first description along with their respective current positions, a list of the currently included species in Dermanyssus with their hosts, and a world map presenting their geographic distribution are provided.

  12. Amblyomma americanum tick saliva insulin-like growth factor binding protein-related protein 1 binds insulin but not insulin-like growth factors.

    Science.gov (United States)

    Radulović, Ž M; Porter, L M; Kim, T K; Bakshi, M; Mulenga, A

    2015-10-01

    Silencing Amblyomma americanum insulin-like growth factor binding protein-related protein 1 (AamIGFBP-rP1) mRNA prevented ticks from feeding to repletion. In this study, we used recombinant (r)AamIGFBP-rP1 in a series of assays to obtain further insight into the role(s) of this protein in tick feeding regulation. Our results suggest that AamIGFBP-1 is an antigenic protein that is apparently exclusively expressed in salivary glands. We found that both males and females secrete AamIGFBP-rP1 into the host during feeding and confirmed that female ticks secrete this protein from within 24-48 h after attachment. Our data suggest that native AamIGFBP-rP1 is a functional insulin binding protein in that both yeast- and insect cell-expressed rAamIGFBP-rP1 bound insulin, but not insulin-like growth factors. When subjected to anti-blood clotting and platelet aggregation assays, rAamIGFBP-rP1 did not have any effect. Unlike human IGFBP-rP1, which is controlled by trypsinization, rAamIGFBP-rP1 is resistant to digestion, suggesting that the tick protein may not be under mammalian host control at the tick feeding site. The majority of tick-borne pathogens are transmitted 48 h after the tick has attached. Thus, the demonstrated antigenicity and secretion into the host within 24-48 h of the tick starting to feed makes AamIGFBP-rP1 an attractive target for antitick vaccine development.

  13. Evaluation of the speed of kill of sarolaner (Simparica™) against induced infestations of three species of ticks (Amblyomma maculatum, Ixodes scapularis, Ixodes ricinus) on dogs.

    Science.gov (United States)

    Six, Robert H; Geurden, Thomas; Carter, Lori; Everett, William R; McLoughlin, A; Mahabir, Sean P; Myers, Melanie R; Slootmans, Nathalie

    2016-05-30

    The rapid speed of kill of sarolaner (Simparica™, Zoetis), a novel isoxazoline compound, was demonstrated against three tick species known to infest dogs in Europe or the United States. Efficacy was measured against an existing infestation and against subsequent weekly re-infestations for 35 days after treatment. Dogs were randomly allocated to treatment with a single oral dose of either placebo or sarolaner (2mg/kg) based on pre-treatment host-suitability tick counts. Dogs were infested with approximately 50 unfed adult Ixodes scapularis, Ixodes ricinus or Amblyomma maculatum ticks on Days-2, 7, 14, 21, 28 and 35. Tick counts were conducted at 4 (I. scapularis only), 8, 12 and 24h after treatment on Day 0 and after each subsequent re-infestation. No treatment-related adverse reactions occurred during any of these studies. Dogs in the placebo-treated groups maintained adequate tick infestations (recovery of 20-70% of applied ticks) throughout the duration of the studies. Following treatment, live tick counts were significantly reduced relative to placebo at the 8h post treatment counts indicating that sarolaner started killing existing infestations of ticks rapidly after treatment. Efficacy was 90.1% against I. ricinus, 98.8% against I. scapularis, and 99.2% against A. maculatum within 12h, and 100% efficacy was achieved at 24h after treatment against all three tick species. This speed of kill was maintained throughout the month with ≥95.7%, ≥98.7% and ≥89.6% efficacy against I. scapularis, I. ricinus, and A. maculatum, respectively, at 24h after re-infestation at least through Day 28. PMID:26928659

  14. High detection rate of Rickettsia africae in Amblyomma variegatum but low prevalence of anti-rickettsial antibodies in healthy pregnant women in Madagascar.

    Science.gov (United States)

    Keller, Christian; Krüger, Andreas; Schwarz, Norbert Georg; Rakotozandrindrainy, Raphael; Rakotondrainiarivelo, Jean Philibert; Razafindrabe, Tsiry; Derschum, Henri; Silaghi, Cornelia; Pothmann, Daniela; Veit, Alexandra; Hogan, Benedikt; May, Jürgen; Girmann, Mirko; Kramme, Stefanie; Fleischer, Bernhard; Poppert, Sven

    2016-02-01

    Tick-borne spotted fever group (SFG) rickettsioses are emerging infectious diseases in Sub-Saharan Africa. In Madagascar, the endemicity of tick-borne rickettsiae and their vectors has been incompletely studied. The first part of the present study was conducted in 2011 and 2012 to identify potential anthropophilic tick vectors for SFG rickettsiae on cattle from seven Malagasy regions, and to detect and characterize rickettsiae in these ticks. Amblyomma variegatum was the only anthropophilic tick species found on 262 cattle. Using a novel ompB-specific qPCR, screening for rickettsial DNA was performed on 111 A. variegatum ticks. Rickettsial DNA was detected in 96 of 111 ticks studied (86.5%). Rickettsia africae was identified as the only infecting rickettsia using phylogenetic analysis of ompA and ompB gene sequences and three variable intergenic spacers from 11 ticks. The second part of the study was a cross-sectional survey for antibodies against SFG rickettsiae in plasma samples taken from healthy, pregnant women at six locations in Madagascar, two at sea level and four between 450 and 1300m altitude. An indirect fluorescent antibody test with Rickettsia conorii as surrogate SFG rickettsial antigen was used. We found R. conorii-seropositives at all altitudes with prevalences between 0.5% and 3.1%. Our results suggest that A. variegatum ticks highly infected with R. africae are the most prevalent cattle-associated tick vectors for SFG rickettsiosis in Madagascar. Transmission of SFG rickettsiosis to humans occurs at different altitudes in Madagascar and should be considered as a relevant cause of febrile diseases.

  15. Structural characterization of tick cement cones collected from in vivo and artificial membrane blood-fed Lone Star ticks (Amblyomma americanum).

    Science.gov (United States)

    Bullard, Rebekah; Allen, Paige; Chao, Chien-Chung; Douglas, Jessica; Das, Pradipta; Morgan, Sarah E; Ching, Wei-Mei; Karim, Shahid

    2016-07-01

    The Lone Star tick, Amblyomma americanum, is endemic to the southeastern United States and capable of transmitting pathogenic diseases and causing non-pathogenic conditions. To remain firmly attached to the host, the tick secretes a proteinaceous matrix termed the cement cone which hardens around the tick's mouthparts to assist in the attachment of the tick as well as to protect the mouthparts from the host immune system. Cement cones collected from ticks on a host are commonly contaminated with host skin and hair making analysis of the cone difficult. To reduce the contamination found in the cement cone, we have adapted an artificial membrane feeding system used to feed long mouthpart ticks. Cones collected from in vivo and membrane fed ticks are analyzed to determine changes in the cone morphology. Comparisons of the cement cones using light microscopy shows similar structures and color however using scanning electron microscopy the cones have drastically different structures. The in vivo cones contain fibrils, sheets, and are heavily textured whereas cones from membrane fed ticks are remarkably smooth with no distinct structures. Analysis of the secondary protein structures using FTIR-ATR show both in vivo and membrane fed cement cones contain β sheets but only in vivo cement cones contain helical protein structures. Additionally, proteomic analysis using LC-MS/MS identifies many proteins including glycine rich proteins, metalloproteases, and protease inhibitors. Proteomic analysis of the cones identified both secreted and non-secreted tick proteins. Artificial membrane feeding is a suitable model for increased collection of cement cones for proteomic analysis however, structurally there are significant differences.

  16. Temporal Gene Expression Analysis and RNA Silencing of Single and Multiple Members of Gene Family in the Lone Star Tick Amblyomma americanum

    Science.gov (United States)

    Karim, Shahid

    2016-01-01

    Saliva is an integral factor in the feeding success of veterinary and medically important ticks. Therefore, the characterization of the proteins present in tick saliva is an important area of tick research. Here, we confirmed previously generated sialotranscriptome data using quantitative real-time PCR. The information obtained in this in-depth study of gene expression was used to measure the effects of metalloprotease gene silencing on tick feeding. We analyzed the temporal expression of seven housekeeping genes and 44 differentially expressed salivary molecules selected from a previously published Amblyomma americanum sialotranscriptome. Separate reference genes were selected for the salivary glands and midgut from among the seven housekeeping genes, to normalize the transcriptional expression of differentially expressed genes. The salivary gland reference gene, ubiquitin, was used to normalize the expression of 44 salivary genes. Unsurprisingly, each gene family was expressed throughout the blood meal, but the expression of specific genes differed at each time point. To further clarify the complex nature of the many proteins found in the saliva, we disrupted the translation of several members of the metalloprotease family. Intriguingly, the nucleotide sequence similarity of the reprolysin metalloprotease gene family is so homologous that a single synthesized dsRNA sequence knocked down multiple members of the family. The use of multigene knockdown yielded a more significant picture of the role of metalloproteases in tick feeding success, and changes were observed in the female engorgement weight and larval hatching success. Interestingly, the depletion of metalloprotease transcripts also reduced the total number of bacteria present in the salivary glands. These data provide insight into the expression and functions of tick salivary proteins expressed while feeding on its host. PMID:26872360

  17. Structural characterization of tick cement cones collected from in vivo and artificial membrane blood-fed Lone Star ticks (Amblyomma americanum).

    Science.gov (United States)

    Bullard, Rebekah; Allen, Paige; Chao, Chien-Chung; Douglas, Jessica; Das, Pradipta; Morgan, Sarah E; Ching, Wei-Mei; Karim, Shahid

    2016-07-01

    The Lone Star tick, Amblyomma americanum, is endemic to the southeastern United States and capable of transmitting pathogenic diseases and causing non-pathogenic conditions. To remain firmly attached to the host, the tick secretes a proteinaceous matrix termed the cement cone which hardens around the tick's mouthparts to assist in the attachment of the tick as well as to protect the mouthparts from the host immune system. Cement cones collected from ticks on a host are commonly contaminated with host skin and hair making analysis of the cone difficult. To reduce the contamination found in the cement cone, we have adapted an artificial membrane feeding system used to feed long mouthpart ticks. Cones collected from in vivo and membrane fed ticks are analyzed to determine changes in the cone morphology. Comparisons of the cement cones using light microscopy shows similar structures and color however using scanning electron microscopy the cones have drastically different structures. The in vivo cones contain fibrils, sheets, and are heavily textured whereas cones from membrane fed ticks are remarkably smooth with no distinct structures. Analysis of the secondary protein structures using FTIR-ATR show both in vivo and membrane fed cement cones contain β sheets but only in vivo cement cones contain helical protein structures. Additionally, proteomic analysis using LC-MS/MS identifies many proteins including glycine rich proteins, metalloproteases, and protease inhibitors. Proteomic analysis of the cones identified both secreted and non-secreted tick proteins. Artificial membrane feeding is a suitable model for increased collection of cement cones for proteomic analysis however, structurally there are significant differences. PMID:27118479

  18. Induction of complete courtship ritual in Amblyomma cajennense using 2,6-dichlorophenol at female-equivalent quantities Indução dos comportamentos de cortejo em Amblyomma cajennense pelo 2,6-diclorofenol em quantidades equivalentes às das fêmeas

    Directory of Open Access Journals (Sweden)

    Kennedy Kiriira Gachoka

    2011-12-01

    Full Text Available In order to clarify the role of 2,6-dichlorophenol (2,6-DCP in the courtship of Amblyomma cajennense, sexually mature males that had previously fed on rabbits were tested in bioassays. The males were released onto dummies treated with whole female extract or synthetic 2,6-DCP at a concentration of two female equivalents, or with hexane (control, and their responses were observed. In the presence of both the extract and 2,6-DCP, excitation was observed among the males, expressed in the form of touching and probing the dummy, and mounting occurred readily. The percentages of mounting (73% and tipping over (60% were equal in the two treatments and higher than in the control group (27 and 20%, respectively. Relatively short durations of mounting were recorded, and these were statistically similar in all treatments. Almost all instances of mounting resulted in tipping-over behavior. A few isolated cases of males that went directly to ventral positioning without mounting were observed. It was confirmed that 2,6-DCP alone is capable of mediation of mounting behavior in A. cajennense.Visando elucidar o papel do 2,6-diclorofenol (2,6-DCF no cortejo de Amblyomma cajennense, machos sexualmente maduros, previamente alimentados em coelhos, foram avaliados em testes biológicos. Os machos foram liberados sobre manequins tratados com um extrato de fêmeas, ou com 2,6-DCF sintético na concentração equivalente a duas fêmeas, ou com hexano (controle, e suas respostas foram observadas. Na presença do extrato e do 2,6-DCF, a excitação dos machos foi expressa na forma de toques e sondagens, e a monta ocorreu rapidamente. As porcentagens de respostas observadas nos dois tratamentos foram iguais, sendo a monta (73% e retorno na superfície ventral (60% mais altos que no controle (27 e 20%, respectivamente. Foram observados períodos de monta relativamente curtos, sendo esses estatisticamente iguais em todos os tratamentos, e quase todos resultando em

  19. Amblyomma tigrinum no Município de Lages, SC e observações da biologia em condições de laboratório Amblyomma tigrinum in the Municipality of Lages, SC and biology observations under laboratory conditions

    Directory of Open Access Journals (Sweden)

    Cristina P. Cardoso

    2008-03-01

    Full Text Available Com objetivo de observar os parâmetros biológicos de Amblyomma tigrinum, fêmeas ingurgitadas, coletadas de cães da cidade de Lages-SC, foram acondicionadas em placas de Petri, mantidas em câmara climatizada tipo BOD regulada à temperatura de 27 + 1º C, 80 + 10% UR e escotofase para realização da postura. Para o desenvolvimento das fases sucessivas do experimento, foram realizadas infestações em coelhos, por meio da técnica do saco de pano aderido à base das orelhas. Os períodos médios de eclosão, de ingurgitamento e de ecdise larval foram de 11,67; 5,93 e 10,96 dias, respectivamente. Os períodos médios de ingurgitamento e de ecdise ninfal foram de 12,40 e 16,27 dias respectivamente. Foi obtido o ingurgitamento de uma fêmea, com desprendimento no 22º dia. A longevidade foi de 75, 96 e 150 dias, para larvas, ninfas e adultos respectivamente.To study the biological features of Amblyomma tigrinum, samples of engorged females collected from dogs in the city of Lages, SC, Brazil, were maintained in Petri dishes into an incubator at 27±1ºC and 80±10% RH, for egg laying. For the development of the subsequent experimental phases, artificial infestations were performed in rabbits using the technique of the cotton bag glued to the ear's base. The mean period of hatch, feeding and larval molt were 11.67, 5.93 and 10.96 days, respectively, whereas the mean period of feeding and nymph's molt were 12.40 and 16.27 days, respectively. Only one engorged female was obtained, with detachment observed on the 22nd day. The longevity periods for larvae, nymphs and adults were 75, 96 and 150 days respectively.

  20. Acaricidal and Ovicidal Effects of Sage (Salvia officinalis L.) and Rosemary (Rosmarinus officinalis L.) (Lamiaceae) Extracts on Tetranychus urticae Koch (Acari: Tetranychidae)

    OpenAIRE

    Sibel YORULMAZ SALMAN; Sarıtaş, Semiha; KARA, Nimet; Ay, Recep

    2014-01-01

    Tetranychus urticae Koch (Acari: Tetranychidae) is a harmful pest for crops such as vegetables, fruits, and ornamental and industrial plants. The usage of plant extracts for pest control is seen as an alternative to synthetic pesticides. The effect of methanolic extracts obtained from sage (S. officinalis) and rosemary (R. officinalis) plants from the Lamiaceae family on T. urticae was researched in an effort to create an alternative to synthetic pesticides. The spray tower-leaf disk method w...

  1. Susceptibility of Tetranychus urticae Koch. (Acari: Tetranychidae to Isolates of Entomopathogenic Fungus Beauveria bassiana

    Directory of Open Access Journals (Sweden)

    Slavimira A. Draganova

    2010-01-01

    Full Text Available Bioassays with five isolates of the entomopathogenic fungus Beauveria bassiana (Bals.- Criv. Vuillemin were conducted under laboratory conditions with a goal to estimate their virulence to the two-spotted spider mite Tetranychus urticae Koch. (Acari: Tetranychidae. Common bean plants with mites were treated by spraying conidial suspensions of isolates at concentrations of 106, 107 and 108 conidia/ml. Lethal effects of the fungal isolates wereevaluated as percentages of cumulative daily mortality due to mycoses, corrected for mortality in the control variant. Virulence of the isolates was estimated based on values of the median lethal time (LT50 calculated by probit analysis for the variants treated with conidial suspensions at the concentration of 106 conidia/ml.The two-spotted spider mite was found susceptible to the examined isolates of the entomopathogenic fungus B. bassiana. Mycosis caused to T. urticae by the B. bassiana isolates 444 Bb and 445 Bb had fast lethal effect after treatment with conidial suspensions even at the concentration of 106 conidia/ml. The mean mortality values of host individuals were 83.78 ± 3.62% and 68.49 ± 4.28% on the first day, respectively, and up to 100% in both variants on the fourth day.The isolates 426 Bb, 444 Bb and 445 Bb of B. bassiana were highly virulent to two-spotted spider mites with values of the median lethal time varied within overlapped narrow confidence intervals from 0.122 to 1.084 days (average value 0.162 days, from 0.117 to 1.398 days (average value 0.146 days and from 0.106 to 1.162 days (average value 0.131 days,respectively. Significant differences regarding virulence of the three isolates at p-level < 0.05 could not been proved. The other two examined isolates were distinctly less virulent to T. urticae than these three B. bassiana isolates.

  2. Seasonal changes in the cold hardiness of the two-spotted spider mite females (Acari: Tetranychidae).

    Science.gov (United States)

    Khodayari, S; Colinet, H; Moharramipour, S; Renault, D

    2013-12-01

    The twospotted spider mite Tetranychus urticae Koch (Acari: Tetranychidae) is an important agricultural pest. Population dynamics and pest outbreaks highly depend on the overwintering success of the mite specimens; therefore, it is necessary to assess winter survival dynamics of this pest. Seasonal changes in supercooling point (SCP) and acute cold tolerance (2-h exposure at -5, -10, -15, -20, -23, or -25°C) were assessed in field-collected females during the winter in 2010-2011 in Iran. The SCP values varied from a minimum of -30.5°C (January 2011) to a maximum of -12.6°C (April 2011). Significant differences were recorded in the SCP distribution patterns between autumn- and winter-sampled females, depicting the acquisition of cold hardiness over the winter. The mean ambient air temperature was the lowest in January (4°C), when the females showed the highest supercooling ability. Correlated patterns between monthly temperatures and acute cold tolerance also were found. At -20°C, the survival of the mites was very low (10%) when they were sampled in October 2010; whereas it was high (97.5%) in January 2011, before decreasing to 5% in April 2011. The present data show that T. urticae females are chill tolerant and capable of adjusting their cold tolerance over the winter season. Acute cold tolerance (-15 and -20°C) and SCP represent valuable metrics that can be used for predicting the seasonal changes of the cold hardiness of T. urticae females.

  3. Effect of Pollen from Different Plant Species on Development of Typhlodromus pyri (Sheuten (Acari: Phytoseiidae Efecto del Polen de Diferentes Especies Vegetales sobre el Desarrollo de Typhlodromus pyri (Sheuten (Acari: Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Paulina Bermúdez

    2010-09-01

    Full Text Available Typhlodromus pyri (Sheuten (Acari: Phytoseiidae is a phytoseiid mite with a high potential in controlling the false Chilean mite (Brevipalpus chilensis Baker; Acari: Tenuipalpidae. The purpose of this study was to determine the effect of different plant species pollen as a complementary food in the development of T. pyri when its prey is in low levels of availability. Mites were individually placed on black plastic boxes with pollen and maintained at a temperature of 26 ± 2 °C, 70 ± 5% relative humidity (RH, and a photoperiod of 16:8 h (L:D. Postembryonic development of T. pyri was studied in 11 pollen species, as well as in a mixed diet of Hirschfeldia incana (L. and B. chilensis. Results show that H. incana was the only pollen in which there was no mortality (P > 0.05 along with the control (Oxalis pes-caprae L.. Mean duration from egg to adult with H. incana was 8.70 ± 1.66 d, protonymph 3.27 ± 0.21 d, and deutonymph 2.90 ± 1.45 d (P > 0.05. The mix feeding of T. pyri did not show any significant differences neither in the mean time from egg to adult, nor in mortality by feeding only with B. chilensis. Survival curves of T. pyri fed only with H. incana pollen, combined with B. chilensis, and only with B. chilensis are higher in the first 14 d of life. The sex ratio was not significantly affected by being fed only with H. incana pollen, B. chilensis, or by a combination of both.Typhlodromus pyri (Sheuten (Acari: Phytoseiidae es un ácaro que presenta un alto potencial de uso para el control de la falsa arañita roja de la vid (Brevipalpus chilensis Baker; Acari: Tenuipalpidae. El objetivo de este estudio fue determinar el efecto del polen de diferentes especies vegetales como alimento complementario para T. pyri cuando escasea su presa. Los parámetros post-embrionarios de T. pyri se estudiaron en 11 especies de polen, en una dieta mixta de polen de Hirschfeldia incana (L. y B. chilensis. Los ácaros se colocaron individualmente sobre

  4. The diversity and prevalence of hard ticks attacking human hosts in Eastern Siberia (Russian Federation) with first description of invasion of non-endemic tick species.

    Science.gov (United States)

    Khasnatinov, Maxim Anatolyevich; Liapunov, Alexander Valeryevich; Manzarova, Ellina Lopsonovna; Kulakova, Nina Viktorovna; Petrova, Irina Viktorovna; Danchinova, Galina Anatolyevna

    2016-02-01

    Hard ticks are the vectors of many pathogens including tick-borne encephalitis virus and the Lyme disease agent Borrelia burgdorferi sensu lato. In Eastern Siberia, Ixodes persulcatus, Dermacentor nuttalli, Dermacentor silvarum and Haemaphysalis concinna are regarded as aggressive to humans. Recently, significant changes in world tick fauna have been reported and this affects the spread of tick-borne pathogens. We studied the current species diversity, population structure and prevalence of tick-borne pathogens of hard ticks (Acari: Ixodidae) that attacked humans in Eastern Siberia (Irkutsk region, Russia). In total, 31,892 individual ticks were identified and analysed during the years 2007-2014. The majority (85.4%) of victims was bitten by I. persulcatus, 14.55% of attacks on humans were caused by D. nuttalli and D. silvarum, whereas H. concinna was documented only in 15 cases (0.05%). The seasonal activity and the age/gender structure of the tick population were studied as well. Among all the studied ticks, three unconventional species, i.e. Rhipicephalus sanguineus, Dermacentor reticulatus and Amblyomma americanum, were identified. Analysis of tick bite histories indicates at least three events of invasion of non-endemic ticks into the ecosystems of northern Eurasia with harsh continental climates. Invading ticks are able to reach the adult life stage and are aggressive to the local human population. Phylogenetic analysis of mt 16S rRNA gene fragments suggests multiple independent routes of tick migration to Eastern Siberia. Possible implications to human health and epidemiology of tick-borne infections are discussed. PMID:26443685

  5. Primer registro del hongo Neozygites sp. (Zygomycota: Entomophthorales, patógeno de Tetranychus urticae (Acari: Tetranychidae en la República Argentina First record of Neozygites sp. (Zygomycota: Entomophthorales, pathogen of Tetranychus urticae (Acari: Tetranychidae in Argentina

    Directory of Open Access Journals (Sweden)

    Ana C. Scorsetti

    Full Text Available En el presente trabajo se cita por primera vez para la Argentina la presencia del hongo entomopatógeno Neozygites cf. floridana (Zygomycota: Zygomycetes: Entomophthorales como patógeno de la «arañuela roja», Tetranychus urticae (Acari: Tetranychidae, importante plaga de cultivos hortícolas en la región. Los muestreos fueron realizados en el cinturón hortícola del Gran La Plata sobre cultivos de tomate, pimiento, berenjena, y otras hortalizas. El material de herbario, como preparaciones microscópicas y ácaros infectados fue depositado en el Herbario del Instituto de Botánica C. Spegazzini y en el herbario micológico del CEPAVE. Este trabajo contribuye a ampliar la distribución y el espectro de hospedadores de Neozygites , así como ampliar la información de los hongos entomopatógenos en la Argentina.In this paper, the presence of the fungi Neozygites cf. floridana (Zygomycota: Zygomycetes: Entomophthorales, as pathogen of the mite Tetranychus urticae (Acari: Tetranychidae, is recorded for first time in Argentina. Samplings were carried out in La Plata , on tomato, pepper, egg-plant, and other horticultural crops. Microscopic slides and mites infected were placed in the Herbarium of the Institute of Botany C. Spegazzini and in the Herbarium of CEPAVE. This work contributes to further expand the distribution and the host range of Neozygites as well as the information of entomopathogenic fungi in Argentina.

  6. SELETIVIDADE DE INSETICIDAS A Neoseiulus californicus MCGREGOR (ACARI: PHYTOSEIIDAE EM MACIEIRA, NO RIO GRANDE DO SUL AGROCHEMICAL SELECTIVITY TO Neoseiulus californicus MCGREGOR (ACARI: PHYTOSEIIDAE ON APPLE IN RIO GRANDE DO SUL

    Directory of Open Access Journals (Sweden)

    LINO BITTENCOURT MONTEIRO

    2001-12-01

    Full Text Available Testes para determinar os efeitos de agroquímicos homologados para macieira foram realizados em laboratório sobre Neoseiulus californicus (Acari: Phytoseiidae. Os indivíduos testados foram coletados de um pomar comercial da Agriflor Ltda, em Vacaria, Rio Grande do Sul, após várias liberações inoculativas. Os inseticidas utilizados foram os tradicionalmente recomendados para o controle de pragas, principalmente mosca-das-frutas Anastrepha fraterculus (Diptera: Tephritidae. A oviposição e a mortalidade dos ácaros foram avaliadas 12; 24; 48 e 96 horas após a pulverização, cujos produtos foram classificados em quatro classes de toxicidade (IOBC/WPRS. Azinphos ethyl, deltametrina e fenthion provocaram 100% de mortalidade, sendo que dimethoate, fenitrotion, paration, phosmet e triclorfon foram levemente nocivos (classe 2. Malation foi considerado neutro para esta população.The side-effects of agrochemical to Neoseiulus californicus (Acari: Phytoseiidae were studied in laboratory. The mites were collected in commercial apple orchard of Agropastoril Rincão das Flores, in Vacaria, Rio Grande do Sul, Brazil, after successive inoculative releases. The insecticids used were recommended to control of same pest, as Anastrepha fraterculus (Diptera: Tephritidae. The reproduction effect and mortality were evalued 12, 24, 48 and 96 hours after pulverization, while the agrochemical were ranked in toxicity classes, according to IOBC/WPRS. Azinphos ethyl, deltametrina e fenthion were harmful with ca. 100% of mortality in 24 hours, dimethoate, fenitrotion, paration, phosmet e triclorfon were slightly harmful (class 2. Malation was harmless.

  7. Parasite-host interaction between ectoparasites (Ixodida & Siphonaptera) and common opossum Didelphisaurita Wied-Neuwied, 1826 (Mammalia: Didelphimorphia), on the mainland and on Santa Catarina coastal islands, Southern Brazil

    OpenAIRE

    Maurício E. Graipel; Raimundo Carvalho; Carlos Carvalho-Pinto; Salvador, Carlos H.; Paulo C. Simões-Lopes

    2007-01-01

    This is the first study about the ecological interaction between the ectoparasites and marsupials of the Didelphis genus and the second one about mammals in Santa Catarina State. Three insular populations and a mainland population were sampled. The fleas Leptopsylla segnis and Xenopsylla cheopis and the mites Amblyomma cajennense, A. aureolatum and Ixodes loricatus were new records for this state. Leptopsylla segnis is also a new record for Didelphis. The numbers of ectoparasite species were ...

  8. TAMBO VIEJO: UN ASENTAMIENTO FORTIFICADO EN EL VALLE DE ACARÍ, PERÚ (Tambo Viejo: A Fortified Settlement in the Acari Valley, Peru

    Directory of Open Access Journals (Sweden)

    Lidio M. Valdez

    2013-10-01

    Full Text Available La aparición de los asentamientos fortificados y el origen del conflicto violento son temas poco discutidos en el contexto de la arqueología peruana. Considero que es oportuno investigar y determinar cuándo y por qué surgieron los primeros asentamientos fortificados. El propósito central de este artículo está precisamente orientado a responder tales interrogantes y discutir el tema del conflicto violento en el valle de Acarí y, por extensión, en la costa sur del Perú. Las evidencias arqueológicas disponibles señalan que, durante el periodo Intermedio Temprano, Tambo Viejo fue un asentamiento defendido por varias estructuras perimétricas. Otros sitios contemporáneos de Tambo Viejo en Acarí también fueron fortificados. Además, existe en el mismo valle evidencia tangible de violencia en la forma de prisioneros que posteriormente fueron decapitados. En contraste a la evidencia proveniente de Acarí, no existen asentamientos del periodo Intermedio Temprano identificables como fortificaciones, lo que hace de los sitios de Acarí los primeros asentamientos fortificados de toda la costa sur. ENGLISH: The emergence of violent conflict and of fortified settlements is a subject little studied within Peruvian archaeology. However, I consider it vital to investigate and determine the time and the reasons under which fortified settlements were first established. The central aim of this paper is to discuss when and why fortified settlements emerged first in the Acari Valley and, by extension, in the south coast of Peru. Available archaeological evidence indicates that during the Early Intermediate Period, Tambo Viejo was a fortified settlement protected by several massive walls. Other neighbouring sites in Acari were also fortified. Furthermore, in Acari there is conclusive evidence for violence in the form of decapitated individuals. In contrast to evidence coming from Acari, not a single Early Intermediate Period settlement from other

  9. A new species of Tenuipalpus sensu stricto (Acari: Tenuipalpidae) from Brazil, with ontogeny and a key to the known species.

    Science.gov (United States)

    Castro, Elizeu B; Feres, Reinaldo J F; Ochoa, Ronald; Bauchan, Gary R

    2016-01-01

    The Cerrado is the second largest Brazilian biome, and is considered to be a "hotspot" due the great concentration of endemic species and high rate of deforestation. Surveys of the mite fauna present in this biome have revealed a great number of new species. In this paper, we describe Tenuipalpus spinosaurus sp. nov. (Acari: Tenuipalpidae), a new species of Tenuipalpus sensu stricto, from adult females, deutonymphs, protonymphs, larvae and eggs, collected on Terminalia argentea (Combretaceae), from the Cerrado in Brazil. Females of this new species bear a prominent longitudinal crest on the opisthosoma. The ontogenetic changes in the idiosoma and leg chaetotaxy of all stages are presented. A key to the world species of Tenuipalpus sensu stricto is provided. PMID:27394345

  10. Screening of spider mites (Acari: Tetranychidae) for reproductive endosymbionts reveals links between co-infection and evolutionary history.

    Science.gov (United States)

    Zhang, Yan-Kai; Chen, Ya-Ting; Yang, Kun; Qiao, Ge-Xia; Hong, Xiao-Yue

    2016-01-01

    Reproductive endosymbionts have been shown to have wide-ranging effects on many aspects of their hosts' biology. A first step to understanding how these endosymbionts interact with their hosts is to determine their incidences. Here, we screened for four reproductive endosymbionts (Wolbachia, Cardinium, Spiroplasma and Rickettsia) in 28 populations of spider mites (Acari: Tetranychidae) representing 12 species. Each of the four endosymbionts were identified in at least some of the tested specimens, and their infection patterns showed variations at the species-level and population-level, suggesting their distributions can be correlated with both the phylogeny and ecology of the hosts. Co-infections of unrelated bacteria, especially double infections of Wolbachia and Cardinium within the same individuals were common. Spiroplasma and Rickettsia infections were specific to particular host species, respectively. Further, the evolutionary histories of these endosymbionts were inferred by comparing the phylogenies of them and their hosts. These findings can help to clarify the interactions between endosymbionts and arthropods.

  11. Demodex castoris sp. nov. (Acari: Demodecidae) parasitizing Castor fiber (Rodentia), and other parasitic arthropods associated with Castor spp.

    Science.gov (United States)

    Izdebska, Joanna N; Fryderyk, Sławomira; Rolbiecki, Leszek

    2016-02-11

    A new species of demodecid mite, Demodex castoris sp. nov. (Acari: Prostigmata: Demodecidae), is described based on adult stages from the skin of the nasal region of the Eurasian beaver Castor fiber Linnaeus, 1758, collected in Poland. This is the first detection of a representative demodecid mite in rodents of the suborder Castorimorpha and also represents the first detection of a skin mite in Eurasian beavers. The new species is a small skin mite (average 173 µm in length) characterized by sexual dimorphism related to body proportions. D. castoris sp. nov. was observed in 4 out of 6 beavers examined (66.6%), with a mean intensity of 10.8 and an intensity range of 2-23 ind. host(-1). This paper also contains a checklist of parasitic arthropods known from Castor spp. PMID:26865230

  12. Poderá o carrapato transmitir a lepra?: isolamento e cultura dum bacilo acido-álcool resistente de sedimento de "Amblyomma cajennense" capturado em leproso: 2ª nota May ticks transmit leprosy?: Second Note

    Directory of Open Access Journals (Sweden)

    H. C. Souza-Araujo

    1942-01-01

    Full Text Available In this 2nd note upon the possibility of transmission of human leprosy by ticks, the A. relates his stepps to obtain the collaboration of his colleagues working in leprosaria in various States of Brazil, Argentina and Paraguay in such studies. Firstly the A. describes the positive results of examination of sediment of ticks, the cattle tick Boophilus microplus (Canestrini, 1888, received from Paraná (Leprosário São Roque , which were put on active lepers, two of them sucking during 9 days and one during 7 days. Two out of three were killed for examination and were very strongly positive for acid-fast bacilli. A series of tubes of Loewenstein medium was smeared with the sediment of such ticks. Secondly the A. relates his personnal experiment, carried out in Rio de Janeiro, trying to infect normal ticks in lepers. The experiment with Boophilus microplus was negative and was twicely positive the experiment with Amblyomma cajennense Fabricius, 1794. The experiment is being in progress and will be continued in other places of Brazil. Finally, after being given the general characteristics of Boophilus microplus, the A. describes the non-chromogenic culture of a acid-fast bacillus isolated by him from sediment of ticks (Amblyomma cajennense captured in lepers from Colônia Santa Isabel (Minas gerais, which parasitism was spontaneous. The first isolation was obtained in Loewenstein medium after 62 days incubation at 37°C. The culture is pure and the bacillus is permanent acid-fast. The plate1, in full color, represents this culture in its four generations. The colonies are pearl-white in color, dry, elevated and rough, developing slowly and beginning as white pinhead points scattered upon the surface of the medium. The culture is not yet rich enough to be inoculated into laboratory animals, which will be done when possible.

  13. Prevalence of equine Piroplasmosis and its association with tick infestation in the State of São Paulo, Brazil Prevalência da Piroplasmose equina e sua associação com infestação por carrapatos no Estado de São Paulo

    Directory of Open Access Journals (Sweden)

    Claudia E. Kerber

    2009-12-01

    Full Text Available Serum samples were collected from 582 horses from 40 stud farms in the State of São Paulo and tick (Acari: Ixodidae infestations were evaluated on them. Serum samples were subjected to the complement fixation test (CFT and a competitive inhibition ELISA (cELISA for Babesia caballi and Theileria equi. Logistic regression analyses were performed to construct multivariate models that could explain the dependent variable (horses positive for B. caballi or T. equi as a function of the independent variables (presence or abundance of each one of the tick species found on the farms. A higher overall prevalence of B. caballi (54.1% than of T. equi (21.6% was found by the two tests. The ticks Dermacentor nitens Neumann, 1897, Amblyomma cajennense (Fabricius, 1787 and Rhipicephalus (Boophilus microplus (Canestrini, 1887 were present on horses on 38 (95%, 20 (50%, and 4 (10% farms, respectively. Infestations by D. nitens were statistically associated with B. caballi-positive horses on the farms by either the CFT or cELISA. Infestations by A. cajennense were statistically associated with T. equi-positive horses on the farms by either CFT or cELISA.Amostras de soro sanguineo foram coletadas de 582 equinos de 40 haras no estado de São Paulo, onde as infestações por carrapatos foram avaliadas nos animais. Os soros foram testados por reação de fixação do complemento (RFC e ELISA competitivo por inibição (cELISA com antígenos de Babesia caballi e Theileria equi. Análises de regressão logística foram realizadas para construir modelos multivariados que pudessem explicar as variáveis dependentes (equinos positivos para B. caballi ou T. equi em função de variáveis independentes (presença e abundância de cada uma das espécies de carrapatos encontradas nos equinos dos haras. Em geral, os dois testes sorológicos indicaram uma prevalência maior para B. caballi (54,1% do que para T. equi (21,6%. Os carrapatos Dermacentor nitens Neumann, 1897

  14. The biology and fecundity of the citrus red mite Panonychus citri (McGregor) (Acari: Tetranychidae) at different temperatures under laboratory conditions

    OpenAIRE

    KASAP, İsmail

    2009-01-01

    The developmental time and fecundity of Panonychus citri (McGregor 1916) (Acari: Tetranychidae) on Washington navel sweet orange (Citrus sinensis (L.) Osb.) leaves were determined at 15, 20, 25, 30 and 35 ± 1 °C, 65 ± 10% RH, and a 16:8-h (L:D) photoperiod under laboratory conditions. Total development time of P. citri females was 37.2, 16.6, 12.2, 9.8, and 9.0 days at 15, 20, 25, 30, and 35 ± 1 °C, respectively. Total and daily egg production levels of P. citri were highest at 25 °C (25.6 an...

  15. Detección de anticuerpos contra Borrelia burgdorferi e identificación de garrapatas ixodidas en Piura Y Amazonas, Perú

    Directory of Open Access Journals (Sweden)

    Martha Glenny A

    2004-01-01

    Full Text Available Objetivos: Detectar anticuerpos IgG/IgM contra Borrelia burgdorferi en población general, procedentes de los departamentos de Piura y Amazonas e identificar especies de garrapatas probablemente incriminadas en la transmisión de la enfermedad de Lyme. Material y Métodos: Entre agosto del año 2001 y junio de 2002, se colectaron muestras de sangre de 232 pobladores procedentes de ocho localidades del Departamento de Piura y 12 del Departamento de Amazonas, para evaluar mediante ELISA Captia™ Lyme IgG/IgM (Trinity biotech la presencia de anticuerpos contra Borrelia burgdorferi. Además, se colectaron garrapatas en animales domésticos por búsqueda directa. Resultados: Se detectó seropositividad en 9,9 % de los sueros evaluados. Asimismo, de 433 garrapatas colectadas se identificaron los géneros: Ixodes (5,5%, Amblyomma (18,0%, Rhipicephalus (23,5%, Anocentor (31,1% y Boophilus (21,7%. Conclusiones: Existen personas seropositivas por Borrelia en Piura y Amazonas, coincidiendo con los hallazgos realizados en Sapillica en el año 1992, además se detectó la presencia de garrapatas del género Ixodes en Piura.

  16. Screening of spider mites (Acari: Tetranychidae) for reproductive endosymbionts reveals links between co-infection and evolutionary history.

    Science.gov (United States)

    Zhang, Yan-Kai; Chen, Ya-Ting; Yang, Kun; Qiao, Ge-Xia; Hong, Xiao-Yue

    2016-01-01

    Reproductive endosymbionts have been shown to have wide-ranging effects on many aspects of their hosts' biology. A first step to understanding how these endosymbionts interact with their hosts is to determine their incidences. Here, we screened for four reproductive endosymbionts (Wolbachia, Cardinium, Spiroplasma and Rickettsia) in 28 populations of spider mites (Acari: Tetranychidae) representing 12 species. Each of the four endosymbionts were identified in at least some of the tested specimens, and their infection patterns showed variations at the species-level and population-level, suggesting their distributions can be correlated with both the phylogeny and ecology of the hosts. Co-infections of unrelated bacteria, especially double infections of Wolbachia and Cardinium within the same individuals were common. Spiroplasma and Rickettsia infections were specific to particular host species, respectively. Further, the evolutionary histories of these endosymbionts were inferred by comparing the phylogenies of them and their hosts. These findings can help to clarify the interactions between endosymbionts and arthropods. PMID:27291078

  17. SELECTION OF MODELS FOR SEQUENTIAL SAMPLING OF THE TAN-MITE Dichopelmus notus KEIFER (ACARI, ERIOPHYIDAE IN MATE-TEA

    Directory of Open Access Journals (Sweden)

    João Vieira Neto

    2007-09-01

    Full Text Available This research established models for the construction of plans of binomial sequential sampling for the tan-miteDichopelmus notus Keifer (Acari, Eriophyidae in mate-tea orchards. The study was carried out in a ten years old orchard, locatedin Chapecó, Santa Catarina state, Brazil. In three areas of approximately 2,500 m2, 30 plants had been selected randomly. Fortnightly,from January to December, 2004, infestation of D. notus in 18 mature leaves of ten plants in each area were evaluated. Theevaluations were executed directly in the orchard, using lenses (10x and 1 cm2 of fixed field. The lines of the sequential plans wereconstructed using the methodology based on the confidence interval of Iwao (1975, considering the models of Normal Approach withCorrection of Continuity, Normal Approach of Blyth (1986, Approach of Hall (1982 modified by Blyth (1986, Normal Approach ofMolenaar (1973, Normal Approach of Pratt (1968 and Leemis & Trivedi (1996 methodology. The models were evaluatedconsidering amplitude analysis of the confidence intervals. The results had evidenced that the Model of Normal Approach withCorrection of Continuity must preferentiably be used in the elaboration of plans of binomial sequential sampling for the tan-mite inmate-tea orchards.

  18. Transcriptome Analysis of the Carmine Spider Mite, Tetranychus cinnabarinus (Boisduval, 1867 (Acari: Tetranychidae, and Its Response to β-Sitosterol

    Directory of Open Access Journals (Sweden)

    Chunya Bu

    2015-01-01

    Full Text Available Tetranychus cinnabarinus (Acari: Tetranychidae is a worldwide polyphagous agricultural pest that has the title of resistance champion among arthropods. We reported previously the identification of the acaricidal compound β-sitosterol from Mentha piperita and Inula japonica. However, the acaricidal mechanism of β-sitosterol is unclear. Due to the limited genetic research carried out, we de novo assembled the transcriptome of T. cinnabarinus using Illumina sequencing and conducted a differential expression analysis of control and β-sitosterol-treated mites. In total, we obtained >5.4 G high-quality bases for each sample with unprecedented sequencing depth and assembled them into 22,941 unigenes. We identified 617 xenobiotic metabolism-related genes involved in detoxification, binding, and transporting of xenobiotics. A highly expanded xenobiotic metabolic system was found in mites. T. cinnabarinus detoxification genes—including carboxyl/cholinesterase and ABC transporter class C—were upregulated after β-sitosterol treatment. Defense-related proteins, such as Toll-like receptor, legumain, and serine proteases, were also activated. Furthermore, other important genes—such as the chloride channel protein, cytochrome b, carboxypeptidase, peritrophic membrane chitin binding protein, and calphostin—may also play important roles in mites’ response to β-sitosterol. Our results demonstrate that high-throughput-omics tool facilitates identification of xenobiotic metabolism-related genes and illustration of the acaricidal mechanisms of β-sitosterol.

  19. New Miticides for Integrated Pest Management of Varroa destructor (Acari: Varroidae) in Honey Bee Colonies on the Canadian Prairies.

    Science.gov (United States)

    Vandervalk, L P; Nasr, M E; Dosdall, L M

    2014-12-01

    Varroa destructor Anderson and Trueman 2000 (Acari: Varroidae) is an ectoparasitic mite of the honey bee, Apis mellifera L. (Hymenoptera: Apidae). Honey bee colonies require extensive management to prevent mortality caused by varroa mites and the viruses they vector. New miticides (Thymovar and HopGuard) to manage varroa mites were evaluated during the spring and fall treatment windows of the Canadian prairies to determine their effectiveness as part of an integrated management strategy. Thymovar and HopGuard were evaluated alongside the currently used industry standards: Apivar and formic acid. Results demonstrated that Apivar and formic acid remain effective V. destructor management options under spring and fall conditions. Applications of Thymovar during spring were associated with a reduction in brood area, and therefore should be limited to the fall season. The miticide HopGuard was not effective in managing V. destructor, and alteration of the current delivery system is necessary. This study demonstrates the potential for new effective treatment options to supplement currently used V. destructor integrated pest management systems. PMID:26470066

  20. Relative contribution of biotic and abiotic factors to the population density of the cassava green mite, Mononychellus tanajoa (Acari: Tetranychidae).

    Science.gov (United States)

    Rêgo, Adriano S; Teodoro, Adenir V; Maciel, Anilde G S; Sarmento, Renato A

    2013-08-01

    The cassava green mite, Mononychellus tanajoa, is a key pest of cassava, Manihot esculenta Crantz (Euphorbiaceae), and it may be kept in check by naturally occurring predatory mites of the family Phytoseiidae. In addition to predatory mites, abiotic factors may also contribute to regulate pest mite populations in the field. Here, we evaluated the population densities of both M. tanajoa and the generalist predatory mite Euseius ho DeLeon (Acari: Phytoseiidae) over the cultivation cycle (11 months) of cassava in four study sites located around the city of Miranda do Norte, Maranhão, Brazil. The abiotic variables rainfall, temperature and relative humidity were also recorded throughout the cultivation cycle of cassava. We determined the relative importance of biotic (density of E. ho) and abiotic (rainfall, temperature and relative humidity) factors to the density of M. tanajoa. The density of M. tanajoa increased whereas the density of E. ho remained constant throughout time. A hierarchical partitioning analysis revealed that most of the variance for the density of M. tanajoa was explained by rainfall and relative humidity followed by E. ho density and temperature. We conclude that abiotic factors, especially rainfall, were the main mechanisms driving M. tanajoa densities.

  1. Effect of coconut palm proximities and Musa spp. germplasm resistance to colonization by Raoiella indica (Acari: Tenuipalpidae).

    Science.gov (United States)

    Rodrigues, Jose Carlos Verle; Irish, Brian M

    2012-08-01

    Although coconut (Cocos nucifera L.) is the predominant host for Raoiella indica Hirst (Acari: Tenuipalpidae), false spider mite infestations do occur on bananas and plantains (Musa spp. Colla). Since its introduction, the banana and plantain industries have been negatively impacted to different degrees by R. indica infestation throughout the Caribbean. Genetic resistance in the host and the proximity of natural sources of mite infestation has been suggested as two of the main factors affecting R. indica densities in Musa spp. plantations. Greenhouse experiments were established to try to determine what effect coconut palm proximities and planting densities had on R. indica populations infesting Musa spp. plants. Trials were carried out using potted Musa spp. and coconut palms plants at two different ratios. In addition, fourteen Musa spp. hybrid accessions were evaluated for their susceptibility/resistance to colonization by R. indica populations. Differences were observed for mite population buildup for both the density and germplasm accession evaluations. These results have potential implications on how this important pest can be managed on essential agricultural commodities such as bananas and plantains. PMID:21915683

  2. Transcriptome Analysis of the Carmine Spider Mite, Tetranychus cinnabarinus (Boisduval, 1867) (Acari: Tetranychidae), and Its Response to β-Sitosterol.

    Science.gov (United States)

    Bu, Chunya; Li, Jinling; Wang, Xiao-Qin; Shi, Guanglu; Peng, Bo; Han, Jingyu; Gao, Pin; Wang, Younian

    2015-01-01

    Tetranychus cinnabarinus (Acari: Tetranychidae) is a worldwide polyphagous agricultural pest that has the title of resistance champion among arthropods. We reported previously the identification of the acaricidal compound β-sitosterol from Mentha piperita and Inula japonica. However, the acaricidal mechanism of β-sitosterol is unclear. Due to the limited genetic research carried out, we de novo assembled the transcriptome of T. cinnabarinus using Illumina sequencing and conducted a differential expression analysis of control and β-sitosterol-treated mites. In total, we obtained >5.4 G high-quality bases for each sample with unprecedented sequencing depth and assembled them into 22,941 unigenes. We identified 617 xenobiotic metabolism-related genes involved in detoxification, binding, and transporting of xenobiotics. A highly expanded xenobiotic metabolic system was found in mites. T. cinnabarinus detoxification genes-including carboxyl/cholinesterase and ABC transporter class C-were upregulated after β-sitosterol treatment. Defense-related proteins, such as Toll-like receptor, legumain, and serine proteases, were also activated. Furthermore, other important genes-such as the chloride channel protein, cytochrome b, carboxypeptidase, peritrophic membrane chitin binding protein, and calphostin-may also play important roles in mites' response to β-sitosterol. Our results demonstrate that high-throughput-omics tool facilitates identification of xenobiotic metabolism-related genes and illustration of the acaricidal mechanisms of β-sitosterol.

  3. Precopulatory mate guarding influences the development of quiescent deutonymph females in the two-spotted spider mite (Acari: Tetranychidae).

    Science.gov (United States)

    Oku, Keiko

    2016-01-01

    Individuals of some organisms have a specific stage sensitive to environmental cues that initiate developmental plasticity which subsequently influences their entire development. Females may use male behaviour such as precopulatory mate guarding as an environmental cue to change their developmental rate. In the two-spotted spider mite Tetranychus urticae (Acari: Tetranychidae), only the first insemination results in fertilization and males guard quiescent deutonymph females. As quiescent individuals take on a silvery appearance before moulting, the period of the quiescent stage can be divided into two parts: from entering the quiescent stage to becoming silvery (1st period) and from becoming silvery to moulting (2nd period). Females may be sensitive to precopulatory mate guarding immediately before moulting (i.e. 2nd period). Thus, I examined whether precopulatory mate guarding during either period affects the total developmental duration of quiescent deutonymph females. When guarded by a male, the whole developmental duration of the quiescent deutonymph females became significantly shorter (by 3-5%) than that of solitary ones, regardless whether the guarding occurred during the 1st period, the 2nd period or both periods. In conclusion, quiescent deutonymph T. urticae females use precopulatory mate guarding by conspecific males as an environmental cue for their developmental rate, although they are sensitive to the mate guarding not only immediately before moulting.

  4. The red spider mite, Oligonychus coffeae (Acari: Tetranychidae): its status, biology, ecology and management in tea plantations.

    Science.gov (United States)

    Roy, Somnath; Muraleedharan, Narayanannair; Mukhopadhyay, Ananda

    2014-08-01

    Oligonychus coffeae Nietner (Acari: Tetranychidae), the red spider mite (RSM), is a major pest of tea (Camellia sinensis) in most tea-producing countries. Nymphs and adults of RSM lacerate cells, producing minute characteristic reddish brown marks on the upper surface of mature leaves, which turn red in severe cases of infestation, resulting in crop loss. The pest is present on tea all the year round, although numbers vary depending on season. Their number increases as the weather warms up and decreases markedly once rains set in. Under optimal conditions there may be 22 overlapping generations in a year. Parthenogenesis is known to occur; consequently, all mite stages can be found at a given time. Their infestation is mainly confined to the upper surface of the mature leaves and could readily be identified by the bronzing of the leaf. There are several naturally occurring insect predators, such as coccinellid and staphylinid larvae, lacewing larvae, and mite predators, most importantly species of the families Phytoseiidae and Stigmaeidae. Integrated management has been adopted to control this mite pest, involving cultural, mechanical, physical, biological and chemical methods. This review collates the most important works carried out on biology, ecology and management of O. coffeae. Also the scope of future studies for better management of this regular mite pest of tea is discussed.

  5. New Miticides for Integrated Pest Management of Varroa destructor (Acari: Varroidae) in Honey Bee Colonies on the Canadian Prairies.

    Science.gov (United States)

    Vandervalk, L P; Nasr, M E; Dosdall, L M

    2014-12-01

    Varroa destructor Anderson and Trueman 2000 (Acari: Varroidae) is an ectoparasitic mite of the honey bee, Apis mellifera L. (Hymenoptera: Apidae). Honey bee colonies require extensive management to prevent mortality caused by varroa mites and the viruses they vector. New miticides (Thymovar and HopGuard) to manage varroa mites were evaluated during the spring and fall treatment windows of the Canadian prairies to determine their effectiveness as part of an integrated management strategy. Thymovar and HopGuard were evaluated alongside the currently used industry standards: Apivar and formic acid. Results demonstrated that Apivar and formic acid remain effective V. destructor management options under spring and fall conditions. Applications of Thymovar during spring were associated with a reduction in brood area, and therefore should be limited to the fall season. The miticide HopGuard was not effective in managing V. destructor, and alteration of the current delivery system is necessary. This study demonstrates the potential for new effective treatment options to supplement currently used V. destructor integrated pest management systems.

  6. Impact of ectohumus application in birch and pine nurseries on the presence of soil mites (Acari, Oribatida in particular

    Directory of Open Access Journals (Sweden)

    Klimek Andrzej

    2016-03-01

    Full Text Available Intensively used forest nurseries are characterised by degradation processes that lead to a drop in the quality of seedlings. The main reason of this problem is a decrease in biological soil diversity. Therefore, an attempt of nursery soil enrichment by introducing ectohumus – as compost and fresh litter – from the pine forest was carried out. The research was carried out in 2009–2011 in the Bielawy forest nursery near the city of Toruń, Poland. The objective of the study was to determine the impact of organic fertilisation (compost made up of forest humus and mulching using fresh ectohumus on the density and community composition of Acari mites and on species composition of oribatid mites (Oribatida in the nurseries of silver birch and Scots pine. Mites, especially oribatid mites, were treated as bioindicators of soil biological activity. Research has shown that mulching using fresh ectohumus caused a multiple increase in the density of mites, especially in saprophagous mites Oribatida. Oribatid mites were clearly more numerous in birch cultivation than in that of pine. Overall, 27 species of oribatid mites were found. Mulching resulted in a significant growth in species diversity in both cultivations. The most numerous oribatid mite in the area under the study was Oribatula tibialis. This species was present in all plots and showed clear preference for birch cultivation. Tectocepheus velatus and Oppiella nova, common and known to be present in a variety of environments, were slightly less numerous.

  7. Life history of Neoseiulus californicus (McGregor, 1954) (Acari: Phytoseiidae) fed with castor bean (Ricinus communis L.) pollen in laboratory conditions.

    Science.gov (United States)

    Marafeli, P P; Reis, P R; Silveira, E C da; Souza-Pimentel, G C; de Toledo, M A

    2014-08-01

    The predatory mite, Neoseiulus californicus (McGregor, 1954) (Acari: Phytoseiidae) is one of the principal natural enemies of tetranychid mites in several countries, promoting efficient control of those mites in several food and ornamental crops. Pest attacks such as that of the spider mite, Tetranychus urticae Koch, 1836 (Acari: Tetranychidae), is one of the problems faced by farmers, especially in the greenhouse, due to the difficulty of its control with the use of chemicals because of the development of fast resistance making it hard to control it. The objective of this work was to study the life history of the predatory mite N. californicus as a contribution to its mass laboratory rearing, having castor bean plant [Ricinus communis L. (Euphorbiaceae)] pollen as food, for its subsequent use as a natural enemy of T. urticae on a cultivation of greenhouse rosebushes. The studies were carried out in the laboratory, at 25 ± 2°C of temperature, 70 ± 10% RH and a 14 hour photophase. The biological aspects and the fertility life table were appraised. Longevity of 32.9 days was verified for adult females and 40.4 days for males. The intrinsic rate of increase (rm) was 0.2 and the mean generation time (T) was 17.2 days. The population doubled every 4.1 days. The results obtained were similar to those in which the predatory mite N. californicus fed on T. urticae.

  8. Identification de facteurs des glandes salivaires d’Ixodes ricinus impliqués dans la transmission de Bartonella henselae

    OpenAIRE

    Liu, Xiangye

    2013-01-01

    Ticks are obligate blood-feeding ectoparasites of many hosts including mammals, birds and reptiles. After mosquitoes, they are the most important vectors worldwide, and are able to transmit the highest variety of pathogens including virus, bacteria and parasites. Ixodes ricinus (Acari: Ixodidae), the most common tick species in Europe, is a three-life stage hard tick. It is frequently associated with bites in humans, and transmits several pathogens, including Tick-Borne Encephalitis, Babesia ...

  9. Preliminary assays for efficiency avaliation of neem oil for control of Oligonychus yothersi (Acari: Tetranychidae) /
    Ensaios preliminares para avaliação da eficiência de óleo de neem no controle de Oligonychus yothersi (Acari: Tetranychidae)

    OpenAIRE

    Renato C. Oliveira; Sandra M. J. Capelo; Amarildo Pasini

    2003-01-01

    The effect of a commercial formulation of the neem oil (azadirachtina) was evaluated in different stages of the biological cycle of the red mite of the paraguay tea Oligonychus yothersi (Acari: Tetranychidae). The formulation was shown efficient in the adults control, as well as it affected the fecundity of the females of the mite, however it didn’t inhabited oviposition, when the leaves were treated with the product.Avaliou-se o efeito de uma formulação comercial a base de neem (azadirachtin...

  10. Ocorrência do ácaro fitófago Catarhinus tricholaenae Keifer (Acari: Diptilomiopidae em cultivares de milho Bt Occurrence of the phytophagous mite Catarhinus tricholaenae Keifer (Acari: Diptilomiopidae on Bt corn cultivars

    Directory of Open Access Journals (Sweden)

    Marcos Antônio Matiello Fadini

    2012-09-01

    Full Text Available O objetivo deste trabalho foi avaliar a ocorrência do microácaro-da-face-inferior-das-folhas-de-milho Catarhinus tricholaenae Keifer (Acari: Diptilomiopidae em cultivares transgênicas de milho, contendo as proteínas Cry1F e Cry 1 A(b e milho não Bt. Durante o período de junho de 2010 a janeiro de 2011, foram coletadas, quinzenalmente, cinco amostras aleatórias de quatro folhas em talhões de milho Bt, contendo a proteína Cry 1F e Cry 1 A(b, e de milho não Bt em áreas experimentais da Embrapa Milho e Sorgo, em Sete Lagoas, MG. As amostras de folhas foram vistoriadas por 15 minutos na região da nervura central, em busca de adultos de C. tricholaenae. Foram registrados 2.930 indivíduos de C. tricholaenae, sendo que 1.114 no milho Bt Cry 1F, 753 em Cry 1 A(b e 1063 indivíduos em folhas das cultivares não Bt. As maiores abundâncias populacionais médias ocorreram nos meses de novembro e dezembro. Os fatores estágio fenológico das plantas e precipitação afetaram positivamente a abundância de C. tricholaenae. A abundância média do período de coleta de C. tricholaenae foi reduzida pela cultivar de milho contendo a proteína Cry 1 A(b. Esse é o primeiro registro de ácaros sobre cultivares de milho transgênico no Brasil.The objective of this study was to evaluate the occurrence of "microácaro-da-face-inferior-das-folhas-de-milho" Catarhinus tricholaenae Keifer (Acari: Diptilomiopidae on transgenic cultivars of corn containing proteins Cry1F and Cry 1 A (b and non-Bt corn. During the period from June 2010 to January 2011 were collected, every two weeks, five random samples of four leaves in plots of Bt corn containing the protein Cry 1F and Cry 1 A (b and non-Bt corn in the experimental area of Embrapa Corn and Sorghum, Sete Lagoas, MG. The leaf samples were examined for 15 minutes in the central region of leaf in search of adult C. tricholaenae. We recorded 2930 individuals of C. tricholaenae, 1114 on Bt Cry 1F, 752 on Cry 1 A

  11. Seletividade de agrotóxicos usados na cultura da macieira a Neoseiulus Californicus (McGregor (Acari: Phytoseiidae1 Pesticide selectivity used in apple crops Neoseiulus californicus (McGregor (Acari: Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Geraldine de Andrade Meyer

    2009-06-01

    Full Text Available Objetivou-se avaliar os efeitos secundários dos principais agrotóxicos utilizados em macieira sobre adultos e imaturos de Neoseiulus californicus (McGregor (Acari: Phytoseiidae. Os testes foram conduzidos em laboratório, utilizando as doses dos produtos recomendadas para a cultura e o método de contato e residual com pulverização em superfície de folha. Foram testados tebufenozida, fosmete, metidationa, clorpirifós, abamectina, fenpiroximato, piridabem, captana, mancozebe (duas dosagens e ditianona. Para o cálculo do efeito total (E% sobre os adultos, avaliaram-se a mortalidade, a oviposição e a viabilidade dos ovos, e para os imaturos, somente a mortalidade. Os resultados do E% foram avaliados 96 horas após a pulverização. Os produtos foram classificados quanto ao efeito total (E% de toxicidade proposta pela IOBC/WPRS. Fosmete, tebufenozida e metidationa foram inócuos; abamectina, fenpiroximato, clorpirifós, captana, mancozebe (nas duas dosagens testadas e ditianona foram levemente nocivos, e piridabem foi moderadamente nocivo aos adultos de N. californicus. O fungicida mancozebe, na maior dosagem (320g,i.a./100L, foi o que mais afetou o ácaro predador. Quanto à seletividade dos agrotóxicos aos imaturos, constatouse que abamectina e piridabem foram moderadamente nocivos, e os demais foram inócuos. Nenhum produto foi classificado como nocivo, evidenciando a tolerância de N. californicus a estes agrotóxicos. Estes resultados permitem uma escolha e manejo mais adequado para os agrotóxicos utilizados nos pomares comerciais de macieira, de forma que a presença deste ácaro predador exerça pressão de controle do ácaro-vermelho.The objective of this study was to evaluate the side effects of the main pesticides used in adult and immature Neoseiulus californicus (McGregor (Acari: Phytoseiidae. The tests were carried out in the laboratory by using the contact and residual spraying method on the leaf surface. It was tested

  12. Removal of drone brood from Apis mellifera (Hymenoptera: Apidae) colonies to control Varroa destructor (Acari: Varroidae) and retain adult drones.

    Science.gov (United States)

    Wantuch, Holly A; Tarpy, David R

    2009-12-01

    The parasitic mite Varroa destructor Anderson & Trueman (Acari: Varroidae) has plagued European honey bees, Apis mellifera L. (Hymenoptera: Apidae), in the Americas since its introduction in the 1980s. For many years, these mites were sufficiently controlled using synthetic acaricides. Recently, however, beekeepers have experienced increased resistance by mites to chemical pesticides, which are also known to leave residues in hive products such as wax and honey. Thus there has been increased emphasis on nonchemical integrated pest management control tactics for Varroa. Because mites preferentially reproduce in drone brood (pupal males), we developed a treatment strategy focusing on salvaging parasitized drones while removing mites from them. We removed drone brood from colonies in which there was no acaricidal application and banked them in separate "drone-brood receiving" colonies treated with pesticides to kill mites emerging with drones. We tested 20 colonies divided into three groups: 1) negative control (no mite treatment), 2) positive control (treatment with acaricides), and 3) drone-brood removal and placement into drone-brood receiving colonies. We found that drone-brood trapping significantly lowered mite numbers during the early months of the season, eliminating the need for additional control measures in the spring. However, mite levels in the drone-brood removal group increased later in the summer, suggesting that this benefit does not persist throughout the entire season. Our results suggest that this method of drone-brood trapping can be used as an element of an integrated control strategy to control varroa mites, eliminating a large portion of the Varroa population with limited chemical treatments while retaining the benefits of maintaining adult drones in the population.

  13. The invasive spider mite Tetranychus evansi (Acari: Tetranychidae) alters community composition and host-plant use of native relatives.

    Science.gov (United States)

    Ferragut, Francisco; Garzón-Luque, Eva; Pekas, Apostolos

    2013-07-01

    The tomato spider mite Tetranychus evansi Baker and Pritchard (Acari: Tetranychidae), is a worldwide pest of solanaceous crops that has recently invaded many parts of the world. In the present study we examined the ecological impact of its arrival in the Mediterranean region. The spider mite and phytoseiid mite assemblages in various crop and non-crop plants in three areas of Valencia (Spain) were studied a few months before and 10 years after the invasion of T. evansi. According to rarefaction analyses, the invasion of T. evansi did not affect neither the total number of species in the mite community examined (spider mite and phytoseiid species) nor the number of species when the two communities were examined separately. However, after the invasion, the absolute and relative abundance of the native Tetranychus species was significantly reduced. Before the invasion, T. urticae and T. turkestani were the most abundant spider mites, accounting for 62.9 and 22.8 % of the specimens. After the invasion, T. evansi became the most abundant species, representing 60 % of the total spider mites recorded, whereas the abundance of T. urticae was significantly reduced (23 %). This reduction took place principally on non-crop plants, where native species were replaced by the invader. Null model analyses provided evidence for competition structuring the spider mite community on non-crop plants after the invasion of T. evansi. Resistance to acaricides, the absence of efficient native natural enemies, manipulation of the plant defenses and the web type produced by T. evansi are discussed as possible causes for the competitive displacement.

  14. Seasonal variation of North American form of Gigantolaelaps mattogrossensis (Acari: Laelapidae) on marsh rice rat in southern coastal Texas.

    Science.gov (United States)

    Carmichael, Joseph A; Strauss, Richard E; McIntyre, Nancy E

    2007-01-01

    The ectoparasites of a small mammal community within an intertidal zone in the upper Gulf coast region of Texas were studied to assess the seasonal variation in abundances of the mite Gigantolaelaps mattogrossensis (Fonseca) (Acari: Laelapidae) on the marsh rice rat, Oryzomys palustris (Harlan). Further study into the ecology and dynamics of this parasite-host relationship was deemed to be necessary to expand the understanding of these potential participants in the ecology of Bayou Hantavirus, an important causative agent of Hantavirus pulmonary syndrome. The objective of this study was to determine the effects of five predictor variables on mite abundance: prevalences of hosts, relative humidity, precipitation, temperature, and length of daylight. Mite abundance was modeled as a function of the five variables with analyses of variance and multiple regressions; however, because the predictor variables pertain to the sampling period rather than to the individual rodent host, the effective sample size was small and thus the sums of squares and cross products matrix was singular. We therefore developed and used a new method for estimating regression coefficients based on the "noise-addition method" (random residual variation) combined with a bootstrap step converting the reduced rank data to full rank, providing realistic estimates of confidence intervals for the regression statistics. The population abundances of mites fluctuated significantly across collecting periods. Humidity and precipitation were the most influential variables in explaining the variation in abundances of mites. Model interpretation suggests that G. mattogrossensis is a nidicolous parasite. These results provide a baseline understanding of the seasonal interactions between parasite and host. PMID:17294924

  15. Removal of drone brood from Apis mellifera (Hymenoptera: Apidae) colonies to control Varroa destructor (Acari: Varroidae) and retain adult drones.

    Science.gov (United States)

    Wantuch, Holly A; Tarpy, David R

    2009-12-01

    The parasitic mite Varroa destructor Anderson & Trueman (Acari: Varroidae) has plagued European honey bees, Apis mellifera L. (Hymenoptera: Apidae), in the Americas since its introduction in the 1980s. For many years, these mites were sufficiently controlled using synthetic acaricides. Recently, however, beekeepers have experienced increased resistance by mites to chemical pesticides, which are also known to leave residues in hive products such as wax and honey. Thus there has been increased emphasis on nonchemical integrated pest management control tactics for Varroa. Because mites preferentially reproduce in drone brood (pupal males), we developed a treatment strategy focusing on salvaging parasitized drones while removing mites from them. We removed drone brood from colonies in which there was no acaricidal application and banked them in separate "drone-brood receiving" colonies treated with pesticides to kill mites emerging with drones. We tested 20 colonies divided into three groups: 1) negative control (no mite treatment), 2) positive control (treatment with acaricides), and 3) drone-brood removal and placement into drone-brood receiving colonies. We found that drone-brood trapping significantly lowered mite numbers during the early months of the season, eliminating the need for additional control measures in the spring. However, mite levels in the drone-brood removal group increased later in the summer, suggesting that this benefit does not persist throughout the entire season. Our results suggest that this method of drone-brood trapping can be used as an element of an integrated control strategy to control varroa mites, eliminating a large portion of the Varroa population with limited chemical treatments while retaining the benefits of maintaining adult drones in the population. PMID:20069828

  16. Genetic diversity and population structure of Panonychus citri (Acari: Tetranychidae), in China based on mitochondrial COI gene sequences.

    Science.gov (United States)

    Yuan, Ming-Long; Wei, Dan-Dan; Zhang, Kun; Gao, Yu-Zhen; Liu, Yong-Hua; Wang, Bao-Jun; Wang, Jin-Jun

    2010-12-01

    The citrus red mite, Panonychus citri (McGregor) (Acari: Tetranychidae), is regarded as one of the most important citrus pests in many countries, such as Japan, Spain, and China. In this study, the mitochondrial cytochrome oxidase subunit I gene was used to analyze genetic diversity and population structure of 15 P. citri populations collected from three citrus (Citrus spp.) planting regions of China. Our analysis found that these populations had relatively low genetic diversities. Bayesian tree and haplotype network showed that the 22 haplotypes of P. citri formed two lineages with low Bayesian posterior probabilities (0.55 and 0.63), and haplotypes in a sample were scattered throughout the Bayesian tree, indicating that there may be no significant genealogical structure among populations. However, when Yuxi and Danjiangkou populations (both without H7 haplotype) were excluded from the analysis, analysis of molecular variance found a weak, but significant, geographic structuring. Mantel test indicated a significant and positive correlation between genetic and geographical distances, reflecting certain degree of isolation by distance. The genetic differentiation based on pairwise F(ST) was not significant between most populations, and some F(ST) were even negative, indicating remarkable gene flow among these populations. The weak population structure of P. citri in this study was probably influenced by high gene flow between some populations due to long-distance dispersal of this species, which may be largely relied on the movement of plants between populations. The mismatch distribution analysis showed that no signal of population growth, but the Fu's F(S) value was significantly negative for total populations and the star-like shape of haplotype network, suggesting a history of population expansion of P. citri in China. PMID:21309245

  17. Indoor winter fumigation with formic acid for control of Acarapis woodi (Acari: Tarsonemidae) and nosema disease, Nosema sp.

    Science.gov (United States)

    Underwood, Robyn M; Currie, Robert W

    2009-10-01

    Indoor fumigation of honey bees, Apis mellifera L., with formic acid to control varroa mites, Varroa destructor Anderson & Trueman, allows simultaneous fumigation of multiple colonies with little labor input and good efficacy. Several experiments were designed to test the efficacy of formic acid as a treatment for honey bee mites, Acarapis woodi (Rennie) (Acari: Tarsonemidae), and nosema disease, Nosema sp., indoors in winter. The objectives of this study were (1) to determine the efficacy of formic acid fumigation for honey bee mite control by using both the thoracic slice and live dissection methods and (2) to determine whether indoor fumigation can reliably prevent the buildup of nosema disease in overwintering honey bee colonies. Indoor winter fumigation of honey bee colonies with formic acid was effective in killing a high percentage of honey bee mites but did not significantly reduce the proportion of bees with infested tracheae over the duration of the experiments. Thus, the method used to determine the efficacy of the treatment affected the results. Under conditions of relatively low or decreasing levels of nosema, fumigation tended to suppress the mean abundance of nosema spores relative to the controls. In three separate fumigation experiments using a range of formic acid concentrations, there was no statistical difference between the buildup or maintenance of nosema spore mean abundance over the winter in bees from formic acid fumigated colonies compared with untreated controls. However, fumigation with formic acid during winter at a low concentration for extended periods significantly suppressed spore buildup of mixed populations of nosema (Nosema apis and Nosema ceranae) in 1 yr. PMID:19886435

  18. Prevalence, mean intensity of infestation and host specificity of Spinturnicidae mites (Acari: Mesostigmata) on bats (Mammalia: Chiroptera) in the Pantanal, Brazil.

    Science.gov (United States)

    Silva, Camila de Lima; Graciolli, Gustavo

    2013-06-01

    Acari ectoparasites were collected from bats during 12 months in the Rio Negro farm (19°34'22″S and 56°14'36″W), Aquidauana, Mato Grosso do Sul. A total of 654 bats belonging to the families Phyllostomidae, Noctilionidae, Molossidae, Vespertilionidae and Emballonuridae were captured. Only 136 bats of nine genera and 11 species were parasitised. Periglischrus iheringi Oudemans was the most abundant mite species, and this prevalence may be related to the low degree of host specificity of this species and due to the broad geographical distribution of its hosts. The greatest mean intensity was found to Periglischrus torrealbai Machado-Allison on Phyllostomus discolor Wagner (Phyllostomidae) and Periglischrus tonatii Herrin and Tipton associated with Lophostoma silviculum d'Orbigny (Phyllostomidae), which also had the highest prevalence of infestation.

  19. SELETIVIDADE DE CHLORFENAPYR E FENBUTATIN-OXIDE SOBRE DUAS ESPÉCIES DE ÁCAROS PREDADORES (ACARI: PHYTOSEIIDAE EM CITROS

    Directory of Open Access Journals (Sweden)

    REIS PAULO REBELLES

    2001-01-01

    Full Text Available Com o uso de bioensaios, verificaram-se os efeitos residual de contato, ovicida e de persistência dos produtos chlorfenapyr e fenbutatin-oxide sobre duas espécies de ácaros predadores, Iphiseiodes zuluagai Denmark & Muma e Euseius alatus DeLeon (Acari: Phytoseiidae, associados ao ácaro da leprose-dos-citros Brevipalpus phoenicis (Geijskes (Acari: Tenuipalpidae. O efeito total sobre os adultos foi estudado por meio do método residual de contato com pulverização em superfície de vidro, conforme metodologia da IOBC. O efeito ovicida foi avaliado por meio de pulverização direta sobre os ovos dos ácaros predadores, também em superfície de vidro. A persistência dos produtos foi avaliada em laboratório, em arenas confeccionadas com folhas de laranjeira pulverizadas no campo, aos 0; 5; 15 e 30 dias após a aplicação. Os resultados obtidos mostraram que chlorfenapyr foi nocivo ao I. zuluagai e E. alatus e o fenbutatin-oxide foi levemente nocivo a E. alatus e inócuo a I. zuluagai. Nenhum dos produtos apresentou efeito ovicida. Fenbutatin-oxide apresentou baixa persistência para ambas as espécies de ácaros predadores, e chlorfenapyr, na dosagem de 31,3 ml, foi de baixa persistência, enquanto, na dosagem de 62,5 ml, foi moderadamente persistente. O fenbutatin-oxide apresentou-se inócuo e levemente nocivo aos ácaros predadores I. zuluagai e E. alatus, respectivamente, e de baixa persistência para ambas as espécies

  20. The dynamics of questing ticks collected for 164 consecutive months off the vegetation of two landscape zones in the Kruger National Park (1988-2002). Part I. Total ticks, Amblyomma hebraeum and Rhipicephalus decoloratus.

    Science.gov (United States)

    Horak, Ivan G; Gallivan, Gordon J; Spickett, Arthur M

    2011-02-23

    Despite a large number of studies on tick biology, there is limited information on long- term changes in tick populations. This study thus aimed to assess the long-term population dynamics of questing ixodid ticks in two landscape zones of the Kruger National Park (KNP). Questing ixodid ticks were collected in the KNP from August 1988 to March 2002 by monthly dragging of the vegetation in three habitats (grassland, woodland and gully) at two sites (Nhlowa Road and Skukuza). Findings pertaining to total tick numbers and Amblyomma hebraeum and Rhipicephalus decoloratus specifically are presented here. Fourteen tick species were collected, as well as four others that could be identified only to generic level. More ticks (211 569 vs 125 810) were collected at Nhlowa Road than at Skukuza. Larvae were the most commonly collected stage of all the major tick species. A. hebraeum was the most commonly collected tick (63.6%) at Nhlowa Road, whereas R. decoloratus accounted for 15.3% of the ticks collected there. At Skukuza, 31.6% and 27.1% of the collected ticks were R. decoloratus and A. hebraeum respectively. Most A. hebraeum larvae were collected in summer and the fewest in winter and early spring, mostly in woodland and least often in grassland habitats. Most R. decoloratus larvae were collected in spring and the fewest in autumn and winter, and were more frequently collected in woodland and grassland than in gullies. The largest collections of most tick species were made during the early 1990 s, while numbers were lowest in the mid-1990 s after a drought during 1991 and 1992 and then increased towards the late 1990 s, followed by a final decrease. The changes in tick numbers over time probably reflect differences in their host communities at the two sites and the effect of climatic conditions on both hosts and free-living ticks. The population dynamics of questing ticks reflect a complex interaction between ticks, their hosts and the environment.

  1. Effects of Temperature on Development and Voltinism of Chaetodactylus krombeini (Acari: Chaetodactylidae): Implications for Climate Change Impacts.

    Science.gov (United States)

    Ahn, Jeong Joon; Son, Youngsoo; He, Yaqian; Lee, Eungul; Park, Yong-Lak

    2016-01-01

    Temperature plays an important role in the growth and development of arthropods, and thus the current trend of climate change will alter their biology and species distribution. We used Chaetodactylus krombeini (Acari: Chaetodactylidae), a cleptoparasitic mite associated with Osmia bees (Hymenoptera: Megachilidae), as a model organism to investigate how temperature affects the development and voltinism of C. krombeini in the eastern United States. The effects of temperature on the stage-specific development of C. krombeini were determined at seven constant temperatures (16.1, 20.2, 24.1, 27.5, 30.0, 32.4 and 37.8°C). Parameters for stage-specific development, such as threshold temperatures and thermal constant, were determined by using empirical models. Results of this study showed that C. krombeini eggs developed successfully to adult at all temperatures tested except 37.8°C. The nonlinear and linear empirical models were applied to describe quantitatively the relationship between temperature and development of each C. krombeini stage. The nonlinear Lactin model estimated optimal temperatures as 31.4, 32.9, 32.6 and 32.5°C for egg, larva, nymph, and egg to adult, respectively. In the linear model, the lower threshold temperatures were estimated to be 9.9, 14.7, 13.0 and 12.4°C for egg, larva, nymph, and egg to adult, respectively. The thermal constant for each stage completion were 61.5, 28.1, 64.8 and 171.1 degree days for egg, larva, nymph, and egg to adult, respectively. Under the future climate scenarios, the number of generations (i.e., voltinism) would increase more likely by 1.5 to 2.0 times by the year of 2100 according to simulation. The findings herein firstly provided comprehensive data on thermal development of C. krombeini and implications for the management of C. krombeini populations under global warming were discussed. *Scientific Article No. 3278 of the West Virginia Agricultural and Forestry Experiment Station, Morgantown, West Virginia. PMID

  2. ROLE OF SEX PHEROMONE, 2, 6-DICHLOROPHENOL, IN THE MATING BEHAVIOUR OF HAEMAPHYSALIS LONGICORNIS (ACARI:IXODIDAE)%性信息素2,6-二氯酚在长角血蜱交配行为中的作用

    Institute of Scientific and Technical Information of China (English)

    刘敬泽; 姜在阶; 李仲来; 杨亦萍; 孙儒泳

    1999-01-01

    长角血蜱Haemaphysalis longicornis的交配行为包括7个时期,行为的完成依赖于性信息素的调节.生物测定表明:雄蜱的行为反应受雌蜱分泌的性信息素影响.堵塞雌蜱盾窝其行为受到抑制,点滴2,6-DCP或雌蜱盾窝腺提取物则被恢复.用气相色谱法测定了雌蜱盾窝腺中2,6-DCP的含量;吸血后1~2天含量最高(11.12 ng/只);吸血后3~5天即交配前下降交维持在一较恒定的水平;吸血后6~7天即交配后明显降低;饱血后检测不到2,6-DCP.2,6-DCP是长角血蜱性信息素的一种成分.

  3. Evidence for the role of white-tailed deer(Artiodactyla:Cervidae)in the epidemiology of cattle ticks and southern cattle ticks (Acari:Ixodidae)in reinfestations along the Texas/Mexico border in South Texas-A review and update

    Science.gov (United States)

    From 1907 when the fever tick eradication campaign began until 1933 the tick eradication methods of dipping cattle in an acaricide or "pasture vacation" were enormously successful in eradicating southern cattle ticks [SCT, Rhipicephalus (Boophilus) microplus (Canestrini)], until failures began to oc...

  4. Changes in the hemolymph of female Haemaphysalis longicornis Neumann (Acari: Ixodidae) after infection by Heterorhabditis bacteriophora (Nematoda: Heterorhabditidae)%长角血蜱雌蜱感染嗜菌异小杆线虫后血淋巴的变化

    Institute of Scientific and Technical Information of China (English)

    高志华; 杨小龙; 刘敬泽; 简恒

    2006-01-01

    用嗜菌异小杆线虫Heterorhabditis bacteriophora E-6-7(Hb E-6-7)感染长角血蜱Haemaphysalis longicornis雌蜱,测定感染后雌蜱血淋巴总蛋白含量、酯酶活性及酯酶同工酶的变化,以探讨昆虫病原线虫对蜱的致病机理.结果显示,雌蜱血淋巴总蛋白含量在Hb E-6-7感染后12 h显著增加,达到最大值92.21 μg/μL;在感染后24 h明显下降(49.06 μg/μL);至感染后48 h降至34.25 μg/μL.雌蜱血淋巴酯酶活性在线虫感染后0~12 h内无显著变化;在感染24 h后迅速增加(OD24h=0.1840, OD36h=0.1940, OD48h=0.2165),与对照组差异显著.PAGE结果表明,线虫感染后导致雌蜱血淋巴酯酶同工酶电泳图谱发生变化,主要为电泳图谱两端a带和b带的消失以及一条c带的增加.上述结果表明,长角血蜱雌蜱被Hb E-6-7感染后其血淋巴总蛋白含量和酯酶发生变化,这种变化可能与蜱的防御和对昆虫病原线虫的适应有关.

  5. Ocorrência de Ornithonyssus bursa (Berlese, 1888 (Acari: Macronyssidae em filhotes de Megascops choliba (corujinha-do-mato e Pitangus sulphuratus (bem-te-vi, no Rio Grande do Sul, Brasil Ocurrence of Ornithonyssus bursa (Berlese, 1888 (Acari: Macronyssidae on Megascops choliba (tropical screech-owl and Pitangus sulphuratus (great kiskadee nestlings in the Rio Grande do Sul State, Brazil

    Directory of Open Access Journals (Sweden)

    Carolina S. Mascarenhas

    2009-12-01

    Full Text Available O Núcleo de Reabilitação da Fauna Silvestre e Centro de Triagem de Animais Silvestres da Universidade Federal de Pelotas - RS atendeu dois filhotes de Megascops choliba (corujinha-do-mato (Strigiformes - Strigidae e dois de Pitangus sulphuratus (bem-te-vi (Passeriformes - Tyrannidae intensamente parasitados por ácaros, em maio de 2005 e dezembro de 2006, respectivamente. Os filhotes e o ninho de P. sulphuratus foram recolhidos na zona urbana da cidade de Pelotas - RS após forte temporal. Os ácaros foram removidos, colocados em álcool 70% e levados ao laboratório de parasitologia para identificação. Os espécimes foram clarificados em lactofenol, montados em meio de Hoyer e identificados como Ornithonyssus bursa (Acari - Macronyssidae. Registra-se Megascops choliba e Pitangus sulphuratus como hospedeiros de Ornithonyssus bursa, no Rio Grande do Sul, Brasil.The Center for Rehabilitation of Wildlife and Center for Selection of Wild Animal of the Federal University of Pelotas has attended two nestlings of Megascops choliba (tropical screech-owl (Strigiformes - Strigidae and two of Pitangus sulphuratus (great kiskadee (Passeriformes - Tyrannidae heavily parasitized by mites, in May 2005 and December 2006, respectively. The nestlings and the nest of P. sulphuratus were collected in the Pelotas urban area after severe storms. The mites were removed, clarified in lactofenol, permanently mounted in Hoyer's medium and identified as Ornithonyssus bursa (Acari - Macronyssidae. Megascops choliba and Pitangus sulphuratus are reported as host of Ornithonyssus bursa in Rio Grande do Sul State, Brazil.

  6. Biologia e flutuação populacional de Mononychellus Planki (Mc Gregor) (Acari: Tetranychidae) em cultivares de soja Glycine Max (L.) Merr. e impacto do imidacloprido em aspectos biológicos do adulto.

    OpenAIRE

    Siqueira, Fabio

    2012-01-01

    Resumo: Visando buscar cultivares de soja Glycine max (L.) Merr. com fatores de resistência ao ácaro verde Mononychellus planki (McGregor) (Acari: Tetranychidae) foram realizados estudos sobre a biologia em laboratório, flutuação populacional em diferentes cultivares durante duas safras e possíveis ações de agrotóxicos no crescimento populacional. Inicialmente foram realizados estudos de biologia de imaturos em dez cultivares BRS 133, BRS 134, BRS 282, BRS 284, BRS 245 RR, BMX Titan RR, IAC 1...

  7. Biological cycle of Tenuipalpus heveae Baker (Acari, Tenuipalpidae on leaflets of three rubber tree clones Ciclo de vida de Tenuipalpus heveae Baker (Acari, Tenuipalpidae em folíolos de três clones de seringueira

    Directory of Open Access Journals (Sweden)

    Reinaldo José Fazzio Feres

    2010-06-01

    Full Text Available Life cycle of Tenuipalpus heveae Baker (Acari, Tenuipalpidae on leaflets from three rubber tree clones. The biological cycle of Tenuipalpus heveae Baker, 1945 (Tenuipalpidae, a potential rubber tree pest mite, was studied by the observation of individuals reared on leaflets of the clones GT 1, PB 235 and RRIM 600, in controlled environmental conditions. Three daily observations were done of 60 eggs on leaflets from each clone in order to verify the development of immature stages and the female oviposition. The fertility life table was constructed based in the collected data. Mites reared on PB 235 had faster rate of development, requiring less time in days, to double its population in number (TD, and had the highest values for egg production, female longevity, net reproductive rate (Ro, intrinsic rate of natural increase (r m and finite rate of increase (λ. Lower reproductive values and the longest time necessary to reach adult stage were recorded for the mites on GT 1. In all studied clones, the deutonymphal phase had the highest viability, while the larval phase had the lowest, highlighted by the survivorship curve that indicated high mortality during this life stage. The clone PB 235 allowed the most suitable conditions for the development of T. heveae, followed by RRIM 600, while GT 1 was the less suitable substratum to rear this mite species.O ciclo de vida de Tenuipalpus heveae Baker, 1945 (Tenuipalpidae, um potencial ácaro-praga da seringueira, foi estudado a partir de indivíduos criados sobre folíolos destacados dos clones GT 1, PB 235 e RRIM 600, em condições controladas. Três observações diárias foram realizadas, acompanhando-se o desenvolvimento de 60 ovos e de sua prole em folíolos de cada um dos clones, para verificação da oviposição das fêmeas e dos estágios de desenvolvimento. A partir dos dados obtidos, foi elaborada uma tabela de vida de fertilidade. Os ácaros criados sobre folíolos de PB 235 apresentaram r

  8. Dinâmica populacional de Calepitrimerus vitis (Nalepa (Acari: eriophyidae em cultivares de videira na região da campanha do Rio Grande do Sul

    Directory of Open Access Journals (Sweden)

    Paulo Ricardo Ebert Siqueira

    2013-06-01

    Full Text Available Na Região da Campanha do Rio Grande do Sul, o ácaro-da-ferrugem-da-videira, Calepitrimerus vitis (Nalepa (Acari: Eriophyidae, é encontrado com frequência em vinhedos de cultivares europeias, desde a safra de 2004/2005, causando bronzeamento nas folhas. A dinâmica populacional de C. vitis nas cultivares Chardonnay e Merlot foi avaliada em vinhedo comercial localizado no município de Dom Pedrito, na região da Campanha, durante os anos agrícolas de 2005/2006 e 2006/2007, por meio de amostragem realizada em folhas das posições basal, intermediária e apical de ramos de produção. O pico populacional de C. vitis ocorre entre o final de fevereiro e o início de março, sendo seguido de forte declínio populacional. A infestação variou de intensidade entre as cultivares de acordo com o ano, sendo a cultivar Chardonnay mais infestada no primeiro ano, e Merlot, no segundo. Folhas na posição basal, mediana e apical apresentam níveis similares de infestação. Uma correlação positiva foi encontrada entre o número de C. vitis na face abaxial das folhas e o percentual de folhas com infestação.

  9. Population structure and dynamics of the cassava green mite Mononychellus tanajoa (Bondar and the predator Euseius ho (DeLeon (Acari: Tetranychidae, Phytoseiidae

    Directory of Open Access Journals (Sweden)

    Evila C. Costa

    2012-06-01

    Full Text Available Population structure and dynamics of the cassava green mite Mononychellus tanajoa and the predator Euseius ho (Acari: Tetranychidae, Phytoseiidae. Cassava is attacked by several pests, among which the cassava green mite Mononychellus tanajoa. Predatory mites of the family Phytoseiidae are major natural enemies of pestmites and are naturally found inhabiting cassava plants in the field. We evaluated the temporal variation of the developmental stages of M. tanajoa and the most abundant predatory mite in cassava fields in the study region, the phytoseiid Euseius ho. Densities of all developmental stages of M. tanajoa were low during the rainy season, increasing over the cultivation cycle of cassava and peaking in the dry season. Overall, the larval stage of M. tanajoa presented the lowest densities throughout time. Densities of all developmental stages of E. ho were low and remained constant throughout the cultivation cycle of cassava. The number of eggs, nymphs and adults of M. tanajoa was higher in comparison to the larval stage whereas there were no differences in densities of the stages of E. ho. Densities of all developmental stages of M. tanajoa were negatively correlated with precipitation. Densities of the stages of egg, nymph and adult of M. tanajoa were positively related while the stage of larva was negatively related to temperature. We conclude that it is important to consider the population structure in studies of population dynamics of arthropods as each developmental stage experiences and responds uniquely to the local environment over time.

  10. Acaricidal activity of Annonaceae fractions against Tetranychus tumidus and Tetranychus urticae (Acari: Tetranychidae and the metabolite profile of Duguetia lanceolata (Annonaceae using GC-MS

    Directory of Open Access Journals (Sweden)

    Dejane Santos Alves

    2015-12-01

    Full Text Available Species of the Tetranychus genus feed on plant tissues, which reduces the rate of photosynthesis and can lead to the death of plant tissues. As a result, considerable production losses are caused by these arthropods. Thus, in order to aid in the development of new products for the control of Tetranychus tumidus Banks and Tetranychus urticae Koch (Acari: Tetranychidae, the initial objective of this study was to select Annonaceae derived fractions that were soluble in dichloromethane and have acaricidal activity. Then, an exploratory analysis of the metabolite profile of the most successful fraction was performed by gas chromatography-mass spectrometry (GC-MS. Among the dichloromethane soluble fractions derived from Annona cacans Warm., Annona coriacea Mart., Annona neolaurifolia H. Rainer, Annona sylvatica A.St.-Hil., Duguetia lanceolata A.St.-Hil., Guatteria australis A.St.-Hil., Xylopia brasiliensis Spreng., Xylopia emarginata Mart. and Xylopia sericea A.St.-Hil., only the fraction from D. lanceolata stem bark reduced the survival of T. tumidus females. However, ovicidal activity was not detected when D. lanceolata stem bark was evaluated against T. tumidus eggs. Further, we studied the effect of dichloromethane soluble fractions from D. lanceolata leaves, berry fruits and stem bark on T. urticae, and the stem bark was found to be the most active fraction against T. urticae. The metabolite profile analysis of D. lanceolata stem bark by GC-MS, suggested that the main constituents were 2,4,5-trimethoxystyrene and trans-asarone.

  11. Parasite-host interaction between ectoparasites (Ixodida & Siphonaptera and common opossum Didelphisaurita Wied-Neuwied, 1826 (Mammalia: Didelphimorphia, on the mainland and on Santa Catarina coastal islands, Southern Brazil

    Directory of Open Access Journals (Sweden)

    Maurício E. Graipel

    2007-12-01

    Full Text Available This is the first study about the ecological interaction between the ectoparasites and marsupials of the Didelphis genus and the second one about mammals in Santa Catarina State. Three insular populations and a mainland population were sampled. The fleas Leptopsylla segnis and Xenopsylla cheopis and the mites Amblyomma cajennense, A. aureolatum and Ixodes loricatus were new records for this state. Leptopsylla segnis is also a new record for Didelphis. The numbers of ectoparasite species were between two on Arvoredo Island (IA and four on Santa Catarina Island. The hosts on IA had an ectoparasite prevalence of 14.3% and the others had a prevalence of 100%. The mean infestation varied between 0.4 (IA and 128 (Ratones Grande Island ectoparasites per host. Although the common opossum hosted few species of ectoparasites, the degree of infestation on the Santa Catarina coast was high. The results had no relationship with either the with hosts’ population density or with the possible numbers of host species. A suitable interpretation of the results depends on information such as the colonization and extinction history of the fauna of each location. Nevertheless, the study contributes with new records and corroborates the idea that this ecological interaction can be wide and complex.

  12. Toxicidade diferencial de produtos à base de abamectina ao ácaro Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae em citros Differential toxicity of abamectin based products over Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae mite in citrus

    Directory of Open Access Journals (Sweden)

    Daniel Júnior de Andrade

    2010-03-01

    Full Text Available O ácaro Brevipalpus phoenicis é uma das principais pragas dos citros por ser vetor do "Citrus Leprosis Virus" (CiLV, agente causal da leprose, uma das mais graves doenças da citricultura. Objetivou-se avaliar o efeito tóxico de produtos à base de abamectina sobre o ácaro B. phoenicis. Foram realizados um experimento de ação direta e três de ação residual no Laboratório de Acarologia do Departamento de Proteção de Plantas (Fitossanidade da FCAV - UNESP, Jaboticabal-SP. O delineamento adotado nos bioensaios foi o inteiramente casualizado, onde 10 tratamentos foram repetidos 7 vezes, sendo cada repetição composta por um fruto de laranja. Os tratamentos estudados (mL p.c./100 L de água foram: Acaramik a 20; 30; 40 e 50 mL; Vertimec a 30 e 40 mL; Abamectin Nortox a 30 e 40 mL; Tricofol a 77 mL e uma testemunha sem aplicação. Utilizaram-se frutos com presença de verrugose, que foram lavados e parcialmente parafinados, deixando-se uma área sem parafina, que foi circundada com cola entomológica para contenção dos ácaros. Transferiram-se 20 ácaros adultos B. phoenicis para cada fruto. No bioensaio de ação direta, a transferência foi realizada antes das aplicações e, nos bioensaios de ação residual, aos 5; 10 e 15 dias após a aplicação dos produtos. A aplicação dos produtos sobre os frutos foi realizada em Torre de Potter. Os resultados obtidos nos bioensaios evidenciaram que os melhores tratamentos foram: Tricofol a 77 mL, Acaramik a 40 e 50 mL e Vertimec a 40 mL. De forma geral, os produtos testados podem ser utilizados no controle do ácaro B. phoenicis.The mite Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae is one of the most important pests in Brazil citrus plantation, because it is the virus "Citrus Leprosis Virus" (CiLV vector, one of the most serious citrus plantation diseases. The purpose of this experiment was to evaluate the toxical effect of abamectin in the mite B. phoenicis. It was performed

  13. Ácaros de penas e carrapatos (Acari associados a Turdus albicollis Vieillot (Aves, Muscicapidae em uma área de Mata Atlântica da Ilha Grande, Rio de Janeiro, Brasil Feather mites and ticks (Acari associated to Turdus albicollis Vieillot (Aves, Muscicapidae in an area of Atlantic Forest at Ilha Grande, Rio de Janeiro, Brasil

    Directory of Open Access Journals (Sweden)

    Alline Storni

    2005-06-01

    Full Text Available O parasitismo é um importante mecanismo que afeta populações e comunidades. O objetivo deste estudo foi investigar a fauna de ectoparasitos que habita o corpo do sabiá-de-coleira, Turdus albicollis Vieillot, 1818 e avaliar se a massa corporal do hospedeiro é afetada por estes parasitos. Os indivíduos de T. albicollis foram mensalmente capturados na Ilha Grande, Rio de Janeiro, no período de julho de 1999 a junho de 2000, em uma área de Floresta Atlântica. As aves foram individualmente marcadas, pesadas e examinadas para registrar e quantificar a presença de ectoparasitos. A abundância e a localização dos parasitos no corpo do hospedeiro foram registradas. Em 54 indivíduos de T. albicollis amostrados, foram encontrados duas espécies de ectoparasitos. A prevalência de ácaros de penas, Pterodectes turdinus Berla, 1959, foi de 72,2% enquanto que a de carrapatos, Amblyomma longirostre Koch, 1844, foi de 27,8%. A abundância mensal de P. turdinus foi significativamente relacionada com os meses do ano, sendo maior nos meses com menor freqüência de chuva. Não houve relação estatisticamente significativa entre a massa corporal do hospedeiro (g e a abundância total de ácaros de penas e carrapatos.Parasitism is an important mechanism affecting populations and communities. The purpose of this study was to investigate the ectoparasites fauna living on the body of the white-necked trush, Turdus albicollis Vieillot, 1818, and to evaluate if the host body mass is affected by these parasites. Turdus albicollis were monthly captured at Ilha Grande, Rio de Janeiro, from July 1999 to June 2000 in an area of Atlantic Forest. The birds were individualy marked, weighed and carefully checked to record and quantify the presence of ectoparasites. Parasite abundance and location on the bird's body were recorded. In 54 individuals of T. albicollis sampled, two ectoparasite species were found. The prevalence of the feather mite Pterodectes turdinus

  14. Elenco y biogeografía de los ácaros acuáticos (Acari, Parasitengona, Hydrachnidia de Sudamérica

    Directory of Open Access Journals (Sweden)

    Rosso de Ferradás, B.

    2005-12-01

    Full Text Available Checklist and catalog publications demonstrate a clear connection between basic taxonomy and biodiversity issues. According to some estimates, only 10-30% of all global species have been named. As in other fields, catalogs provide an important source of information concerning species diversity in freshwater ecology.

    South America is a continent dominated by freshwater ecosystems. The tremendous habitat diversity created by this landscape supports a high number of arthropods, including water mites, which belong to the hyperdiverse group Acari. South America has a substantial task ahead in cataloging its biodiversity.

    Much has been published on water mites in South America. In fact, according to Besch, water mites were the most studied with the exception of Europe up until the 1960’s. Most of the collections were conducted by two acarologists (Lundblad and Karl Viets during the 1940’s. Today, the collection, identification and description process of water mites is slower. In the 1980’s, the north-american acarologist D. R. Cook produced two lengthy papers about neotropical water mites in four regions of South America. Recently, several Argentine acarologists have published papers on water mites from diverse habitats and regions in South America.

    The catalog presented here includes information regarding 6 superfamilies, including 23 families in 118 genera of true water mites (Hydrachnidia, Parasitengona, Acari. It also includes the references concerning the species, distribution in various regions of South America and –as far as known– habitat.

    At present, there are 916 species from several authors cataloged in 11 countries in South America. The degree of knowledge varies greatly from country to country, with numerous entries for Brazil and none for French Guiana.

    Las publicaciones de catálogos y listados de especies determinan una clara conexión entre taxonomía básica y temas

  15. Responses of Ornithonyssus sylviarum (Acari: Macronyssidae) and Menacanthus stramineus (Phthiraptera: Menoponidae) to gradients of temperature, light, and humidity, with comments on microhabitat selection on chickens.

    Science.gov (United States)

    Halbritter, D A; Mullens, B A

    2011-03-01

    Responses of the northern fowl mite (NFM), Ornithonyssus sylviarum (Canestrini & Fanzago) (Acari: Macronyssidae), and the chicken body louse (CBL), Menacanthus stramineus (Nitzsch) (Phthiraptera: Menoponidae), to variation in temperature, light, and humidity were assessed in bioassays. The location on a continuous thermal gradient at which each ectoparasite arrested was recorded and analyzed. NFM adults arrested at an average temperature of 30.09 +/- 0.34 degrees C. Adult CBL and first-instar CBL nymphs arrested at 33.69 +/- 0.20 degrees C and 34.99 +/- 0.26 degrees C, respectively. Groups of each ectoparasite were placed into clear glass vials (n = 10/vial) with one half shaded, and vials were exposed to three light levels, as follows: high (200 micromolm(-2)s(-1)), low (4 micromolm(-2)s(-1)), and nearly no light (0 micromolm(-2)s(-1)). The vial cap edges provided an opportunity to assess the interactive effect of light with harborage. NFM avoided light and sought harborage. In low light, the harborage preference overrode the tendency to avoid light. CBL avoided the harborage and showed a minimal preference for light. A four-level humidity gradient was established in two separate experimental arenas for NFM and CBL. Trials were run in ambient light (4 micromolm(-2)s(-1)) for the NFM and in nearly no light for the CBL. The NFM gradient used 38 +/- 2%, 54 +/- 7%, 73 +/- 3%, and 90 +/- 4% RH, whereas the CBL gradient used 42 +/- 5%, 48 +/- 7%, 63 +/- 4%, and 73 +/- 5% RH. NFM showed no humidity response in the walking bioassay, but the CBL settled at the lowest humidity level. Temperature and humidity on different hen body regions were related to the bioassay results and observed on-host ectoparasite distributions. PMID:21485360

  16. Sampling method evaluation and empirical model fitting for count data to estimate densities of Oligonychus perseae (Acari: Tetranychidae) on 'Hass' avocado leaves in southern California.

    Science.gov (United States)

    Lara, Jesús R; Saremi, Naseem T; Castillo, Martin J; Hoddle, Mark S

    2016-04-01

    Oligonychus perseae (Acari: Tetranychidae) is an important foliar spider mite pest of 'Hass' avocados in several commercial production areas of the world. In California (USA), O. perseae densities in orchards can exceed more than 100 mites per leaf and this makes enumerative counting prohibitive for field sampling. In this study, partial enumerative mite counts along half a vein on an avocado leaf, an industry recommended practice known as the "half-vein method", was evaluated for accuracy using four data sets with a combined total of more than 485,913 motile O. perseae counted on 3849 leaves. Sampling simulations indicated that the half-vein method underestimated mite densities in a range of 15-60 %. This problem may adversely affect management of this pest in orchards and potentially compromise the results of field research requiring accurate mite density estimation. To address this limitation, four negative binomial regression models were fit to count data in an attempt to rescue the half-vein method for estimating mite densities. These models were incorporated into sampling plans and evaluated for their ability to estimate mite densities on whole leaves within 30-tree blocks of avocados. Model 3, a revised version of the original half-vein model, showed improvement in providing reliable estimates of O. perseae densities for making assessments of general leaf infestation densities across orchards in southern California. The implications of these results for customizing the revised half-vein method as a potential field sampling tool and for experimental research in avocado production in California are discussed.

  17. Sampling method evaluation and empirical model fitting for count data to estimate densities of Oligonychus perseae (Acari: Tetranychidae) on 'Hass' avocado leaves in southern California.

    Science.gov (United States)

    Lara, Jesús R; Saremi, Naseem T; Castillo, Martin J; Hoddle, Mark S

    2016-04-01

    Oligonychus perseae (Acari: Tetranychidae) is an important foliar spider mite pest of 'Hass' avocados in several commercial production areas of the world. In California (USA), O. perseae densities in orchards can exceed more than 100 mites per leaf and this makes enumerative counting prohibitive for field sampling. In this study, partial enumerative mite counts along half a vein on an avocado leaf, an industry recommended practice known as the "half-vein method", was evaluated for accuracy using four data sets with a combined total of more than 485,913 motile O. perseae counted on 3849 leaves. Sampling simulations indicated that the half-vein method underestimated mite densities in a range of 15-60 %. This problem may adversely affect management of this pest in orchards and potentially compromise the results of field research requiring accurate mite density estimation. To address this limitation, four negative binomial regression models were fit to count data in an attempt to rescue the half-vein method for estimating mite densities. These models were incorporated into sampling plans and evaluated for their ability to estimate mite densities on whole leaves within 30-tree blocks of avocados. Model 3, a revised version of the original half-vein model, showed improvement in providing reliable estimates of O. perseae densities for making assessments of general leaf infestation densities across orchards in southern California. The implications of these results for customizing the revised half-vein method as a potential field sampling tool and for experimental research in avocado production in California are discussed. PMID:26861068

  18. Controle de Brevipalpus phoenicis (Geijskes, 1939 E Oligonychus ilicis (McGregor, 1917 (Acari: Tenuipalpidae, Tetranychidae em cafeeiro e o impacto sobre ácaros benéficos: I - abamectin e emamectin Control of Brevipalpus phoenicis (Geijskes, 1939 and Oligonychus ilicis (McGregor, 1917 (Acari: Tenuipalpidae, Tetranychidae in coffee plants and the impact on beneficial mites: I - Abamectin and emamectin

    Directory of Open Access Journals (Sweden)

    Paulo Rebelles Reis

    2004-04-01

    Full Text Available O ácaro Brevipalpus phoenicis (Geijskes, 1939 (Acari: Tenuipalpidae é importante em cafeeiro (Coffea spp., por ser o vetor do vírus da mancha-anular, responsável por queda de folhas e má qualidade da bebida do café, e o ácaro-vermelho, Oligonychus ilicis (McGregor, 1917 (Acari: Tetranychidae, por reduzir a área foliar de fotossíntese. Alguns ácaros da família Phytoseiidae são eficientes predadores associados aos ácaros-praga. Com este trabalho teve-se como objetivo estudar o controle dos ácaros-praga e o impacto do abamectin e emamectin sobre fitoseídeos. Em laboratório, foram estudados os efeitos ovicida, tópico, residual, tópico mais residual aos ácaros-praga e a seletividade fisiológica aos fitoseídeos. Em semicampo, foi estudada a persistência dos produtos no controle dos ácaros-praga. O efeito ovicida foi avaliado em ovos no início e fim de incubação; os efeitos residual, tópico e tópico mais residual foram avaliados pela mortalidade de larvas, ninfas e adultos após 48 horas da aplicação, enquanto a persistência foi avaliada pela mortalidade até 30 dias após a pulverização. A seletividade aos ácaros fitoseídeos foi avaliada pelo efeito total às fêmeas adultas, em teste residual em superfície de vidro. Pelos resultados, verificou-se que abamectin e emamectin não possuem ação ovicida, para ambas as espécies de ácaros-praga estudadas. Considerando o efeito tópico mais residual, o abamectin e emamectin foram altamente eficientes no controle de larvas, ninfas e adultos de B. phoenicis; apenas abamectin foi eficiente no controle de O. ilicis. Abamectin foi levemente a moderadamente nocivo e emamectin mostrou-se inócuo a levemente nocivo aos fitoseídeos. Devido à eficiência de controle e seletividade a fitoseídeos, conclui-se que abamectin e emamectin podem ser utilizados em programas de manejo integrado do ácaro B. phoenicis, e abamectin para o manejo de B. phoenicis e O. ilicis em cafeeiro

  19. Biology of three species of Agistemus (Acari: Stigmaeidae): life table parameters using eggs of Panonychus citri or pollen of Malephora crocea as food.

    Science.gov (United States)

    Goldarazena, Arturo; Aguilar, Hugo; Kutuk, Halil; Childers, Carl C

    2004-01-01

    The biology and life table parameters of Agistemus industani Gonzalez, A. cyprius Gonzalez, and A. floridanus Gonzalez (Acari: Stigmaeidae) were studied under laboratory conditions using two food sources: Panonychus citri (McGregor) eggs or ice plant, Malephora crocea (Jacquin) Schwantes pollen at 25 degrees C. The larval, protonymph, deutonymph, and adult stages of A. industani fed on citrus red mite eggs. All active stages of A. industani, except the larva, fed on all P. citri stages and the larval stage could not feed on P. citri adults. All immature stages of A. industani fed on M. crocea pollen. Agistemus cyprius larvae fed on P. citri eggs and larvae or ice plant pollen. The nymphal stages fed on P. citri eggs, larvae, and protonymphs but not deutonymphs or adults while A. cyprius deutonymphs and adults fed on all P. citri stages. Adult and nymphal stages of A. cyprius fed on ice plant pollen and successfully completed their development while A. floridanus did not. Agistemus floridanus larvae fed only on P. citri eggs, while the other stages fed on P. citri eggs, larvae, and protonymphs. The developmental times from egg to adult for A. industani and A. cyprius when fed M. crocea pollen were 11.3 and 13.4 days, respectively. Agistemus floridanus was unable to complete its life cycle on a diet of only M. crocea pollen. Agistemus industani, A. cyprius, and A. floridanus completed development from egg to adult in 11.7, 13.8, and 10.8 days, respectively, when fed P. citri eggs. The intrinsic rate of increase (r(m)) values for A. cyprius and A. industani were 0.0311 and 0.1201 per day on the pollen diet. The net reproductive rate (Ro) was 3.58 for A. cyprius and 10.07 for A. industani with generation times (T) of 45.2 and 35.1 days, respectively, on the ice plant pollen diet. The r(m) values for A. cyprius, A. floridanus, and A. industani on the P. citri egg only diet were: 0.0562, 0.1001, and 0.1031 per day, respectively. The Ro values for each species fed P

  20. Seleções para resistência e suscetibilidade, detecção e monitoramento da resistência de Tetranychus urticae ao acaricida clorfenapir Selections for resistance and susceptibility, detection and monitoring of resistance to the acaricide chlorfenapyr in Tetranychus urticae koch (Acari: Tetranychidae)

    OpenAIRE

    Mário Eidi Sato; Marcos Zatti da Silva; Katia Gigliola Cangani; Adalton Raga

    2007-01-01

    Problemas com resistência de ácaro-rajado, Tetranychus urticae Koch (Acari: Tetranychidae), a acaricidas têm sido registrados em diversos países, inclusive no Brasil. O estudo teve como objetivo caracterizar a resistência de T. urticae ao acaricida clorfenapir e avaliar a freqüência de resistência a esse composto em áreas comerciais de seis culturas no Estado de São Paulo. Seleções para resistência e suscetibilidade a clorfenapir foram realizadas em laboratório, utilizando-se uma população de...

  1. KURU MEYVE AKARI Carpoglyphus Lactis (L.) (Acari :Carpoglyphidae)’ İN FARKLI SICAKLIK VE NEM ORTAMLARINDAKİ GELİŞMESİ ÜZERİNE ARAŞTIRMALAR

    OpenAIRE

    GÜLDALI, Begül

    2007-01-01

    Ankara Üniversitesi Ziraat Fakültesi Bitki Koruma bölümünde yürütülen bu çalışmada Carpoglyphus lactis (L.) (Acari :Carpoglyphidae)’ in 18°C , 23°C ve 28 °C sıcaklık değerlerinde ve %65 ve % 80 orantılı nem değeri kombinasyonlarında biyolojik özellikleri incelenmiştir. Akarın gelişme süresi 5- 12 gün arasında değişmektedir. Sıcaklık ve orantılı nem artışıyla birlikte gelişme süresi kısalmıştır. Ergin ömür uzunluğu 11-68 gün arasında değişim göstermiştir. en uzun ergin ömrü 18°C ve % 65 ...

  2. Influence de l'âge de la feuille sur les paramètres biologiques et les populations de l'acarien vert du manioc Mononychellus tanajoa Bondar (Acari: tetranychidae

    Directory of Open Access Journals (Sweden)

    Badegana, AM.

    2002-01-01

    Full Text Available The Effect of Leaf Age on the Cassava Green Mite Mononychellus tanajoa Bondar (Acari: Tetranychidae Biological Parameters and Population Growth Rates. The study of cassava (Manihot esculenta Crantz leaf age effect on Mononychellus tanajoa Bondar biological parameters and population growth rates was studied in laboratory (T= 24-26 °C; RH= 70-90%. The local Dschang cultivar was used and the study concerned the 15, 40, 65, 90 and 115 days old leaves. The results obtained show that the egg incubation duration was the longest (6.4 days and that of the deutonymph stage the shortest one (1.9 days. The hatching rate was very high (98%. There was no significant difference (p= 0.05 between the developmental stages of M. tanajoa reared on the leaves of different ages. On the contrary fecundity whatever it is daily or total was high on young leaves and small on the old ones. The correlation coefficient between the leaf age and the intrinsic rate of increase (rm was -0.896 and that obtained between the net reproduction rate (Ro and the leaf age -0.966. These coefficients are negative and in absolute value near to one; which shows that the more the leaf is old, the more the M. tanajoa population growth is little. The M. tanajoa population growth is therefore fast on young leaves and slow on the old ones.

  3. Chlorotic spots on Clerodendrum, a disease caused by a nuclear type of Brevipalpus (Acari:Tenuipalpidae transmitted virus Mancha clorótica do Clerodendrum, uma enfermidade causada por um vírus do tipo nuclear, transmitido pelo ácaro Brevipalpus phoenicis (Acari:Tenuipalpidae

    Directory of Open Access Journals (Sweden)

    Elliot Watanabe Kitajima

    2008-02-01

    Full Text Available Chlorotic spots have been observed in plants of Clerodendrum x speciosum growing in residential gardens and parks in Piracicaba, SP, Brazil. Thin sections of diseased tissues revealed characteristic cytopathic effects of the nuclear type of the Brevipalpus (Acari: Tenuipalpidae mite-transmitted viruses (BTrV. Brevipalpus mites, identified as B. phoenicis, infesting symptomatic C. x speciosum plants transmitted the pathogen to healthy C. x speciosum and to C. thomsonae, Gomphrena globosa, Hibiscus cannabinus, H. coccineus, H. schizopetalus, Salvia leucantha, Spathiphyllum wallasi and Tetragonia expansa causing chlorotic spots on their leaves. Mechanical inoculation using leaf extracts from infected C. x speciosum resulted in chlorotic spots on inoculated C. x speciosum, Chenopodium quinoa, C. amaranticolor, G. globosa, H. cannabinus, H. coccineus and T. expansa leaves. C. amaranticolor and C. quinoa kept at 28 - 30°C became systemically infected. The same cytopathic effects caused by the nuclear type of BTrV were seen in tissues from all infected test plants by electron microscopy. The virus was purified from systemically infected leaves of C. amaranticolor and C. quinoa. A polyclonal antiserum obtained from an immunized rabbit presented a strong reaction with the homologous antigen in ELISA tests. The results suggest that this chlorotic spot disease of C. x speciosum is caused by a new species of the nuclear type of BTrV, tentatively named Clerodendrum chlorotic spot virus (ClCSV.Manchas cloróticas e necróticas foram observadas em folhas de várias plantas de coração-sangrento (Clerodendrum x speciosum cultivadas em parques e jardins em Piracicaba, SP, associadas à infestação pelo ácaro tenuipalpídeo Brevipalpus phoenicis. Exames preliminares de secções de tecido das manchas cloróticas ao microscópio eletrônico revelaram a ocorrência de efeitos citopáticos característicos dos induzidos pelos vírus do tipo nuclear, transmitido

  4. Influence de l'usage préventif des pesticides sur les acariens Tetranychus urticae et Phytoseiulus persimilis (Acari : Tetranychidae, Phytoseiidae présents en cultures de fraisiers du Nord du Maroc

    Directory of Open Access Journals (Sweden)

    Lagziri, M.

    2015-01-01

    Full Text Available Influence of previous pesticide use on Tetranychus urticae and Phytoseiulus persimilis (Acari: Tetranychidae, Phytoseiidae from strawberry crops in the north of Morocco. Description of the subject. Effects of recommended doses of five common pesticides in the strawberries of Loukkos area (Morocco were tested on the two-spotted spider mite Tetranychus urticae and its predatory mite Phytoseiulus persimilis. Laboratory study assessed the contact toxicity of one avermectin miticide (abamectin, two pyrethrinoid insecticide-acaricides (bifenthrin and lambda-cyalothrin, and two fungicides: firstly, mancozeb, which belongs to the dithiocarbamates family of chemicals and secondly, hexaconazole, of the triazole family. Objectives. The aim of the present study was to test in laboratory conditions the effect of five pesticides on the two-spotted spider mite, T. urticae and its predatory mite, P. persimilis. The five pesticides tested were those most frequently applied for at least two years on strawberries at the experimental site. Method. Bioassays were performed with populations of mites originating from different plots with various crop protection backgrounds. The first group of plots had been repeatedly treated with the five tested pesticides during a two-year period, the second group had been moderately treated, and the third had been treated once with the tested pesticides. Results. Our results showed that the tested pesticides provided effective control of T. urticae but that they were not compatible with use on the predatory mite P. persimilis, as these particular mites did not usually come into contact with these products. On the other hand, in plots where pesticides had been used for a long time, the susceptibility of P. persimilis populations to these products was significantly reduced. Conclusions. If the tested pesticides are to be considered for integrated pest control programs in plots where they have been used for a long time and where P

  5. Sensibilité à Mononychellus tanajoa Bondar (Acari : Tetranychidae de quelques cultivars de manioc (Manihot esculenta Crantz et incidence des attaques sur le rendement, dans la région des hauts plateaux de l'Ouest Cameroun

    Directory of Open Access Journals (Sweden)

    Badegana, AM.

    2001-01-01

    Full Text Available Sensibility to Mononychellus tanajoa Bondar (Acari : Tetranychidae of some Cassava (Manihot esculenta Crantz, Cultivars and Effect of Damage on Yield Loss in the Cameroonian Western High-lands. The study of the sensibility towards the green mite Mononychellus tanajoa Bondar of some cassava (Manihot esculenta Crantz cultivars and the assessment of the effect of damage on the yield losses was carried out in the Western highlands of Cameroon. Four cassava cultivars were used : two local (Dschang and Njombe and two improved varieties (IITA 8017 and IITA 82516. The results obtained showed that the density (mites number/cm2 of leaf area was low during the rainy season and high during the dry season, which means that rains reduce the mite population by washing or lead the mites to death. The highest mean density (3.40 mites/cm2 of leaf area was obtained on the local Njombe cultivar which is consequently the most sensitive. On the contrary, the local Dschang cultivar, with the lowest mite density (1.40 mites/cm2 of leaf area was the most resistant followed by the IITA 8017 cultivar (1.74 mites/cm2. The IITA82516 cultivar had a mean density of2.65 mites/cm2. Yield losses ranged from 36.90 % for IITA 8017 (1.74 mites/cm2 and damages level of 2.75 to 58.70 % for local Dschang (3.40 mites/cm2 and damages level of 3.84. Local Dschang cultivar (1.40 mites/cm2 and damage level of 2.96 and IITA 82516 (2.65 mites/cm2 and damage level of 2.96 had a yield losse of38.10 % and 41.80 %. The results showed that higher the mite density and damage level are, higher is the yield loss, unless the cultivar is tolerant.

  6. Effects of Tobacco Bacterial Wilt on the Abundance of Acari and Collembola in Tobacco Rhizosphere Soil%烟草青枯病危害对烟株根际土壤螨类和弹尾虫发生的影响

    Institute of Scientific and Technical Information of China (English)

    白耀宇; 庞帅; 李石力; 丁伟

    2015-01-01

    为了明确烟草青枯病的危害对烟株根际土壤螨类和弹尾虫发生的影响,于2013年7-9月在重庆市彭水县烟区青枯病发病典型试验地进行了调查,共捕获土壤动物27169头,其中螨类和弹尾虫共占86%~99%.研究结果表明,在发病初期,发病烟株(3级以下)根际土中螨类和弹尾虫的数量与健康植株相比差异均不具有统计学意义(p>0.05);在发病中期,仅3级以下烟株0~10 cm根际土中的螨类和弹尾虫数量显著高于5~7级和9级(p<0.05);但在发病后期,无论是0~10 cm还是10~20 cm的3级以下烟株的螨类数量均显著高于5~7级和9级( p<0.05),而9级的弹尾虫数量显著高于3级以下和5~7级(p<0.05);随着发病时间的推移,根际土中螨类和弹尾虫的比值随着青枯病危害程度的加剧而显著降低(p<0.05).青枯病危害强烈影响根际土壤螨类和弹尾虫的发生.%During July‐September ,2013 ,field studies were conducted at Pengshui County in Chongqing , China ,to assess the potential effects of tobacco bacterial wilt on abundance of Acari and Collembola in to‐bacco rhizosphere soil .A total of 27 ,169 soil animals were collected ,86 -99% of which was Acari and Collembola .The results showed that the abundance of Acari or Collembola in tobacco rhizosphere soil did not significantly increased in the disease plants than its control at the early stage of the diseased ( p >0.05) .The abundance of Acari and Collembola in 0-10 cm rhizosphere soil of the 9 level of damage in the disease plants significantly increased than those of the below 3 level and 5-7 level of damage at the mid‐term of the diseased (p<0.05) .At the later period of the diseased ,the abundance of Acari in 0-10 cm or 10-20 cm rhizosphere soil of the below 3 level of damage in the diseased both significantly increased than those of the 5-7 level and the 9 level of damage ;while those of

  7. Amblyomma cajennense is an intrastadial biological vector of theileria equi

    Science.gov (United States)

    Background: The apicomplexan hemoprotozoan parasite Theileria equi is one of the etiologic agents causing equine piroplasmosis (EP), a disease of horses and their relatives that are endemic throughout large parts of the world. Prior to 2009 the United States had been considered to be free of this pa...

  8. Geographic distribution of Bhanja virus.

    Science.gov (United States)

    Hubálek, Z

    1987-01-01

    A review on the geographic distribution, vectors and hosts of Bhanja virus (Bunyaviridae) is based on reports about: isolations of the virus; antibody surveys. Bhanja virus has been isolated in 15 countries of Asia, Africa and Europe, and antibodies against it have been detected in 15 additional countries. Vector range includes ticks of the family Ixodidae (subfam. Amblyomminae; not subfam. Ixodinae): 13 species of 6 genera (Haemaphysalis, Dermacentor, Hyalomma, Amblyomma, Rhipicephalus and Boophilus) yielded the virus. Bhanja virus has only rarely been isolated from vertebrates (Atelerix, Xerus, Ovis, Bos; possibly bats), though antibodies have been detected frequently in a wide range of mammals (Ruminantia being the major hosts), in several species of birds (Passeriformes, Galliformes) and even reptiles (Ophisaurus apodus). Natural foci of the Bhanja virus infections are of the boskematic type (sensu Rosický), associated closely with pastures of domestic ruminants infested by ticks in the regions of tropical, subtropical and partly temperate climatic zones. PMID:3108117

  9. A comparative study of the dynamics of Wolbachia infection in different populations of Tetranychus urticae (Acari : Tetranychidae)%共生菌Wolbachia在中国二斑叶螨种群中的扩散规律

    Institute of Scientific and Technical Information of China (English)

    谢蓉蓉; 陈小琳; 孙荆涛; 洪晓月

    2013-01-01

    共生菌Wolbachia在中国二斑叶螨Tetranychus urticae Koch中分布广泛,所有的地理种群中均感染Wolbachia.以二斑叶螨湖南长沙(HN),辽宁兴城(LN)和江苏徐州(JS)3个地理种群为实验材料,经筛选获得100%感染和不感染Wolbachia的品系后,人工设置Wolbachia感染率为50%的品系,通过PCR技术检测二斑叶螨连续世代Wolbachia感染率动态变化,研究Wolbachia在二斑叶螨种群中的扩散规律.结果表明:3个地理种群的垂直传播效率都为100%;HN种群Wolbachia感染率上升速度最快,F7代达到100%感染;LN种群F12达到100%感染;而JS地理种群中Wolbachia感染率速度上升最慢,在F20代达到100%感染,其后感染率均能稳定在100%.LN种群Wolbachia通过诱导胞质不亲和的策略,JS种群的Wolbachia通过提高寄主适合度的策略,而HN种群Wolbachia则通过诱导胞质不亲和与提高寄主适合度两者相结合的策略,最终达到在二斑叶螨中维持感染状态并扩散传播的目的.本研究结果为今后利用Wolbachia的扩散规律控制有害生物及疾病传播提供了基础.%Maternally inherited Wolbachia bacteria are widely distributed in Chinese populations of the two-spotted spider mite Tetranychus urticae Koch (Acari; Tetranychidae). All populations were found to be infected with Wolbachia. Using the Hunan ( HN) , Liaoning ( LN ) and Jiangsu ( JS) populations of T. urticae as experimental subjects, 100% Wolbachia-infected and 100% uninfected spider mite lines were obtained by screening. This study investigated the dynamics of Wolbachia spread in the two-spotted spider mite. Infection frequencies of Wolbachia among the progenies of the artificial populations, initiated with 50% infected and 50% uninfected female adults, were monitored by PCR. The results show 100% maternal transmission in all three populations. The rate of spread was fastest in the HN population in which the infection rate reached 100% by the F7

  10. Sustained efficacy of the novel topical repellent TT-4302 against mosquitoes and ticks.

    Science.gov (United States)

    Bissinger, B W; Kennedy, M K; Carroll, S P

    2016-03-01

    Mosquitoes and ticks are blood-feeding pests of humans and animals that can vector many important aetiological agents of disease. Previous research demonstrated that TT-4302 (Guardian(®) Wilderness) containing 5% geraniol applied to human subjects gave 5-6 h of repellency against mosquitoes (depending on species) and was repellent to ticks in vitro. This study was conducted to obtain an independent third-party evaluation of TT-4302 against Stegomyia aegypti (= Aedes aegypti) (Diptera: Culicidae) mosquitoes and to test the efficacy of the product in the field against ticks. TT-4302 provided an average of 6.5 h of repellency of ≥ 95% [Weibull mean protection time: 7.4 h, 95% confidence interval (CI) 5.8-11.3 h] for St. aegypti, whereas a 15% DEET formulation provided 4.7 h of repellency (Weibull mean protection time: 5.2 h, 95% CI 3.7-6.9 h). In tick field trials, the efficacy of TT-4302 did not differ significantly from that of a 25% DEET formulation against Amblyomma americanum (Ixodida: Ixodidae). TT-4302 was 81.3% repellent at 2.5 h after application, whereas DEET was 77.2% repellent at the same time-point. Results at 3.5 h after application were 71.4% for TT-4302 and 72.9% for DEET. PMID:26614394

  11. Notes on the comparative morphology of ticks (Anactinotrichida: Ixodida)

    NARCIS (Netherlands)

    hammen, van der L.

    1983-01-01

    A study is made of the comparative morphology of Ticks, based on the principles and methods set down in the author's previous studies in Mites and other Chelicerates, and in his Glossary of Acarological Terminology. Special attention is paid to the morphology of gnathosoma and appendages.

  12. Wild carnivores (Mammalia) as hosts for ticks (Ixodida) in Panama

    NARCIS (Netherlands)

    Bermudez, S.E.; Esser, H.J.; Miranda, R.; Moreno, R.S.

    2015-01-01

    This study reports ticks collected from wild carnivores from different habitat types in Panama. We examined 94 individual wild carnivores and we found 87 parasitized by ticks: seven coyotes, six crab-eating foxes, 54 coatis, four raccoons, five ocelots, two pumas, two gray foxes, two skunks, and one

  13. Caracterização de um vírus baciliforme isolado de Solanum violaefolium transmitido pelos ácaros Brevipalpus phoenicis e Brevipalpus obovatus (Acari: Tenuipalpidae Characterization of a bacilliform virus isolated from Solanum violaefolium transmitted by the tenuipalpid mites Brevipalpus phoenicis and Brevipalpus obovatus

    Directory of Open Access Journals (Sweden)

    Paulo de Tarso Oliveira Ferreira

    2007-09-01

    Full Text Available Solano-violeta (Solanum violaefolium é uma planta ornamental rasteira usada para cobrir solos de áreas sombreadas. Um vírus que induz manchas anelares nas folhas desta planta, tentativamente designado Solanum violaefolium ringspot virus - SvRSV, transmitido pelo ácaro Brevipalpus phoenicis (Acari: Tenuipalpidae foi encontrado em Piracicaba, SP. Trata-se de um vírus baciliforme que se assemelha a outros vírus do tipo citoplasmático transmitidos por Brevipalpus sp. Este trabalho teve como objetivo relatar propriedades biológicas e estabelecer uma caracterização molecular parcial do SvRSV. O vírus pode ser transmitido mecanicamente a várias outras espécies botânicas, causando lesões localizadas. Entre as espécies avaliadas, Datura stramonium mostrou-se a melhor hospedeira experimental. Observou-se também a manifestação de sintomas nestas plantas após infestação das mesmas por B. obovatus previamente alimentado em lesões de SvRSV, confirmando esta outra espécie de ácaro como vetor do vírus. Suas propriedades físicas in vitro foram: temperatura de inativação 40-45 ºC; ponto final de diluição 10-3-10-4; longevidade in vitro 12 dias. Em secções ultrafinas, as partículas do SvRSV mostraram-se levemente mais delgadas e mais longas que as de outros vírus do mesmo grupo. A partir do dsRNA do SvRSV foi construída uma biblioteca de cDNA e foram identificadas duas possíveis regiões codificadoras das proteínas de movimento e replicase viral. Baseado nestas regiões foram desenhados "primers" para amplificação do RNA do SvRSV por RT-PCR. Sondas baseadas nas seqüências obtidas hibridizaram com ss- e dsRNA de D. stramonium infectadas pelo vírus. Ensaios preliminares de RT-PCR e hibridização não resultaram em reação com o vírus da leprose dos citros, tipo citoplasmático (CiLV-C.Solanum violaefolium is an ornamental plant, with prostrate, trailing growth habit and is cultivated in shaded areas. A virus that causes

  14. Ectoparasitos de cães e gatos da cidade de Manaus, Amazonas, Brasil Ectoparasites on cats and dogs from Manaus, Amazonas State, Brazil

    Directory of Open Access Journals (Sweden)

    Marcelo Cutrim Moreira de Castro

    2006-12-01

    Full Text Available São apresentados resultados da coleta de ectoparasitos em cães e gatos entre agosto de 2001 e maio de 2002 em diferentes bairros da cidade Manaus. No cão foram encontrados: Ctenocephalides f. felis (Bouché, 1835 (Siphonaptera, Pulicidae, Heterodoxus spiniger (Enderlein, 1909(Phthiraptera, Boopidae, Trichodectes canis (De Geer, 1778 (Phthiraptera, Trichodectidae e Rhipicephalus sanguineus (Latreille,1806 (Acari, Ixodidae. No gato foi coletado C. f. felis. A prevalência de ectoparasitos foi de 80,8% para cães e 72,7% para gatos. Para a pulga C. f. felis foi de 28,7% para cães e 72,7% para gatos. Para o piolho H. spiniger foi de 12,3% para cães. Para o piolho T. canis foi de 0,1% para cães e para o carrapato R. sanguineus foi de 63% para cães. A média de infestaçãode pulga foi de 1,26 para cães e 1,27 para gatos. A proporção sexual fêmea/macho foi de 1,96:1 no cão e de 3,66:1 no gato. A pulga C. canis (Curtis, 1826, registrada em 1922, não foi coletada.Ectoparasites from different neighborhood of Manaus were collected from august 2001 to May 2002. On dogs it was found: Ctenocephalides f. felis (Bouché, 1835 (Siphonaptera, Pulicidae, Heterodoxus spiniger (Enderlein, 1909(Phthiraptera, Boopidae, Trichodetes canis (De Geer, 1778 (Phthiraptera, Trichodectidae and Rhipicephalus sanguineus (Latreille,1806 (Acari, Ixodidae. On cats: C. f. felis. The prevalence of ectoparasites was 80.8% to dogs and 72.7% to cats. For the flea C. f. felis was 28.7% to dogs and 72.7% to cats. For the lice H. spiniger was 12.3% for dogs. For the lice T. canis was 0.1% for dogs and for the tick R. sanguineus was 63% for dogs. The infestation index for fleas was 1.26 to dogs and 1.27 to cats. The sexual ratio obtained was 1.96:1 to dogs and 3.66:1 to cats. The flea C. canis (Curtis, 1826 registered in 1922 was not found.

  15. ECTOFAUNA PARASITÁRIA DE CÃES URBANOS DOMICILIADOS ATENDIDOS EM CLÍNICAS VETERINÁRIAS PARTICULARES NA CIDADE DE LAVRAS, MG

    Directory of Open Access Journals (Sweden)

    Antonio Marcos Guimarães

    2011-03-01

    Full Text Available The objective of this study was to determine the frequency of ectoparasites in urban domiciled dogs treated at nine private veterinary clinics in the city of Lavras, Minas Gerais, Brazil. Visible and palpable ectoparasites specimens were collected manually from 67 dogs during the period of September 2004 to May 2005, kept in flasks with ethanol 70º GL and identified under a stereomicroscope. In the case of mites that cause mange, performed the analysis of the results obtained from 155 skin scrapings of the same number of dogs with clinical suspicion of parasitic dermatosis was performed, and sent to diagnostic at the Laboratory of Parasitic Diseases of Federal University of Lavras (UFLA, during the period of September 2002 to July 2007. A total of 540 ectoparasites were recorded, and four species were identified: Rhipicephalus sanguineus (60%, Ctenocephalides canis and C. felis (both 36%, and Dermatobia hominis larvae (4%. In scraped skin, positive results were verified in 12.9% (20/155, of which 80.0% with Demodex canis (16/20 and 20.0% with Sarcoptes scabiei var. canis (4/20. After ectoparasites identification a database with the dogs´medical records was made and analyzed by SPSS 12.0. It can be concluded that the predominant species of ectoparasites in dogs treated at private veterinary clinics in the city of Lavras, MG, were Ctenocephalides canis and C. felis (Siphonaptera: Pulicidae and R. sanguineus (Acari: Ixodidae and Demodex canis (Acari: Demodecidae that had a significant predominance (p<0.05 on scraped skin of young animals with suspicion of canine demodicosis.

  16. Antiectoparasitic activity of the gum resin, gum haggar, from the East African plant, Commiphora holtziana.

    Science.gov (United States)

    Birkett, Michael A; Abassi, Sate Al; Kröber, Thomas; Chamberlain, Keith; Hooper, Antony M; Guerin, Patrick M; Pettersson, Jan; Pickett, John A; Slade, Robin; Wadhams, Lester J

    2008-05-01

    The mechanism of ixodid tick (Acari: Ixodidae) repellency by gum haggar, a resin produced by Commiphora holtziana (Burseraceae), was investigated by evaluating activity against the cattle tick, Boophilus microplus. In an arena bioassay, a hexane extract of the resin of C. holtziana exhibited a repellent effect lasting up to 5h. The hydrocarbon fraction of the resin extract was shown to account for the repellent activity, and was analysed by coupled gas chromatography-mass spectrometry (GC-MS). Major sesquiterpene hydrocarbons were tentatively identified as germacrene-D, delta-elemene and beta-bourbonene. The identity and stereochemistry of the former compound was confirmed as the (+)-isomer by peak enhancement using enantioselective GC, whereas the latter 2 compounds, which are most likely degradation products of germacrene-type precursors, were identified through isolation by preparative gas chromatography followed by microprobe-NMR spectroscopy. GC comparison of gum haggar with another resin, C. myrrha, which was inactive in the tick bioassay, showed that the latter contained much lower levels of these hydrocarbons. To assess the suitability of the gum haggar resin as a general acarine repellent, further tests were made on a major acarine pest of European and US animal husbandry systems, the red poultry mite, Dermanyssus gallinae (Acari: Dermanyssidae). Gum haggar extract, and the isolated hydrocarbon fraction, showed strong repellent effects in an olfactometer assay, and again gum myrrh showed no effect. These findings provide a scientific basis for the observed anti-tick properties of gum haggar, and demonstrate the potential for its development as a general acarine repellent for use in animal husbandry systems.

  17. Seleções para resistência e suscetibilidade, detecção e monitoramento da resistência de Tetranychus urticae ao acaricida clorfenapir Selections for resistance and susceptibility, detection and monitoring of resistance to the acaricide chlorfenapyr in Tetranychus urticae koch (Acari: Tetranychidae

    Directory of Open Access Journals (Sweden)

    Mário Eidi Sato

    2007-01-01

    Full Text Available Problemas com resistência de ácaro-rajado, Tetranychus urticae Koch (Acari: Tetranychidae, a acaricidas têm sido registrados em diversos países, inclusive no Brasil. O estudo teve como objetivo caracterizar a resistência de T. urticae ao acaricida clorfenapir e avaliar a freqüência de resistência a esse composto em áreas comerciais de seis culturas no Estado de São Paulo. Seleções para resistência e suscetibilidade a clorfenapir foram realizadas em laboratório, utilizando-se uma população de T. urticae coletada em 2002 de um cultivo comercial de crisântemo em Holambra (SP. Após seis seleções para resistência e cinco seleções para suscetibilidade, foram obtidas as linhagens suscetível (S e resistente (R de T. urticae a clorfenapir. A razão de resistência (CL50 R/ CL50 S obtida alcançou valores de 571 vezes. Estabeleceu-se uma concentração discriminatória de 37,4 mg L-1 de ingrediente ativo (i.a. para o monitoramento da resistência de T. urticae a clorfenapir. O monitoramento foi realizado coletando-se 21 populações de ácaros em áreas comerciais de diferentes culturas (mamão, morango, feijão, tomate, crisântemo, rosa, em vários municípios do Estado de São Paulo. Arenas confeccionadas com folha de feijão foram infestadas com ácaros T. urticae e pulverizadas com clorfenapir, na sua concentração discriminatória, em torre de Potter. Os resultados indicaram grande variabilidade entre as populações com relação à suscetibilidade a clorfenapir. Foram observadas populações com freqüências de resistência entre 0,0 e 65,4%. As maiores freqüências de resistência foram observadas para populações coletadas de crisântemo em Holambra (SP.Problems associated with acaricide resistance in Tetranychus urticae Koch have been recorded in several countries including Brazil. The objective of this study was to characterize the resistance of T. urticae to the acaricide chlorfenapyr and to evaluate the resistance

  18. Carbohydrate digestion in ticks and a digestive α-L-fucosidase.

    Science.gov (United States)

    Moreti, R; Perrella, N N; Lopes, A R

    2013-10-01

    Digestive carbohydrases are present in many species of hematophagous Arthropoda, including ticks. In this work, Amblyomma cajennense (Ixodidae) midgut digestive carbohydrases were tracked with different substrates, resulting in the identification of a chitinase and an N-acetyl-β-glucosaminidase and the first description of a digestive α-L-fucosidase in ticks. α-L-fucosidases are involved in various physiological processes, and digestive α-L-fucosidases have been shown to be present in other types of organisms. Amblyomma cajennense α-L-fucosidase activity was isolated using acidic and salting-out precipitations and chromatographic steps in hydrophobic and cation-exchange columns. The specificity of the isolated activity as an α-L-fucosidase was confirmed by the hydrolysis of 4-methylumbelliferyl α-L-fucopyranoside and the natural substrate fucoidan and the inhibition by fucose and deoxyfuconojirimycin. The isolated activity of α-L-fucosidase forms oligomers with molecular mass of 140 kDa or 150 kDa as determined by gel filtration and non-reducing SDS-PAGE, respectively. This particular fucosidase has an optimum pH of 5.3, is stable even at high temperatures (stable for at least 2h at 50 °C), has a Km of 45 μM to the substrate 4-methylumbelliferyl α-L-fucopyranoside and IC 50% of 327 μM to fucose and 42 pM to deoxyfuconojirimycin. The presence of digestive fucosidases in hematophagous Arthropoda may be related to defence mechanisms against host-parasite interactions. PMID:23994295

  19. Ticks collected from humans, domestic animals, and wildlife in Yucatan, Mexico.

    Science.gov (United States)

    Rodríguez-Vivas, R I; Apanaskevich, D A; Ojeda-Chi, M M; Trinidad-Martínez, I; Reyes-Novelo, E; Esteve-Gassent, M D; Pérez de León, A A

    2016-01-15

    Domestic animals and wildlife play important roles as reservoirs of zoonotic pathogens that are transmitted to humans by ticks. Besides their role as vectors of several classes of microorganisms of veterinary and public health relevance, ticks also burden human and animal populations through their obligate blood-feeding habit. It is estimated that in Mexico there are around 100 tick species belonging to the Ixodidae and Argasidae families. Information is lacking on tick species that affect humans, domestic animals, and wildlife through their life cycle. This study was conducted to bridge that knowledge gap by inventorying tick species that infest humans, domestic animals and wildlife in the State of Yucatan, Mexico. Amblyomma ticks were observed as euryxenous vertebrate parasites because they were found parasitizing 17 animal species and human. Amblyomma mixtum was the most eryxenous species found in 11 different animal species and humans. Both A. mixtum and A. parvum were found parasitizing humans. Ixodes near affinis was the second most abundant species parasitizing six animal species (dogs, cats, horses, white-nosed coati, white-tail deer and black vulture) and was found widely across the State of Yucatan. Ixodid tick populations may increase in the State of Yucatan with time due to animal production intensification, an increasing wildlife population near rural communities because of natural habitat reduction and fragmentation. The diversity of ticks across host taxa documented here highlights the relevance of ecological information to understand tick-host dynamics. This knowledge is critical to inform public health and veterinary programs for the sustainable control of ticks and tick-borne diseases. PMID:26790745

  20. Molecular Investigation of Francisella-Like Endosymbiont in Ticks and Francisella tularensis in Ixodid Ticks and Mosquitoes in Turkey.

    Science.gov (United States)

    Duzlu, Onder; Yildirim, Alparslan; Inci, Abdullah; Gumussoy, Kadir Semih; Ciloglu, Arif; Onder, Zuhal

    2016-01-01

    This study was carried out to investigate the molecular prevalence of Francisella-like endosymbionts (FLEs) and Francisella tularensis in ticks (Acari: Ixodidae) and mosquitoes in Turkey. Genomic DNA pools were constructed from a total of 1477 adult hard ticks of Rhipicephalus (Rh.) annulatus, Rh. turanicus, Rh. sanguineus, Rh. bursa, Haemaphysalis (Hae.) parva, Hae. sulcata, Hyalomma marginatum marginatum, H. anatolicum anatolicum, H. anatolicum excavatum, H. detritum detritum, H. dromedarii, Dermacentor marginatus, and Ixodes ricinus species, which were collected from several barns, cattle, and people. Genomic DNA was also extracted from pools consisting of 6203 adult female mosquito species belonging to Aedes vexans, Culex (Cx.) pipiens, Cx. hortensis, Cx. theileri, Culiseta annulata, and Anopheles maculipennis species. Conventional PCR and TaqMan probe-based real- time PCR targeting the 16S rRNA gene for FLEs and the lpnA gene for F. tularensis, respectively, were performed on the DNA isolates obtained. FLEs and F. tularensis were not found in any genomic DNA pools constructed from ixodid ticks and mosquitos. This study represents the first investigation of F. tularensis and FLEs in potential vector ticks and mosquitoes by molecular methods in Turkey. The present study provides useful insights into the molecular epidemiology of F. tularensis and FLEs. One of the major conclusions of the study is that tularemia outbreaks may be essentially due to direct transmission from the environment (especially from water) in Turkey and not to vector-borne transmission.